data_6S1M
# 
_entry.id   6S1M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.322 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6S1M         
WWPDB D_1292102865 
EMDB  EMD-10080    
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'Nuclear protein complex 1' EMD-10080 'associated EM volume' 
EMDB .                           EMD-10081 'other EM volume'      
EMDB .                           EMD-10082 'other EM volume'      
EMDB .                           EMD-10539 'other EM volume'      
EMDB .                           EMD-10540 'other EM volume'      
PDB  .                           6S1N      unspecified            
PDB  .                           6S1O      unspecified            
PDB  .                           6TNY      unspecified            
PDB  .                           6TNZ      unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6S1M 
_pdbx_database_status.recvd_initial_deposition_date   2019-06-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lancey, C.'    1 ? 
'Hamdan, S.M.'  2 ? 
'De Biasio, A.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                1109 
_citation.page_last                 1109 
_citation.title                     'Structure of the processive human Pol delta holoenzyme.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-14898-6 
_citation.pdbx_database_id_PubMed   32111820 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lancey, C.'     1  ?                   
primary 'Tehseen, M.'    2  ?                   
primary 'Raducanu, V.S.' 3  0000-0001-6722-9262 
primary 'Rashid, F.'     4  ?                   
primary 'Merino, N.'     5  0000-0003-0721-4813 
primary 'Ragan, T.J.'    6  0000-0002-6233-3375 
primary 'Savva, C.G.'    7  ?                   
primary 'Zaher, M.S.'    8  0000-0002-7785-4384 
primary 'Shirbini, A.'   9  ?                   
primary 'Blanco, F.J.'   10 0000-0003-2545-4319 
primary 'Hamdan, S.M.'   11 0000-0001-5192-1852 
primary 'De Biasio, A.'  12 ?                   
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA polymerase delta catalytic subunit' 123785.922 1 2.7.7.7,3.1.11.- ? ? ? 
2  polymer     man 'DNA polymerase delta subunit 2'         51338.168  1 ?                ? ? ? 
3  polymer     man 'DNA polymerase delta subunit 3'         52528.500  1 ?                ? ? ? 
4  polymer     man 'DNA polymerase delta subunit 4'         16274.323  1 ?                ? ? ? 
5  polymer     man 'Proliferating cell nuclear antigen'     29088.061  3 ?                ? ? ? 
6  polymer     syn 'DNA primer'                             7665.987   1 ?                ? ? ? 
7  polymer     syn 'DNA template'                           11677.539  1 ?                ? ? ? 
8  non-polymer syn 'ZINC ION'                               65.409     1 ?                ? ? ? 
9  non-polymer syn 'IRON/SULFUR CLUSTER'                    351.640    1 ?                ? ? ? 
10 non-polymer syn "THYMIDINE-5'-TRIPHOSPHATE"              482.168    1 ?                ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'DNA polymerase subunit delta p125'                                                                
2 'DNA polymerase delta subunit p50'                                                                 
3 'DNA polymerase delta subunit C,DNA polymerase delta subunit p66,DNA polymerase delta subunit p68' 
4 'DNA polymerase delta subunit p12'                                                                 
5 PCNA,Cyclin                                                                                        
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MDGKRRPGPGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQSVLEGVADGQVPPSAIDPRWL
RPTPPALDPQTEPLIFQQLEIDHYVGPAQPVPGGPPPSRGSVPVLRAFGVTDEGFSVCCHIHGFAPYFYTPAPPGFGPEH
MGDLQRELNLAISRDSRGGRELTGPAVLAVELCSRESMFGYHGHGPSPFLRITVALPRLVAPARRLLEQGIRVAGLGTPS
FAPYEANVDFEIRFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEADVLWSDVVSHPPEGPWQRIAPLRVLSFDIECA
GRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRIMDPDVITGYNIQN
FDLPYLISRAQTLKVQTFPFLGRVAGLCSNIRDSSFQSKQTGRRDTKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFH
FLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTGVPLSYLLSRGQQVKVVSQLL
RQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTEDQFIRT
PTGDEFVKTSVRKGLLPQILENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSV
TGFGRQMIEKTKQLVESKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAADWVSGHFPSPIRLEFEKVYFP
YLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLVANLVTASLRRLLIDRDPEGAVAHAQDVISDLLCNRIDISQ
LVITKELTRAASDYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQ
QLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRRNCCIGCRTVLSHQGAVCEFCQPRESELYQKE
VSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMRKKVRKDLEDQEQLLRRFGPPGPEAW
;
;MDGKRRPGPGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQSVLEGVADGQVPPSAIDPRWL
RPTPPALDPQTEPLIFQQLEIDHYVGPAQPVPGGPPPSRGSVPVLRAFGVTDEGFSVCCHIHGFAPYFYTPAPPGFGPEH
MGDLQRELNLAISRDSRGGRELTGPAVLAVELCSRESMFGYHGHGPSPFLRITVALPRLVAPARRLLEQGIRVAGLGTPS
FAPYEANVDFEIRFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEADVLWSDVVSHPPEGPWQRIAPLRVLSFDIECA
GRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRIMDPDVITGYNIQN
FDLPYLISRAQTLKVQTFPFLGRVAGLCSNIRDSSFQSKQTGRRDTKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFH
FLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTGVPLSYLLSRGQQVKVVSQLL
RQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTEDQFIRT
PTGDEFVKTSVRKGLLPQILENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSV
TGFGRQMIEKTKQLVESKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAADWVSGHFPSPIRLEFEKVYFP
YLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLVANLVTASLRRLLIDRDPEGAVAHAQDVISDLLCNRIDISQ
LVITKELTRAASDYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQ
QLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRRNCCIGCRTVLSHQGAVCEFCQPRESELYQKE
VSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMRKKVRKDLEDQEQLLRRFGPPGPEAW
;
A     ? 
2 'polypeptide(L)'        no no  
;MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVK
KLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLA
VFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSR
VILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLAT
AYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPH
VYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP
;
;MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVK
KLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLA
VFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSR
VILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLAT
AYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPH
VYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP
;
B     ? 
3 'polypeptide(L)'        no no  
;MWSHPQFEKADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGH
SCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRAPAESSSSS
KKFEQSHLHMSSETQANNELTTNGHGPPASKQVSQQPKGIMGMFASKAAAKTQETNKETKTEAKEVTNASAAGNKAPGKG
NMMSNFFGKAAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETK
ETENMRKKRRRIKLPESDSSEDEVFPDSPGAYEAESPSPPPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTY
LDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
;
;MWSHPQFEKADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGH
SCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRAPAESSSSS
KKFEQSHLHMSSETQANNELTTNGHGPPASKQVSQQPKGIMGMFASKAAAKTQETNKETKTEAKEVTNASAAGNKAPGKG
NMMSNFFGKAAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETK
ETENMRKKRRRIKLPESDSSEDEVFPDSPGAYEAESPSPPPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTY
LDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
;
C     ? 
4 'polypeptide(L)'        no no  
;MHHHHHHSRAWRHPQFGGHHHHHHENLYFQSGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLR
QFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
;
;MHHHHHHSRAWRHPQFGGHHHHHHENLYFQSGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLR
QFDLAWQYGPCTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
;
D     ? 
5 'polypeptide(L)'        no no  
;GPHMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSK
ILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDA
VVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVV
EYKIADMGHLKYYLAPKIEDEEGS
;
;GPHMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSK
ILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDA
VVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVV
EYKIADMGHLKYYLAPKIEDEEGS
;
E,F,G ? 
6 polydeoxyribonucleotide no yes 
;(DA)(DG)(DC)(DT)(DA)(DT)(DG)(DA)(DC)(DC)(DA)(DT)(DG)(DA)(DT)(DT)(DA)(DC)(DG)(DA)
(DA)(DT)(DT)(DG)(DOC)
;
AGCTATGACCATGATTACGAATTGC P     ? 
7 polydeoxyribonucleotide no no  
;(DC)(DT)(DG)(DC)(DA)(DC)(DG)(DA)(DA)(DT)(DT)(DA)(DA)(DG)(DC)(DA)(DA)(DT)(DT)(DC)
(DG)(DT)(DA)(DA)(DT)(DC)(DA)(DT)(DG)(DG)(DT)(DC)(DA)(DT)(DA)(DG)(DC)(DT)
;
CTGCACGAATTAAGCAATTCGTAATCATGGTCATAGCT T     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ASP n 
1 3    GLY n 
1 4    LYS n 
1 5    ARG n 
1 6    ARG n 
1 7    PRO n 
1 8    GLY n 
1 9    PRO n 
1 10   GLY n 
1 11   PRO n 
1 12   GLY n 
1 13   VAL n 
1 14   PRO n 
1 15   PRO n 
1 16   LYS n 
1 17   ARG n 
1 18   ALA n 
1 19   ARG n 
1 20   GLY n 
1 21   GLY n 
1 22   LEU n 
1 23   TRP n 
1 24   ASP n 
1 25   ASP n 
1 26   ASP n 
1 27   ASP n 
1 28   ALA n 
1 29   PRO n 
1 30   ARG n 
1 31   PRO n 
1 32   SER n 
1 33   GLN n 
1 34   PHE n 
1 35   GLU n 
1 36   GLU n 
1 37   ASP n 
1 38   LEU n 
1 39   ALA n 
1 40   LEU n 
1 41   MET n 
1 42   GLU n 
1 43   GLU n 
1 44   MET n 
1 45   GLU n 
1 46   ALA n 
1 47   GLU n 
1 48   HIS n 
1 49   ARG n 
1 50   LEU n 
1 51   GLN n 
1 52   GLU n 
1 53   GLN n 
1 54   GLU n 
1 55   GLU n 
1 56   GLU n 
1 57   GLU n 
1 58   LEU n 
1 59   GLN n 
1 60   SER n 
1 61   VAL n 
1 62   LEU n 
1 63   GLU n 
1 64   GLY n 
1 65   VAL n 
1 66   ALA n 
1 67   ASP n 
1 68   GLY n 
1 69   GLN n 
1 70   VAL n 
1 71   PRO n 
1 72   PRO n 
1 73   SER n 
1 74   ALA n 
1 75   ILE n 
1 76   ASP n 
1 77   PRO n 
1 78   ARG n 
1 79   TRP n 
1 80   LEU n 
1 81   ARG n 
1 82   PRO n 
1 83   THR n 
1 84   PRO n 
1 85   PRO n 
1 86   ALA n 
1 87   LEU n 
1 88   ASP n 
1 89   PRO n 
1 90   GLN n 
1 91   THR n 
1 92   GLU n 
1 93   PRO n 
1 94   LEU n 
1 95   ILE n 
1 96   PHE n 
1 97   GLN n 
1 98   GLN n 
1 99   LEU n 
1 100  GLU n 
1 101  ILE n 
1 102  ASP n 
1 103  HIS n 
1 104  TYR n 
1 105  VAL n 
1 106  GLY n 
1 107  PRO n 
1 108  ALA n 
1 109  GLN n 
1 110  PRO n 
1 111  VAL n 
1 112  PRO n 
1 113  GLY n 
1 114  GLY n 
1 115  PRO n 
1 116  PRO n 
1 117  PRO n 
1 118  SER n 
1 119  ARG n 
1 120  GLY n 
1 121  SER n 
1 122  VAL n 
1 123  PRO n 
1 124  VAL n 
1 125  LEU n 
1 126  ARG n 
1 127  ALA n 
1 128  PHE n 
1 129  GLY n 
1 130  VAL n 
1 131  THR n 
1 132  ASP n 
1 133  GLU n 
1 134  GLY n 
1 135  PHE n 
1 136  SER n 
1 137  VAL n 
1 138  CYS n 
1 139  CYS n 
1 140  HIS n 
1 141  ILE n 
1 142  HIS n 
1 143  GLY n 
1 144  PHE n 
1 145  ALA n 
1 146  PRO n 
1 147  TYR n 
1 148  PHE n 
1 149  TYR n 
1 150  THR n 
1 151  PRO n 
1 152  ALA n 
1 153  PRO n 
1 154  PRO n 
1 155  GLY n 
1 156  PHE n 
1 157  GLY n 
1 158  PRO n 
1 159  GLU n 
1 160  HIS n 
1 161  MET n 
1 162  GLY n 
1 163  ASP n 
1 164  LEU n 
1 165  GLN n 
1 166  ARG n 
1 167  GLU n 
1 168  LEU n 
1 169  ASN n 
1 170  LEU n 
1 171  ALA n 
1 172  ILE n 
1 173  SER n 
1 174  ARG n 
1 175  ASP n 
1 176  SER n 
1 177  ARG n 
1 178  GLY n 
1 179  GLY n 
1 180  ARG n 
1 181  GLU n 
1 182  LEU n 
1 183  THR n 
1 184  GLY n 
1 185  PRO n 
1 186  ALA n 
1 187  VAL n 
1 188  LEU n 
1 189  ALA n 
1 190  VAL n 
1 191  GLU n 
1 192  LEU n 
1 193  CYS n 
1 194  SER n 
1 195  ARG n 
1 196  GLU n 
1 197  SER n 
1 198  MET n 
1 199  PHE n 
1 200  GLY n 
1 201  TYR n 
1 202  HIS n 
1 203  GLY n 
1 204  HIS n 
1 205  GLY n 
1 206  PRO n 
1 207  SER n 
1 208  PRO n 
1 209  PHE n 
1 210  LEU n 
1 211  ARG n 
1 212  ILE n 
1 213  THR n 
1 214  VAL n 
1 215  ALA n 
1 216  LEU n 
1 217  PRO n 
1 218  ARG n 
1 219  LEU n 
1 220  VAL n 
1 221  ALA n 
1 222  PRO n 
1 223  ALA n 
1 224  ARG n 
1 225  ARG n 
1 226  LEU n 
1 227  LEU n 
1 228  GLU n 
1 229  GLN n 
1 230  GLY n 
1 231  ILE n 
1 232  ARG n 
1 233  VAL n 
1 234  ALA n 
1 235  GLY n 
1 236  LEU n 
1 237  GLY n 
1 238  THR n 
1 239  PRO n 
1 240  SER n 
1 241  PHE n 
1 242  ALA n 
1 243  PRO n 
1 244  TYR n 
1 245  GLU n 
1 246  ALA n 
1 247  ASN n 
1 248  VAL n 
1 249  ASP n 
1 250  PHE n 
1 251  GLU n 
1 252  ILE n 
1 253  ARG n 
1 254  PHE n 
1 255  MET n 
1 256  VAL n 
1 257  ASP n 
1 258  THR n 
1 259  ASP n 
1 260  ILE n 
1 261  VAL n 
1 262  GLY n 
1 263  CYS n 
1 264  ASN n 
1 265  TRP n 
1 266  LEU n 
1 267  GLU n 
1 268  LEU n 
1 269  PRO n 
1 270  ALA n 
1 271  GLY n 
1 272  LYS n 
1 273  TYR n 
1 274  ALA n 
1 275  LEU n 
1 276  ARG n 
1 277  LEU n 
1 278  LYS n 
1 279  GLU n 
1 280  LYS n 
1 281  ALA n 
1 282  THR n 
1 283  GLN n 
1 284  CYS n 
1 285  GLN n 
1 286  LEU n 
1 287  GLU n 
1 288  ALA n 
1 289  ASP n 
1 290  VAL n 
1 291  LEU n 
1 292  TRP n 
1 293  SER n 
1 294  ASP n 
1 295  VAL n 
1 296  VAL n 
1 297  SER n 
1 298  HIS n 
1 299  PRO n 
1 300  PRO n 
1 301  GLU n 
1 302  GLY n 
1 303  PRO n 
1 304  TRP n 
1 305  GLN n 
1 306  ARG n 
1 307  ILE n 
1 308  ALA n 
1 309  PRO n 
1 310  LEU n 
1 311  ARG n 
1 312  VAL n 
1 313  LEU n 
1 314  SER n 
1 315  PHE n 
1 316  ASP n 
1 317  ILE n 
1 318  GLU n 
1 319  CYS n 
1 320  ALA n 
1 321  GLY n 
1 322  ARG n 
1 323  LYS n 
1 324  GLY n 
1 325  ILE n 
1 326  PHE n 
1 327  PRO n 
1 328  GLU n 
1 329  PRO n 
1 330  GLU n 
1 331  ARG n 
1 332  ASP n 
1 333  PRO n 
1 334  VAL n 
1 335  ILE n 
1 336  GLN n 
1 337  ILE n 
1 338  CYS n 
1 339  SER n 
1 340  LEU n 
1 341  GLY n 
1 342  LEU n 
1 343  ARG n 
1 344  TRP n 
1 345  GLY n 
1 346  GLU n 
1 347  PRO n 
1 348  GLU n 
1 349  PRO n 
1 350  PHE n 
1 351  LEU n 
1 352  ARG n 
1 353  LEU n 
1 354  ALA n 
1 355  LEU n 
1 356  THR n 
1 357  LEU n 
1 358  ARG n 
1 359  PRO n 
1 360  CYS n 
1 361  ALA n 
1 362  PRO n 
1 363  ILE n 
1 364  LEU n 
1 365  GLY n 
1 366  ALA n 
1 367  LYS n 
1 368  VAL n 
1 369  GLN n 
1 370  SER n 
1 371  TYR n 
1 372  GLU n 
1 373  LYS n 
1 374  GLU n 
1 375  GLU n 
1 376  ASP n 
1 377  LEU n 
1 378  LEU n 
1 379  GLN n 
1 380  ALA n 
1 381  TRP n 
1 382  SER n 
1 383  THR n 
1 384  PHE n 
1 385  ILE n 
1 386  ARG n 
1 387  ILE n 
1 388  MET n 
1 389  ASP n 
1 390  PRO n 
1 391  ASP n 
1 392  VAL n 
1 393  ILE n 
1 394  THR n 
1 395  GLY n 
1 396  TYR n 
1 397  ASN n 
1 398  ILE n 
1 399  GLN n 
1 400  ASN n 
1 401  PHE n 
1 402  ASP n 
1 403  LEU n 
1 404  PRO n 
1 405  TYR n 
1 406  LEU n 
1 407  ILE n 
1 408  SER n 
1 409  ARG n 
1 410  ALA n 
1 411  GLN n 
1 412  THR n 
1 413  LEU n 
1 414  LYS n 
1 415  VAL n 
1 416  GLN n 
1 417  THR n 
1 418  PHE n 
1 419  PRO n 
1 420  PHE n 
1 421  LEU n 
1 422  GLY n 
1 423  ARG n 
1 424  VAL n 
1 425  ALA n 
1 426  GLY n 
1 427  LEU n 
1 428  CYS n 
1 429  SER n 
1 430  ASN n 
1 431  ILE n 
1 432  ARG n 
1 433  ASP n 
1 434  SER n 
1 435  SER n 
1 436  PHE n 
1 437  GLN n 
1 438  SER n 
1 439  LYS n 
1 440  GLN n 
1 441  THR n 
1 442  GLY n 
1 443  ARG n 
1 444  ARG n 
1 445  ASP n 
1 446  THR n 
1 447  LYS n 
1 448  VAL n 
1 449  VAL n 
1 450  SER n 
1 451  MET n 
1 452  VAL n 
1 453  GLY n 
1 454  ARG n 
1 455  VAL n 
1 456  GLN n 
1 457  MET n 
1 458  ASP n 
1 459  MET n 
1 460  LEU n 
1 461  GLN n 
1 462  VAL n 
1 463  LEU n 
1 464  LEU n 
1 465  ARG n 
1 466  GLU n 
1 467  TYR n 
1 468  LYS n 
1 469  LEU n 
1 470  ARG n 
1 471  SER n 
1 472  TYR n 
1 473  THR n 
1 474  LEU n 
1 475  ASN n 
1 476  ALA n 
1 477  VAL n 
1 478  SER n 
1 479  PHE n 
1 480  HIS n 
1 481  PHE n 
1 482  LEU n 
1 483  GLY n 
1 484  GLU n 
1 485  GLN n 
1 486  LYS n 
1 487  GLU n 
1 488  ASP n 
1 489  VAL n 
1 490  GLN n 
1 491  HIS n 
1 492  SER n 
1 493  ILE n 
1 494  ILE n 
1 495  THR n 
1 496  ASP n 
1 497  LEU n 
1 498  GLN n 
1 499  ASN n 
1 500  GLY n 
1 501  ASN n 
1 502  ASP n 
1 503  GLN n 
1 504  THR n 
1 505  ARG n 
1 506  ARG n 
1 507  ARG n 
1 508  LEU n 
1 509  ALA n 
1 510  VAL n 
1 511  TYR n 
1 512  CYS n 
1 513  LEU n 
1 514  LYS n 
1 515  ASP n 
1 516  ALA n 
1 517  TYR n 
1 518  LEU n 
1 519  PRO n 
1 520  LEU n 
1 521  ARG n 
1 522  LEU n 
1 523  LEU n 
1 524  GLU n 
1 525  ARG n 
1 526  LEU n 
1 527  MET n 
1 528  VAL n 
1 529  LEU n 
1 530  VAL n 
1 531  ASN n 
1 532  ALA n 
1 533  VAL n 
1 534  GLU n 
1 535  MET n 
1 536  ALA n 
1 537  ARG n 
1 538  VAL n 
1 539  THR n 
1 540  GLY n 
1 541  VAL n 
1 542  PRO n 
1 543  LEU n 
1 544  SER n 
1 545  TYR n 
1 546  LEU n 
1 547  LEU n 
1 548  SER n 
1 549  ARG n 
1 550  GLY n 
1 551  GLN n 
1 552  GLN n 
1 553  VAL n 
1 554  LYS n 
1 555  VAL n 
1 556  VAL n 
1 557  SER n 
1 558  GLN n 
1 559  LEU n 
1 560  LEU n 
1 561  ARG n 
1 562  GLN n 
1 563  ALA n 
1 564  MET n 
1 565  HIS n 
1 566  GLU n 
1 567  GLY n 
1 568  LEU n 
1 569  LEU n 
1 570  MET n 
1 571  PRO n 
1 572  VAL n 
1 573  VAL n 
1 574  LYS n 
1 575  SER n 
1 576  GLU n 
1 577  GLY n 
1 578  GLY n 
1 579  GLU n 
1 580  ASP n 
1 581  TYR n 
1 582  THR n 
1 583  GLY n 
1 584  ALA n 
1 585  THR n 
1 586  VAL n 
1 587  ILE n 
1 588  GLU n 
1 589  PRO n 
1 590  LEU n 
1 591  LYS n 
1 592  GLY n 
1 593  TYR n 
1 594  TYR n 
1 595  ASP n 
1 596  VAL n 
1 597  PRO n 
1 598  ILE n 
1 599  ALA n 
1 600  THR n 
1 601  LEU n 
1 602  ASP n 
1 603  PHE n 
1 604  SER n 
1 605  SER n 
1 606  LEU n 
1 607  TYR n 
1 608  PRO n 
1 609  SER n 
1 610  ILE n 
1 611  MET n 
1 612  MET n 
1 613  ALA n 
1 614  HIS n 
1 615  ASN n 
1 616  LEU n 
1 617  CYS n 
1 618  TYR n 
1 619  THR n 
1 620  THR n 
1 621  LEU n 
1 622  LEU n 
1 623  ARG n 
1 624  PRO n 
1 625  GLY n 
1 626  THR n 
1 627  ALA n 
1 628  GLN n 
1 629  LYS n 
1 630  LEU n 
1 631  GLY n 
1 632  LEU n 
1 633  THR n 
1 634  GLU n 
1 635  ASP n 
1 636  GLN n 
1 637  PHE n 
1 638  ILE n 
1 639  ARG n 
1 640  THR n 
1 641  PRO n 
1 642  THR n 
1 643  GLY n 
1 644  ASP n 
1 645  GLU n 
1 646  PHE n 
1 647  VAL n 
1 648  LYS n 
1 649  THR n 
1 650  SER n 
1 651  VAL n 
1 652  ARG n 
1 653  LYS n 
1 654  GLY n 
1 655  LEU n 
1 656  LEU n 
1 657  PRO n 
1 658  GLN n 
1 659  ILE n 
1 660  LEU n 
1 661  GLU n 
1 662  ASN n 
1 663  LEU n 
1 664  LEU n 
1 665  SER n 
1 666  ALA n 
1 667  ARG n 
1 668  LYS n 
1 669  ARG n 
1 670  ALA n 
1 671  LYS n 
1 672  ALA n 
1 673  GLU n 
1 674  LEU n 
1 675  ALA n 
1 676  LYS n 
1 677  GLU n 
1 678  THR n 
1 679  ASP n 
1 680  PRO n 
1 681  LEU n 
1 682  ARG n 
1 683  ARG n 
1 684  GLN n 
1 685  VAL n 
1 686  LEU n 
1 687  ASP n 
1 688  GLY n 
1 689  ARG n 
1 690  GLN n 
1 691  LEU n 
1 692  ALA n 
1 693  LEU n 
1 694  LYS n 
1 695  VAL n 
1 696  SER n 
1 697  ALA n 
1 698  ASN n 
1 699  SER n 
1 700  VAL n 
1 701  TYR n 
1 702  GLY n 
1 703  PHE n 
1 704  THR n 
1 705  GLY n 
1 706  ALA n 
1 707  GLN n 
1 708  VAL n 
1 709  GLY n 
1 710  LYS n 
1 711  LEU n 
1 712  PRO n 
1 713  CYS n 
1 714  LEU n 
1 715  GLU n 
1 716  ILE n 
1 717  SER n 
1 718  GLN n 
1 719  SER n 
1 720  VAL n 
1 721  THR n 
1 722  GLY n 
1 723  PHE n 
1 724  GLY n 
1 725  ARG n 
1 726  GLN n 
1 727  MET n 
1 728  ILE n 
1 729  GLU n 
1 730  LYS n 
1 731  THR n 
1 732  LYS n 
1 733  GLN n 
1 734  LEU n 
1 735  VAL n 
1 736  GLU n 
1 737  SER n 
1 738  LYS n 
1 739  TYR n 
1 740  THR n 
1 741  VAL n 
1 742  GLU n 
1 743  ASN n 
1 744  GLY n 
1 745  TYR n 
1 746  SER n 
1 747  THR n 
1 748  SER n 
1 749  ALA n 
1 750  LYS n 
1 751  VAL n 
1 752  VAL n 
1 753  TYR n 
1 754  GLY n 
1 755  ASP n 
1 756  THR n 
1 757  ASP n 
1 758  SER n 
1 759  VAL n 
1 760  MET n 
1 761  CYS n 
1 762  ARG n 
1 763  PHE n 
1 764  GLY n 
1 765  VAL n 
1 766  SER n 
1 767  SER n 
1 768  VAL n 
1 769  ALA n 
1 770  GLU n 
1 771  ALA n 
1 772  MET n 
1 773  ALA n 
1 774  LEU n 
1 775  GLY n 
1 776  ARG n 
1 777  GLU n 
1 778  ALA n 
1 779  ALA n 
1 780  ASP n 
1 781  TRP n 
1 782  VAL n 
1 783  SER n 
1 784  GLY n 
1 785  HIS n 
1 786  PHE n 
1 787  PRO n 
1 788  SER n 
1 789  PRO n 
1 790  ILE n 
1 791  ARG n 
1 792  LEU n 
1 793  GLU n 
1 794  PHE n 
1 795  GLU n 
1 796  LYS n 
1 797  VAL n 
1 798  TYR n 
1 799  PHE n 
1 800  PRO n 
1 801  TYR n 
1 802  LEU n 
1 803  LEU n 
1 804  ILE n 
1 805  SER n 
1 806  LYS n 
1 807  LYS n 
1 808  ARG n 
1 809  TYR n 
1 810  ALA n 
1 811  GLY n 
1 812  LEU n 
1 813  LEU n 
1 814  PHE n 
1 815  SER n 
1 816  SER n 
1 817  ARG n 
1 818  PRO n 
1 819  ASP n 
1 820  ALA n 
1 821  HIS n 
1 822  ASP n 
1 823  ARG n 
1 824  MET n 
1 825  ASP n 
1 826  CYS n 
1 827  LYS n 
1 828  GLY n 
1 829  LEU n 
1 830  GLU n 
1 831  ALA n 
1 832  VAL n 
1 833  ARG n 
1 834  ARG n 
1 835  ASP n 
1 836  ASN n 
1 837  CYS n 
1 838  PRO n 
1 839  LEU n 
1 840  VAL n 
1 841  ALA n 
1 842  ASN n 
1 843  LEU n 
1 844  VAL n 
1 845  THR n 
1 846  ALA n 
1 847  SER n 
1 848  LEU n 
1 849  ARG n 
1 850  ARG n 
1 851  LEU n 
1 852  LEU n 
1 853  ILE n 
1 854  ASP n 
1 855  ARG n 
1 856  ASP n 
1 857  PRO n 
1 858  GLU n 
1 859  GLY n 
1 860  ALA n 
1 861  VAL n 
1 862  ALA n 
1 863  HIS n 
1 864  ALA n 
1 865  GLN n 
1 866  ASP n 
1 867  VAL n 
1 868  ILE n 
1 869  SER n 
1 870  ASP n 
1 871  LEU n 
1 872  LEU n 
1 873  CYS n 
1 874  ASN n 
1 875  ARG n 
1 876  ILE n 
1 877  ASP n 
1 878  ILE n 
1 879  SER n 
1 880  GLN n 
1 881  LEU n 
1 882  VAL n 
1 883  ILE n 
1 884  THR n 
1 885  LYS n 
1 886  GLU n 
1 887  LEU n 
1 888  THR n 
1 889  ARG n 
1 890  ALA n 
1 891  ALA n 
1 892  SER n 
1 893  ASP n 
1 894  TYR n 
1 895  ALA n 
1 896  GLY n 
1 897  LYS n 
1 898  GLN n 
1 899  ALA n 
1 900  HIS n 
1 901  VAL n 
1 902  GLU n 
1 903  LEU n 
1 904  ALA n 
1 905  GLU n 
1 906  ARG n 
1 907  MET n 
1 908  ARG n 
1 909  LYS n 
1 910  ARG n 
1 911  ASP n 
1 912  PRO n 
1 913  GLY n 
1 914  SER n 
1 915  ALA n 
1 916  PRO n 
1 917  SER n 
1 918  LEU n 
1 919  GLY n 
1 920  ASP n 
1 921  ARG n 
1 922  VAL n 
1 923  PRO n 
1 924  TYR n 
1 925  VAL n 
1 926  ILE n 
1 927  ILE n 
1 928  SER n 
1 929  ALA n 
1 930  ALA n 
1 931  LYS n 
1 932  GLY n 
1 933  VAL n 
1 934  ALA n 
1 935  ALA n 
1 936  TYR n 
1 937  MET n 
1 938  LYS n 
1 939  SER n 
1 940  GLU n 
1 941  ASP n 
1 942  PRO n 
1 943  LEU n 
1 944  PHE n 
1 945  VAL n 
1 946  LEU n 
1 947  GLU n 
1 948  HIS n 
1 949  SER n 
1 950  LEU n 
1 951  PRO n 
1 952  ILE n 
1 953  ASP n 
1 954  THR n 
1 955  GLN n 
1 956  TYR n 
1 957  TYR n 
1 958  LEU n 
1 959  GLU n 
1 960  GLN n 
1 961  GLN n 
1 962  LEU n 
1 963  ALA n 
1 964  LYS n 
1 965  PRO n 
1 966  LEU n 
1 967  LEU n 
1 968  ARG n 
1 969  ILE n 
1 970  PHE n 
1 971  GLU n 
1 972  PRO n 
1 973  ILE n 
1 974  LEU n 
1 975  GLY n 
1 976  GLU n 
1 977  GLY n 
1 978  ARG n 
1 979  ALA n 
1 980  GLU n 
1 981  ALA n 
1 982  VAL n 
1 983  LEU n 
1 984  LEU n 
1 985  ARG n 
1 986  GLY n 
1 987  ASP n 
1 988  HIS n 
1 989  THR n 
1 990  ARG n 
1 991  CYS n 
1 992  LYS n 
1 993  THR n 
1 994  VAL n 
1 995  LEU n 
1 996  THR n 
1 997  GLY n 
1 998  LYS n 
1 999  VAL n 
1 1000 GLY n 
1 1001 GLY n 
1 1002 LEU n 
1 1003 LEU n 
1 1004 ALA n 
1 1005 PHE n 
1 1006 ALA n 
1 1007 LYS n 
1 1008 ARG n 
1 1009 ARG n 
1 1010 ASN n 
1 1011 CYS n 
1 1012 CYS n 
1 1013 ILE n 
1 1014 GLY n 
1 1015 CYS n 
1 1016 ARG n 
1 1017 THR n 
1 1018 VAL n 
1 1019 LEU n 
1 1020 SER n 
1 1021 HIS n 
1 1022 GLN n 
1 1023 GLY n 
1 1024 ALA n 
1 1025 VAL n 
1 1026 CYS n 
1 1027 GLU n 
1 1028 PHE n 
1 1029 CYS n 
1 1030 GLN n 
1 1031 PRO n 
1 1032 ARG n 
1 1033 GLU n 
1 1034 SER n 
1 1035 GLU n 
1 1036 LEU n 
1 1037 TYR n 
1 1038 GLN n 
1 1039 LYS n 
1 1040 GLU n 
1 1041 VAL n 
1 1042 SER n 
1 1043 HIS n 
1 1044 LEU n 
1 1045 ASN n 
1 1046 ALA n 
1 1047 LEU n 
1 1048 GLU n 
1 1049 GLU n 
1 1050 ARG n 
1 1051 PHE n 
1 1052 SER n 
1 1053 ARG n 
1 1054 LEU n 
1 1055 TRP n 
1 1056 THR n 
1 1057 GLN n 
1 1058 CYS n 
1 1059 GLN n 
1 1060 ARG n 
1 1061 CYS n 
1 1062 GLN n 
1 1063 GLY n 
1 1064 SER n 
1 1065 LEU n 
1 1066 HIS n 
1 1067 GLU n 
1 1068 ASP n 
1 1069 VAL n 
1 1070 ILE n 
1 1071 CYS n 
1 1072 THR n 
1 1073 SER n 
1 1074 ARG n 
1 1075 ASP n 
1 1076 CYS n 
1 1077 PRO n 
1 1078 ILE n 
1 1079 PHE n 
1 1080 TYR n 
1 1081 MET n 
1 1082 ARG n 
1 1083 LYS n 
1 1084 LYS n 
1 1085 VAL n 
1 1086 ARG n 
1 1087 LYS n 
1 1088 ASP n 
1 1089 LEU n 
1 1090 GLU n 
1 1091 ASP n 
1 1092 GLN n 
1 1093 GLU n 
1 1094 GLN n 
1 1095 LEU n 
1 1096 LEU n 
1 1097 ARG n 
1 1098 ARG n 
1 1099 PHE n 
1 1100 GLY n 
1 1101 PRO n 
1 1102 PRO n 
1 1103 GLY n 
1 1104 PRO n 
1 1105 GLU n 
1 1106 ALA n 
1 1107 TRP n 
2 1    MET n 
2 2    PHE n 
2 3    SER n 
2 4    GLU n 
2 5    GLN n 
2 6    ALA n 
2 7    ALA n 
2 8    GLN n 
2 9    ARG n 
2 10   ALA n 
2 11   HIS n 
2 12   THR n 
2 13   LEU n 
2 14   LEU n 
2 15   SER n 
2 16   PRO n 
2 17   PRO n 
2 18   SER n 
2 19   ALA n 
2 20   ASN n 
2 21   ASN n 
2 22   ALA n 
2 23   THR n 
2 24   PHE n 
2 25   ALA n 
2 26   ARG n 
2 27   VAL n 
2 28   PRO n 
2 29   VAL n 
2 30   ALA n 
2 31   THR n 
2 32   TYR n 
2 33   THR n 
2 34   ASN n 
2 35   SER n 
2 36   SER n 
2 37   GLN n 
2 38   PRO n 
2 39   PHE n 
2 40   ARG n 
2 41   LEU n 
2 42   GLY n 
2 43   GLU n 
2 44   ARG n 
2 45   SER n 
2 46   PHE n 
2 47   SER n 
2 48   ARG n 
2 49   GLN n 
2 50   TYR n 
2 51   ALA n 
2 52   HIS n 
2 53   ILE n 
2 54   TYR n 
2 55   ALA n 
2 56   THR n 
2 57   ARG n 
2 58   LEU n 
2 59   ILE n 
2 60   GLN n 
2 61   MET n 
2 62   ARG n 
2 63   PRO n 
2 64   PHE n 
2 65   LEU n 
2 66   GLU n 
2 67   ASN n 
2 68   ARG n 
2 69   ALA n 
2 70   GLN n 
2 71   GLN n 
2 72   HIS n 
2 73   TRP n 
2 74   GLY n 
2 75   SER n 
2 76   GLY n 
2 77   VAL n 
2 78   GLY n 
2 79   VAL n 
2 80   LYS n 
2 81   LYS n 
2 82   LEU n 
2 83   CYS n 
2 84   GLU n 
2 85   LEU n 
2 86   GLN n 
2 87   PRO n 
2 88   GLU n 
2 89   GLU n 
2 90   LYS n 
2 91   CYS n 
2 92   CYS n 
2 93   VAL n 
2 94   VAL n 
2 95   GLY n 
2 96   THR n 
2 97   LEU n 
2 98   PHE n 
2 99   LYS n 
2 100  ALA n 
2 101  MET n 
2 102  PRO n 
2 103  LEU n 
2 104  GLN n 
2 105  PRO n 
2 106  SER n 
2 107  ILE n 
2 108  LEU n 
2 109  ARG n 
2 110  GLU n 
2 111  VAL n 
2 112  SER n 
2 113  GLU n 
2 114  GLU n 
2 115  HIS n 
2 116  ASN n 
2 117  LEU n 
2 118  LEU n 
2 119  PRO n 
2 120  GLN n 
2 121  PRO n 
2 122  PRO n 
2 123  ARG n 
2 124  SER n 
2 125  LYS n 
2 126  TYR n 
2 127  ILE n 
2 128  HIS n 
2 129  PRO n 
2 130  ASP n 
2 131  ASP n 
2 132  GLU n 
2 133  LEU n 
2 134  VAL n 
2 135  LEU n 
2 136  GLU n 
2 137  ASP n 
2 138  GLU n 
2 139  LEU n 
2 140  GLN n 
2 141  ARG n 
2 142  ILE n 
2 143  LYS n 
2 144  LEU n 
2 145  LYS n 
2 146  GLY n 
2 147  THR n 
2 148  ILE n 
2 149  ASP n 
2 150  VAL n 
2 151  SER n 
2 152  LYS n 
2 153  LEU n 
2 154  VAL n 
2 155  THR n 
2 156  GLY n 
2 157  THR n 
2 158  VAL n 
2 159  LEU n 
2 160  ALA n 
2 161  VAL n 
2 162  PHE n 
2 163  GLY n 
2 164  SER n 
2 165  VAL n 
2 166  ARG n 
2 167  ASP n 
2 168  ASP n 
2 169  GLY n 
2 170  LYS n 
2 171  PHE n 
2 172  LEU n 
2 173  VAL n 
2 174  GLU n 
2 175  ASP n 
2 176  TYR n 
2 177  CYS n 
2 178  PHE n 
2 179  ALA n 
2 180  ASP n 
2 181  LEU n 
2 182  ALA n 
2 183  PRO n 
2 184  GLN n 
2 185  LYS n 
2 186  PRO n 
2 187  ALA n 
2 188  PRO n 
2 189  PRO n 
2 190  LEU n 
2 191  ASP n 
2 192  THR n 
2 193  ASP n 
2 194  ARG n 
2 195  PHE n 
2 196  VAL n 
2 197  LEU n 
2 198  LEU n 
2 199  VAL n 
2 200  SER n 
2 201  GLY n 
2 202  LEU n 
2 203  GLY n 
2 204  LEU n 
2 205  GLY n 
2 206  GLY n 
2 207  GLY n 
2 208  GLY n 
2 209  GLY n 
2 210  GLU n 
2 211  SER n 
2 212  LEU n 
2 213  LEU n 
2 214  GLY n 
2 215  THR n 
2 216  GLN n 
2 217  LEU n 
2 218  LEU n 
2 219  VAL n 
2 220  ASP n 
2 221  VAL n 
2 222  VAL n 
2 223  THR n 
2 224  GLY n 
2 225  GLN n 
2 226  LEU n 
2 227  GLY n 
2 228  ASP n 
2 229  GLU n 
2 230  GLY n 
2 231  GLU n 
2 232  GLN n 
2 233  CYS n 
2 234  SER n 
2 235  ALA n 
2 236  ALA n 
2 237  HIS n 
2 238  VAL n 
2 239  SER n 
2 240  ARG n 
2 241  VAL n 
2 242  ILE n 
2 243  LEU n 
2 244  ALA n 
2 245  GLY n 
2 246  ASN n 
2 247  LEU n 
2 248  LEU n 
2 249  SER n 
2 250  HIS n 
2 251  SER n 
2 252  THR n 
2 253  GLN n 
2 254  SER n 
2 255  ARG n 
2 256  ASP n 
2 257  SER n 
2 258  ILE n 
2 259  ASN n 
2 260  LYS n 
2 261  ALA n 
2 262  LYS n 
2 263  TYR n 
2 264  LEU n 
2 265  THR n 
2 266  LYS n 
2 267  LYS n 
2 268  THR n 
2 269  GLN n 
2 270  ALA n 
2 271  ALA n 
2 272  SER n 
2 273  VAL n 
2 274  GLU n 
2 275  ALA n 
2 276  VAL n 
2 277  LYS n 
2 278  MET n 
2 279  LEU n 
2 280  ASP n 
2 281  GLU n 
2 282  ILE n 
2 283  LEU n 
2 284  LEU n 
2 285  GLN n 
2 286  LEU n 
2 287  SER n 
2 288  ALA n 
2 289  SER n 
2 290  VAL n 
2 291  PRO n 
2 292  VAL n 
2 293  ASP n 
2 294  VAL n 
2 295  MET n 
2 296  PRO n 
2 297  GLY n 
2 298  GLU n 
2 299  PHE n 
2 300  ASP n 
2 301  PRO n 
2 302  THR n 
2 303  ASN n 
2 304  TYR n 
2 305  THR n 
2 306  LEU n 
2 307  PRO n 
2 308  GLN n 
2 309  GLN n 
2 310  PRO n 
2 311  LEU n 
2 312  HIS n 
2 313  PRO n 
2 314  CYS n 
2 315  MET n 
2 316  PHE n 
2 317  PRO n 
2 318  LEU n 
2 319  ALA n 
2 320  THR n 
2 321  ALA n 
2 322  TYR n 
2 323  SER n 
2 324  THR n 
2 325  LEU n 
2 326  GLN n 
2 327  LEU n 
2 328  VAL n 
2 329  THR n 
2 330  ASN n 
2 331  PRO n 
2 332  TYR n 
2 333  GLN n 
2 334  ALA n 
2 335  THR n 
2 336  ILE n 
2 337  ASP n 
2 338  GLY n 
2 339  VAL n 
2 340  ARG n 
2 341  PHE n 
2 342  LEU n 
2 343  GLY n 
2 344  THR n 
2 345  SER n 
2 346  GLY n 
2 347  GLN n 
2 348  ASN n 
2 349  VAL n 
2 350  SER n 
2 351  ASP n 
2 352  ILE n 
2 353  PHE n 
2 354  ARG n 
2 355  TYR n 
2 356  SER n 
2 357  SER n 
2 358  MET n 
2 359  GLU n 
2 360  ASP n 
2 361  HIS n 
2 362  LEU n 
2 363  GLU n 
2 364  ILE n 
2 365  LEU n 
2 366  GLU n 
2 367  TRP n 
2 368  THR n 
2 369  LEU n 
2 370  ARG n 
2 371  VAL n 
2 372  ARG n 
2 373  HIS n 
2 374  ILE n 
2 375  SER n 
2 376  PRO n 
2 377  THR n 
2 378  ALA n 
2 379  PRO n 
2 380  ASP n 
2 381  THR n 
2 382  LEU n 
2 383  GLY n 
2 384  CYS n 
2 385  TYR n 
2 386  PRO n 
2 387  PHE n 
2 388  TYR n 
2 389  LYS n 
2 390  THR n 
2 391  ASP n 
2 392  PRO n 
2 393  PHE n 
2 394  ILE n 
2 395  PHE n 
2 396  PRO n 
2 397  GLU n 
2 398  CYS n 
2 399  PRO n 
2 400  HIS n 
2 401  VAL n 
2 402  TYR n 
2 403  PHE n 
2 404  CYS n 
2 405  GLY n 
2 406  ASN n 
2 407  THR n 
2 408  PRO n 
2 409  SER n 
2 410  PHE n 
2 411  GLY n 
2 412  SER n 
2 413  LYS n 
2 414  ILE n 
2 415  ILE n 
2 416  ARG n 
2 417  GLY n 
2 418  PRO n 
2 419  GLU n 
2 420  ASP n 
2 421  GLN n 
2 422  THR n 
2 423  VAL n 
2 424  LEU n 
2 425  LEU n 
2 426  VAL n 
2 427  THR n 
2 428  VAL n 
2 429  PRO n 
2 430  ASP n 
2 431  PHE n 
2 432  SER n 
2 433  ALA n 
2 434  THR n 
2 435  GLN n 
2 436  THR n 
2 437  ALA n 
2 438  CYS n 
2 439  LEU n 
2 440  VAL n 
2 441  ASN n 
2 442  LEU n 
2 443  ARG n 
2 444  SER n 
2 445  LEU n 
2 446  ALA n 
2 447  CYS n 
2 448  GLN n 
2 449  PRO n 
2 450  ILE n 
2 451  SER n 
2 452  PHE n 
2 453  SER n 
2 454  GLY n 
2 455  PHE n 
2 456  GLY n 
2 457  ALA n 
2 458  GLU n 
2 459  ASP n 
2 460  ASP n 
2 461  ASP n 
2 462  LEU n 
2 463  GLY n 
2 464  GLY n 
2 465  LEU n 
2 466  GLY n 
2 467  LEU n 
2 468  GLY n 
2 469  PRO n 
3 1    MET n 
3 2    TRP n 
3 3    SER n 
3 4    HIS n 
3 5    PRO n 
3 6    GLN n 
3 7    PHE n 
3 8    GLU n 
3 9    LYS n 
3 10   ALA n 
3 11   ASP n 
3 12   GLN n 
3 13   LEU n 
3 14   TYR n 
3 15   LEU n 
3 16   GLU n 
3 17   ASN n 
3 18   ILE n 
3 19   ASP n 
3 20   GLU n 
3 21   PHE n 
3 22   VAL n 
3 23   THR n 
3 24   ASP n 
3 25   GLN n 
3 26   ASN n 
3 27   LYS n 
3 28   ILE n 
3 29   VAL n 
3 30   THR n 
3 31   TYR n 
3 32   LYS n 
3 33   TRP n 
3 34   LEU n 
3 35   SER n 
3 36   TYR n 
3 37   THR n 
3 38   LEU n 
3 39   GLY n 
3 40   VAL n 
3 41   HIS n 
3 42   VAL n 
3 43   ASN n 
3 44   GLN n 
3 45   ALA n 
3 46   LYS n 
3 47   GLN n 
3 48   MET n 
3 49   LEU n 
3 50   TYR n 
3 51   ASP n 
3 52   TYR n 
3 53   VAL n 
3 54   GLU n 
3 55   ARG n 
3 56   LYS n 
3 57   ARG n 
3 58   LYS n 
3 59   GLU n 
3 60   ASN n 
3 61   SER n 
3 62   GLY n 
3 63   ALA n 
3 64   GLN n 
3 65   LEU n 
3 66   HIS n 
3 67   VAL n 
3 68   THR n 
3 69   TYR n 
3 70   LEU n 
3 71   VAL n 
3 72   SER n 
3 73   GLY n 
3 74   SER n 
3 75   LEU n 
3 76   ILE n 
3 77   GLN n 
3 78   ASN n 
3 79   GLY n 
3 80   HIS n 
3 81   SER n 
3 82   CYS n 
3 83   HIS n 
3 84   LYS n 
3 85   VAL n 
3 86   ALA n 
3 87   VAL n 
3 88   VAL n 
3 89   ARG n 
3 90   GLU n 
3 91   ASP n 
3 92   LYS n 
3 93   LEU n 
3 94   GLU n 
3 95   ALA n 
3 96   VAL n 
3 97   LYS n 
3 98   SER n 
3 99   LYS n 
3 100  LEU n 
3 101  ALA n 
3 102  VAL n 
3 103  THR n 
3 104  ALA n 
3 105  SER n 
3 106  ILE n 
3 107  HIS n 
3 108  VAL n 
3 109  TYR n 
3 110  SER n 
3 111  ILE n 
3 112  GLN n 
3 113  LYS n 
3 114  ALA n 
3 115  MET n 
3 116  LEU n 
3 117  LYS n 
3 118  ASP n 
3 119  SER n 
3 120  GLY n 
3 121  PRO n 
3 122  LEU n 
3 123  PHE n 
3 124  ASN n 
3 125  THR n 
3 126  ASP n 
3 127  TYR n 
3 128  ASP n 
3 129  ILE n 
3 130  LEU n 
3 131  LYS n 
3 132  SER n 
3 133  ASN n 
3 134  LEU n 
3 135  GLN n 
3 136  ASN n 
3 137  CYS n 
3 138  SER n 
3 139  LYS n 
3 140  PHE n 
3 141  SER n 
3 142  ALA n 
3 143  ILE n 
3 144  GLN n 
3 145  CYS n 
3 146  ALA n 
3 147  ALA n 
3 148  ALA n 
3 149  VAL n 
3 150  PRO n 
3 151  ARG n 
3 152  ALA n 
3 153  PRO n 
3 154  ALA n 
3 155  GLU n 
3 156  SER n 
3 157  SER n 
3 158  SER n 
3 159  SER n 
3 160  SER n 
3 161  LYS n 
3 162  LYS n 
3 163  PHE n 
3 164  GLU n 
3 165  GLN n 
3 166  SER n 
3 167  HIS n 
3 168  LEU n 
3 169  HIS n 
3 170  MET n 
3 171  SER n 
3 172  SER n 
3 173  GLU n 
3 174  THR n 
3 175  GLN n 
3 176  ALA n 
3 177  ASN n 
3 178  ASN n 
3 179  GLU n 
3 180  LEU n 
3 181  THR n 
3 182  THR n 
3 183  ASN n 
3 184  GLY n 
3 185  HIS n 
3 186  GLY n 
3 187  PRO n 
3 188  PRO n 
3 189  ALA n 
3 190  SER n 
3 191  LYS n 
3 192  GLN n 
3 193  VAL n 
3 194  SER n 
3 195  GLN n 
3 196  GLN n 
3 197  PRO n 
3 198  LYS n 
3 199  GLY n 
3 200  ILE n 
3 201  MET n 
3 202  GLY n 
3 203  MET n 
3 204  PHE n 
3 205  ALA n 
3 206  SER n 
3 207  LYS n 
3 208  ALA n 
3 209  ALA n 
3 210  ALA n 
3 211  LYS n 
3 212  THR n 
3 213  GLN n 
3 214  GLU n 
3 215  THR n 
3 216  ASN n 
3 217  LYS n 
3 218  GLU n 
3 219  THR n 
3 220  LYS n 
3 221  THR n 
3 222  GLU n 
3 223  ALA n 
3 224  LYS n 
3 225  GLU n 
3 226  VAL n 
3 227  THR n 
3 228  ASN n 
3 229  ALA n 
3 230  SER n 
3 231  ALA n 
3 232  ALA n 
3 233  GLY n 
3 234  ASN n 
3 235  LYS n 
3 236  ALA n 
3 237  PRO n 
3 238  GLY n 
3 239  LYS n 
3 240  GLY n 
3 241  ASN n 
3 242  MET n 
3 243  MET n 
3 244  SER n 
3 245  ASN n 
3 246  PHE n 
3 247  PHE n 
3 248  GLY n 
3 249  LYS n 
3 250  ALA n 
3 251  ALA n 
3 252  MET n 
3 253  ASN n 
3 254  LYS n 
3 255  PHE n 
3 256  LYS n 
3 257  VAL n 
3 258  ASN n 
3 259  LEU n 
3 260  ASP n 
3 261  SER n 
3 262  GLU n 
3 263  GLN n 
3 264  ALA n 
3 265  VAL n 
3 266  LYS n 
3 267  GLU n 
3 268  GLU n 
3 269  LYS n 
3 270  ILE n 
3 271  VAL n 
3 272  GLU n 
3 273  GLN n 
3 274  PRO n 
3 275  THR n 
3 276  VAL n 
3 277  SER n 
3 278  VAL n 
3 279  THR n 
3 280  GLU n 
3 281  PRO n 
3 282  LYS n 
3 283  LEU n 
3 284  ALA n 
3 285  THR n 
3 286  PRO n 
3 287  ALA n 
3 288  GLY n 
3 289  LEU n 
3 290  LYS n 
3 291  LYS n 
3 292  SER n 
3 293  SER n 
3 294  LYS n 
3 295  LYS n 
3 296  ALA n 
3 297  GLU n 
3 298  PRO n 
3 299  VAL n 
3 300  LYS n 
3 301  VAL n 
3 302  LEU n 
3 303  GLN n 
3 304  LYS n 
3 305  GLU n 
3 306  LYS n 
3 307  LYS n 
3 308  ARG n 
3 309  GLY n 
3 310  LYS n 
3 311  ARG n 
3 312  VAL n 
3 313  ALA n 
3 314  LEU n 
3 315  SER n 
3 316  ASP n 
3 317  ASP n 
3 318  GLU n 
3 319  THR n 
3 320  LYS n 
3 321  GLU n 
3 322  THR n 
3 323  GLU n 
3 324  ASN n 
3 325  MET n 
3 326  ARG n 
3 327  LYS n 
3 328  LYS n 
3 329  ARG n 
3 330  ARG n 
3 331  ARG n 
3 332  ILE n 
3 333  LYS n 
3 334  LEU n 
3 335  PRO n 
3 336  GLU n 
3 337  SER n 
3 338  ASP n 
3 339  SER n 
3 340  SER n 
3 341  GLU n 
3 342  ASP n 
3 343  GLU n 
3 344  VAL n 
3 345  PHE n 
3 346  PRO n 
3 347  ASP n 
3 348  SER n 
3 349  PRO n 
3 350  GLY n 
3 351  ALA n 
3 352  TYR n 
3 353  GLU n 
3 354  ALA n 
3 355  GLU n 
3 356  SER n 
3 357  PRO n 
3 358  SER n 
3 359  PRO n 
3 360  PRO n 
3 361  PRO n 
3 362  PRO n 
3 363  PRO n 
3 364  SER n 
3 365  PRO n 
3 366  PRO n 
3 367  LEU n 
3 368  GLU n 
3 369  PRO n 
3 370  VAL n 
3 371  PRO n 
3 372  LYS n 
3 373  THR n 
3 374  GLU n 
3 375  PRO n 
3 376  GLU n 
3 377  PRO n 
3 378  PRO n 
3 379  SER n 
3 380  VAL n 
3 381  LYS n 
3 382  SER n 
3 383  SER n 
3 384  SER n 
3 385  GLY n 
3 386  GLU n 
3 387  ASN n 
3 388  LYS n 
3 389  ARG n 
3 390  LYS n 
3 391  ARG n 
3 392  LYS n 
3 393  ARG n 
3 394  VAL n 
3 395  LEU n 
3 396  LYS n 
3 397  SER n 
3 398  LYS n 
3 399  THR n 
3 400  TYR n 
3 401  LEU n 
3 402  ASP n 
3 403  GLY n 
3 404  GLU n 
3 405  GLY n 
3 406  CYS n 
3 407  ILE n 
3 408  VAL n 
3 409  THR n 
3 410  GLU n 
3 411  LYS n 
3 412  VAL n 
3 413  TYR n 
3 414  GLU n 
3 415  SER n 
3 416  GLU n 
3 417  SER n 
3 418  CYS n 
3 419  THR n 
3 420  ASP n 
3 421  SER n 
3 422  GLU n 
3 423  GLU n 
3 424  GLU n 
3 425  LEU n 
3 426  ASN n 
3 427  MET n 
3 428  LYS n 
3 429  THR n 
3 430  SER n 
3 431  SER n 
3 432  VAL n 
3 433  HIS n 
3 434  ARG n 
3 435  PRO n 
3 436  PRO n 
3 437  ALA n 
3 438  MET n 
3 439  THR n 
3 440  VAL n 
3 441  LYS n 
3 442  LYS n 
3 443  GLU n 
3 444  PRO n 
3 445  ARG n 
3 446  GLU n 
3 447  GLU n 
3 448  ARG n 
3 449  LYS n 
3 450  GLY n 
3 451  PRO n 
3 452  LYS n 
3 453  LYS n 
3 454  GLY n 
3 455  THR n 
3 456  ALA n 
3 457  ALA n 
3 458  LEU n 
3 459  GLY n 
3 460  LYS n 
3 461  ALA n 
3 462  ASN n 
3 463  ARG n 
3 464  GLN n 
3 465  VAL n 
3 466  SER n 
3 467  ILE n 
3 468  THR n 
3 469  GLY n 
3 470  PHE n 
3 471  PHE n 
3 472  GLN n 
3 473  ARG n 
3 474  LYS n 
4 1    MET n 
4 2    HIS n 
4 3    HIS n 
4 4    HIS n 
4 5    HIS n 
4 6    HIS n 
4 7    HIS n 
4 8    SER n 
4 9    ARG n 
4 10   ALA n 
4 11   TRP n 
4 12   ARG n 
4 13   HIS n 
4 14   PRO n 
4 15   GLN n 
4 16   PHE n 
4 17   GLY n 
4 18   GLY n 
4 19   HIS n 
4 20   HIS n 
4 21   HIS n 
4 22   HIS n 
4 23   HIS n 
4 24   HIS n 
4 25   GLU n 
4 26   ASN n 
4 27   LEU n 
4 28   TYR n 
4 29   PHE n 
4 30   GLN n 
4 31   SER n 
4 32   GLY n 
4 33   ARG n 
4 34   LYS n 
4 35   ARG n 
4 36   LEU n 
4 37   ILE n 
4 38   THR n 
4 39   ASP n 
4 40   SER n 
4 41   TYR n 
4 42   PRO n 
4 43   VAL n 
4 44   VAL n 
4 45   LYS n 
4 46   ARG n 
4 47   ARG n 
4 48   GLU n 
4 49   GLY n 
4 50   PRO n 
4 51   ALA n 
4 52   GLY n 
4 53   HIS n 
4 54   SER n 
4 55   LYS n 
4 56   GLY n 
4 57   GLU n 
4 58   LEU n 
4 59   ALA n 
4 60   PRO n 
4 61   GLU n 
4 62   LEU n 
4 63   GLY n 
4 64   GLU n 
4 65   GLU n 
4 66   PRO n 
4 67   GLN n 
4 68   PRO n 
4 69   ARG n 
4 70   ASP n 
4 71   GLU n 
4 72   GLU n 
4 73   GLU n 
4 74   ALA n 
4 75   GLU n 
4 76   LEU n 
4 77   GLU n 
4 78   LEU n 
4 79   LEU n 
4 80   ARG n 
4 81   GLN n 
4 82   PHE n 
4 83   ASP n 
4 84   LEU n 
4 85   ALA n 
4 86   TRP n 
4 87   GLN n 
4 88   TYR n 
4 89   GLY n 
4 90   PRO n 
4 91   CYS n 
4 92   THR n 
4 93   GLY n 
4 94   ILE n 
4 95   THR n 
4 96   ARG n 
4 97   LEU n 
4 98   GLN n 
4 99   ARG n 
4 100  TRP n 
4 101  CYS n 
4 102  ARG n 
4 103  ALA n 
4 104  LYS n 
4 105  GLN n 
4 106  MET n 
4 107  GLY n 
4 108  LEU n 
4 109  GLU n 
4 110  PRO n 
4 111  PRO n 
4 112  PRO n 
4 113  GLU n 
4 114  VAL n 
4 115  TRP n 
4 116  GLN n 
4 117  VAL n 
4 118  LEU n 
4 119  LYS n 
4 120  THR n 
4 121  HIS n 
4 122  PRO n 
4 123  GLY n 
4 124  ASP n 
4 125  PRO n 
4 126  ARG n 
4 127  PHE n 
4 128  GLN n 
4 129  CYS n 
4 130  SER n 
4 131  LEU n 
4 132  TRP n 
4 133  HIS n 
4 134  LEU n 
4 135  TYR n 
4 136  PRO n 
4 137  LEU n 
5 1    GLY n 
5 2    PRO n 
5 3    HIS n 
5 4    MET n 
5 5    PHE n 
5 6    GLU n 
5 7    ALA n 
5 8    ARG n 
5 9    LEU n 
5 10   VAL n 
5 11   GLN n 
5 12   GLY n 
5 13   SER n 
5 14   ILE n 
5 15   LEU n 
5 16   LYS n 
5 17   LYS n 
5 18   VAL n 
5 19   LEU n 
5 20   GLU n 
5 21   ALA n 
5 22   LEU n 
5 23   LYS n 
5 24   ASP n 
5 25   LEU n 
5 26   ILE n 
5 27   ASN n 
5 28   GLU n 
5 29   ALA n 
5 30   CYS n 
5 31   TRP n 
5 32   ASP n 
5 33   ILE n 
5 34   SER n 
5 35   SER n 
5 36   SER n 
5 37   GLY n 
5 38   VAL n 
5 39   ASN n 
5 40   LEU n 
5 41   GLN n 
5 42   SER n 
5 43   MET n 
5 44   ASP n 
5 45   SER n 
5 46   SER n 
5 47   HIS n 
5 48   VAL n 
5 49   SER n 
5 50   LEU n 
5 51   VAL n 
5 52   GLN n 
5 53   LEU n 
5 54   THR n 
5 55   LEU n 
5 56   ARG n 
5 57   SER n 
5 58   GLU n 
5 59   GLY n 
5 60   PHE n 
5 61   ASP n 
5 62   THR n 
5 63   TYR n 
5 64   ARG n 
5 65   CYS n 
5 66   ASP n 
5 67   ARG n 
5 68   ASN n 
5 69   LEU n 
5 70   ALA n 
5 71   MET n 
5 72   GLY n 
5 73   VAL n 
5 74   ASN n 
5 75   LEU n 
5 76   THR n 
5 77   SER n 
5 78   MET n 
5 79   SER n 
5 80   LYS n 
5 81   ILE n 
5 82   LEU n 
5 83   LYS n 
5 84   CYS n 
5 85   ALA n 
5 86   GLY n 
5 87   ASN n 
5 88   GLU n 
5 89   ASP n 
5 90   ILE n 
5 91   ILE n 
5 92   THR n 
5 93   LEU n 
5 94   ARG n 
5 95   ALA n 
5 96   GLU n 
5 97   ASP n 
5 98   ASN n 
5 99   ALA n 
5 100  ASP n 
5 101  THR n 
5 102  LEU n 
5 103  ALA n 
5 104  LEU n 
5 105  VAL n 
5 106  PHE n 
5 107  GLU n 
5 108  ALA n 
5 109  PRO n 
5 110  ASN n 
5 111  GLN n 
5 112  GLU n 
5 113  LYS n 
5 114  VAL n 
5 115  SER n 
5 116  ASP n 
5 117  TYR n 
5 118  GLU n 
5 119  MET n 
5 120  LYS n 
5 121  LEU n 
5 122  MET n 
5 123  ASP n 
5 124  LEU n 
5 125  ASP n 
5 126  VAL n 
5 127  GLU n 
5 128  GLN n 
5 129  LEU n 
5 130  GLY n 
5 131  ILE n 
5 132  PRO n 
5 133  GLU n 
5 134  GLN n 
5 135  GLU n 
5 136  TYR n 
5 137  SER n 
5 138  CYS n 
5 139  VAL n 
5 140  VAL n 
5 141  LYS n 
5 142  MET n 
5 143  PRO n 
5 144  SER n 
5 145  GLY n 
5 146  GLU n 
5 147  PHE n 
5 148  ALA n 
5 149  ARG n 
5 150  ILE n 
5 151  CYS n 
5 152  ARG n 
5 153  ASP n 
5 154  LEU n 
5 155  SER n 
5 156  HIS n 
5 157  ILE n 
5 158  GLY n 
5 159  ASP n 
5 160  ALA n 
5 161  VAL n 
5 162  VAL n 
5 163  ILE n 
5 164  SER n 
5 165  CYS n 
5 166  ALA n 
5 167  LYS n 
5 168  ASP n 
5 169  GLY n 
5 170  VAL n 
5 171  LYS n 
5 172  PHE n 
5 173  SER n 
5 174  ALA n 
5 175  SER n 
5 176  GLY n 
5 177  GLU n 
5 178  LEU n 
5 179  GLY n 
5 180  ASN n 
5 181  GLY n 
5 182  ASN n 
5 183  ILE n 
5 184  LYS n 
5 185  LEU n 
5 186  SER n 
5 187  GLN n 
5 188  THR n 
5 189  SER n 
5 190  ASN n 
5 191  VAL n 
5 192  ASP n 
5 193  LYS n 
5 194  GLU n 
5 195  GLU n 
5 196  GLU n 
5 197  ALA n 
5 198  VAL n 
5 199  THR n 
5 200  ILE n 
5 201  GLU n 
5 202  MET n 
5 203  ASN n 
5 204  GLU n 
5 205  PRO n 
5 206  VAL n 
5 207  GLN n 
5 208  LEU n 
5 209  THR n 
5 210  PHE n 
5 211  ALA n 
5 212  LEU n 
5 213  ARG n 
5 214  TYR n 
5 215  LEU n 
5 216  ASN n 
5 217  PHE n 
5 218  PHE n 
5 219  THR n 
5 220  LYS n 
5 221  ALA n 
5 222  THR n 
5 223  PRO n 
5 224  LEU n 
5 225  SER n 
5 226  SER n 
5 227  THR n 
5 228  VAL n 
5 229  THR n 
5 230  LEU n 
5 231  SER n 
5 232  MET n 
5 233  SER n 
5 234  ALA n 
5 235  ASP n 
5 236  VAL n 
5 237  PRO n 
5 238  LEU n 
5 239  VAL n 
5 240  VAL n 
5 241  GLU n 
5 242  TYR n 
5 243  LYS n 
5 244  ILE n 
5 245  ALA n 
5 246  ASP n 
5 247  MET n 
5 248  GLY n 
5 249  HIS n 
5 250  LEU n 
5 251  LYS n 
5 252  TYR n 
5 253  TYR n 
5 254  LEU n 
5 255  ALA n 
5 256  PRO n 
5 257  LYS n 
5 258  ILE n 
5 259  GLU n 
5 260  ASP n 
5 261  GLU n 
5 262  GLU n 
5 263  GLY n 
5 264  SER n 
6 1    DA  n 
6 2    DG  n 
6 3    DC  n 
6 4    DT  n 
6 5    DA  n 
6 6    DT  n 
6 7    DG  n 
6 8    DA  n 
6 9    DC  n 
6 10   DC  n 
6 11   DA  n 
6 12   DT  n 
6 13   DG  n 
6 14   DA  n 
6 15   DT  n 
6 16   DT  n 
6 17   DA  n 
6 18   DC  n 
6 19   DG  n 
6 20   DA  n 
6 21   DA  n 
6 22   DT  n 
6 23   DT  n 
6 24   DG  n 
6 25   DOC n 
7 1    DC  n 
7 2    DT  n 
7 3    DG  n 
7 4    DC  n 
7 5    DA  n 
7 6    DC  n 
7 7    DG  n 
7 8    DA  n 
7 9    DA  n 
7 10   DT  n 
7 11   DT  n 
7 12   DA  n 
7 13   DA  n 
7 14   DG  n 
7 15   DC  n 
7 16   DA  n 
7 17   DA  n 
7 18   DT  n 
7 19   DT  n 
7 20   DC  n 
7 21   DG  n 
7 22   DT  n 
7 23   DA  n 
7 24   DA  n 
7 25   DT  n 
7 26   DC  n 
7 27   DA  n 
7 28   DT  n 
7 29   DG  n 
7 30   DG  n 
7 31   DT  n 
7 32   DC  n 
7 33   DA  n 
7 34   DT  n 
7 35   DA  n 
7 36   DG  n 
7 37   DC  n 
7 38   DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 1107 Human ? 'POLD1, POLD'     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 
'Spodoptera frugiperda'      7108   ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Bacmid ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 469  Human ? POLD2             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 
'Spodoptera frugiperda'      7108   ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Bacmid ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 474  Human ? 'POLD3, KIAA0039' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 
'Spodoptera frugiperda'      7108   ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Bacmid ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 137  Human ? 'POLD4, POLDS'    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'fall armyworm' 
'Spodoptera frugiperda'      7108   ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? Bacmid ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 264  Human ? PCNA              ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ?               
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ?   ? ? ? ? ? ?      ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 25 'synthetic construct' ? 32630 ? 
7 1 sample 1 38 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPOD1_HUMAN P28340 ? 1 
;MDGKRRPGPGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQSVLEGVADGQVPPSAIDPRWL
RPTPPALDPQTEPLIFQQLEIDHYVGPAQPVPGGPPPSRGSVPVLRAFGVTDEGFSVCCHIHGFAPYFYTPAPPGFGPEH
MGDLQRELNLAISRDSRGGRELTGPAVLAVELCSRESMFGYHGHGPSPFLRITVALPRLVAPARRLLEQGIRVAGLGTPS
FAPYEANVDFEIRFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEADVLWSDVVSHPPEGPWQRIAPLRVLSFDIECA
GRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYEKEEDLLQAWSTFIRIMDPDVITGYNIQN
FDLPYLISRAQTLKVQTFPFLGRVAGLCSNIRDSSFQSKQTGRRDTKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFH
FLGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTGVPLSYLLSRGQQVKVVSQLL
RQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMMAHNLCYTTLLRPGTAQKLGLTEDQFIRT
PTGDEFVKTSVRKGLLPQILENLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSV
TGFGRQMIEKTKQLVESKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAADWVSGHFPSPIRLEFEKVYFP
YLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLVANLVTASLRRLLIDRDPEGAVAHAQDVISDLLCNRIDISQ
LVITKELTRAASDYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQ
QLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRRNCCIGCRTVLSHQGAVCEFCQPRESELYQKE
VSHLNALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMRKKVRKDLEDQEQLLRRFGPPGPEAW
;
1 
2 UNP DPOD2_HUMAN P49005 ? 2 
;MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVK
KLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLA
VFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSR
VILAGNLLSHSTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFDPTNYTLPQQPLHPCMFPLAT
AYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMEDHLEILEWTLRVRHISPTAPDTLGCYPFYKTDPFIFPECPH
VYFCGNTPSFGSKIIRGPEDQTVLLVTVPDFSATQTACLVNLRSLACQPISFSGFGAEDDDLGGLGLGP
;
1 
3 UNP DPOD3_HUMAN Q15054 ? 3 
;ADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQNGHSCHKVAVVR
EDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAAVPRAPAESSSSSKKFEQSHLH
MSSETQANNELTTNGHGPPASKQVSQQPKGIMGMFASKAAAKTQETNKETKTEAKEVTNASAAGNKAPGKGNMMSNFFGK
AAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAGLKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKR
RRIKLPESDSSEDEVFPDSPGAYEAESPSPPPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVT
EKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
;
2 
4 UNP DPOD4_HUMAN Q9HCU8 ? 4 
;GRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRWCRAKQMGLEPP
PEVWQVLKTHPGDPRFQCSLWHLYPL
;
2 
5 UNP PCNA_HUMAN  P12004 ? 5 
;MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILK
CAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVI
SCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
;
1 
6 PDB 6S1M        6S1M   ? 6 ? 1 
7 PDB 6S1M        6S1M   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6S1M A 1  ? 1107 ? P28340 1   ? 1107 ? 1   1107 
2 2 6S1M B 1  ? 469  ? P49005 1   ? 469  ? 1   469  
3 3 6S1M C 10 ? 474  ? Q15054 2   ? 466  ? 2   466  
4 4 6S1M D 32 ? 137  ? Q9HCU8 2   ? 107  ? 2   107  
5 5 6S1M E 4  ? 264  ? P12004 1   ? 261  ? 1   261  
6 5 6S1M F 4  ? 264  ? P12004 1   ? 261  ? 1   261  
7 5 6S1M G 4  ? 264  ? P12004 1   ? 261  ? 1   261  
8 6 6S1M P 1  ? 25   ? 6S1M   1   ? 25   ? 1   25   
9 7 6S1M T 1  ? 38   ? 6S1M   -12 ? 25   ? -12 25   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 6S1M MET C 1  ? UNP Q15054 ? ? 'initiating methionine' -7  1  
3 6S1M TRP C 2  ? UNP Q15054 ? ? 'expression tag'        -6  2  
3 6S1M SER C 3  ? UNP Q15054 ? ? 'expression tag'        -5  3  
3 6S1M HIS C 4  ? UNP Q15054 ? ? 'expression tag'        -4  4  
3 6S1M PRO C 5  ? UNP Q15054 ? ? 'expression tag'        -3  5  
3 6S1M GLN C 6  ? UNP Q15054 ? ? 'expression tag'        -2  6  
3 6S1M PHE C 7  ? UNP Q15054 ? ? 'expression tag'        -1  7  
3 6S1M GLU C 8  ? UNP Q15054 ? ? 'expression tag'        0   8  
3 6S1M LYS C 9  ? UNP Q15054 ? ? 'expression tag'        1   9  
4 6S1M MET D 1  ? UNP Q9HCU8 ? ? 'initiating methionine' -29 10 
4 6S1M HIS D 2  ? UNP Q9HCU8 ? ? 'expression tag'        -28 11 
4 6S1M HIS D 3  ? UNP Q9HCU8 ? ? 'expression tag'        -27 12 
4 6S1M HIS D 4  ? UNP Q9HCU8 ? ? 'expression tag'        -26 13 
4 6S1M HIS D 5  ? UNP Q9HCU8 ? ? 'expression tag'        -25 14 
4 6S1M HIS D 6  ? UNP Q9HCU8 ? ? 'expression tag'        -24 15 
4 6S1M HIS D 7  ? UNP Q9HCU8 ? ? 'expression tag'        -23 16 
4 6S1M SER D 8  ? UNP Q9HCU8 ? ? 'expression tag'        -22 17 
4 6S1M ARG D 9  ? UNP Q9HCU8 ? ? 'expression tag'        -21 18 
4 6S1M ALA D 10 ? UNP Q9HCU8 ? ? 'expression tag'        -20 19 
4 6S1M TRP D 11 ? UNP Q9HCU8 ? ? 'expression tag'        -19 20 
4 6S1M ARG D 12 ? UNP Q9HCU8 ? ? 'expression tag'        -18 21 
4 6S1M HIS D 13 ? UNP Q9HCU8 ? ? 'expression tag'        -17 22 
4 6S1M PRO D 14 ? UNP Q9HCU8 ? ? 'expression tag'        -16 23 
4 6S1M GLN D 15 ? UNP Q9HCU8 ? ? 'expression tag'        -15 24 
4 6S1M PHE D 16 ? UNP Q9HCU8 ? ? 'expression tag'        -14 25 
4 6S1M GLY D 17 ? UNP Q9HCU8 ? ? 'expression tag'        -13 26 
4 6S1M GLY D 18 ? UNP Q9HCU8 ? ? 'expression tag'        -12 27 
4 6S1M HIS D 19 ? UNP Q9HCU8 ? ? 'expression tag'        -11 28 
4 6S1M HIS D 20 ? UNP Q9HCU8 ? ? 'expression tag'        -10 29 
4 6S1M HIS D 21 ? UNP Q9HCU8 ? ? 'expression tag'        -9  30 
4 6S1M HIS D 22 ? UNP Q9HCU8 ? ? 'expression tag'        -8  31 
4 6S1M HIS D 23 ? UNP Q9HCU8 ? ? 'expression tag'        -7  32 
4 6S1M HIS D 24 ? UNP Q9HCU8 ? ? 'expression tag'        -6  33 
4 6S1M GLU D 25 ? UNP Q9HCU8 ? ? 'expression tag'        -5  34 
4 6S1M ASN D 26 ? UNP Q9HCU8 ? ? 'expression tag'        -4  35 
4 6S1M LEU D 27 ? UNP Q9HCU8 ? ? 'expression tag'        -3  36 
4 6S1M TYR D 28 ? UNP Q9HCU8 ? ? 'expression tag'        -2  37 
4 6S1M PHE D 29 ? UNP Q9HCU8 ? ? 'expression tag'        -1  38 
4 6S1M GLN D 30 ? UNP Q9HCU8 ? ? 'expression tag'        0   39 
4 6S1M SER D 31 ? UNP Q9HCU8 ? ? 'expression tag'        1   40 
5 6S1M GLY E 1  ? UNP P12004 ? ? 'expression tag'        -2  41 
5 6S1M PRO E 2  ? UNP P12004 ? ? 'expression tag'        -1  42 
5 6S1M HIS E 3  ? UNP P12004 ? ? 'expression tag'        0   43 
6 6S1M GLY F 1  ? UNP P12004 ? ? 'expression tag'        -2  44 
6 6S1M PRO F 2  ? UNP P12004 ? ? 'expression tag'        -1  45 
6 6S1M HIS F 3  ? UNP P12004 ? ? 'expression tag'        0   46 
7 6S1M GLY G 1  ? UNP P12004 ? ? 'expression tag'        -2  47 
7 6S1M PRO G 2  ? UNP P12004 ? ? 'expression tag'        -1  48 
7 6S1M HIS G 3  ? UNP P12004 ? ? 'expression tag'        0   49 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ? 'C10 H14 N5 O7 P'   347.221 
DOC 'DNA linking'       n "2',3'-DIDEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O6 P'    291.198 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'        105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'                    ? 'Fe4 S4'            351.640 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'     204.225 
TTP non-polymer         . "THYMIDINE-5'-TRIPHOSPHATE"              ? 'C10 H17 N2 O14 P3' 482.168 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                               ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6S1M 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6S1M 
_struct.title                        'Human polymerase delta holoenzyme Conformer 1' 
_struct.pdbx_descriptor              
;DNA polymerase delta catalytic subunit, DNA polymerase delta subunit 3, Proliferating cell nuclear antigen, DNA polymerase delta subunit 2/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6S1M 
_struct_keywords.text            'Protein, REPLICATION' 
_struct_keywords.pdbx_keywords   REPLICATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 5  ? 
G N N 5  ? 
H N N 6  ? 
I N N 7  ? 
J N N 8  ? 
K N N 9  ? 
L N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 HIS A 160  ? ASN A 169  ? HIS A 160  ASN A 169  1 ? 10 
HELX_P HELX_P2  AA2 SER A 173  ? ARG A 177  ? SER A 173  ARG A 177  5 ? 5  
HELX_P HELX_P3  AA3 LEU A 216  ? ARG A 218  ? LEU A 216  ARG A 218  5 ? 3  
HELX_P HELX_P4  AA4 LEU A 219  ? GLU A 228  ? LEU A 219  GLU A 228  1 ? 10 
HELX_P HELX_P5  AA5 ASP A 249  ? ASP A 259  ? ASP A 249  ASP A 259  1 ? 11 
HELX_P HELX_P6  AA6 GLU A 301  ? ARG A 306  ? GLU A 301  ARG A 306  5 ? 6  
HELX_P HELX_P7  AA7 LYS A 373  ? ASP A 389  ? LYS A 373  ASP A 389  1 ? 17 
HELX_P HELX_P8  AA8 PHE A 401  ? LEU A 413  ? PHE A 401  LEU A 413  1 ? 13 
HELX_P HELX_P9  AA9 MET A 459  ? TYR A 467  ? MET A 459  TYR A 467  1 ? 9  
HELX_P HELX_P10 AB1 THR A 473  ? LEU A 482  ? THR A 473  LEU A 482  1 ? 10 
HELX_P HELX_P11 AB2 ILE A 493  ? ASN A 499  ? ILE A 493  ASN A 499  1 ? 7  
HELX_P HELX_P12 AB3 ASN A 501  ? LEU A 526  ? ASN A 501  LEU A 526  1 ? 26 
HELX_P HELX_P13 AB4 MET A 527  ? GLY A 540  ? MET A 527  GLY A 540  1 ? 14 
HELX_P HELX_P14 AB5 SER A 544  ? SER A 548  ? SER A 544  SER A 548  5 ? 5  
HELX_P HELX_P15 AB6 GLN A 551  ? MET A 564  ? GLN A 551  MET A 564  1 ? 14 
HELX_P HELX_P16 AB7 SER A 605  ? HIS A 614  ? SER A 605  HIS A 614  1 ? 10 
HELX_P HELX_P17 AB8 CYS A 617  ? THR A 619  ? CYS A 617  THR A 619  5 ? 3  
HELX_P HELX_P18 AB9 LEU A 655  ? ALA A 675  ? LEU A 655  ALA A 675  1 ? 21 
HELX_P HELX_P19 AC1 ASP A 679  ? GLY A 705  ? ASP A 679  GLY A 705  1 ? 27 
HELX_P HELX_P20 AC2 CYS A 713  ? TYR A 739  ? CYS A 713  TYR A 739  1 ? 27 
HELX_P HELX_P21 AC3 SER A 767  ? SER A 783  ? SER A 767  SER A 783  1 ? 17 
HELX_P HELX_P22 AC4 CYS A 837  ? ILE A 853  ? CYS A 837  ILE A 853  1 ? 17 
HELX_P HELX_P23 AC5 ASP A 856  ? CYS A 873  ? ASP A 856  CYS A 873  1 ? 18 
HELX_P HELX_P24 AC6 GLN A 898  ? ARG A 906  ? GLN A 898  ARG A 906  1 ? 9  
HELX_P HELX_P25 AC7 ASP A 941  ? SER A 949  ? ASP A 941  SER A 949  1 ? 9  
HELX_P HELX_P26 AC8 ASP A 953  ? GLN A 960  ? ASP A 953  GLN A 960  1 ? 8  
HELX_P HELX_P27 AC9 LEU A 962  ? GLU A 971  ? LEU A 962  GLU A 971  1 ? 10 
HELX_P HELX_P28 AD1 GLU A 976  ? HIS A 988  ? GLU A 976  HIS A 988  1 ? 13 
HELX_P HELX_P29 AD2 GLY A 1001 ? PHE A 1005 ? GLY A 1001 PHE A 1005 5 ? 5  
HELX_P HELX_P30 AD3 GLU A 1033 ? THR A 1056 ? GLU A 1033 THR A 1056 1 ? 24 
HELX_P HELX_P31 AD4 THR A 1056 ? GLY A 1063 ? THR A 1056 GLY A 1063 1 ? 8  
HELX_P HELX_P32 AD5 TYR A 1080 ? LEU A 1096 ? TYR A 1080 LEU A 1096 1 ? 17 
HELX_P HELX_P33 AD6 GLU B 4    ? GLN B 8    ? GLU B 4    GLN B 8    5 ? 5  
HELX_P HELX_P34 AD7 SER B 36   ? ARG B 40   ? SER B 36   ARG B 40   5 ? 5  
HELX_P HELX_P35 AD8 TYR B 50   ? GLY B 74   ? TYR B 50   GLY B 74   1 ? 25 
HELX_P HELX_P36 AD9 GLY B 209  ? THR B 223  ? GLY B 209  THR B 223  1 ? 15 
HELX_P HELX_P37 AE1 ASP B 228  ? ALA B 236  ? ASP B 228  ALA B 236  1 ? 9  
HELX_P HELX_P38 AE2 SER B 272  ? ALA B 288  ? SER B 272  ALA B 288  1 ? 17 
HELX_P HELX_P39 AE3 HIS B 312  ? PHE B 316  ? HIS B 312  PHE B 316  5 ? 5  
HELX_P HELX_P40 AE4 LEU B 318  ? TYR B 322  ? LEU B 318  TYR B 322  5 ? 5  
HELX_P HELX_P41 AE5 GLN B 347  ? TYR B 355  ? GLN B 347  TYR B 355  1 ? 9  
HELX_P HELX_P42 AE6 ASP B 360  ? VAL B 371  ? ASP B 360  VAL B 371  1 ? 12 
HELX_P HELX_P43 AE7 ASP C 11   ? THR C 23   ? ASP C 3    THR C 15   1 ? 13 
HELX_P HELX_P44 AE8 LYS C 32   ? LEU C 38   ? LYS C 24   LEU C 30   1 ? 7  
HELX_P HELX_P45 AE9 HIS C 41   ? ASN C 60   ? HIS C 33   ASN C 52   1 ? 20 
HELX_P HELX_P46 AF1 LYS C 92   ? LEU C 100  ? LYS C 84   LEU C 92   1 ? 9  
HELX_P HELX_P47 AF2 GLY C 120  ? SER C 132  ? GLY C 112  SER C 124  1 ? 13 
HELX_P HELX_P48 AF3 ALA D 74   ? ASP D 83   ? ALA D 44   ASP D 53   1 ? 10 
HELX_P HELX_P49 AF4 THR D 95   ? GLY D 107  ? THR D 65   GLY D 77   1 ? 13 
HELX_P HELX_P50 AF5 GLY E 12   ? LYS E 23   ? GLY E 9    LYS E 20   1 ? 12 
HELX_P HELX_P51 AF6 GLU E 58   ? PHE E 60   ? GLU E 55   PHE E 57   5 ? 3  
HELX_P HELX_P52 AF7 LEU E 75   ? LYS E 83   ? LEU E 72   LYS E 80   1 ? 9  
HELX_P HELX_P53 AF8 SER E 144  ? SER E 155  ? SER E 141  SER E 152  1 ? 12 
HELX_P HELX_P54 AF9 LEU E 212  ? THR E 219  ? LEU E 209  THR E 216  1 ? 8  
HELX_P HELX_P55 AG1 LYS E 220  ? SER E 225  ? LYS E 217  SER E 222  5 ? 6  
HELX_P HELX_P56 AG2 GLY F 12   ? LYS F 23   ? GLY F 9    LYS F 20   1 ? 12 
HELX_P HELX_P57 AG3 GLU F 58   ? PHE F 60   ? GLU F 55   PHE F 57   5 ? 3  
HELX_P HELX_P58 AG4 LEU F 75   ? LYS F 83   ? LEU F 72   LYS F 80   1 ? 9  
HELX_P HELX_P59 AG5 SER F 144  ? SER F 155  ? SER F 141  SER F 152  1 ? 12 
HELX_P HELX_P60 AG6 LEU F 212  ? THR F 219  ? LEU F 209  THR F 216  1 ? 8  
HELX_P HELX_P61 AG7 LYS F 220  ? SER F 225  ? LYS F 217  SER F 222  5 ? 6  
HELX_P HELX_P62 AG8 GLY G 12   ? LYS G 23   ? GLY G 9    LYS G 20   1 ? 12 
HELX_P HELX_P63 AG9 GLU G 58   ? PHE G 60   ? GLU G 55   PHE G 57   5 ? 3  
HELX_P HELX_P64 AH1 LEU G 75   ? LYS G 83   ? LEU G 72   LYS G 80   1 ? 9  
HELX_P HELX_P65 AH2 SER G 144  ? SER G 155  ? SER G 141  SER G 152  1 ? 12 
HELX_P HELX_P66 AH3 LEU G 212  ? THR G 219  ? LEU G 209  THR G 216  1 ? 8  
HELX_P HELX_P67 AH4 LYS G 220  ? SER G 225  ? LYS G 217  SER G 222  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A CYS 1012 SG    ? ? ? 1_555 J ZN  .  ZN  ? ? A CYS 1012 A ZN  1201 1_555 ? ? ? ? ? ? ?            2.474 ? 
metalc2  metalc ?    ? A CYS 1015 SG    ? ? ? 1_555 J ZN  .  ZN  ? ? A CYS 1015 A ZN  1201 1_555 ? ? ? ? ? ? ?            2.254 ? 
metalc3  metalc ?    ? A CYS 1026 SG    ? ? ? 1_555 J ZN  .  ZN  ? ? A CYS 1026 A ZN  1201 1_555 ? ? ? ? ? ? ?            2.532 ? 
metalc4  metalc ?    ? A CYS 1029 SG    ? ? ? 1_555 J ZN  .  ZN  ? ? A CYS 1029 A ZN  1201 1_555 ? ? ? ? ? ? ?            2.013 ? 
metalc5  metalc ?    ? A CYS 1058 SG    ? ? ? 1_555 K SF4 .  FE3 ? ? A CYS 1058 A SF4 1202 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc6  metalc ?    ? A CYS 1061 SG    ? ? ? 1_555 K SF4 .  FE4 ? ? A CYS 1061 A SF4 1202 1_555 ? ? ? ? ? ? ?            2.375 ? 
metalc7  metalc ?    ? A CYS 1071 SG    ? ? ? 1_555 K SF4 .  FE1 ? ? A CYS 1071 A SF4 1202 1_555 ? ? ? ? ? ? ?            2.252 ? 
metalc8  metalc ?    ? A CYS 1076 SG    ? ? ? 1_555 K SF4 .  FE2 ? ? A CYS 1076 A SF4 1202 1_555 ? ? ? ? ? ? ?            2.252 ? 
covale1  covale both ? H DG  24   "O3'" ? ? ? 1_555 H DOC 25 P   ? ? P DG  24   P DOC 25   1_555 ? ? ? ? ? ? ?            1.563 ? 
hydrog1  hydrog ?    ? H DC  3    N3    ? ? ? 1_555 I DG  36 N1  ? ? P DC  3    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ?    ? H DC  3    N4    ? ? ? 1_555 I DG  36 O6  ? ? P DC  3    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ?    ? H DC  3    O2    ? ? ? 1_555 I DG  36 N2  ? ? P DC  3    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ?    ? H DT  4    N3    ? ? ? 1_555 I DA  35 N1  ? ? P DT  4    T DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ?    ? H DT  4    O4    ? ? ? 1_555 I DA  35 N6  ? ? P DT  4    T DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ?    ? H DA  5    N1    ? ? ? 1_555 I DT  34 N3  ? ? P DA  5    T DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ?    ? H DA  5    N6    ? ? ? 1_555 I DT  34 O4  ? ? P DA  5    T DT  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ?    ? H DT  6    N3    ? ? ? 1_555 I DA  33 N1  ? ? P DT  6    T DA  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ?    ? H DT  6    O4    ? ? ? 1_555 I DA  33 N6  ? ? P DT  6    T DA  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ?    ? H DG  7    N1    ? ? ? 1_555 I DC  32 N3  ? ? P DG  7    T DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ?    ? H DG  7    N2    ? ? ? 1_555 I DC  32 O2  ? ? P DG  7    T DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ?    ? H DG  7    O6    ? ? ? 1_555 I DC  32 N4  ? ? P DG  7    T DC  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ?    ? H DA  8    N1    ? ? ? 1_555 I DT  31 N3  ? ? P DA  8    T DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ?    ? H DA  8    N6    ? ? ? 1_555 I DT  31 O4  ? ? P DA  8    T DT  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ?    ? H DC  9    N3    ? ? ? 1_555 I DG  30 N1  ? ? P DC  9    T DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ?    ? H DC  9    N4    ? ? ? 1_555 I DG  30 O6  ? ? P DC  9    T DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ?    ? H DC  9    O2    ? ? ? 1_555 I DG  30 N2  ? ? P DC  9    T DG  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ?    ? H DC  10   N3    ? ? ? 1_555 I DG  29 N1  ? ? P DC  10   T DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ?    ? H DC  10   N4    ? ? ? 1_555 I DG  29 O6  ? ? P DC  10   T DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ?    ? H DC  10   O2    ? ? ? 1_555 I DG  29 N2  ? ? P DC  10   T DG  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ?    ? H DA  11   N1    ? ? ? 1_555 I DT  28 N3  ? ? P DA  11   T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ?    ? H DA  11   N6    ? ? ? 1_555 I DT  28 O4  ? ? P DA  11   T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ?    ? H DT  12   N3    ? ? ? 1_555 I DA  27 N1  ? ? P DT  12   T DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ?    ? H DT  12   O4    ? ? ? 1_555 I DA  27 N6  ? ? P DT  12   T DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ?    ? H DG  13   N1    ? ? ? 1_555 I DC  26 N3  ? ? P DG  13   T DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ?    ? H DG  13   N2    ? ? ? 1_555 I DC  26 O2  ? ? P DG  13   T DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ?    ? H DG  13   O6    ? ? ? 1_555 I DC  26 N4  ? ? P DG  13   T DC  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ?    ? H DA  14   N1    ? ? ? 1_555 I DT  25 N3  ? ? P DA  14   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ?    ? H DA  14   N6    ? ? ? 1_555 I DT  25 O4  ? ? P DA  14   T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ?    ? H DT  15   N3    ? ? ? 1_555 I DA  24 N1  ? ? P DT  15   T DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ?    ? H DT  15   O4    ? ? ? 1_555 I DA  24 N6  ? ? P DT  15   T DA  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ?    ? H DT  16   N3    ? ? ? 1_555 I DA  23 N1  ? ? P DT  16   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ?    ? H DT  16   O4    ? ? ? 1_555 I DA  23 N6  ? ? P DT  16   T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ?    ? H DA  17   N1    ? ? ? 1_555 I DT  22 N3  ? ? P DA  17   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ?    ? H DA  17   N6    ? ? ? 1_555 I DT  22 O4  ? ? P DA  17   T DT  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ?    ? H DC  18   N3    ? ? ? 1_555 I DG  21 N1  ? ? P DC  18   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ?    ? H DC  18   N4    ? ? ? 1_555 I DG  21 O6  ? ? P DC  18   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ?    ? H DC  18   O2    ? ? ? 1_555 I DG  21 N2  ? ? P DC  18   T DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ?    ? H DG  19   N1    ? ? ? 1_555 I DC  20 N3  ? ? P DG  19   T DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ?    ? H DG  19   N2    ? ? ? 1_555 I DC  20 O2  ? ? P DG  19   T DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ?    ? H DG  19   O6    ? ? ? 1_555 I DC  20 N4  ? ? P DG  19   T DC  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ?    ? H DA  20   N1    ? ? ? 1_555 I DT  19 N3  ? ? P DA  20   T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ?    ? H DA  20   N6    ? ? ? 1_555 I DT  19 O4  ? ? P DA  20   T DT  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ?    ? H DA  21   N1    ? ? ? 1_555 I DT  18 N3  ? ? P DA  21   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ?    ? H DA  21   N6    ? ? ? 1_555 I DT  18 O4  ? ? P DA  21   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ?    ? H DT  22   N3    ? ? ? 1_555 I DA  17 N1  ? ? P DT  22   T DA  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ?    ? H DT  22   O4    ? ? ? 1_555 I DA  17 N6  ? ? P DT  22   T DA  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ?    ? H DT  23   N3    ? ? ? 1_555 I DA  16 N1  ? ? P DT  23   T DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ?    ? H DT  23   O4    ? ? ? 1_555 I DA  16 N6  ? ? P DT  23   T DA  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ?    ? H DG  24   N1    ? ? ? 1_555 I DC  15 N3  ? ? P DG  24   T DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ?    ? H DG  24   N2    ? ? ? 1_555 I DC  15 O2  ? ? P DG  24   T DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ?    ? H DG  24   O6    ? ? ? 1_555 I DC  15 N4  ? ? P DG  24   T DC  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ?    ? H DOC 25   N3    ? ? ? 1_555 I DG  14 N1  ? ? P DOC 25   T DG  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ?    ? H DOC 25   N4    ? ? ? 1_555 I DG  14 O6  ? ? P DOC 25   T DG  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ?    ? H DOC 25   O2    ? ? ? 1_555 I DG  14 N2  ? ? P DOC 25   T DG  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 240 A . ? SER 240 A PHE 241 A ? PHE 241 A 1 6.30  
2 GLU 576 A . ? GLU 576 A GLY 577 A ? GLY 577 A 1 -3.31 
3 GLN 628 A . ? GLN 628 A LYS 629 A ? LYS 629 A 1 3.79  
4 SER 788 A . ? SER 788 A PRO 789 A ? PRO 789 A 1 6.13  
5 PHE 799 A . ? PHE 799 A PRO 800 A ? PRO 800 A 1 3.07  
6 ALA 378 B . ? ALA 378 B PRO 379 B ? PRO 379 B 1 -4.48 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6  ? 
AA2 ? 3  ? 
AA3 ? 6  ? 
AA4 ? 2  ? 
AA5 ? 5  ? 
AA6 ? 4  ? 
AA7 ? 3  ? 
AA8 ? 3  ? 
AA9 ? 2  ? 
AB1 ? 6  ? 
AB2 ? 10 ? 
AB3 ? 5  ? 
AB4 ? 8  ? 
AB5 ? 2  ? 
AB6 ? 7  ? 
AB7 ? 8  ? 
AB8 ? 8  ? 
AB9 ? 2  ? 
AC1 ? 7  ? 
AC2 ? 2  ? 
AC3 ? 7  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? parallel      
AA1 2 3  ? anti-parallel 
AA1 3 4  ? anti-parallel 
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA2 1 2  ? anti-parallel 
AA2 2 3  ? anti-parallel 
AA3 1 2  ? parallel      
AA3 2 3  ? anti-parallel 
AA3 3 4  ? anti-parallel 
AA3 4 5  ? parallel      
AA3 5 6  ? parallel      
AA4 1 2  ? anti-parallel 
AA5 1 2  ? anti-parallel 
AA5 2 3  ? anti-parallel 
AA5 3 4  ? anti-parallel 
AA5 4 5  ? anti-parallel 
AA6 1 2  ? anti-parallel 
AA6 2 3  ? anti-parallel 
AA6 3 4  ? anti-parallel 
AA7 1 2  ? anti-parallel 
AA7 2 3  ? anti-parallel 
AA8 1 2  ? anti-parallel 
AA8 2 3  ? anti-parallel 
AA9 1 2  ? parallel      
AB1 1 2  ? anti-parallel 
AB1 2 3  ? anti-parallel 
AB1 3 4  ? anti-parallel 
AB1 4 5  ? anti-parallel 
AB1 5 6  ? parallel      
AB2 1 2  ? parallel      
AB2 2 3  ? parallel      
AB2 3 4  ? parallel      
AB2 4 5  ? anti-parallel 
AB2 5 6  ? anti-parallel 
AB2 6 7  ? parallel      
AB2 7 8  ? anti-parallel 
AB2 8 9  ? anti-parallel 
AB2 9 10 ? anti-parallel 
AB3 1 2  ? anti-parallel 
AB3 2 3  ? parallel      
AB3 3 4  ? parallel      
AB3 4 5  ? anti-parallel 
AB4 1 2  ? anti-parallel 
AB4 2 3  ? anti-parallel 
AB4 3 4  ? anti-parallel 
AB4 4 5  ? anti-parallel 
AB4 5 6  ? anti-parallel 
AB4 6 7  ? anti-parallel 
AB4 7 8  ? anti-parallel 
AB5 1 2  ? anti-parallel 
AB6 1 2  ? anti-parallel 
AB6 2 3  ? anti-parallel 
AB6 3 4  ? anti-parallel 
AB6 4 5  ? anti-parallel 
AB6 5 6  ? anti-parallel 
AB6 6 7  ? anti-parallel 
AB7 1 2  ? anti-parallel 
AB7 2 3  ? anti-parallel 
AB7 3 4  ? anti-parallel 
AB7 4 5  ? anti-parallel 
AB7 5 6  ? anti-parallel 
AB7 6 7  ? anti-parallel 
AB7 7 8  ? anti-parallel 
AB8 1 2  ? anti-parallel 
AB8 2 3  ? anti-parallel 
AB8 3 4  ? anti-parallel 
AB8 4 5  ? anti-parallel 
AB8 5 6  ? anti-parallel 
AB8 6 7  ? anti-parallel 
AB8 7 8  ? anti-parallel 
AB9 1 2  ? anti-parallel 
AC1 1 2  ? anti-parallel 
AC1 2 3  ? anti-parallel 
AC1 3 4  ? anti-parallel 
AC1 4 5  ? anti-parallel 
AC1 5 6  ? anti-parallel 
AC1 6 7  ? anti-parallel 
AC2 1 2  ? anti-parallel 
AC3 1 2  ? anti-parallel 
AC3 2 3  ? anti-parallel 
AC3 3 4  ? anti-parallel 
AC3 4 5  ? anti-parallel 
AC3 5 6  ? anti-parallel 
AC3 6 7  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 286 ? LEU A 291 ? LEU A 286 LEU A 291 
AA1 2  SER A 136 ? HIS A 142 ? SER A 136 HIS A 142 
AA1 3  PRO A 123 ? THR A 131 ? PRO A 123 THR A 131 
AA1 4  LEU A 94  ? VAL A 105 ? LEU A 94  VAL A 105 
AA1 5  TRP A 265 ? LEU A 268 ? TRP A 265 LEU A 268 
AA1 6  VAL A 296 ? HIS A 298 ? VAL A 296 HIS A 298 
AA2 1  TYR A 147 ? PRO A 151 ? TYR A 147 PRO A 151 
AA2 2  SER A 207 ? THR A 213 ? SER A 207 THR A 213 
AA2 3  LEU A 192 ? ARG A 195 ? LEU A 192 ARG A 195 
AA3 1  LYS A 367 ? SER A 370 ? LYS A 367 SER A 370 
AA3 2  LEU A 351 ? THR A 356 ? LEU A 351 THR A 356 
AA3 3  VAL A 334 ? ARG A 343 ? VAL A 334 ARG A 343 
AA3 4  ARG A 311 ? CYS A 319 ? ARG A 311 CYS A 319 
AA3 5  VAL A 392 ? GLY A 395 ? VAL A 392 GLY A 395 
AA3 6  VAL A 455 ? ASP A 458 ? VAL A 455 ASP A 458 
AA4 1  ILE A 431 ? SER A 438 ? ILE A 431 SER A 438 
AA4 2  GLY A 442 ? VAL A 449 ? GLY A 442 VAL A 449 
AA5 1  GLY A 592 ? TYR A 594 ? GLY A 592 TYR A 594 
AA5 2  LEU A 792 ? SER A 805 ? LEU A 792 SER A 805 
AA5 3  ILE A 598 ? PHE A 603 ? ILE A 598 PHE A 603 
AA5 4  SER A 758 ? ARG A 762 ? SER A 758 ARG A 762 
AA5 5  LYS A 750 ? GLY A 754 ? LYS A 750 GLY A 754 
AA6 1  GLY A 592 ? TYR A 594 ? GLY A 592 TYR A 594 
AA6 2  LEU A 792 ? SER A 805 ? LEU A 792 SER A 805 
AA6 3  ARG A 808 ? PHE A 814 ? ARG A 808 PHE A 814 
AA6 4  MET A 824 ? LYS A 827 ? MET A 824 LYS A 827 
AA7 1  LEU A 621 ? LEU A 622 ? LEU A 621 LEU A 622 
AA7 2  GLU A 645 ? VAL A 647 ? GLU A 645 VAL A 647 
AA7 3  PHE A 637 ? ARG A 639 ? PHE A 637 ARG A 639 
AA8 1  ILE A 883 ? GLU A 886 ? ILE A 883 GLU A 886 
AA8 2  ARG A 921 ? ILE A 926 ? ARG A 921 ILE A 926 
AA8 3  SER A 939 ? GLU A 940 ? SER A 939 GLU A 940 
AA9 1  LYS A 992 ? THR A 993 ? LYS A 992 THR A 993 
AA9 2  ASP F 123 ? LEU F 124 ? ASP F 120 LEU F 121 
AB1 1  ARG B 141 ? LYS B 143 ? ARG B 141 LYS B 143 
AB1 2  GLU B 132 ? GLU B 136 ? GLU B 132 GLU B 136 
AB1 3  CYS B 91  ? ALA B 100 ? CYS B 91  ALA B 100 
AB1 4  VAL B 158 ? VAL B 165 ? VAL B 158 VAL B 165 
AB1 5  PHE B 171 ? CYS B 177 ? PHE B 171 CYS B 177 
AB1 6  LYS B 145 ? GLY B 146 ? LYS B 145 GLY B 146 
AB2 1  LEU B 325 ? LEU B 327 ? LEU B 325 LEU B 327 
AB2 2  VAL B 292 ? MET B 295 ? VAL B 292 MET B 295 
AB2 3  VAL B 238 ? ALA B 244 ? VAL B 238 ALA B 244 
AB2 4  PHE B 195 ? VAL B 199 ? PHE B 195 VAL B 199 
AB2 5  THR B 436 ? ASN B 441 ? THR B 436 ASN B 441 
AB2 6  CYS B 447 ? GLY B 454 ? CYS B 447 GLY B 454 
AB2 7  SER C 81  ? VAL C 88  ? SER C 73  VAL C 80  
AB2 8  HIS C 66  ? ILE C 76  ? HIS C 58  ILE C 68  
AB2 9  SER C 105 ? GLN C 112 ? SER C 97  GLN C 104 
AB2 10 VAL C 29  ? THR C 30  ? VAL C 21  THR C 22  
AB3 1  TYR B 332 ? ILE B 336 ? TYR B 332 ILE B 336 
AB3 2  VAL B 339 ? GLY B 343 ? VAL B 339 GLY B 343 
AB3 3  VAL B 401 ? PHE B 403 ? VAL B 401 PHE B 403 
AB3 4  THR B 422 ? THR B 427 ? THR B 422 THR B 427 
AB3 5  GLY B 411 ? ARG B 416 ? GLY B 411 ARG B 416 
AB4 1  PHE E 5   ? LEU E 9   ? PHE E 2   LEU E 6   
AB4 2  ILE E 90  ? ALA E 95  ? ILE E 87  ALA E 92  
AB4 3  THR E 101 ? GLU E 107 ? THR E 98  GLU E 104 
AB4 4  LYS E 113 ? LYS E 120 ? LYS E 110 LYS E 117 
AB4 5  GLY F 179 ? SER F 186 ? GLY F 176 SER F 183 
AB4 6  GLY F 169 ? GLY F 176 ? GLY F 166 GLY F 173 
AB4 7  ALA F 160 ? CYS F 165 ? ALA F 157 CYS F 162 
AB4 8  VAL F 206 ? ALA F 211 ? VAL F 203 ALA F 208 
AB5 1  GLU E 28  ? ILE E 33  ? GLU E 25  ILE E 30  
AB5 2  LEU E 69  ? ASN E 74  ? LEU E 66  ASN E 71  
AB6 1  GLY E 37  ? MET E 43  ? GLY E 34  MET E 40  
AB6 2  SER E 49  ? ARG E 56  ? SER E 46  ARG E 53  
AB6 3  GLY E 248 ? LEU E 254 ? GLY E 245 LEU E 251 
AB6 4  LEU E 238 ? ILE E 244 ? LEU E 235 ILE E 241 
AB6 5  THR E 227 ? MET E 232 ? THR E 224 MET E 229 
AB6 6  CYS E 138 ? PRO E 143 ? CYS E 135 PRO E 140 
AB6 7  THR E 199 ? MET E 202 ? THR E 196 MET E 199 
AB7 1  VAL E 206 ? ALA E 211 ? VAL E 203 ALA E 208 
AB7 2  ALA E 160 ? CYS E 165 ? ALA E 157 CYS E 162 
AB7 3  GLY E 169 ? GLY E 176 ? GLY E 166 GLY E 173 
AB7 4  GLY E 179 ? SER E 186 ? GLY E 176 SER E 183 
AB7 5  LYS G 113 ? LYS G 120 ? LYS G 110 LYS G 117 
AB7 6  THR G 101 ? GLU G 107 ? THR G 98  GLU G 104 
AB7 7  ILE G 90  ? ALA G 95  ? ILE G 87  ALA G 92  
AB7 8  PHE G 5   ? LEU G 9   ? PHE G 2   LEU G 6   
AB8 1  PHE F 5   ? LEU F 9   ? PHE F 2   LEU F 6   
AB8 2  ILE F 90  ? ALA F 95  ? ILE F 87  ALA F 92  
AB8 3  THR F 101 ? GLU F 107 ? THR F 98  GLU F 104 
AB8 4  LYS F 113 ? LYS F 120 ? LYS F 110 LYS F 117 
AB8 5  GLY G 179 ? SER G 186 ? GLY G 176 SER G 183 
AB8 6  GLY G 169 ? GLY G 176 ? GLY G 166 GLY G 173 
AB8 7  ALA G 160 ? CYS G 165 ? ALA G 157 CYS G 162 
AB8 8  VAL G 206 ? ALA G 211 ? VAL G 203 ALA G 208 
AB9 1  GLU F 28  ? ASP F 32  ? GLU F 25  ASP F 29  
AB9 2  ALA F 70  ? ASN F 74  ? ALA F 67  ASN F 71  
AC1 1  GLY F 37  ? MET F 43  ? GLY F 34  MET F 40  
AC1 2  SER F 49  ? ARG F 56  ? SER F 46  ARG F 53  
AC1 3  GLY F 248 ? LEU F 254 ? GLY F 245 LEU F 251 
AC1 4  LEU F 238 ? ILE F 244 ? LEU F 235 ILE F 241 
AC1 5  THR F 227 ? MET F 232 ? THR F 224 MET F 229 
AC1 6  CYS F 138 ? PRO F 143 ? CYS F 135 PRO F 140 
AC1 7  THR F 199 ? MET F 202 ? THR F 196 MET F 199 
AC2 1  GLU G 28  ? ILE G 33  ? GLU G 25  ILE G 30  
AC2 2  LEU G 69  ? ASN G 74  ? LEU G 66  ASN G 71  
AC3 1  GLY G 37  ? MET G 43  ? GLY G 34  MET G 40  
AC3 2  SER G 49  ? ARG G 56  ? SER G 46  ARG G 53  
AC3 3  GLY G 248 ? LEU G 254 ? GLY G 245 LEU G 251 
AC3 4  LEU G 238 ? ILE G 244 ? LEU G 235 ILE G 241 
AC3 5  THR G 227 ? MET G 232 ? THR G 224 MET G 229 
AC3 6  CYS G 138 ? PRO G 143 ? CYS G 135 PRO G 140 
AC3 7  THR G 199 ? MET G 202 ? THR G 196 MET G 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O VAL A 290 ? O VAL A 290 N HIS A 140 ? N HIS A 140 
AA1 2 3  O ILE A 141 ? O ILE A 141 N LEU A 125 ? N LEU A 125 
AA1 3 4  O VAL A 124 ? O VAL A 124 N TYR A 104 ? N TYR A 104 
AA1 4 5  N PHE A 96  ? N PHE A 96  O LEU A 266 ? O LEU A 266 
AA1 5 6  N TRP A 265 ? N TRP A 265 O HIS A 298 ? O HIS A 298 
AA2 1 2  N THR A 150 ? N THR A 150 O LEU A 210 ? O LEU A 210 
AA2 2 3  O PHE A 209 ? O PHE A 209 N CYS A 193 ? N CYS A 193 
AA3 1 2  O GLN A 369 ? O GLN A 369 N THR A 356 ? N THR A 356 
AA3 2 3  O LEU A 355 ? O LEU A 355 N ILE A 337 ? N ILE A 337 
AA3 3 4  O LEU A 342 ? O LEU A 342 N VAL A 312 ? N VAL A 312 
AA3 4 5  N LEU A 313 ? N LEU A 313 O THR A 394 ? O THR A 394 
AA3 5 6  N ILE A 393 ? N ILE A 393 O MET A 457 ? O MET A 457 
AA4 1 2  N PHE A 436 ? N PHE A 436 O ARG A 444 ? O ARG A 444 
AA5 1 2  N TYR A 594 ? N TYR A 594 O TYR A 801 ? O TYR A 801 
AA5 2 3  O TYR A 798 ? O TYR A 798 N ILE A 598 ? N ILE A 598 
AA5 3 4  N ALA A 599 ? N ALA A 599 O CYS A 761 ? O CYS A 761 
AA5 4 5  O MET A 760 ? O MET A 760 N TYR A 753 ? N TYR A 753 
AA6 1 2  N TYR A 594 ? N TYR A 594 O TYR A 801 ? O TYR A 801 
AA6 2 3  N LEU A 802 ? N LEU A 802 O ALA A 810 ? O ALA A 810 
AA6 3 4  N GLY A 811 ? N GLY A 811 O ASP A 825 ? O ASP A 825 
AA7 1 2  N LEU A 622 ? N LEU A 622 O GLU A 645 ? O GLU A 645 
AA7 2 3  O PHE A 646 ? O PHE A 646 N ILE A 638 ? N ILE A 638 
AA8 1 2  N ILE A 883 ? N ILE A 883 O TYR A 924 ? O TYR A 924 
AA8 2 3  N VAL A 925 ? N VAL A 925 O GLU A 940 ? O GLU A 940 
AA9 1 2  N THR A 993 ? N THR A 993 O ASP F 123 ? O ASP F 120 
AB1 1 2  O ILE B 142 ? O ILE B 142 N LEU B 135 ? N LEU B 135 
AB1 2 3  O GLU B 136 ? O GLU B 136 N THR B 96  ? N THR B 96  
AB1 3 4  N CYS B 91  ? N CYS B 91  O GLY B 163 ? O GLY B 163 
AB1 4 5  N PHE B 162 ? N PHE B 162 O GLU B 174 ? O GLU B 174 
AB1 5 6  O PHE B 171 ? O PHE B 171 N LYS B 145 ? N LYS B 145 
AB2 1 2  O GLN B 326 ? O GLN B 326 N VAL B 294 ? N VAL B 294 
AB2 2 3  O ASP B 293 ? O ASP B 293 N LEU B 243 ? N LEU B 243 
AB2 3 4  O SER B 239 ? O SER B 239 N PHE B 195 ? N PHE B 195 
AB2 4 5  N VAL B 196 ? N VAL B 196 O VAL B 440 ? O VAL B 440 
AB2 5 6  N LEU B 439 ? N LEU B 439 O GLN B 448 ? O GLN B 448 
AB2 6 7  N SER B 451 ? N SER B 451 O HIS C 83  ? O HIS C 75  
AB2 7 8  O ALA C 86  ? O ALA C 78  N VAL C 71  ? N VAL C 63  
AB2 8 9  N THR C 68  ? N THR C 60  O TYR C 109 ? O TYR C 101 
AB2 9 10 O ILE C 111 ? O ILE C 103 N VAL C 29  ? N VAL C 21  
AB3 1 2  N TYR B 332 ? N TYR B 332 O GLY B 343 ? O GLY B 343 
AB3 2 3  N ARG B 340 ? N ARG B 340 O VAL B 401 ? O VAL B 401 
AB3 3 4  N TYR B 402 ? N TYR B 402 O LEU B 424 ? O LEU B 424 
AB3 4 5  O THR B 427 ? O THR B 427 N GLY B 411 ? N GLY B 411 
AB4 1 2  N LEU E 9   ? N LEU E 6   O ILE E 91  ? O ILE E 88  
AB4 2 3  N ILE E 90  ? N ILE E 87  O GLU E 107 ? O GLU E 104 
AB4 3 4  N LEU E 104 ? N LEU E 101 O TYR E 117 ? O TYR E 114 
AB4 4 5  N GLU E 118 ? N GLU E 115 O ASN F 180 ? O ASN F 177 
AB4 5 6  O GLY F 179 ? O GLY F 176 N GLY F 176 ? N GLY F 173 
AB4 6 7  O LYS F 171 ? O LYS F 168 N SER F 164 ? N SER F 161 
AB4 7 8  N VAL F 161 ? N VAL F 158 O PHE F 210 ? O PHE F 207 
AB5 1 2  N ALA E 29  ? N ALA E 26  O VAL E 73  ? O VAL E 70  
AB6 1 2  N LEU E 40  ? N LEU E 37  O LEU E 53  ? O LEU E 50  
AB6 2 3  N LEU E 50  ? N LEU E 47  O TYR E 253 ? O TYR E 250 
AB6 3 4  O TYR E 252 ? O TYR E 249 N VAL E 240 ? N VAL E 237 
AB6 4 5  O VAL E 239 ? O VAL E 236 N SER E 231 ? N SER E 228 
AB6 5 6  O LEU E 230 ? O LEU E 227 N VAL E 140 ? N VAL E 137 
AB6 6 7  N LYS E 141 ? N LYS E 138 O THR E 199 ? O THR E 196 
AB7 1 2  O VAL E 206 ? O VAL E 203 N CYS E 165 ? N CYS E 162 
AB7 2 3  N SER E 164 ? N SER E 161 O LYS E 171 ? O LYS E 168 
AB7 3 4  N GLY E 176 ? N GLY E 173 O GLY E 179 ? O GLY E 176 
AB7 4 5  N ASN E 180 ? N ASN E 177 O GLU G 118 ? O GLU G 115 
AB7 5 6  O TYR G 117 ? O TYR G 114 N LEU G 104 ? N LEU G 101 
AB7 6 7  O GLU G 107 ? O GLU G 104 N ILE G 90  ? N ILE G 87  
AB7 7 8  O ILE G 91  ? O ILE G 88  N LEU G 9   ? N LEU G 6   
AB8 1 2  N LEU F 9   ? N LEU F 6   O ILE F 91  ? O ILE F 88  
AB8 2 3  N ILE F 90  ? N ILE F 87  O GLU F 107 ? O GLU F 104 
AB8 3 4  N LEU F 104 ? N LEU F 101 O TYR F 117 ? O TYR F 114 
AB8 4 5  N GLU F 118 ? N GLU F 115 O ASN G 180 ? O ASN G 177 
AB8 5 6  O GLY G 179 ? O GLY G 176 N GLY G 176 ? N GLY G 173 
AB8 6 7  O LYS G 171 ? O LYS G 168 N SER G 164 ? N SER G 161 
AB8 7 8  N VAL G 161 ? N VAL G 158 O PHE G 210 ? O PHE G 207 
AB9 1 2  N ALA F 29  ? N ALA F 26  O VAL F 73  ? O VAL F 70  
AC1 1 2  N LEU F 40  ? N LEU F 37  O LEU F 53  ? O LEU F 50  
AC1 2 3  N GLN F 52  ? N GLN F 49  O LYS F 251 ? O LYS F 248 
AC1 3 4  O TYR F 252 ? O TYR F 249 N VAL F 240 ? N VAL F 237 
AC1 4 5  O VAL F 239 ? O VAL F 236 N SER F 231 ? N SER F 228 
AC1 5 6  O LEU F 230 ? O LEU F 227 N VAL F 140 ? N VAL F 137 
AC1 6 7  N LYS F 141 ? N LYS F 138 O THR F 199 ? O THR F 196 
AC2 1 2  N ALA G 29  ? N ALA G 26  O VAL G 73  ? O VAL G 70  
AC3 1 2  N LEU G 40  ? N LEU G 37  O LEU G 53  ? O LEU G 50  
AC3 2 3  N LEU G 50  ? N LEU G 47  O TYR G 253 ? O TYR G 250 
AC3 3 4  O TYR G 252 ? O TYR G 249 N VAL G 240 ? N VAL G 237 
AC3 4 5  O VAL G 239 ? O VAL G 236 N SER G 231 ? N SER G 228 
AC3 5 6  O LEU G 230 ? O LEU G 227 N VAL G 140 ? N VAL G 137 
AC3 6 7  N LYS G 141 ? N LYS G 138 O THR G 199 ? O THR G 196 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  1201 ? 4  'binding site for residue ZN A 1201'                  
AC2 Software A SF4 1202 ? 6  'binding site for residue SF4 A 1202'                 
AC3 Software T TTP 101  ? 12 'binding site for residue TTP T 101'                  
AC4 Software P DG  24   ? 11 'binding site for Di-nucleotide DG P 24 and DOC P 25' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 1012 ? CYS A 1012 . ? 1_555 ? 
2  AC1 4  CYS A 1015 ? CYS A 1015 . ? 1_555 ? 
3  AC1 4  CYS A 1026 ? CYS A 1026 . ? 1_555 ? 
4  AC1 4  CYS A 1029 ? CYS A 1029 . ? 1_555 ? 
5  AC2 6  CYS A 1058 ? CYS A 1058 . ? 1_555 ? 
6  AC2 6  CYS A 1061 ? CYS A 1061 . ? 1_555 ? 
7  AC2 6  CYS A 1071 ? CYS A 1071 . ? 1_555 ? 
8  AC2 6  CYS A 1076 ? CYS A 1076 . ? 1_555 ? 
9  AC2 6  ILE A 1078 ? ILE A 1078 . ? 1_555 ? 
10 AC2 6  PHE A 1079 ? PHE A 1079 . ? 1_555 ? 
11 AC3 12 PHE A 603  ? PHE A 603  . ? 1_555 ? 
12 AC3 12 SER A 604  ? SER A 604  . ? 1_555 ? 
13 AC3 12 SER A 605  ? SER A 605  . ? 1_555 ? 
14 AC3 12 LEU A 606  ? LEU A 606  . ? 1_555 ? 
15 AC3 12 TYR A 607  ? TYR A 607  . ? 1_555 ? 
16 AC3 12 ARG A 667  ? ARG A 667  . ? 1_555 ? 
17 AC3 12 LYS A 694  ? LYS A 694  . ? 1_555 ? 
18 AC3 12 ASN A 698  ? ASN A 698  . ? 1_555 ? 
19 AC3 12 ASP A 757  ? ASP A 757  . ? 1_555 ? 
20 AC3 12 DOC H 25   ? DOC P 25   . ? 1_555 ? 
21 AC3 12 DA  I 13   ? DA  T 0    . ? 1_555 ? 
22 AC3 12 DG  I 14   ? DG  T 1    . ? 1_555 ? 
23 AC4 11 ASP A 755  ? ASP A 755  . ? 1_555 ? 
24 AC4 11 THR A 756  ? THR A 756  . ? 1_555 ? 
25 AC4 11 ASP A 757  ? ASP A 757  . ? 1_555 ? 
26 AC4 11 TYR A 809  ? TYR A 809  . ? 1_555 ? 
27 AC4 11 LYS A 827  ? LYS A 827  . ? 1_555 ? 
28 AC4 11 GLY A 828  ? GLY A 828  . ? 1_555 ? 
29 AC4 11 DT  H 23   ? DT  P 23   . ? 1_555 ? 
30 AC4 11 DG  I 14   ? DG  T 1    . ? 1_555 ? 
31 AC4 11 DC  I 15   ? DC  T 2    . ? 1_555 ? 
32 AC4 11 DA  I 16   ? DA  T 3    . ? 1_555 ? 
33 AC4 11 TTP L .    ? TTP T 101  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6S1M 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ARG A 1  78   ? 115.682 188.341 153.335 1.00 24.83  ?  78   ARG A N     1 
ATOM   2     C  CA    . ARG A 1  78   ? 115.431 188.741 151.963 1.00 24.83  ?  78   ARG A CA    1 
ATOM   3     C  C     . ARG A 1  78   ? 114.843 187.597 151.157 1.00 24.83  ?  78   ARG A C     1 
ATOM   4     O  O     . ARG A 1  78   ? 113.628 187.422 151.179 1.00 24.83  ?  78   ARG A O     1 
ATOM   5     C  CB    . ARG A 1  78   ? 116.701 189.292 151.341 1.00 24.83  ?  78   ARG A CB    1 
ATOM   6     C  CG    . ARG A 1  78   ? 117.217 190.513 152.088 1.00 24.83  ?  78   ARG A CG    1 
ATOM   7     C  CD    . ARG A 1  78   ? 116.266 191.704 151.988 1.00 24.83  ?  78   ARG A CD    1 
ATOM   8     N  NE    . ARG A 1  78   ? 115.335 191.801 153.112 1.00 24.83  ?  78   ARG A NE    1 
ATOM   9     C  CZ    . ARG A 1  78   ? 115.539 192.512 154.211 1.00 24.83  ?  78   ARG A CZ    1 
ATOM   10    N  NH1   . ARG A 1  78   ? 116.636 193.241 154.338 1.00 24.83  1  78   ARG A NH1   1 
ATOM   11    N  NH2   . ARG A 1  78   ? 114.630 192.517 155.173 1.00 24.83  ?  78   ARG A NH2   1 
ATOM   12    N  N     . TRP A 1  79   ? 115.653 186.819 150.445 1.00 29.79  ?  79   TRP A N     1 
ATOM   13    C  CA    . TRP A 1  79   ? 115.070 185.693 149.733 1.00 29.79  ?  79   TRP A CA    1 
ATOM   14    C  C     . TRP A 1  79   ? 114.679 184.594 150.702 1.00 29.79  ?  79   TRP A C     1 
ATOM   15    O  O     . TRP A 1  79   ? 115.396 184.299 151.660 1.00 29.79  ?  79   TRP A O     1 
ATOM   16    C  CB    . TRP A 1  79   ? 115.987 185.135 148.648 1.00 29.79  ?  79   TRP A CB    1 
ATOM   17    C  CG    . TRP A 1  79   ? 116.077 186.021 147.473 1.00 29.79  ?  79   TRP A CG    1 
ATOM   18    C  CD1   . TRP A 1  79   ? 117.134 186.781 147.099 1.00 29.79  ?  79   TRP A CD1   1 
ATOM   19    C  CD2   . TRP A 1  79   ? 115.012 186.343 146.572 1.00 29.79  ?  79   TRP A CD2   1 
ATOM   20    N  NE1   . TRP A 1  79   ? 116.828 187.504 145.977 1.00 29.79  ?  79   TRP A NE1   1 
ATOM   21    C  CE2   . TRP A 1  79   ? 115.524 187.262 145.639 1.00 29.79  ?  79   TRP A CE2   1 
ATOM   22    C  CE3   . TRP A 1  79   ? 113.682 185.919 146.447 1.00 29.79  ?  79   TRP A CE3   1 
ATOM   23    C  CZ2   . TRP A 1  79   ? 114.755 187.771 144.595 1.00 29.79  ?  79   TRP A CZ2   1 
ATOM   24    C  CZ3   . TRP A 1  79   ? 112.923 186.422 145.417 1.00 29.79  ?  79   TRP A CZ3   1 
ATOM   25    C  CH2   . TRP A 1  79   ? 113.462 187.338 144.497 1.00 29.79  ?  79   TRP A CH2   1 
ATOM   26    N  N     . LEU A 1  80   ? 113.528 184.000 150.436 1.00 25.46  ?  80   LEU A N     1 
ATOM   27    C  CA    . LEU A 1  80   ? 112.886 183.034 151.299 1.00 25.46  ?  80   LEU A CA    1 
ATOM   28    C  C     . LEU A 1  80   ? 113.169 181.631 150.791 1.00 25.46  ?  80   LEU A C     1 
ATOM   29    O  O     . LEU A 1  80   ? 113.617 181.435 149.662 1.00 25.46  ?  80   LEU A O     1 
ATOM   30    C  CB    . LEU A 1  80   ? 111.382 183.298 151.343 1.00 25.46  ?  80   LEU A CB    1 
ATOM   31    C  CG    . LEU A 1  80   ? 110.925 184.645 151.919 1.00 25.46  ?  80   LEU A CG    1 
ATOM   32    C  CD1   . LEU A 1  80   ? 110.676 185.667 150.839 1.00 25.46  ?  80   LEU A CD1   1 
ATOM   33    C  CD2   . LEU A 1  80   ? 109.671 184.487 152.759 1.00 25.46  ?  80   LEU A CD2   1 
ATOM   34    N  N     . ARG A 1  81   ? 112.929 180.652 151.651 1.00 28.01  ?  81   ARG A N     1 
ATOM   35    C  CA    . ARG A 1  81   ? 113.015 179.270 151.227 1.00 28.01  ?  81   ARG A CA    1 
ATOM   36    C  C     . ARG A 1  81   ? 111.803 178.926 150.360 1.00 28.01  ?  81   ARG A C     1 
ATOM   37    O  O     . ARG A 1  81   ? 110.767 179.587 150.451 1.00 28.01  ?  81   ARG A O     1 
ATOM   38    C  CB    . ARG A 1  81   ? 113.091 178.344 152.443 1.00 28.01  ?  81   ARG A CB    1 
ATOM   39    C  CG    . ARG A 1  81   ? 114.414 178.397 153.203 1.00 28.01  ?  81   ARG A CG    1 
ATOM   40    C  CD    . ARG A 1  81   ? 114.599 177.207 154.127 1.00 28.01  ?  81   ARG A CD    1 
ATOM   41    N  NE    . ARG A 1  81   ? 115.773 177.344 154.984 1.00 28.01  ?  81   ARG A NE    1 
ATOM   42    C  CZ    . ARG A 1  81   ? 116.885 176.615 154.888 1.00 28.01  ?  81   ARG A CZ    1 
ATOM   43    N  NH1   . ARG A 1  81   ? 117.002 175.671 153.972 1.00 28.01  1  81   ARG A NH1   1 
ATOM   44    N  NH2   . ARG A 1  81   ? 117.889 176.830 155.724 1.00 28.01  ?  81   ARG A NH2   1 
ATOM   45    N  N     . PRO A 1  82   ? 111.920 177.934 149.478 1.00 35.03  ?  82   PRO A N     1 
ATOM   46    C  CA    . PRO A 1  82   ? 110.741 177.464 148.740 1.00 35.03  ?  82   PRO A CA    1 
ATOM   47    C  C     . PRO A 1  82   ? 109.707 176.843 149.669 1.00 35.03  ?  82   PRO A C     1 
ATOM   48    O  O     . PRO A 1  82   ? 110.017 176.394 150.773 1.00 35.03  ?  82   PRO A O     1 
ATOM   49    C  CB    . PRO A 1  82   ? 111.314 176.427 147.765 1.00 35.03  ?  82   PRO A CB    1 
ATOM   50    C  CG    . PRO A 1  82   ? 112.684 176.132 148.256 1.00 35.03  ?  82   PRO A CG    1 
ATOM   51    C  CD    . PRO A 1  82   ? 113.159 177.374 148.920 1.00 35.03  ?  82   PRO A CD    1 
ATOM   52    N  N     . THR A 1  83   ? 108.460 176.819 149.198 1.00 42.51  ?  83   THR A N     1 
ATOM   53    C  CA    . THR A 1  83   ? 107.176 176.510 149.825 1.00 42.51  ?  83   THR A CA    1 
ATOM   54    C  C     . THR A 1  83   ? 106.935 174.999 149.857 1.00 42.51  ?  83   THR A C     1 
ATOM   55    O  O     . THR A 1  83   ? 106.990 174.345 148.813 1.00 42.51  ?  83   THR A O     1 
ATOM   56    C  CB    . THR A 1  83   ? 106.051 177.191 149.056 1.00 42.51  ?  83   THR A CB    1 
ATOM   57    O  OG1   . THR A 1  83   ? 106.439 178.533 148.742 1.00 42.51  ?  83   THR A OG1   1 
ATOM   58    C  CG2   . THR A 1  83   ? 104.769 177.227 149.860 1.00 42.51  ?  83   THR A CG2   1 
ATOM   59    N  N     . PRO A 1  84   ? 106.649 174.425 151.026 1.00 43.68  ?  84   PRO A N     1 
ATOM   60    C  CA    . PRO A 1  84   ? 106.393 172.981 151.108 1.00 43.68  ?  84   PRO A CA    1 
ATOM   61    C  C     . PRO A 1  84   ? 104.984 172.652 150.653 1.00 43.68  ?  84   PRO A C     1 
ATOM   62    O  O     . PRO A 1  84   ? 104.008 172.965 151.351 1.00 43.68  ?  84   PRO A O     1 
ATOM   63    C  CB    . PRO A 1  84   ? 106.590 172.665 152.599 1.00 43.68  ?  84   PRO A CB    1 
ATOM   64    C  CG    . PRO A 1  84   ? 106.697 173.997 153.306 1.00 43.68  ?  84   PRO A CG    1 
ATOM   65    C  CD    . PRO A 1  84   ? 106.443 175.087 152.324 1.00 43.68  ?  84   PRO A CD    1 
ATOM   66    N  N     . PRO A 1  85   ? 104.834 172.038 149.475 1.00 55.49  ?  85   PRO A N     1 
ATOM   67    C  CA    . PRO A 1  85   ? 103.508 171.946 148.846 1.00 55.49  ?  85   PRO A CA    1 
ATOM   68    C  C     . PRO A 1  85   ? 102.480 170.988 149.447 1.00 55.49  ?  85   PRO A C     1 
ATOM   69    O  O     . PRO A 1  85   ? 101.443 171.435 149.945 1.00 55.49  ?  85   PRO A O     1 
ATOM   70    C  CB    . PRO A 1  85   ? 103.846 171.520 147.410 1.00 55.49  ?  85   PRO A CB    1 
ATOM   71    C  CG    . PRO A 1  85   ? 105.241 170.934 147.466 1.00 55.49  ?  85   PRO A CG    1 
ATOM   72    C  CD    . PRO A 1  85   ? 105.817 171.156 148.827 1.00 55.49  ?  85   PRO A CD    1 
ATOM   73    N  N     . ALA A 1  86   ? 102.751 169.679 149.420 1.00 65.75  ?  86   ALA A N     1 
ATOM   74    C  CA    . ALA A 1  86   ? 101.651 168.712 149.415 1.00 65.75  ?  86   ALA A CA    1 
ATOM   75    C  C     . ALA A 1  86   ? 101.967 167.464 150.237 1.00 65.75  ?  86   ALA A C     1 
ATOM   76    O  O     . ALA A 1  86   ? 101.557 166.356 149.877 1.00 65.75  ?  86   ALA A O     1 
ATOM   77    C  CB    . ALA A 1  86   ? 101.273 168.315 147.986 1.00 65.75  ?  86   ALA A CB    1 
ATOM   78    N  N     . LEU A 1  87   ? 102.700 167.615 151.332 1.00 58.00  ?  87   LEU A N     1 
ATOM   79    C  CA    . LEU A 1  87   ? 103.077 166.453 152.132 1.00 58.00  ?  87   LEU A CA    1 
ATOM   80    C  C     . LEU A 1  87   ? 101.883 165.925 152.930 1.00 58.00  ?  87   LEU A C     1 
ATOM   81    O  O     . LEU A 1  87   ? 101.310 166.642 153.756 1.00 58.00  ?  87   LEU A O     1 
ATOM   82    C  CB    . LEU A 1  87   ? 104.230 166.814 153.060 1.00 58.00  ?  87   LEU A CB    1 
ATOM   83    C  CG    . LEU A 1  87   ? 104.725 165.696 153.971 1.00 58.00  ?  87   LEU A CG    1 
ATOM   84    C  CD1   . LEU A 1  87   ? 105.674 164.769 153.227 1.00 58.00  ?  87   LEU A CD1   1 
ATOM   85    C  CD2   . LEU A 1  87   ? 105.395 166.298 155.195 1.00 58.00  ?  87   LEU A CD2   1 
ATOM   86    N  N     . ASP A 1  88   ? 101.509 164.665 152.677 1.00 59.35  ?  88   ASP A N     1 
ATOM   87    C  CA    . ASP A 1  88   ? 100.423 164.007 153.397 1.00 59.35  ?  88   ASP A CA    1 
ATOM   88    C  C     . ASP A 1  88   ? 100.991 162.852 154.205 1.00 59.35  ?  88   ASP A C     1 
ATOM   89    O  O     . ASP A 1  88   ? 101.569 161.931 153.615 1.00 59.35  ?  88   ASP A O     1 
ATOM   90    C  CB    . ASP A 1  88   ? 99.365  163.504 152.426 1.00 59.35  ?  88   ASP A CB    1 
ATOM   91    C  CG    . ASP A 1  88   ? 98.031  163.238 153.099 1.00 59.35  ?  88   ASP A CG    1 
ATOM   92    O  OD1   . ASP A 1  88   ? 97.952  162.342 153.969 1.00 59.35  ?  88   ASP A OD1   1 
ATOM   93    O  OD2   . ASP A 1  88   ? 97.054  163.936 152.755 1.00 59.35  -1 88   ASP A OD2   1 
ATOM   94    N  N     . PRO A 1  89   ? 100.836 162.838 155.532 1.00 54.72  ?  89   PRO A N     1 
ATOM   95    C  CA    . PRO A 1  89   ? 101.642 161.922 156.355 1.00 54.72  ?  89   PRO A CA    1 
ATOM   96    C  C     . PRO A 1  89   ? 101.191 160.473 156.315 1.00 54.72  ?  89   PRO A C     1 
ATOM   97    O  O     . PRO A 1  89   ? 102.012 159.585 156.585 1.00 54.72  ?  89   PRO A O     1 
ATOM   98    C  CB    . PRO A 1  89   ? 101.502 162.507 157.763 1.00 54.72  ?  89   PRO A CB    1 
ATOM   99    C  CG    . PRO A 1  89   ? 100.196 163.186 157.747 1.00 54.72  ?  89   PRO A CG    1 
ATOM   100   C  CD    . PRO A 1  89   ? 99.970  163.699 156.352 1.00 54.72  ?  89   PRO A CD    1 
ATOM   101   N  N     . GLN A 1  90   ? 99.933  160.195 155.989 1.00 60.93  ?  90   GLN A N     1 
ATOM   102   C  CA    . GLN A 1  90   ? 99.432  158.827 155.974 1.00 60.93  ?  90   GLN A CA    1 
ATOM   103   C  C     . GLN A 1  90   ? 99.842  158.041 154.737 1.00 60.93  ?  90   GLN A C     1 
ATOM   104   O  O     . GLN A 1  90   ? 99.606  156.830 154.690 1.00 60.93  ?  90   GLN A O     1 
ATOM   105   C  CB    . GLN A 1  90   ? 97.910  158.819 156.113 1.00 60.93  ?  90   GLN A CB    1 
ATOM   106   C  CG    . GLN A 1  90   ? 97.443  159.105 157.520 1.00 60.93  ?  90   GLN A CG    1 
ATOM   107   C  CD    . GLN A 1  90   ? 95.943  159.048 157.648 1.00 60.93  ?  90   GLN A CD    1 
ATOM   108   O  OE1   . GLN A 1  90   ? 95.245  158.671 156.710 1.00 60.93  ?  90   GLN A OE1   1 
ATOM   109   N  NE2   . GLN A 1  90   ? 95.436  159.411 158.820 1.00 60.93  ?  90   GLN A NE2   1 
ATOM   110   N  N     . THR A 1  91   ? 100.453 158.686 153.744 1.00 58.15  ?  91   THR A N     1 
ATOM   111   C  CA    . THR A 1  91   ? 100.887 158.003 152.531 1.00 58.15  ?  91   THR A CA    1 
ATOM   112   C  C     . THR A 1  91   ? 102.363 158.249 152.245 1.00 58.15  ?  91   THR A C     1 
ATOM   113   O  O     . THR A 1  91   ? 103.056 157.341 151.769 1.00 58.15  ?  91   THR A O     1 
ATOM   114   C  CB    . THR A 1  91   ? 100.021 158.455 151.349 1.00 58.15  ?  91   THR A CB    1 
ATOM   115   O  OG1   . THR A 1  91   ? 98.641  158.442 151.734 1.00 58.15  ?  91   THR A OG1   1 
ATOM   116   C  CG2   . THR A 1  91   ? 100.206 157.524 150.163 1.00 58.15  ?  91   THR A CG2   1 
ATOM   117   N  N     . GLU A 1  92   ? 102.873 159.453 152.540 1.00 50.54  ?  92   GLU A N     1 
ATOM   118   C  CA    . GLU A 1  92   ? 104.218 159.871 152.181 1.00 50.54  ?  92   GLU A CA    1 
ATOM   119   C  C     . GLU A 1  92   ? 105.165 159.781 153.369 1.00 50.54  ?  92   GLU A C     1 
ATOM   120   O  O     . GLU A 1  92   ? 104.767 159.993 154.516 1.00 50.54  ?  92   GLU A O     1 
ATOM   121   C  CB    . GLU A 1  92   ? 104.194 161.308 151.658 1.00 50.54  ?  92   GLU A CB    1 
ATOM   122   C  CG    . GLU A 1  92   ? 103.908 161.435 150.178 1.00 50.54  ?  92   GLU A CG    1 
ATOM   123   C  CD    . GLU A 1  92   ? 102.429 161.448 149.863 1.00 50.54  ?  92   GLU A CD    1 
ATOM   124   O  OE1   . GLU A 1  92   ? 101.618 161.359 150.805 1.00 50.54  ?  92   GLU A OE1   1 
ATOM   125   O  OE2   . GLU A 1  92   ? 102.078 161.545 148.667 1.00 50.54  -1 92   GLU A OE2   1 
ATOM   126   N  N     . PRO A 1  93   ? 106.430 159.457 153.126 1.00 37.37  ?  93   PRO A N     1 
ATOM   127   C  CA    . PRO A 1  93   ? 107.441 159.520 154.185 1.00 37.37  ?  93   PRO A CA    1 
ATOM   128   C  C     . PRO A 1  93   ? 108.128 160.882 154.237 1.00 37.37  ?  93   PRO A C     1 
ATOM   129   O  O     . PRO A 1  93   ? 107.876 161.774 153.427 1.00 37.37  ?  93   PRO A O     1 
ATOM   130   C  CB    . PRO A 1  93   ? 108.427 158.427 153.767 1.00 37.37  ?  93   PRO A CB    1 
ATOM   131   C  CG    . PRO A 1  93   ? 108.367 158.448 152.302 1.00 37.37  ?  93   PRO A CG    1 
ATOM   132   C  CD    . PRO A 1  93   ? 106.927 158.721 151.951 1.00 37.37  ?  93   PRO A CD    1 
ATOM   133   N  N     . LEU A 1  94   ? 109.010 161.032 155.225 1.00 28.43  ?  94   LEU A N     1 
ATOM   134   C  CA    . LEU A 1  94   ? 109.948 162.151 155.284 1.00 28.43  ?  94   LEU A CA    1 
ATOM   135   C  C     . LEU A 1  94   ? 111.369 161.630 155.170 1.00 28.43  ?  94   LEU A C     1 
ATOM   136   O  O     . LEU A 1  94   ? 111.730 160.659 155.840 1.00 28.43  ?  94   LEU A O     1 
ATOM   137   C  CB    . LEU A 1  94   ? 109.817 162.953 156.579 1.00 28.43  ?  94   LEU A CB    1 
ATOM   138   C  CG    . LEU A 1  94   ? 109.019 164.247 156.545 1.00 28.43  ?  94   LEU A CG    1 
ATOM   139   C  CD1   . LEU A 1  94   ? 109.282 165.035 157.801 1.00 28.43  ?  94   LEU A CD1   1 
ATOM   140   C  CD2   . LEU A 1  94   ? 109.398 165.058 155.336 1.00 28.43  ?  94   LEU A CD2   1 
ATOM   141   N  N     . ILE A 1  95   ? 112.171 162.262 154.318 1.00 24.94  ?  95   ILE A N     1 
ATOM   142   C  CA    . ILE A 1  95   ? 113.590 161.955 154.188 1.00 24.94  ?  95   ILE A CA    1 
ATOM   143   C  C     . ILE A 1  95   ? 114.341 163.273 154.314 1.00 24.94  ?  95   ILE A C     1 
ATOM   144   O  O     . ILE A 1  95   ? 114.244 164.131 153.429 1.00 24.94  ?  95   ILE A O     1 
ATOM   145   C  CB    . ILE A 1  95   ? 113.926 161.261 152.860 1.00 24.94  ?  95   ILE A CB    1 
ATOM   146   C  CG1   . ILE A 1  95   ? 112.950 160.128 152.546 1.00 24.94  ?  95   ILE A CG1   1 
ATOM   147   C  CG2   . ILE A 1  95   ? 115.324 160.691 152.906 1.00 24.94  ?  95   ILE A CG2   1 
ATOM   148   C  CD1   . ILE A 1  95   ? 113.141 159.527 151.183 1.00 24.94  ?  95   ILE A CD1   1 
ATOM   149   N  N     . PHE A 1  96   ? 115.088 163.446 155.405 1.00 28.44  ?  96   PHE A N     1 
ATOM   150   C  CA    . PHE A 1  96   ? 115.822 164.691 155.591 1.00 28.44  ?  96   PHE A CA    1 
ATOM   151   C  C     . PHE A 1  96   ? 117.147 164.413 156.277 1.00 28.44  ?  96   PHE A C     1 
ATOM   152   O  O     . PHE A 1  96   ? 117.364 163.339 156.836 1.00 28.44  ?  96   PHE A O     1 
ATOM   153   C  CB    . PHE A 1  96   ? 114.998 165.727 156.371 1.00 28.44  ?  96   PHE A CB    1 
ATOM   154   C  CG    . PHE A 1  96   ? 114.914 165.473 157.847 1.00 28.44  ?  96   PHE A CG    1 
ATOM   155   C  CD1   . PHE A 1  96   ? 114.131 164.452 158.345 1.00 28.44  ?  96   PHE A CD1   1 
ATOM   156   C  CD2   . PHE A 1  96   ? 115.588 166.285 158.740 1.00 28.44  ?  96   PHE A CD2   1 
ATOM   157   C  CE1   . PHE A 1  96   ? 114.046 164.232 159.699 1.00 28.44  ?  96   PHE A CE1   1 
ATOM   158   C  CE2   . PHE A 1  96   ? 115.507 166.069 160.093 1.00 28.44  ?  96   PHE A CE2   1 
ATOM   159   C  CZ    . PHE A 1  96   ? 114.736 165.040 160.573 1.00 28.44  ?  96   PHE A CZ    1 
ATOM   160   N  N     . GLN A 1  97   ? 118.046 165.389 156.213 1.00 28.22  ?  97   GLN A N     1 
ATOM   161   C  CA    . GLN A 1  97   ? 119.397 165.262 156.747 1.00 28.22  ?  97   GLN A CA    1 
ATOM   162   C  C     . GLN A 1  97   ? 119.544 166.214 157.917 1.00 28.22  ?  97   GLN A C     1 
ATOM   163   O  O     . GLN A 1  97   ? 119.275 167.410 157.781 1.00 28.22  ?  97   GLN A O     1 
ATOM   164   C  CB    . GLN A 1  97   ? 120.450 165.561 155.684 1.00 28.22  ?  97   GLN A CB    1 
ATOM   165   C  CG    . GLN A 1  97   ? 121.808 165.015 156.028 1.00 28.22  ?  97   GLN A CG    1 
ATOM   166   C  CD    . GLN A 1  97   ? 122.923 165.625 155.228 1.00 28.22  ?  97   GLN A CD    1 
ATOM   167   O  OE1   . GLN A 1  97   ? 123.052 166.845 155.145 1.00 28.22  ?  97   GLN A OE1   1 
ATOM   168   N  NE2   . GLN A 1  97   ? 123.761 164.778 154.649 1.00 28.22  ?  97   GLN A NE2   1 
ATOM   169   N  N     . GLN A 1  98   ? 119.968 165.682 159.056 1.00 33.30  ?  98   GLN A N     1 
ATOM   170   C  CA    . GLN A 1  98   ? 120.003 166.435 160.299 1.00 33.30  ?  98   GLN A CA    1 
ATOM   171   C  C     . GLN A 1  98   ? 121.317 167.185 160.463 1.00 33.30  ?  98   GLN A C     1 
ATOM   172   O  O     . GLN A 1  98   ? 122.378 166.747 160.011 1.00 33.30  ?  98   GLN A O     1 
ATOM   173   C  CB    . GLN A 1  98   ? 119.815 165.501 161.490 1.00 33.30  ?  98   GLN A CB    1 
ATOM   174   C  CG    . GLN A 1  98   ? 120.791 164.336 161.488 1.00 33.30  ?  98   GLN A CG    1 
ATOM   175   C  CD    . GLN A 1  98   ? 121.126 163.857 162.870 1.00 33.30  ?  98   GLN A CD    1 
ATOM   176   O  OE1   . GLN A 1  98   ? 120.703 164.446 163.860 1.00 33.30  ?  98   GLN A OE1   1 
ATOM   177   N  NE2   . GLN A 1  98   ? 121.910 162.794 162.950 1.00 33.30  ?  98   GLN A NE2   1 
ATOM   178   N  N     . LEU A 1  99   ? 121.236 168.327 161.132 1.00 26.62  ?  99   LEU A N     1 
ATOM   179   C  CA    . LEU A 1  99   ? 122.405 169.097 161.518 1.00 26.62  ?  99   LEU A CA    1 
ATOM   180   C  C     . LEU A 1  99   ? 122.603 169.149 163.023 1.00 26.62  ?  99   LEU A C     1 
ATOM   181   O  O     . LEU A 1  99   ? 123.652 168.738 163.516 1.00 26.62  ?  99   LEU A O     1 
ATOM   182   C  CB    . LEU A 1  99   ? 122.307 170.523 160.962 1.00 26.62  ?  99   LEU A CB    1 
ATOM   183   C  CG    . LEU A 1  99   ? 122.323 170.715 159.451 1.00 26.62  ?  99   LEU A CG    1 
ATOM   184   C  CD1   . LEU A 1  99   ? 122.708 172.134 159.148 1.00 26.62  ?  99   LEU A CD1   1 
ATOM   185   C  CD2   . LEU A 1  99   ? 123.273 169.756 158.761 1.00 26.62  ?  99   LEU A CD2   1 
ATOM   186   N  N     . GLU A 1  100  ? 121.611 169.622 163.775 1.00 31.94  ?  100  GLU A N     1 
ATOM   187   C  CA    . GLU A 1  100  ? 121.756 169.761 165.215 1.00 31.94  ?  100  GLU A CA    1 
ATOM   188   C  C     . GLU A 1  100  ? 120.731 168.904 165.939 1.00 31.94  ?  100  GLU A C     1 
ATOM   189   O  O     . GLU A 1  100  ? 119.639 168.643 165.441 1.00 31.94  ?  100  GLU A O     1 
ATOM   190   C  CB    . GLU A 1  100  ? 121.619 171.211 165.682 1.00 31.94  ?  100  GLU A CB    1 
ATOM   191   C  CG    . GLU A 1  100  ? 122.488 171.491 166.894 1.00 31.94  ?  100  GLU A CG    1 
ATOM   192   C  CD    . GLU A 1  100  ? 122.260 172.843 167.521 1.00 31.94  ?  100  GLU A CD    1 
ATOM   193   O  OE1   . GLU A 1  100  ? 121.110 173.301 167.540 1.00 31.94  ?  100  GLU A OE1   1 
ATOM   194   O  OE2   . GLU A 1  100  ? 123.240 173.451 167.998 1.00 31.94  -1 100  GLU A OE2   1 
ATOM   195   N  N     . ILE A 1  101  ? 121.117 168.458 167.128 1.00 32.47  ?  101  ILE A N     1 
ATOM   196   C  CA    . ILE A 1  101  ? 120.226 167.789 168.057 1.00 32.47  ?  101  ILE A CA    1 
ATOM   197   C  C     . ILE A 1  101  ? 120.107 168.659 169.300 1.00 32.47  ?  101  ILE A C     1 
ATOM   198   O  O     . ILE A 1  101  ? 120.888 169.587 169.513 1.00 32.47  ?  101  ILE A O     1 
ATOM   199   C  CB    . ILE A 1  101  ? 120.729 166.386 168.416 1.00 32.47  ?  101  ILE A CB    1 
ATOM   200   C  CG1   . ILE A 1  101  ? 122.181 166.491 168.858 1.00 32.47  ?  101  ILE A CG1   1 
ATOM   201   C  CG2   . ILE A 1  101  ? 120.615 165.480 167.221 1.00 32.47  ?  101  ILE A CG2   1 
ATOM   202   C  CD1   . ILE A 1  101  ? 122.829 165.187 169.172 1.00 32.47  ?  101  ILE A CD1   1 
ATOM   203   N  N     . ASP A 1  102  ? 119.125 168.345 170.135 1.00 35.26  ?  102  ASP A N     1 
ATOM   204   C  CA    . ASP A 1  102  ? 118.875 169.150 171.318 1.00 35.26  ?  102  ASP A CA    1 
ATOM   205   C  C     . ASP A 1  102  ? 118.084 168.348 172.336 1.00 35.26  ?  102  ASP A C     1 
ATOM   206   O  O     . ASP A 1  102  ? 117.302 167.464 171.989 1.00 35.26  ?  102  ASP A O     1 
ATOM   207   C  CB    . ASP A 1  102  ? 118.125 170.438 170.974 1.00 35.26  ?  102  ASP A CB    1 
ATOM   208   C  CG    . ASP A 1  102  ? 118.321 171.510 172.013 1.00 35.26  ?  102  ASP A CG    1 
ATOM   209   O  OD1   . ASP A 1  102  ? 119.483 171.882 172.264 1.00 35.26  ?  102  ASP A OD1   1 
ATOM   210   O  OD2   . ASP A 1  102  ? 117.316 171.981 172.579 1.00 35.26  -1 102  ASP A OD2   1 
ATOM   211   N  N     . HIS A 1  103  ? 118.310 168.678 173.597 1.00 41.92  ?  103  HIS A N     1 
ATOM   212   C  CA    . HIS A 1  103  ? 117.593 168.153 174.744 1.00 41.92  ?  103  HIS A CA    1 
ATOM   213   C  C     . HIS A 1  103  ? 116.563 169.166 175.208 1.00 41.92  ?  103  HIS A C     1 
ATOM   214   O  O     . HIS A 1  103  ? 116.791 170.371 175.116 1.00 41.92  ?  103  HIS A O     1 
ATOM   215   C  CB    . HIS A 1  103  ? 118.593 167.846 175.865 1.00 41.92  ?  103  HIS A CB    1 
ATOM   216   C  CG    . HIS A 1  103  ? 117.954 167.569 177.179 1.00 41.92  ?  103  HIS A CG    1 
ATOM   217   N  ND1   . HIS A 1  103  ? 117.257 166.419 177.448 1.00 41.92  ?  103  HIS A ND1   1 
ATOM   218   C  CD2   . HIS A 1  103  ? 117.896 168.317 178.304 1.00 41.92  ?  103  HIS A CD2   1 
ATOM   219   C  CE1   . HIS A 1  103  ? 116.798 166.466 178.684 1.00 41.92  ?  103  HIS A CE1   1 
ATOM   220   N  NE2   . HIS A 1  103  ? 117.171 167.610 179.227 1.00 41.92  ?  103  HIS A NE2   1 
ATOM   221   N  N     . TYR A 1  104  ? 115.427 168.676 175.701 1.00 46.88  ?  104  TYR A N     1 
ATOM   222   C  CA    . TYR A 1  104  ? 114.315 169.550 176.047 1.00 46.88  ?  104  TYR A CA    1 
ATOM   223   C  C     . TYR A 1  104  ? 113.420 168.860 177.066 1.00 46.88  ?  104  TYR A C     1 
ATOM   224   O  O     . TYR A 1  104  ? 112.962 167.739 176.827 1.00 46.88  ?  104  TYR A O     1 
ATOM   225   C  CB    . TYR A 1  104  ? 113.535 169.910 174.778 1.00 46.88  ?  104  TYR A CB    1 
ATOM   226   C  CG    . TYR A 1  104  ? 112.331 170.779 174.991 1.00 46.88  ?  104  TYR A CG    1 
ATOM   227   C  CD1   . TYR A 1  104  ? 112.393 171.874 175.833 1.00 46.88  ?  104  TYR A CD1   1 
ATOM   228   C  CD2   . TYR A 1  104  ? 111.146 170.532 174.314 1.00 46.88  ?  104  TYR A CD2   1 
ATOM   229   C  CE1   . TYR A 1  104  ? 111.299 172.680 176.024 1.00 46.88  ?  104  TYR A CE1   1 
ATOM   230   C  CE2   . TYR A 1  104  ? 110.044 171.328 174.495 1.00 46.88  ?  104  TYR A CE2   1 
ATOM   231   C  CZ    . TYR A 1  104  ? 110.125 172.408 175.351 1.00 46.88  ?  104  TYR A CZ    1 
ATOM   232   O  OH    . TYR A 1  104  ? 109.035 173.223 175.549 1.00 46.88  ?  104  TYR A OH    1 
ATOM   233   N  N     . VAL A 1  105  ? 113.172 169.522 178.194 1.00 53.61  ?  105  VAL A N     1 
ATOM   234   C  CA    . VAL A 1  105  ? 112.297 169.007 179.246 1.00 53.61  ?  105  VAL A CA    1 
ATOM   235   C  C     . VAL A 1  105  ? 110.909 169.597 179.053 1.00 53.61  ?  105  VAL A C     1 
ATOM   236   O  O     . VAL A 1  105  ? 110.735 170.819 179.108 1.00 53.61  ?  105  VAL A O     1 
ATOM   237   C  CB    . VAL A 1  105  ? 112.840 169.330 180.646 1.00 53.61  ?  105  VAL A CB    1 
ATOM   238   C  CG1   . VAL A 1  105  ? 111.825 168.961 181.685 1.00 53.61  ?  105  VAL A CG1   1 
ATOM   239   C  CG2   . VAL A 1  105  ? 114.106 168.557 180.906 1.00 53.61  ?  105  VAL A CG2   1 
ATOM   240   N  N     . GLY A 1  106  ? 109.917 168.734 178.866 1.00 80.08  ?  106  GLY A N     1 
ATOM   241   C  CA    . GLY A 1  106  ? 108.693 169.153 178.236 1.00 80.08  ?  106  GLY A CA    1 
ATOM   242   C  C     . GLY A 1  106  ? 107.384 168.739 178.874 1.00 80.08  ?  106  GLY A C     1 
ATOM   243   O  O     . GLY A 1  106  ? 107.226 167.644 179.419 1.00 80.08  ?  106  GLY A O     1 
ATOM   244   N  N     . PRO A 1  107  ? 106.410 169.644 178.806 1.00 107.77 ?  107  PRO A N     1 
ATOM   245   C  CA    . PRO A 1  107  ? 105.005 169.272 179.007 1.00 107.77 ?  107  PRO A CA    1 
ATOM   246   C  C     . PRO A 1  107  ? 104.375 168.733 177.727 1.00 107.77 ?  107  PRO A C     1 
ATOM   247   O  O     . PRO A 1  107  ? 105.098 168.331 176.806 1.00 107.77 ?  107  PRO A O     1 
ATOM   248   C  CB    . PRO A 1  107  ? 104.349 170.583 179.456 1.00 107.77 ?  107  PRO A CB    1 
ATOM   249   C  CG    . PRO A 1  107  ? 105.282 171.683 179.011 1.00 107.77 ?  107  PRO A CG    1 
ATOM   250   C  CD    . PRO A 1  107  ? 106.565 171.078 178.510 1.00 107.77 ?  107  PRO A CD    1 
ATOM   251   N  N     . ALA A 1  108  ? 103.035 168.648 177.718 1.00 125.41 ?  108  ALA A N     1 
ATOM   252   C  CA    . ALA A 1  108  ? 102.219 168.231 176.564 1.00 125.41 ?  108  ALA A CA    1 
ATOM   253   C  C     . ALA A 1  108  ? 102.506 166.786 176.177 1.00 125.41 ?  108  ALA A C     1 
ATOM   254   O  O     . ALA A 1  108  ? 102.588 166.443 174.993 1.00 125.41 ?  108  ALA A O     1 
ATOM   255   C  CB    . ALA A 1  108  ? 102.381 169.167 175.357 1.00 125.41 ?  108  ALA A CB    1 
ATOM   256   N  N     . GLN A 1  109  ? 102.651 165.955 177.200 1.00 124.11 ?  109  GLN A N     1 
ATOM   257   C  CA    . GLN A 1  109  ? 102.963 164.547 177.054 1.00 124.11 ?  109  GLN A CA    1 
ATOM   258   C  C     . GLN A 1  109  ? 101.805 163.810 176.379 1.00 124.11 ?  109  GLN A C     1 
ATOM   259   O  O     . GLN A 1  109  ? 100.652 164.239 176.473 1.00 124.11 ?  109  GLN A O     1 
ATOM   260   C  CB    . GLN A 1  109  ? 103.242 163.953 178.435 1.00 124.11 ?  109  GLN A CB    1 
ATOM   261   C  CG    . GLN A 1  109  ? 104.486 164.499 179.131 1.00 124.11 ?  109  GLN A CG    1 
ATOM   262   C  CD    . GLN A 1  109  ? 104.257 165.806 179.876 1.00 124.11 ?  109  GLN A CD    1 
ATOM   263   O  OE1   . GLN A 1  109  ? 103.253 166.487 179.677 1.00 124.11 ?  109  GLN A OE1   1 
ATOM   264   N  NE2   . GLN A 1  109  ? 105.196 166.159 180.739 1.00 124.11 ?  109  GLN A NE2   1 
ATOM   265   N  N     . PRO A 1  110  ? 102.082 162.711 175.675 1.00 133.09 ?  110  PRO A N     1 
ATOM   266   C  CA    . PRO A 1  110  ? 100.988 161.938 175.079 1.00 133.09 ?  110  PRO A CA    1 
ATOM   267   C  C     . PRO A 1  110  ? 100.192 161.185 176.136 1.00 133.09 ?  110  PRO A C     1 
ATOM   268   O  O     . PRO A 1  110  ? 100.749 160.572 177.050 1.00 133.09 ?  110  PRO A O     1 
ATOM   269   C  CB    . PRO A 1  110  ? 101.710 160.973 174.131 1.00 133.09 ?  110  PRO A CB    1 
ATOM   270   C  CG    . PRO A 1  110  ? 103.074 160.837 174.704 1.00 133.09 ?  110  PRO A CG    1 
ATOM   271   C  CD    . PRO A 1  110  ? 103.403 162.154 175.322 1.00 133.09 ?  110  PRO A CD    1 
ATOM   272   N  N     . VAL A 1  111  ? 98.872  161.246 176.007 1.00 138.69 ?  111  VAL A N     1 
ATOM   273   C  CA    . VAL A 1  111  ? 97.982  160.599 176.960 1.00 138.69 ?  111  VAL A CA    1 
ATOM   274   C  C     . VAL A 1  111  ? 97.251  159.439 176.296 1.00 138.69 ?  111  VAL A C     1 
ATOM   275   O  O     . VAL A 1  111  ? 97.869  158.581 175.668 1.00 138.69 ?  111  VAL A O     1 
ATOM   276   C  CB    . VAL A 1  111  ? 96.983  161.603 177.559 1.00 138.69 ?  111  VAL A CB    1 
ATOM   277   C  CG1   . VAL A 1  111  ? 97.710  162.622 178.424 1.00 138.69 ?  111  VAL A CG1   1 
ATOM   278   C  CG2   . VAL A 1  111  ? 96.200  162.294 176.453 1.00 138.69 ?  111  VAL A CG2   1 
ATOM   279   N  N     . SER A 1  121  ? 107.922 159.992 178.300 1.00 54.79  ?  121  SER A N     1 
ATOM   280   C  CA    . SER A 1  121  ? 108.764 160.672 179.276 1.00 54.79  ?  121  SER A CA    1 
ATOM   281   C  C     . SER A 1  121  ? 108.737 162.188 179.122 1.00 54.79  ?  121  SER A C     1 
ATOM   282   O  O     . SER A 1  121  ? 108.284 162.724 178.110 1.00 54.79  ?  121  SER A O     1 
ATOM   283   C  CB    . SER A 1  121  ? 110.209 160.173 179.184 1.00 54.79  ?  121  SER A CB    1 
ATOM   284   O  OG    . SER A 1  121  ? 110.321 158.844 179.664 1.00 54.79  ?  121  SER A OG    1 
ATOM   285   N  N     . VAL A 1  122  ? 109.225 162.865 180.156 1.00 52.74  ?  122  VAL A N     1 
ATOM   286   C  CA    . VAL A 1  122  ? 109.361 164.320 180.193 1.00 52.74  ?  122  VAL A CA    1 
ATOM   287   C  C     . VAL A 1  122  ? 110.539 164.828 179.346 1.00 52.74  ?  122  VAL A C     1 
ATOM   288   O  O     . VAL A 1  122  ? 110.393 165.896 178.733 1.00 52.74  ?  122  VAL A O     1 
ATOM   289   C  CB    . VAL A 1  122  ? 109.446 164.810 181.656 1.00 52.74  ?  122  VAL A CB    1 
ATOM   290   C  CG1   . VAL A 1  122  ? 109.185 166.298 181.757 1.00 52.74  ?  122  VAL A CG1   1 
ATOM   291   C  CG2   . VAL A 1  122  ? 108.484 164.039 182.546 1.00 52.74  ?  122  VAL A CG2   1 
ATOM   292   N  N     . PRO A 1  123  ? 111.705 164.167 179.249 1.00 40.87  ?  123  PRO A N     1 
ATOM   293   C  CA    . PRO A 1  123  ? 112.710 164.666 178.291 1.00 40.87  ?  123  PRO A CA    1 
ATOM   294   C  C     . PRO A 1  123  ? 112.398 164.268 176.853 1.00 40.87  ?  123  PRO A C     1 
ATOM   295   O  O     . PRO A 1  123  ? 112.431 163.087 176.498 1.00 40.87  ?  123  PRO A O     1 
ATOM   296   C  CB    . PRO A 1  123  ? 114.013 164.021 178.778 1.00 40.87  ?  123  PRO A CB    1 
ATOM   297   C  CG    . PRO A 1  123  ? 113.615 162.873 179.495 1.00 40.87  ?  123  PRO A CG    1 
ATOM   298   C  CD    . PRO A 1  123  ? 112.380 163.282 180.215 1.00 40.87  ?  123  PRO A CD    1 
ATOM   299   N  N     . VAL A 1  124  ? 112.146 165.265 176.008 1.00 35.82  ?  124  VAL A N     1 
ATOM   300   C  CA    . VAL A 1  124  ? 111.912 165.029 174.591 1.00 35.82  ?  124  VAL A CA    1 
ATOM   301   C  C     . VAL A 1  124  ? 113.042 165.647 173.777 1.00 35.82  ?  124  VAL A C     1 
ATOM   302   O  O     . VAL A 1  124  ? 113.653 166.645 174.171 1.00 35.82  ?  124  VAL A O     1 
ATOM   303   C  CB    . VAL A 1  124  ? 110.537 165.564 174.158 1.00 35.82  ?  124  VAL A CB    1 
ATOM   304   C  CG1   . VAL A 1  124  ? 109.465 164.868 174.954 1.00 35.82  ?  124  VAL A CG1   1 
ATOM   305   C  CG2   . VAL A 1  124  ? 110.441 167.038 174.386 1.00 35.82  ?  124  VAL A CG2   1 
ATOM   306   N  N     . LEU A 1  125  ? 113.332 165.030 172.637 1.00 27.39  ?  125  LEU A N     1 
ATOM   307   C  CA    . LEU A 1  125  ? 114.494 165.359 171.825 1.00 27.39  ?  125  LEU A CA    1 
ATOM   308   C  C     . LEU A 1  125  ? 114.097 166.172 170.600 1.00 27.39  ?  125  LEU A C     1 
ATOM   309   O  O     . LEU A 1  125  ? 113.045 165.950 170.005 1.00 27.39  ?  125  LEU A O     1 
ATOM   310   C  CB    . LEU A 1  125  ? 115.212 164.091 171.379 1.00 27.39  ?  125  LEU A CB    1 
ATOM   311   C  CG    . LEU A 1  125  ? 116.403 163.658 172.216 1.00 27.39  ?  125  LEU A CG    1 
ATOM   312   C  CD1   . LEU A 1  125  ? 115.965 163.066 173.532 1.00 27.39  ?  125  LEU A CD1   1 
ATOM   313   C  CD2   . LEU A 1  125  ? 117.212 162.667 171.424 1.00 27.39  ?  125  LEU A CD2   1 
ATOM   314   N  N     . ARG A 1  126  ? 114.953 167.114 170.219 1.00 28.68  ?  126  ARG A N     1 
ATOM   315   C  CA    . ARG A 1  126  ? 114.755 167.931 169.032 1.00 28.68  ?  126  ARG A CA    1 
ATOM   316   C  C     . ARG A 1  126  ? 115.787 167.537 167.986 1.00 28.68  ?  126  ARG A C     1 
ATOM   317   O  O     . ARG A 1  126  ? 116.921 167.206 168.330 1.00 28.68  ?  126  ARG A O     1 
ATOM   318   C  CB    . ARG A 1  126  ? 114.876 169.409 169.375 1.00 28.68  ?  126  ARG A CB    1 
ATOM   319   C  CG    . ARG A 1  126  ? 113.746 169.914 170.227 1.00 28.68  ?  126  ARG A CG    1 
ATOM   320   C  CD    . ARG A 1  126  ? 113.654 171.431 170.212 1.00 28.68  ?  126  ARG A CD    1 
ATOM   321   N  NE    . ARG A 1  126  ? 114.555 172.046 171.179 1.00 28.68  ?  126  ARG A NE    1 
ATOM   322   C  CZ    . ARG A 1  126  ? 114.183 172.944 172.084 1.00 28.68  ?  126  ARG A CZ    1 
ATOM   323   N  NH1   . ARG A 1  126  ? 112.923 173.341 172.147 1.00 28.68  1  126  ARG A NH1   1 
ATOM   324   N  NH2   . ARG A 1  126  ? 115.071 173.453 172.923 1.00 28.68  ?  126  ARG A NH2   1 
ATOM   325   N  N     . ALA A 1  127  ? 115.397 167.550 166.717 1.00 25.52  ?  127  ALA A N     1 
ATOM   326   C  CA    . ALA A 1  127  ? 116.335 167.295 165.629 1.00 25.52  ?  127  ALA A CA    1 
ATOM   327   C  C     . ALA A 1  127  ? 116.023 168.216 164.466 1.00 25.52  ?  127  ALA A C     1 
ATOM   328   O  O     . ALA A 1  127  ? 114.916 168.185 163.927 1.00 25.52  ?  127  ALA A O     1 
ATOM   329   C  CB    . ALA A 1  127  ? 116.289 165.839 165.171 1.00 25.52  ?  127  ALA A CB    1 
ATOM   330   N  N     . PHE A 1  128  ? 116.995 169.028 164.076 1.00 23.80  ?  128  PHE A N     1 
ATOM   331   C  CA    . PHE A 1  128  ? 116.826 170.034 163.041 1.00 23.80  ?  128  PHE A CA    1 
ATOM   332   C  C     . PHE A 1  128  ? 117.520 169.563 161.773 1.00 23.80  ?  128  PHE A C     1 
ATOM   333   O  O     . PHE A 1  128  ? 118.556 168.906 161.847 1.00 23.80  ?  128  PHE A O     1 
ATOM   334   C  CB    . PHE A 1  128  ? 117.400 171.367 163.497 1.00 23.80  ?  128  PHE A CB    1 
ATOM   335   C  CG    . PHE A 1  128  ? 116.913 171.805 164.838 1.00 23.80  ?  128  PHE A CG    1 
ATOM   336   C  CD1   . PHE A 1  128  ? 115.762 172.542 164.953 1.00 23.80  ?  128  PHE A CD1   1 
ATOM   337   C  CD2   . PHE A 1  128  ? 117.612 171.497 165.987 1.00 23.80  ?  128  PHE A CD2   1 
ATOM   338   C  CE1   . PHE A 1  128  ? 115.313 172.953 166.185 1.00 23.80  ?  128  PHE A CE1   1 
ATOM   339   C  CE2   . PHE A 1  128  ? 117.156 171.905 167.220 1.00 23.80  ?  128  PHE A CE2   1 
ATOM   340   C  CZ    . PHE A 1  128  ? 116.014 172.638 167.313 1.00 23.80  ?  128  PHE A CZ    1 
ATOM   341   N  N     . GLY A 1  129  ? 116.945 169.870 160.614 1.00 26.89  ?  129  GLY A N     1 
ATOM   342   C  CA    . GLY A 1  129  ? 117.536 169.355 159.389 1.00 26.89  ?  129  GLY A CA    1 
ATOM   343   C  C     . GLY A 1  129  ? 116.937 169.981 158.151 1.00 26.89  ?  129  GLY A C     1 
ATOM   344   O  O     . GLY A 1  129  ? 116.076 170.858 158.218 1.00 26.89  ?  129  GLY A O     1 
ATOM   345   N  N     . VAL A 1  130  ? 117.415 169.509 157.002 1.00 24.00  ?  130  VAL A N     1 
ATOM   346   C  CA    . VAL A 1  130  ? 116.973 170.001 155.703 1.00 24.00  ?  130  VAL A CA    1 
ATOM   347   C  C     . VAL A 1  130  ? 116.640 168.838 154.781 1.00 24.00  ?  130  VAL A C     1 
ATOM   348   O  O     . VAL A 1  130  ? 117.271 167.780 154.827 1.00 24.00  ?  130  VAL A O     1 
ATOM   349   C  CB    . VAL A 1  130  ? 118.019 170.918 155.039 1.00 24.00  ?  130  VAL A CB    1 
ATOM   350   C  CG1   . VAL A 1  130  ? 117.997 172.288 155.689 1.00 24.00  ?  130  VAL A CG1   1 
ATOM   351   C  CG2   . VAL A 1  130  ? 119.392 170.300 155.129 1.00 24.00  ?  130  VAL A CG2   1 
ATOM   352   N  N     . THR A 1  131  ? 115.643 169.053 153.930 1.00 28.44  ?  131  THR A N     1 
ATOM   353   C  CA    . THR A 1  131  ? 115.197 168.066 152.957 1.00 28.44  ?  131  THR A CA    1 
ATOM   354   C  C     . THR A 1  131  ? 116.170 167.990 151.784 1.00 28.44  ?  131  THR A C     1 
ATOM   355   O  O     . THR A 1  131  ? 117.122 168.761 151.679 1.00 28.44  ?  131  THR A O     1 
ATOM   356   C  CB    . THR A 1  131  ? 113.802 168.420 152.456 1.00 28.44  ?  131  THR A CB    1 
ATOM   357   O  OG1   . THR A 1  131  ? 113.802 169.779 152.018 1.00 28.44  ?  131  THR A OG1   1 
ATOM   358   C  CG2   . THR A 1  131  ? 112.793 168.271 153.550 1.00 28.44  ?  131  THR A CG2   1 
ATOM   359   N  N     . ASP A 1  132  ? 115.908 167.074 150.856 1.00 34.42  ?  132  ASP A N     1 
ATOM   360   C  CA    . ASP A 1  132  ? 116.706 166.965 149.637 1.00 34.42  ?  132  ASP A CA    1 
ATOM   361   C  C     . ASP A 1  132  ? 116.386 168.064 148.625 1.00 34.42  ?  132  ASP A C     1 
ATOM   362   O  O     . ASP A 1  132  ? 116.965 168.077 147.537 1.00 34.42  ?  132  ASP A O     1 
ATOM   363   C  CB    . ASP A 1  132  ? 116.495 165.584 149.008 1.00 34.42  ?  132  ASP A CB    1 
ATOM   364   C  CG    . ASP A 1  132  ? 117.639 165.155 148.113 1.00 34.42  ?  132  ASP A CG    1 
ATOM   365   O  OD1   . ASP A 1  132  ? 118.710 164.781 148.629 1.00 34.42  ?  132  ASP A OD1   1 
ATOM   366   O  OD2   . ASP A 1  132  ? 117.461 165.181 146.879 1.00 34.42  -1 132  ASP A OD2   1 
ATOM   367   N  N     . GLU A 1  133  ? 115.496 168.988 148.960 1.00 39.16  ?  133  GLU A N     1 
ATOM   368   C  CA    . GLU A 1  133  ? 115.162 170.135 148.132 1.00 39.16  ?  133  GLU A CA    1 
ATOM   369   C  C     . GLU A 1  133  ? 115.573 171.461 148.753 1.00 39.16  ?  133  GLU A C     1 
ATOM   370   O  O     . GLU A 1  133  ? 116.054 172.338 148.037 1.00 39.16  ?  133  GLU A O     1 
ATOM   371   C  CB    . GLU A 1  133  ? 113.657 170.149 147.857 1.00 39.16  ?  133  GLU A CB    1 
ATOM   372   C  CG    . GLU A 1  133  ? 113.253 170.905 146.616 1.00 39.16  ?  133  GLU A CG    1 
ATOM   373   C  CD    . GLU A 1  133  ? 113.035 172.382 146.874 1.00 39.16  ?  133  GLU A CD    1 
ATOM   374   O  OE1   . GLU A 1  133  ? 112.798 172.744 148.042 1.00 39.16  ?  133  GLU A OE1   1 
ATOM   375   O  OE2   . GLU A 1  133  ? 113.119 173.176 145.915 1.00 39.16  -1 133  GLU A OE2   1 
ATOM   376   N  N     . GLY A 1  134  ? 115.413 171.637 150.065 1.00 31.06  ?  134  GLY A N     1 
ATOM   377   C  CA    . GLY A 1  134  ? 115.674 172.928 150.670 1.00 31.06  ?  134  GLY A CA    1 
ATOM   378   C  C     . GLY A 1  134  ? 114.635 173.484 151.625 1.00 31.06  ?  134  GLY A C     1 
ATOM   379   O  O     . GLY A 1  134  ? 114.664 174.675 151.933 1.00 31.06  ?  134  GLY A O     1 
ATOM   380   N  N     . PHE A 1  135  ? 113.716 172.657 152.103 1.00 31.32  ?  135  PHE A N     1 
ATOM   381   C  CA    . PHE A 1  135  ? 112.846 173.056 153.198 1.00 31.32  ?  135  PHE A CA    1 
ATOM   382   C  C     . PHE A 1  135  ? 113.521 172.756 154.534 1.00 31.32  ?  135  PHE A C     1 
ATOM   383   O  O     . PHE A 1  135  ? 114.382 171.881 154.634 1.00 31.32  ?  135  PHE A O     1 
ATOM   384   C  CB    . PHE A 1  135  ? 111.501 172.323 153.128 1.00 31.32  ?  135  PHE A CB    1 
ATOM   385   C  CG    . PHE A 1  135  ? 110.946 172.185 151.745 1.00 31.32  ?  135  PHE A CG    1 
ATOM   386   C  CD1   . PHE A 1  135  ? 110.328 173.249 151.124 1.00 31.32  ?  135  PHE A CD1   1 
ATOM   387   C  CD2   . PHE A 1  135  ? 111.023 170.979 151.072 1.00 31.32  ?  135  PHE A CD2   1 
ATOM   388   C  CE1   . PHE A 1  135  ? 109.820 173.119 149.850 1.00 31.32  ?  135  PHE A CE1   1 
ATOM   389   C  CE2   . PHE A 1  135  ? 110.514 170.845 149.799 1.00 31.32  ?  135  PHE A CE2   1 
ATOM   390   C  CZ    . PHE A 1  135  ? 109.903 171.919 149.193 1.00 31.32  ?  135  PHE A CZ    1 
ATOM   391   N  N     . SER A 1  136  ? 113.114 173.485 155.573 1.00 25.08  ?  136  SER A N     1 
ATOM   392   C  CA    . SER A 1  136  ? 113.667 173.303 156.912 1.00 25.08  ?  136  SER A CA    1 
ATOM   393   C  C     . SER A 1  136  ? 112.706 172.484 157.757 1.00 25.08  ?  136  SER A C     1 
ATOM   394   O  O     . SER A 1  136  ? 111.514 172.788 157.807 1.00 25.08  ?  136  SER A O     1 
ATOM   395   C  CB    . SER A 1  136  ? 113.939 174.642 157.593 1.00 25.08  ?  136  SER A CB    1 
ATOM   396   O  OG    . SER A 1  136  ? 112.809 175.477 157.567 1.00 25.08  ?  136  SER A OG    1 
ATOM   397   N  N     . VAL A 1  137  ? 113.231 171.466 158.435 1.00 28.19  ?  137  VAL A N     1 
ATOM   398   C  CA    . VAL A 1  137  ? 112.432 170.478 159.150 1.00 28.19  ?  137  VAL A CA    1 
ATOM   399   C  C     . VAL A 1  137  ? 112.882 170.416 160.599 1.00 28.19  ?  137  VAL A C     1 
ATOM   400   O  O     . VAL A 1  137  ? 114.054 170.145 160.874 1.00 28.19  ?  137  VAL A O     1 
ATOM   401   C  CB    . VAL A 1  137  ? 112.564 169.083 158.515 1.00 28.19  ?  137  VAL A CB    1 
ATOM   402   C  CG1   . VAL A 1  137  ? 111.844 168.050 159.342 1.00 28.19  ?  137  VAL A CG1   1 
ATOM   403   C  CG2   . VAL A 1  137  ? 112.046 169.090 157.111 1.00 28.19  ?  137  VAL A CG2   1 
ATOM   404   N  N     . CYS A 1  138  ? 111.954 170.641 161.524 1.00 25.76  ?  138  CYS A N     1 
ATOM   405   C  CA    . CYS A 1  138  ? 112.157 170.303 162.926 1.00 25.76  ?  138  CYS A CA    1 
ATOM   406   C  C     . CYS A 1  138  ? 111.440 168.994 163.234 1.00 25.76  ?  138  CYS A C     1 
ATOM   407   O  O     . CYS A 1  138  ? 110.367 168.727 162.696 1.00 25.76  ?  138  CYS A O     1 
ATOM   408   C  CB    . CYS A 1  138  ? 111.648 171.404 163.847 1.00 25.76  ?  138  CYS A CB    1 
ATOM   409   S  SG    . CYS A 1  138  ? 111.881 171.022 165.582 1.00 25.76  ?  138  CYS A SG    1 
ATOM   410   N  N     . CYS A 1  139  ? 112.041 168.172 164.085 1.00 28.91  ?  139  CYS A N     1 
ATOM   411   C  CA    . CYS A 1  139  ? 111.480 166.877 164.431 1.00 28.91  ?  139  CYS A CA    1 
ATOM   412   C  C     . CYS A 1  139  ? 111.509 166.708 165.939 1.00 28.91  ?  139  CYS A C     1 
ATOM   413   O  O     . CYS A 1  139  ? 112.570 166.831 166.555 1.00 28.91  ?  139  CYS A O     1 
ATOM   414   C  CB    . CYS A 1  139  ? 112.257 165.750 163.753 1.00 28.91  ?  139  CYS A CB    1 
ATOM   415   S  SG    . CYS A 1  139  ? 111.461 164.143 163.820 1.00 28.91  ?  139  CYS A SG    1 
ATOM   416   N  N     . HIS A 1  140  ? 110.350 166.422 166.527 1.00 30.45  ?  140  HIS A N     1 
ATOM   417   C  CA    . HIS A 1  140  ? 110.221 166.192 167.962 1.00 30.45  ?  140  HIS A CA    1 
ATOM   418   C  C     . HIS A 1  140  ? 110.135 164.692 168.212 1.00 30.45  ?  140  HIS A C     1 
ATOM   419   O  O     . HIS A 1  140  ? 109.275 164.013 167.646 1.00 30.45  ?  140  HIS A O     1 
ATOM   420   C  CB    . HIS A 1  140  ? 108.993 166.905 168.506 1.00 30.45  ?  140  HIS A CB    1 
ATOM   421   C  CG    . HIS A 1  140  ? 109.151 168.383 168.602 1.00 30.45  ?  140  HIS A CG    1 
ATOM   422   N  ND1   . HIS A 1  140  ? 109.615 169.008 169.736 1.00 30.45  ?  140  HIS A ND1   1 
ATOM   423   C  CD2   . HIS A 1  140  ? 108.894 169.364 167.709 1.00 30.45  ?  140  HIS A CD2   1 
ATOM   424   C  CE1   . HIS A 1  140  ? 109.643 170.312 169.537 1.00 30.45  ?  140  HIS A CE1   1 
ATOM   425   N  NE2   . HIS A 1  140  ? 109.211 170.554 168.314 1.00 30.45  ?  140  HIS A NE2   1 
ATOM   426   N  N     . ILE A 1  141  ? 111.020 164.174 169.058 1.00 28.51  ?  141  ILE A N     1 
ATOM   427   C  CA    . ILE A 1  141  ? 111.142 162.746 169.325 1.00 28.51  ?  141  ILE A CA    1 
ATOM   428   C  C     . ILE A 1  141  ? 110.799 162.496 170.792 1.00 28.51  ?  141  ILE A C     1 
ATOM   429   O  O     . ILE A 1  141  ? 111.259 163.232 171.672 1.00 28.51  ?  141  ILE A O     1 
ATOM   430   C  CB    . ILE A 1  141  ? 112.556 162.250 168.980 1.00 28.51  ?  141  ILE A CB    1 
ATOM   431   C  CG1   . ILE A 1  141  ? 112.913 162.637 167.543 1.00 28.51  ?  141  ILE A CG1   1 
ATOM   432   C  CG2   . ILE A 1  141  ? 112.664 160.781 169.157 1.00 28.51  ?  141  ILE A CG2   1 
ATOM   433   C  CD1   . ILE A 1  141  ? 114.135 161.947 166.967 1.00 28.51  ?  141  ILE A CD1   1 
ATOM   434   N  N     . HIS A 1  142  ? 109.984 161.468 171.057 1.00 32.55  ?  142  HIS A N     1 
ATOM   435   C  CA    . HIS A 1  142  ? 109.394 161.240 172.372 1.00 32.55  ?  142  HIS A CA    1 
ATOM   436   C  C     . HIS A 1  142  ? 109.682 159.840 172.894 1.00 32.55  ?  142  HIS A C     1 
ATOM   437   O  O     . HIS A 1  142  ? 109.823 158.888 172.122 1.00 32.55  ?  142  HIS A O     1 
ATOM   438   C  CB    . HIS A 1  142  ? 107.883 161.421 172.338 1.00 32.55  ?  142  HIS A CB    1 
ATOM   439   C  CG    . HIS A 1  142  ? 107.443 162.773 171.887 1.00 32.55  ?  142  HIS A CG    1 
ATOM   440   N  ND1   . HIS A 1  142  ? 107.123 163.783 172.765 1.00 32.55  ?  142  HIS A ND1   1 
ATOM   441   C  CD2   . HIS A 1  142  ? 107.261 163.280 170.649 1.00 32.55  ?  142  HIS A CD2   1 
ATOM   442   C  CE1   . HIS A 1  142  ? 106.775 164.861 172.086 1.00 32.55  ?  142  HIS A CE1   1 
ATOM   443   N  NE2   . HIS A 1  142  ? 106.846 164.579 170.800 1.00 32.55  ?  142  HIS A NE2   1 
ATOM   444   N  N     . GLY A 1  143  ? 109.758 159.726 174.216 1.00 35.02  ?  143  GLY A N     1 
ATOM   445   C  CA    . GLY A 1  143  ? 109.732 158.449 174.893 1.00 35.02  ?  143  GLY A CA    1 
ATOM   446   C  C     . GLY A 1  143  ? 111.064 157.841 175.275 1.00 35.02  ?  143  GLY A C     1 
ATOM   447   O  O     . GLY A 1  143  ? 111.155 156.613 175.369 1.00 35.02  ?  143  GLY A O     1 
ATOM   448   N  N     . PHE A 1  144  ? 112.086 158.650 175.529 1.00 32.70  ?  144  PHE A N     1 
ATOM   449   C  CA    . PHE A 1  144  ? 113.430 158.160 175.794 1.00 32.70  ?  144  PHE A CA    1 
ATOM   450   C  C     . PHE A 1  144  ? 113.909 158.693 177.135 1.00 32.70  ?  144  PHE A C     1 
ATOM   451   O  O     . PHE A 1  144  ? 113.681 159.861 177.464 1.00 32.70  ?  144  PHE A O     1 
ATOM   452   C  CB    . PHE A 1  144  ? 114.388 158.578 174.678 1.00 32.70  ?  144  PHE A CB    1 
ATOM   453   C  CG    . PHE A 1  144  ? 115.690 157.827 174.676 1.00 32.70  ?  144  PHE A CG    1 
ATOM   454   C  CD1   . PHE A 1  144  ? 115.755 156.525 174.230 1.00 32.70  ?  144  PHE A CD1   1 
ATOM   455   C  CD2   . PHE A 1  144  ? 116.855 158.442 175.103 1.00 32.70  ?  144  PHE A CD2   1 
ATOM   456   C  CE1   . PHE A 1  144  ? 116.953 155.849 174.223 1.00 32.70  ?  144  PHE A CE1   1 
ATOM   457   C  CE2   . PHE A 1  144  ? 118.044 157.773 175.100 1.00 32.70  ?  144  PHE A CE2   1 
ATOM   458   C  CZ    . PHE A 1  144  ? 118.091 156.473 174.665 1.00 32.70  ?  144  PHE A CZ    1 
ATOM   459   N  N     . ALA A 1  145  ? 114.573 157.833 177.910 1.00 28.91  ?  145  ALA A N     1 
ATOM   460   C  CA    . ALA A 1  145  ? 115.000 158.177 179.259 1.00 28.91  ?  145  ALA A CA    1 
ATOM   461   C  C     . ALA A 1  145  ? 116.372 157.585 179.546 1.00 28.91  ?  145  ALA A C     1 
ATOM   462   O  O     . ALA A 1  145  ? 116.662 156.461 179.109 1.00 28.91  ?  145  ALA A O     1 
ATOM   463   C  CB    . ALA A 1  145  ? 113.990 157.676 180.296 1.00 28.91  ?  145  ALA A CB    1 
ATOM   464   N  N     . PRO A 1  146  ? 117.231 158.309 180.265 1.00 29.19  ?  146  PRO A N     1 
ATOM   465   C  CA    . PRO A 1  146  ? 118.588 157.816 180.524 1.00 29.19  ?  146  PRO A CA    1 
ATOM   466   C  C     . PRO A 1  146  ? 118.603 156.665 181.510 1.00 29.19  ?  146  PRO A C     1 
ATOM   467   O  O     . PRO A 1  146  ? 117.661 156.444 182.270 1.00 29.19  ?  146  PRO A O     1 
ATOM   468   C  CB    . PRO A 1  146  ? 119.294 159.035 181.114 1.00 29.19  ?  146  PRO A CB    1 
ATOM   469   C  CG    . PRO A 1  146  ? 118.218 159.793 181.721 1.00 29.19  ?  146  PRO A CG    1 
ATOM   470   C  CD    . PRO A 1  146  ? 117.046 159.659 180.814 1.00 29.19  ?  146  PRO A CD    1 
ATOM   471   N  N     . TYR A 1  147  ? 119.712 155.937 181.505 1.00 33.39  ?  147  TYR A N     1 
ATOM   472   C  CA    . TYR A 1  147  ? 119.862 154.780 182.372 1.00 33.39  ?  147  TYR A CA    1 
ATOM   473   C  C     . TYR A 1  147  ? 121.347 154.547 182.608 1.00 33.39  ?  147  TYR A C     1 
ATOM   474   O  O     . TYR A 1  147  ? 122.196 155.206 182.005 1.00 33.39  ?  147  TYR A O     1 
ATOM   475   C  CB    . TYR A 1  147  ? 119.175 153.555 181.760 1.00 33.39  ?  147  TYR A CB    1 
ATOM   476   C  CG    . TYR A 1  147  ? 119.689 153.108 180.413 1.00 33.39  ?  147  TYR A CG    1 
ATOM   477   C  CD1   . TYR A 1  147  ? 119.125 153.586 179.240 1.00 33.39  ?  147  TYR A CD1   1 
ATOM   478   C  CD2   . TYR A 1  147  ? 120.715 152.178 180.313 1.00 33.39  ?  147  TYR A CD2   1 
ATOM   479   C  CE1   . TYR A 1  147  ? 119.588 153.168 178.009 1.00 33.39  ?  147  TYR A CE1   1 
ATOM   480   C  CE2   . TYR A 1  147  ? 121.185 151.765 179.090 1.00 33.39  ?  147  TYR A CE2   1 
ATOM   481   C  CZ    . TYR A 1  147  ? 120.619 152.251 177.946 1.00 33.39  ?  147  TYR A CZ    1 
ATOM   482   O  OH    . TYR A 1  147  ? 121.100 151.814 176.738 1.00 33.39  ?  147  TYR A OH    1 
ATOM   483   N  N     . PHE A 1  148  ? 121.657 153.610 183.503 1.00 35.64  ?  148  PHE A N     1 
ATOM   484   C  CA    . PHE A 1  148  ? 122.990 153.002 183.563 1.00 35.64  ?  148  PHE A CA    1 
ATOM   485   C  C     . PHE A 1  148  ? 122.869 151.602 184.157 1.00 35.64  ?  148  PHE A C     1 
ATOM   486   O  O     . PHE A 1  148  ? 121.768 151.057 184.290 1.00 35.64  ?  148  PHE A O     1 
ATOM   487   C  CB    . PHE A 1  148  ? 123.998 153.870 184.330 1.00 35.64  ?  148  PHE A CB    1 
ATOM   488   C  CG    . PHE A 1  148  ? 123.666 154.099 185.765 1.00 35.64  ?  148  PHE A CG    1 
ATOM   489   C  CD1   . PHE A 1  148  ? 122.797 155.109 186.136 1.00 35.64  ?  148  PHE A CD1   1 
ATOM   490   C  CD2   . PHE A 1  148  ? 124.273 153.351 186.755 1.00 35.64  ?  148  PHE A CD2   1 
ATOM   491   C  CE1   . PHE A 1  148  ? 122.507 155.341 187.470 1.00 35.64  ?  148  PHE A CE1   1 
ATOM   492   C  CE2   . PHE A 1  148  ? 123.990 153.575 188.086 1.00 35.64  ?  148  PHE A CE2   1 
ATOM   493   C  CZ    . PHE A 1  148  ? 123.104 154.573 188.441 1.00 35.64  ?  148  PHE A CZ    1 
ATOM   494   N  N     . TYR A 1  149  ? 124.005 151.004 184.485 1.00 40.69  ?  149  TYR A N     1 
ATOM   495   C  CA    . TYR A 1  149  ? 124.060 149.633 184.960 1.00 40.69  ?  149  TYR A CA    1 
ATOM   496   C  C     . TYR A 1  149  ? 124.863 149.571 186.247 1.00 40.69  ?  149  TYR A C     1 
ATOM   497   O  O     . TYR A 1  149  ? 125.632 150.480 186.565 1.00 40.69  ?  149  TYR A O     1 
ATOM   498   C  CB    . TYR A 1  149  ? 124.686 148.704 183.919 1.00 40.69  ?  149  TYR A CB    1 
ATOM   499   C  CG    . TYR A 1  149  ? 123.885 148.497 182.654 1.00 40.69  ?  149  TYR A CG    1 
ATOM   500   C  CD1   . TYR A 1  149  ? 123.826 149.474 181.671 1.00 40.69  ?  149  TYR A CD1   1 
ATOM   501   C  CD2   . TYR A 1  149  ? 123.220 147.303 182.424 1.00 40.69  ?  149  TYR A CD2   1 
ATOM   502   C  CE1   . TYR A 1  149  ? 123.115 149.282 180.517 1.00 40.69  ?  149  TYR A CE1   1 
ATOM   503   C  CE2   . TYR A 1  149  ? 122.502 147.102 181.261 1.00 40.69  ?  149  TYR A CE2   1 
ATOM   504   C  CZ    . TYR A 1  149  ? 122.456 148.098 180.310 1.00 40.69  ?  149  TYR A CZ    1 
ATOM   505   O  OH    . TYR A 1  149  ? 121.748 147.909 179.149 1.00 40.69  ?  149  TYR A OH    1 
ATOM   506   N  N     . THR A 1  150  ? 124.679 148.484 186.993 1.00 47.96  ?  150  THR A N     1 
ATOM   507   C  CA    . THR A 1  150  ? 125.343 148.245 188.277 1.00 47.96  ?  150  THR A CA    1 
ATOM   508   C  C     . THR A 1  150  ? 125.248 146.752 188.565 1.00 47.96  ?  150  THR A C     1 
ATOM   509   O  O     . THR A 1  150  ? 124.210 146.164 188.272 1.00 47.96  ?  150  THR A O     1 
ATOM   510   C  CB    . THR A 1  150  ? 124.679 149.081 189.383 1.00 47.96  ?  150  THR A CB    1 
ATOM   511   O  OG1   . THR A 1  150  ? 124.928 150.473 189.155 1.00 47.96  ?  150  THR A OG1   1 
ATOM   512   C  CG2   . THR A 1  150  ? 125.186 148.727 190.742 1.00 47.96  ?  150  THR A CG2   1 
ATOM   513   N  N     . PRO A 1  151  ? 126.287 146.085 189.070 1.00 55.15  ?  151  PRO A N     1 
ATOM   514   C  CA    . PRO A 1  151  ? 126.155 144.651 189.365 1.00 55.15  ?  151  PRO A CA    1 
ATOM   515   C  C     . PRO A 1  151  ? 125.184 144.373 190.508 1.00 55.15  ?  151  PRO A C     1 
ATOM   516   O  O     . PRO A 1  151  ? 125.060 145.148 191.459 1.00 55.15  ?  151  PRO A O     1 
ATOM   517   C  CB    . PRO A 1  151  ? 127.581 144.225 189.740 1.00 55.15  ?  151  PRO A CB    1 
ATOM   518   C  CG    . PRO A 1  151  ? 128.452 145.252 189.173 1.00 55.15  ?  151  PRO A CG    1 
ATOM   519   C  CD    . PRO A 1  151  ? 127.684 146.535 189.171 1.00 55.15  ?  151  PRO A CD    1 
ATOM   520   N  N     . ALA A 1  152  ? 124.470 143.259 190.376 1.00 66.17  ?  152  ALA A N     1 
ATOM   521   C  CA    . ALA A 1  152  ? 123.583 142.778 191.428 1.00 66.17  ?  152  ALA A CA    1 
ATOM   522   C  C     . ALA A 1  152  ? 124.401 142.057 192.491 1.00 66.17  ?  152  ALA A C     1 
ATOM   523   O  O     . ALA A 1  152  ? 125.057 141.058 192.173 1.00 66.17  ?  152  ALA A O     1 
ATOM   524   C  CB    . ALA A 1  152  ? 122.533 141.838 190.855 1.00 66.17  ?  152  ALA A CB    1 
ATOM   525   N  N     . PRO A 1  153  ? 124.407 142.531 193.742 1.00 81.74  ?  153  PRO A N     1 
ATOM   526   C  CA    . PRO A 1  153  ? 125.292 141.941 194.747 1.00 81.74  ?  153  PRO A CA    1 
ATOM   527   C  C     . PRO A 1  153  ? 124.836 140.554 195.147 1.00 81.74  ?  153  PRO A C     1 
ATOM   528   O  O     . PRO A 1  153  ? 123.628 140.256 195.148 1.00 81.74  ?  153  PRO A O     1 
ATOM   529   C  CB    . PRO A 1  153  ? 125.189 142.925 195.928 1.00 81.74  ?  153  PRO A CB    1 
ATOM   530   C  CG    . PRO A 1  153  ? 124.732 144.191 195.326 1.00 81.74  ?  153  PRO A CG    1 
ATOM   531   C  CD    . PRO A 1  153  ? 123.847 143.813 194.191 1.00 81.74  ?  153  PRO A CD    1 
ATOM   532   N  N     . PRO A 1  154  ? 125.768 139.660 195.499 1.00 93.92  ?  154  PRO A N     1 
ATOM   533   C  CA    . PRO A 1  154  ? 125.386 138.284 195.845 1.00 93.92  ?  154  PRO A CA    1 
ATOM   534   C  C     . PRO A 1  154  ? 124.762 138.160 197.227 1.00 93.92  ?  154  PRO A C     1 
ATOM   535   O  O     . PRO A 1  154  ? 125.416 137.750 198.190 1.00 93.92  ?  154  PRO A O     1 
ATOM   536   C  CB    . PRO A 1  154  ? 126.715 137.523 195.756 1.00 93.92  ?  154  PRO A CB    1 
ATOM   537   C  CG    . PRO A 1  154  ? 127.755 138.555 196.025 1.00 93.92  ?  154  PRO A CG    1 
ATOM   538   C  CD    . PRO A 1  154  ? 127.229 139.839 195.459 1.00 93.92  ?  154  PRO A CD    1 
ATOM   539   N  N     . GLY A 1  155  ? 123.486 138.514 197.322 1.00 94.66  ?  155  GLY A N     1 
ATOM   540   C  CA    . GLY A 1  155  ? 122.709 138.311 198.527 1.00 94.66  ?  155  GLY A CA    1 
ATOM   541   C  C     . GLY A 1  155  ? 121.339 137.787 198.166 1.00 94.66  ?  155  GLY A C     1 
ATOM   542   O  O     . GLY A 1  155  ? 121.106 137.401 197.015 1.00 94.66  ?  155  GLY A O     1 
ATOM   543   N  N     . PHE A 1  156  ? 120.418 137.767 199.122 1.00 103.29 ?  156  PHE A N     1 
ATOM   544   C  CA    . PHE A 1  156  ? 119.057 137.328 198.848 1.00 103.29 ?  156  PHE A CA    1 
ATOM   545   C  C     . PHE A 1  156  ? 118.197 138.442 198.274 1.00 103.29 ?  156  PHE A C     1 
ATOM   546   O  O     . PHE A 1  156  ? 117.059 138.192 197.874 1.00 103.29 ?  156  PHE A O     1 
ATOM   547   C  CB    . PHE A 1  156  ? 118.409 136.733 200.114 1.00 103.29 ?  156  PHE A CB    1 
ATOM   548   C  CG    . PHE A 1  156  ? 118.056 137.743 201.183 1.00 103.29 ?  156  PHE A CG    1 
ATOM   549   C  CD1   . PHE A 1  156  ? 119.034 138.284 202.010 1.00 103.29 ?  156  PHE A CD1   1 
ATOM   550   C  CD2   . PHE A 1  156  ? 116.734 138.104 201.401 1.00 103.29 ?  156  PHE A CD2   1 
ATOM   551   C  CE1   . PHE A 1  156  ? 118.702 139.198 203.010 1.00 103.29 ?  156  PHE A CE1   1 
ATOM   552   C  CE2   . PHE A 1  156  ? 116.397 139.020 202.398 1.00 103.29 ?  156  PHE A CE2   1 
ATOM   553   C  CZ    . PHE A 1  156  ? 117.384 139.563 203.200 1.00 103.29 ?  156  PHE A CZ    1 
ATOM   554   N  N     . GLY A 1  157  ? 118.727 139.657 198.206 1.00 104.68 ?  157  GLY A N     1 
ATOM   555   C  CA    . GLY A 1  157  ? 117.991 140.776 197.677 1.00 104.68 ?  157  GLY A CA    1 
ATOM   556   C  C     . GLY A 1  157  ? 117.754 140.778 196.176 1.00 104.68 ?  157  GLY A C     1 
ATOM   557   O  O     . GLY A 1  157  ? 116.643 140.496 195.716 1.00 104.68 ?  157  GLY A O     1 
ATOM   558   N  N     . PRO A 1  158  ? 118.811 141.027 195.365 1.00 92.04  ?  158  PRO A N     1 
ATOM   559   C  CA    . PRO A 1  158  ? 118.577 141.431 193.969 1.00 92.04  ?  158  PRO A CA    1 
ATOM   560   C  C     . PRO A 1  158  ? 118.351 140.272 193.017 1.00 92.04  ?  158  PRO A C     1 
ATOM   561   O  O     . PRO A 1  158  ? 118.403 140.446 191.796 1.00 92.04  ?  158  PRO A O     1 
ATOM   562   C  CB    . PRO A 1  158  ? 119.855 142.202 193.615 1.00 92.04  ?  158  PRO A CB    1 
ATOM   563   C  CG    . PRO A 1  158  ? 120.540 142.438 194.912 1.00 92.04  ?  158  PRO A CG    1 
ATOM   564   C  CD    . PRO A 1  158  ? 120.220 141.230 195.714 1.00 92.04  ?  158  PRO A CD    1 
ATOM   565   N  N     . GLU A 1  159  ? 118.115 139.084 193.565 1.00 98.64  ?  159  GLU A N     1 
ATOM   566   C  CA    . GLU A 1  159  ? 117.578 137.963 192.815 1.00 98.64  ?  159  GLU A CA    1 
ATOM   567   C  C     . GLU A 1  159  ? 116.142 137.658 193.212 1.00 98.64  ?  159  GLU A C     1 
ATOM   568   O  O     . GLU A 1  159  ? 115.580 136.662 192.749 1.00 98.64  ?  159  GLU A O     1 
ATOM   569   C  CB    . GLU A 1  159  ? 118.457 136.723 193.009 1.00 98.64  ?  159  GLU A CB    1 
ATOM   570   C  CG    . GLU A 1  159  ? 119.791 136.772 192.272 1.00 98.64  ?  159  GLU A CG    1 
ATOM   571   C  CD    . GLU A 1  159  ? 120.911 137.390 193.095 1.00 98.64  ?  159  GLU A CD    1 
ATOM   572   O  OE1   . GLU A 1  159  ? 120.623 137.990 194.154 1.00 98.64  ?  159  GLU A OE1   1 
ATOM   573   O  OE2   . GLU A 1  159  ? 122.084 137.267 192.685 1.00 98.64  -1 159  GLU A OE2   1 
ATOM   574   N  N     . HIS A 1  160  ? 115.548 138.484 194.068 1.00 113.30 ?  160  HIS A N     1 
ATOM   575   C  CA    . HIS A 1  160  ? 114.189 138.309 194.560 1.00 113.30 ?  160  HIS A CA    1 
ATOM   576   C  C     . HIS A 1  160  ? 113.382 139.544 194.188 1.00 113.30 ?  160  HIS A C     1 
ATOM   577   O  O     . HIS A 1  160  ? 113.829 140.672 194.429 1.00 113.30 ?  160  HIS A O     1 
ATOM   578   C  CB    . HIS A 1  160  ? 114.194 138.087 196.076 1.00 113.30 ?  160  HIS A CB    1 
ATOM   579   C  CG    . HIS A 1  160  ? 112.839 138.113 196.711 1.00 113.30 ?  160  HIS A CG    1 
ATOM   580   N  ND1   . HIS A 1  160  ? 112.631 138.589 197.987 1.00 113.30 ?  160  HIS A ND1   1 
ATOM   581   C  CD2   . HIS A 1  160  ? 111.631 137.692 196.267 1.00 113.30 ?  160  HIS A CD2   1 
ATOM   582   C  CE1   . HIS A 1  160  ? 111.351 138.482 198.294 1.00 113.30 ?  160  HIS A CE1   1 
ATOM   583   N  NE2   . HIS A 1  160  ? 110.722 137.942 197.266 1.00 113.30 ?  160  HIS A NE2   1 
ATOM   584   N  N     . MET A 1  161  ? 112.196 139.326 193.610 1.00 119.06 ?  161  MET A N     1 
ATOM   585   C  CA    . MET A 1  161  ? 111.436 140.416 193.005 1.00 119.06 ?  161  MET A CA    1 
ATOM   586   C  C     . MET A 1  161  ? 110.915 141.390 194.048 1.00 119.06 ?  161  MET A C     1 
ATOM   587   O  O     . MET A 1  161  ? 110.725 142.580 193.746 1.00 119.06 ?  161  MET A O     1 
ATOM   588   C  CB    . MET A 1  161  ? 110.265 139.868 192.186 1.00 119.06 ?  161  MET A CB    1 
ATOM   589   C  CG    . MET A 1  161  ? 110.527 138.624 191.319 1.00 119.06 ?  161  MET A CG    1 
ATOM   590   S  SD    . MET A 1  161  ? 111.836 138.740 190.077 1.00 119.06 ?  161  MET A SD    1 
ATOM   591   C  CE    . MET A 1  161  ? 113.176 137.820 190.830 1.00 119.06 ?  161  MET A CE    1 
ATOM   592   N  N     . GLY A 1  162  ? 110.674 140.901 195.269 1.00 115.97 ?  162  GLY A N     1 
ATOM   593   C  CA    . GLY A 1  162  ? 110.268 141.779 196.352 1.00 115.97 ?  162  GLY A CA    1 
ATOM   594   C  C     . GLY A 1  162  ? 111.318 142.825 196.658 1.00 115.97 ?  162  GLY A C     1 
ATOM   595   O  O     . GLY A 1  162  ? 111.009 144.007 196.810 1.00 115.97 ?  162  GLY A O     1 
ATOM   596   N  N     . ASP A 1  163  ? 112.586 142.420 196.646 1.00 103.88 ?  163  ASP A N     1 
ATOM   597   C  CA    . ASP A 1  163  ? 113.660 143.377 196.872 1.00 103.88 ?  163  ASP A CA    1 
ATOM   598   C  C     . ASP A 1  163  ? 113.992 144.196 195.631 1.00 103.88 ?  163  ASP A C     1 
ATOM   599   O  O     . ASP A 1  163  ? 114.517 145.301 195.776 1.00 103.88 ?  163  ASP A O     1 
ATOM   600   C  CB    . ASP A 1  163  ? 114.902 142.655 197.377 1.00 103.88 ?  163  ASP A CB    1 
ATOM   601   C  CG    . ASP A 1  163  ? 115.923 143.597 197.989 1.00 103.88 ?  163  ASP A CG    1 
ATOM   602   O  OD1   . ASP A 1  163  ? 116.730 144.173 197.234 1.00 103.88 ?  163  ASP A OD1   1 
ATOM   603   O  OD2   . ASP A 1  163  ? 115.918 143.752 199.225 1.00 103.88 -1 163  ASP A OD2   1 
ATOM   604   N  N     . LEU A 1  164  ? 113.675 143.711 194.427 1.00 96.68  ?  164  LEU A N     1 
ATOM   605   C  CA    . LEU A 1  164  ? 113.798 144.554 193.238 1.00 96.68  ?  164  LEU A CA    1 
ATOM   606   C  C     . LEU A 1  164  ? 112.837 145.734 193.309 1.00 96.68  ?  164  LEU A C     1 
ATOM   607   O  O     . LEU A 1  164  ? 113.241 146.905 193.190 1.00 96.68  ?  164  LEU A O     1 
ATOM   608   C  CB    . LEU A 1  164  ? 113.527 143.741 191.974 1.00 96.68  ?  164  LEU A CB    1 
ATOM   609   C  CG    . LEU A 1  164  ? 114.364 142.500 191.668 1.00 96.68  ?  164  LEU A CG    1 
ATOM   610   C  CD1   . LEU A 1  164  ? 113.962 141.931 190.316 1.00 96.68  ?  164  LEU A CD1   1 
ATOM   611   C  CD2   . LEU A 1  164  ? 115.853 142.797 191.722 1.00 96.68  ?  164  LEU A CD2   1 
ATOM   612   N  N     . GLN A 1  165  ? 111.553 145.447 193.544 1.00 99.57  ?  165  GLN A N     1 
ATOM   613   C  CA    . GLN A 1  165  ? 110.591 146.532 193.673 1.00 99.57  ?  165  GLN A CA    1 
ATOM   614   C  C     . GLN A 1  165  ? 110.771 147.309 194.971 1.00 99.57  ?  165  GLN A C     1 
ATOM   615   O  O     . GLN A 1  165  ? 110.299 148.445 195.066 1.00 99.57  ?  165  GLN A O     1 
ATOM   616   C  CB    . GLN A 1  165  ? 109.153 146.012 193.563 1.00 99.57  ?  165  GLN A CB    1 
ATOM   617   C  CG    . GLN A 1  165  ? 108.695 145.652 192.141 1.00 99.57  ?  165  GLN A CG    1 
ATOM   618   C  CD    . GLN A 1  165  ? 109.310 144.367 191.605 1.00 99.57  ?  165  GLN A CD    1 
ATOM   619   O  OE1   . GLN A 1  165  ? 110.028 144.376 190.610 1.00 99.57  ?  165  GLN A OE1   1 
ATOM   620   N  NE2   . GLN A 1  165  ? 109.009 143.256 192.256 1.00 99.57  ?  165  GLN A NE2   1 
ATOM   621   N  N     . ARG A 1  166  ? 111.456 146.738 195.963 1.00 99.41  ?  166  ARG A N     1 
ATOM   622   C  CA    . ARG A 1  166  ? 111.816 147.503 197.142 1.00 99.41  ?  166  ARG A CA    1 
ATOM   623   C  C     . ARG A 1  166  ? 113.004 148.421 196.900 1.00 99.41  ?  166  ARG A C     1 
ATOM   624   O  O     . ARG A 1  166  ? 113.132 149.439 197.589 1.00 99.41  ?  166  ARG A O     1 
ATOM   625   C  CB    . ARG A 1  166  ? 112.121 146.563 198.301 1.00 99.41  ?  166  ARG A CB    1 
ATOM   626   C  CG    . ARG A 1  166  ? 110.910 146.233 199.161 1.00 99.41  ?  166  ARG A CG    1 
ATOM   627   C  CD    . ARG A 1  166  ? 111.338 145.625 200.472 1.00 99.41  ?  166  ARG A CD    1 
ATOM   628   N  NE    . ARG A 1  166  ? 111.931 146.633 201.339 1.00 99.41  ?  166  ARG A NE    1 
ATOM   629   C  CZ    . ARG A 1  166  ? 113.232 146.738 201.580 1.00 99.41  ?  166  ARG A CZ    1 
ATOM   630   N  NH1   . ARG A 1  166  ? 114.075 145.899 201.001 1.00 99.41  1  166  ARG A NH1   1 
ATOM   631   N  NH2   . ARG A 1  166  ? 113.684 147.694 202.378 1.00 99.41  ?  166  ARG A NH2   1 
ATOM   632   N  N     . GLU A 1  167  ? 113.887 148.069 195.964 1.00 89.36  ?  167  GLU A N     1 
ATOM   633   C  CA    . GLU A 1  167  ? 114.869 149.028 195.480 1.00 89.36  ?  167  GLU A CA    1 
ATOM   634   C  C     . GLU A 1  167  ? 114.178 150.173 194.760 1.00 89.36  ?  167  GLU A C     1 
ATOM   635   O  O     . GLU A 1  167  ? 114.584 151.334 194.894 1.00 89.36  ?  167  GLU A O     1 
ATOM   636   C  CB    . GLU A 1  167  ? 115.874 148.346 194.558 1.00 89.36  ?  167  GLU A CB    1 
ATOM   637   C  CG    . GLU A 1  167  ? 116.960 147.573 195.256 1.00 89.36  ?  167  GLU A CG    1 
ATOM   638   C  CD    . GLU A 1  167  ? 118.273 147.602 194.497 1.00 89.36  ?  167  GLU A CD    1 
ATOM   639   O  OE1   . GLU A 1  167  ? 119.101 148.494 194.766 1.00 89.36  ?  167  GLU A OE1   1 
ATOM   640   O  OE2   . GLU A 1  167  ? 118.471 146.737 193.623 1.00 89.36  -1 167  GLU A OE2   1 
ATOM   641   N  N     . LEU A 1  168  ? 113.132 149.865 193.985 1.00 88.93  ?  168  LEU A N     1 
ATOM   642   C  CA    . LEU A 1  168  ? 112.310 150.941 193.428 1.00 88.93  ?  168  LEU A CA    1 
ATOM   643   C  C     . LEU A 1  168  ? 111.593 151.723 194.531 1.00 88.93  ?  168  LEU A C     1 
ATOM   644   O  O     . LEU A 1  168  ? 111.531 152.960 194.481 1.00 88.93  ?  168  LEU A O     1 
ATOM   645   C  CB    . LEU A 1  168  ? 111.299 150.382 192.421 1.00 88.93  ?  168  LEU A CB    1 
ATOM   646   C  CG    . LEU A 1  168  ? 110.323 151.424 191.848 1.00 88.93  ?  168  LEU A CG    1 
ATOM   647   C  CD1   . LEU A 1  168  ? 111.052 152.545 191.127 1.00 88.93  ?  168  LEU A CD1   1 
ATOM   648   C  CD2   . LEU A 1  168  ? 109.206 150.854 190.985 1.00 88.93  ?  168  LEU A CD2   1 
ATOM   649   N  N     . ASN A 1  169  ? 111.075 151.024 195.545 1.00 99.52  ?  169  ASN A N     1 
ATOM   650   C  CA    . ASN A 1  169  ? 110.338 151.652 196.639 1.00 99.52  ?  169  ASN A CA    1 
ATOM   651   C  C     . ASN A 1  169  ? 111.259 152.502 197.511 1.00 99.52  ?  169  ASN A C     1 
ATOM   652   O  O     . ASN A 1  169  ? 112.438 152.197 197.694 1.00 99.52  ?  169  ASN A O     1 
ATOM   653   C  CB    . ASN A 1  169  ? 109.646 150.579 197.491 1.00 99.52  ?  169  ASN A CB    1 
ATOM   654   C  CG    . ASN A 1  169  ? 108.843 151.156 198.662 1.00 99.52  ?  169  ASN A CG    1 
ATOM   655   O  OD1   . ASN A 1  169  ? 108.383 152.297 198.624 1.00 99.52  ?  169  ASN A OD1   1 
ATOM   656   N  ND2   . ASN A 1  169  ? 108.685 150.363 199.711 1.00 99.52  ?  169  ASN A ND2   1 
ATOM   657   N  N     . LEU A 1  170  ? 110.697 153.581 198.055 1.00 112.48 ?  170  LEU A N     1 
ATOM   658   C  CA    . LEU A 1  170  ? 111.410 154.505 198.924 1.00 112.48 ?  170  LEU A CA    1 
ATOM   659   C  C     . LEU A 1  170  ? 111.293 154.091 200.386 1.00 112.48 ?  170  LEU A C     1 
ATOM   660   O  O     . LEU A 1  170  ? 110.290 153.517 200.818 1.00 112.48 ?  170  LEU A O     1 
ATOM   661   C  CB    . LEU A 1  170  ? 110.883 155.935 198.772 1.00 112.48 ?  170  LEU A CB    1 
ATOM   662   C  CG    . LEU A 1  170  ? 111.319 156.844 197.617 1.00 112.48 ?  170  LEU A CG    1 
ATOM   663   C  CD1   . LEU A 1  170  ? 110.679 156.429 196.311 1.00 112.48 ?  170  LEU A CD1   1 
ATOM   664   C  CD2   . LEU A 1  170  ? 110.941 158.274 197.952 1.00 112.48 ?  170  LEU A CD2   1 
ATOM   665   N  N     . ALA A 1  171  ? 112.330 154.416 201.150 1.00 129.01 ?  171  ALA A N     1 
ATOM   666   C  CA    . ALA A 1  171  ? 112.347 154.177 202.586 1.00 129.01 ?  171  ALA A CA    1 
ATOM   667   C  C     . ALA A 1  171  ? 111.645 155.330 203.296 1.00 129.01 ?  171  ALA A C     1 
ATOM   668   O  O     . ALA A 1  171  ? 112.052 156.490 203.168 1.00 129.01 ?  171  ALA A O     1 
ATOM   669   C  CB    . ALA A 1  171  ? 113.785 154.027 203.078 1.00 129.01 ?  171  ALA A CB    1 
ATOM   670   N  N     . ILE A 1  172  ? 110.592 155.007 204.056 1.00 141.76 ?  172  ILE A N     1 
ATOM   671   C  CA    . ILE A 1  172  ? 109.720 156.030 204.637 1.00 141.76 ?  172  ILE A CA    1 
ATOM   672   C  C     . ILE A 1  172  ? 110.208 156.548 205.979 1.00 141.76 ?  172  ILE A C     1 
ATOM   673   O  O     . ILE A 1  172  ? 109.479 157.303 206.636 1.00 141.76 ?  172  ILE A O     1 
ATOM   674   C  CB    . ILE A 1  172  ? 108.287 155.489 204.802 1.00 141.76 ?  172  ILE A CB    1 
ATOM   675   C  CG1   . ILE A 1  172  ? 108.292 154.236 205.683 1.00 141.76 ?  172  ILE A CG1   1 
ATOM   676   C  CG2   . ILE A 1  172  ? 107.672 155.202 203.442 1.00 141.76 ?  172  ILE A CG2   1 
ATOM   677   C  CD1   . ILE A 1  172  ? 106.935 153.577 205.829 1.00 141.76 ?  172  ILE A CD1   1 
ATOM   678   N  N     . SER A 1  173  ? 111.411 156.172 206.406 1.00 152.91 ?  173  SER A N     1 
ATOM   679   C  CA    . SER A 1  173  ? 111.919 156.597 207.702 1.00 152.91 ?  173  SER A CA    1 
ATOM   680   C  C     . SER A 1  173  ? 112.313 158.071 207.683 1.00 152.91 ?  173  SER A C     1 
ATOM   681   O  O     . SER A 1  173  ? 112.439 158.695 206.625 1.00 152.91 ?  173  SER A O     1 
ATOM   682   C  CB    . SER A 1  173  ? 113.118 155.741 208.110 1.00 152.91 ?  173  SER A CB    1 
ATOM   683   O  OG    . SER A 1  173  ? 112.876 154.367 207.853 1.00 152.91 ?  173  SER A OG    1 
ATOM   684   N  N     . ARG A 1  174  ? 112.500 158.630 208.881 1.00 158.58 ?  174  ARG A N     1 
ATOM   685   C  CA    . ARG A 1  174  ? 112.868 160.036 209.005 1.00 158.58 ?  174  ARG A CA    1 
ATOM   686   C  C     . ARG A 1  174  ? 114.339 160.272 208.694 1.00 158.58 ?  174  ARG A C     1 
ATOM   687   O  O     . ARG A 1  174  ? 114.695 161.333 208.166 1.00 158.58 ?  174  ARG A O     1 
ATOM   688   C  CB    . ARG A 1  174  ? 112.538 160.538 210.414 1.00 158.58 ?  174  ARG A CB    1 
ATOM   689   C  CG    . ARG A 1  174  ? 112.516 162.055 210.567 1.00 158.58 ?  174  ARG A CG    1 
ATOM   690   C  CD    . ARG A 1  174  ? 111.622 162.722 209.529 1.00 158.58 ?  174  ARG A CD    1 
ATOM   691   N  NE    . ARG A 1  174  ? 112.390 163.520 208.577 1.00 158.58 ?  174  ARG A NE    1 
ATOM   692   C  CZ    . ARG A 1  174  ? 111.851 164.231 207.592 1.00 158.58 ?  174  ARG A CZ    1 
ATOM   693   N  NH1   . ARG A 1  174  ? 110.535 164.245 207.425 1.00 158.58 1  174  ARG A NH1   1 
ATOM   694   N  NH2   . ARG A 1  174  ? 112.625 164.930 206.773 1.00 158.58 ?  174  ARG A NH2   1 
ATOM   695   N  N     . ASP A 1  175  ? 115.202 159.302 208.997 1.00 154.64 ?  175  ASP A N     1 
ATOM   696   C  CA    . ASP A 1  175  ? 116.633 159.437 208.747 1.00 154.64 ?  175  ASP A CA    1 
ATOM   697   C  C     . ASP A 1  175  ? 117.032 159.088 207.318 1.00 154.64 ?  175  ASP A C     1 
ATOM   698   O  O     . ASP A 1  175  ? 118.230 159.087 207.014 1.00 154.64 ?  175  ASP A O     1 
ATOM   699   C  CB    . ASP A 1  175  ? 117.420 158.573 209.744 1.00 154.64 ?  175  ASP A CB    1 
ATOM   700   C  CG    . ASP A 1  175  ? 117.102 157.090 209.622 1.00 154.64 ?  175  ASP A CG    1 
ATOM   701   O  OD1   . ASP A 1  175  ? 117.665 156.416 208.732 1.00 154.64 ?  175  ASP A OD1   1 
ATOM   702   O  OD2   . ASP A 1  175  ? 116.307 156.589 210.445 1.00 154.64 -1 175  ASP A OD2   1 
ATOM   703   N  N     . SER A 1  176  ? 116.072 158.796 206.437 1.00 135.80 ?  176  SER A N     1 
ATOM   704   C  CA    . SER A 1  176  ? 116.348 158.526 205.033 1.00 135.80 ?  176  SER A CA    1 
ATOM   705   C  C     . SER A 1  176  ? 116.054 159.746 204.161 1.00 135.80 ?  176  SER A C     1 
ATOM   706   O  O     . SER A 1  176  ? 115.925 159.632 202.938 1.00 135.80 ?  176  SER A O     1 
ATOM   707   C  CB    . SER A 1  176  ? 115.552 157.314 204.554 1.00 135.80 ?  176  SER A CB    1 
ATOM   708   O  OG    . SER A 1  176  ? 115.957 156.914 203.259 1.00 135.80 ?  176  SER A OG    1 
ATOM   709   N  N     . ARG A 1  177  ? 115.961 160.926 204.788 1.00 127.79 ?  177  ARG A N     1 
ATOM   710   C  CA    . ARG A 1  177  ? 115.786 162.182 204.065 1.00 127.79 ?  177  ARG A CA    1 
ATOM   711   C  C     . ARG A 1  177  ? 117.025 162.527 203.245 1.00 127.79 ?  177  ARG A C     1 
ATOM   712   O  O     . ARG A 1  177  ? 116.919 163.194 202.210 1.00 127.79 ?  177  ARG A O     1 
ATOM   713   C  CB    . ARG A 1  177  ? 115.437 163.294 205.064 1.00 127.79 ?  177  ARG A CB    1 
ATOM   714   C  CG    . ARG A 1  177  ? 115.362 164.736 204.532 1.00 127.79 ?  177  ARG A CG    1 
ATOM   715   C  CD    . ARG A 1  177  ? 114.353 164.913 203.399 1.00 127.79 ?  177  ARG A CD    1 
ATOM   716   N  NE    . ARG A 1  177  ? 113.045 164.348 203.717 1.00 127.79 ?  177  ARG A NE    1 
ATOM   717   C  CZ    . ARG A 1  177  ? 111.909 164.717 203.135 1.00 127.79 ?  177  ARG A CZ    1 
ATOM   718   N  NH1   . ARG A 1  177  ? 111.912 165.666 202.212 1.00 127.79 1  177  ARG A NH1   1 
ATOM   719   N  NH2   . ARG A 1  177  ? 110.767 164.144 203.483 1.00 127.79 ?  177  ARG A NH2   1 
ATOM   720   N  N     . GLY A 1  178  ? 118.197 162.041 203.658 1.00 115.37 ?  178  GLY A N     1 
ATOM   721   C  CA    . GLY A 1  178  ? 119.373 162.157 202.814 1.00 115.37 ?  178  GLY A CA    1 
ATOM   722   C  C     . GLY A 1  178  ? 119.485 161.074 201.761 1.00 115.37 ?  178  GLY A C     1 
ATOM   723   O  O     . GLY A 1  178  ? 120.448 161.078 200.989 1.00 115.37 ?  178  GLY A O     1 
ATOM   724   N  N     . GLY A 1  179  ? 118.527 160.149 201.712 1.00 109.54 ?  179  GLY A N     1 
ATOM   725   C  CA    . GLY A 1  179  ? 118.643 159.028 200.798 1.00 109.54 ?  179  GLY A CA    1 
ATOM   726   C  C     . GLY A 1  179  ? 117.426 158.713 199.954 1.00 109.54 ?  179  GLY A C     1 
ATOM   727   O  O     . GLY A 1  179  ? 117.522 157.923 199.013 1.00 109.54 ?  179  GLY A O     1 
ATOM   728   N  N     . ARG A 1  180  ? 116.276 159.307 200.274 1.00 107.18 ?  180  ARG A N     1 
ATOM   729   C  CA    . ARG A 1  180  ? 115.109 159.197 199.408 1.00 107.18 ?  180  ARG A CA    1 
ATOM   730   C  C     . ARG A 1  180  ? 114.443 160.537 199.142 1.00 107.18 ?  180  ARG A C     1 
ATOM   731   O  O     . ARG A 1  180  ? 113.226 160.566 198.933 1.00 107.18 ?  180  ARG A O     1 
ATOM   732   C  CB    . ARG A 1  180  ? 114.060 158.237 199.990 1.00 107.18 ?  180  ARG A CB    1 
ATOM   733   C  CG    . ARG A 1  180  ? 114.520 156.822 200.227 1.00 107.18 ?  180  ARG A CG    1 
ATOM   734   C  CD    . ARG A 1  180  ? 114.838 156.075 198.943 1.00 107.18 ?  180  ARG A CD    1 
ATOM   735   N  NE    . ARG A 1  180  ? 114.783 154.636 199.173 1.00 107.18 ?  180  ARG A NE    1 
ATOM   736   C  CZ    . ARG A 1  180  ? 115.059 153.709 198.264 1.00 107.18 ?  180  ARG A CZ    1 
ATOM   737   N  NH1   . ARG A 1  180  ? 115.432 154.054 197.036 1.00 107.18 1  180  ARG A NH1   1 
ATOM   738   N  NH2   . ARG A 1  180  ? 114.958 152.428 198.589 1.00 107.18 ?  180  ARG A NH2   1 
ATOM   739   N  N     . GLU A 1  181  ? 115.177 161.643 199.178 1.00 104.90 ?  181  GLU A N     1 
ATOM   740   C  CA    . GLU A 1  181  ? 114.581 162.895 198.749 1.00 104.90 ?  181  GLU A CA    1 
ATOM   741   C  C     . GLU A 1  181  ? 115.131 163.367 197.412 1.00 104.90 ?  181  GLU A C     1 
ATOM   742   O  O     . GLU A 1  181  ? 114.364 163.599 196.473 1.00 104.90 ?  181  GLU A O     1 
ATOM   743   C  CB    . GLU A 1  181  ? 114.787 163.983 199.800 1.00 104.90 ?  181  GLU A CB    1 
ATOM   744   C  CG    . GLU A 1  181  ? 113.899 165.182 199.562 1.00 104.90 ?  181  GLU A CG    1 
ATOM   745   C  CD    . GLU A 1  181  ? 112.525 164.780 199.058 1.00 104.90 ?  181  GLU A CD    1 
ATOM   746   O  OE1   . GLU A 1  181  ? 112.217 165.047 197.876 1.00 104.90 ?  181  GLU A OE1   1 
ATOM   747   O  OE2   . GLU A 1  181  ? 111.752 164.191 199.843 1.00 104.90 -1 181  GLU A OE2   1 
ATOM   748   N  N     . LEU A 1  182  ? 116.454 163.512 197.315 1.00 100.78 ?  182  LEU A N     1 
ATOM   749   C  CA    . LEU A 1  182  ? 117.048 164.070 196.106 1.00 100.78 ?  182  LEU A CA    1 
ATOM   750   C  C     . LEU A 1  182  ? 116.970 163.084 194.952 1.00 100.78 ?  182  LEU A C     1 
ATOM   751   O  O     . LEU A 1  182  ? 116.982 163.495 193.787 1.00 100.78 ?  182  LEU A O     1 
ATOM   752   C  CB    . LEU A 1  182  ? 118.498 164.481 196.369 1.00 100.78 ?  182  LEU A CB    1 
ATOM   753   C  CG    . LEU A 1  182  ? 118.787 165.728 197.212 1.00 100.78 ?  182  LEU A CG    1 
ATOM   754   C  CD1   . LEU A 1  182  ? 118.859 165.405 198.708 1.00 100.78 ?  182  LEU A CD1   1 
ATOM   755   C  CD2   . LEU A 1  182  ? 120.077 166.396 196.742 1.00 100.78 ?  182  LEU A CD2   1 
ATOM   756   N  N     . THR A 1  183  ? 116.910 161.786 195.262 1.00 98.37  ?  183  THR A N     1 
ATOM   757   C  CA    . THR A 1  183  ? 116.427 160.794 194.311 1.00 98.37  ?  183  THR A CA    1 
ATOM   758   C  C     . THR A 1  183  ? 114.907 160.734 194.327 1.00 98.37  ?  183  THR A C     1 
ATOM   759   O  O     . THR A 1  183  ? 114.258 160.984 193.306 1.00 98.37  ?  183  THR A O     1 
ATOM   760   C  CB    . THR A 1  183  ? 117.007 159.424 194.634 1.00 98.37  ?  183  THR A CB    1 
ATOM   761   O  OG1   . THR A 1  183  ? 116.820 159.149 196.029 1.00 98.37  ?  183  THR A OG1   1 
ATOM   762   C  CG2   . THR A 1  183  ? 118.475 159.373 194.287 1.00 98.37  ?  183  THR A CG2   1 
ATOM   763   N  N     . GLY A 1  184  ? 114.329 160.401 195.479 1.00 101.49 ?  184  GLY A N     1 
ATOM   764   C  CA    . GLY A 1  184  ? 112.903 160.477 195.688 1.00 101.49 ?  184  GLY A CA    1 
ATOM   765   C  C     . GLY A 1  184  ? 112.095 159.497 194.862 1.00 101.49 ?  184  GLY A C     1 
ATOM   766   O  O     . GLY A 1  184  ? 112.560 158.410 194.507 1.00 101.49 ?  184  GLY A O     1 
ATOM   767   N  N     . PRO A 1  185  ? 110.847 159.871 194.555 1.00 101.31 ?  185  PRO A N     1 
ATOM   768   C  CA    . PRO A 1  185  ? 110.006 159.021 193.698 1.00 101.31 ?  185  PRO A CA    1 
ATOM   769   C  C     . PRO A 1  185  ? 110.262 159.231 192.212 1.00 101.31 ?  185  PRO A C     1 
ATOM   770   O  O     . PRO A 1  185  ? 109.530 159.967 191.542 1.00 101.31 ?  185  PRO A O     1 
ATOM   771   C  CB    . PRO A 1  185  ? 108.576 159.432 194.087 1.00 101.31 ?  185  PRO A CB    1 
ATOM   772   C  CG    . PRO A 1  185  ? 108.718 160.392 195.258 1.00 101.31 ?  185  PRO A CG    1 
ATOM   773   C  CD    . PRO A 1  185  ? 110.080 160.990 195.116 1.00 101.31 ?  185  PRO A CD    1 
ATOM   774   N  N     . ALA A 1  186  ? 111.237 158.484 191.703 1.00 84.35  ?  186  ALA A N     1 
ATOM   775   C  CA    . ALA A 1  186  ? 111.620 158.486 190.295 1.00 84.35  ?  186  ALA A CA    1 
ATOM   776   C  C     . ALA A 1  186  ? 111.519 157.037 189.818 1.00 84.35  ?  186  ALA A C     1 
ATOM   777   O  O     . ALA A 1  186  ? 111.751 156.113 190.595 1.00 84.35  ?  186  ALA A O     1 
ATOM   778   C  CB    . ALA A 1  186  ? 113.035 159.012 190.124 1.00 84.35  ?  186  ALA A CB    1 
ATOM   779   N  N     . VAL A 1  187  ? 111.172 156.857 188.549 1.00 73.20  ?  187  VAL A N     1 
ATOM   780   C  CA    . VAL A 1  187  ? 111.024 155.523 187.997 1.00 73.20  ?  187  VAL A CA    1 
ATOM   781   C  C     . VAL A 1  187  ? 112.366 154.966 187.561 1.00 73.20  ?  187  VAL A C     1 
ATOM   782   O  O     . VAL A 1  187  ? 112.621 154.782 186.371 1.00 73.20  ?  187  VAL A O     1 
ATOM   783   C  CB    . VAL A 1  187  ? 110.069 155.518 186.791 1.00 73.20  ?  187  VAL A CB    1 
ATOM   784   C  CG1   . VAL A 1  187  ? 110.507 156.550 185.764 1.00 73.20  ?  187  VAL A CG1   1 
ATOM   785   C  CG2   . VAL A 1  187  ? 110.004 154.131 186.171 1.00 73.20  ?  187  VAL A CG2   1 
ATOM   786   N  N     . LEU A 1  188  ? 113.229 154.705 188.539 1.00 65.96  ?  188  LEU A N     1 
ATOM   787   C  CA    . LEU A 1  188  ? 114.540 154.131 188.273 1.00 65.96  ?  188  LEU A CA    1 
ATOM   788   C  C     . LEU A 1  188  ? 114.366 152.726 187.704 1.00 65.96  ?  188  LEU A C     1 
ATOM   789   O  O     . LEU A 1  188  ? 115.107 152.316 186.808 1.00 65.96  ?  188  LEU A O     1 
ATOM   790   C  CB    . LEU A 1  188  ? 115.368 154.084 189.556 1.00 65.96  ?  188  LEU A CB    1 
ATOM   791   C  CG    . LEU A 1  188  ? 114.787 154.832 190.758 1.00 65.96  ?  188  LEU A CG    1 
ATOM   792   C  CD1   . LEU A 1  188  ? 115.745 154.775 191.937 1.00 65.96  ?  188  LEU A CD1   1 
ATOM   793   C  CD2   . LEU A 1  188  ? 114.462 156.276 190.400 1.00 65.96  ?  188  LEU A CD2   1 
ATOM   794   N  N     . ALA A 1  189  ? 113.428 151.997 188.317 1.00 72.69  ?  189  ALA A N     1 
ATOM   795   C  CA    . ALA A 1  189  ? 112.990 150.637 187.972 1.00 72.69  ?  189  ALA A CA    1 
ATOM   796   C  C     . ALA A 1  189  ? 113.992 149.537 188.306 1.00 72.69  ?  189  ALA A C     1 
ATOM   797   O  O     . ALA A 1  189  ? 115.076 149.795 188.830 1.00 72.69  ?  189  ALA A O     1 
ATOM   798   C  CB    . ALA A 1  189  ? 112.471 150.522 186.535 1.00 72.69  ?  189  ALA A CB    1 
ATOM   799   N  N     . VAL A 1  190  ? 113.610 148.303 188.002 1.00 63.81  ?  190  VAL A N     1 
ATOM   800   C  CA    . VAL A 1  190  ? 114.473 147.160 188.230 1.00 63.81  ?  190  VAL A CA    1 
ATOM   801   C  C     . VAL A 1  190  ? 114.495 146.283 186.987 1.00 63.81  ?  190  VAL A C     1 
ATOM   802   O  O     . VAL A 1  190  ? 113.449 145.942 186.439 1.00 63.81  ?  190  VAL A O     1 
ATOM   803   C  CB    . VAL A 1  190  ? 114.022 146.334 189.447 1.00 63.81  ?  190  VAL A CB    1 
ATOM   804   C  CG1   . VAL A 1  190  ? 113.272 145.089 189.000 1.00 63.81  ?  190  VAL A CG1   1 
ATOM   805   C  CG2   . VAL A 1  190  ? 115.221 145.964 190.306 1.00 63.81  ?  190  VAL A CG2   1 
ATOM   806   N  N     . GLU A 1  191  ? 115.689 145.930 186.535 1.00 55.07  ?  191  GLU A N     1 
ATOM   807   C  CA    . GLU A 1  191  ? 115.818 145.073 185.371 1.00 55.07  ?  191  GLU A CA    1 
ATOM   808   C  C     . GLU A 1  191  ? 116.944 144.083 185.596 1.00 55.07  ?  191  GLU A C     1 
ATOM   809   O  O     . GLU A 1  191  ? 117.930 144.401 186.259 1.00 55.07  ?  191  GLU A O     1 
ATOM   810   C  CB    . GLU A 1  191  ? 116.089 145.905 184.117 1.00 55.07  ?  191  GLU A CB    1 
ATOM   811   C  CG    . GLU A 1  191  ? 115.425 145.364 182.860 1.00 55.07  ?  191  GLU A CG    1 
ATOM   812   C  CD    . GLU A 1  191  ? 115.239 146.428 181.798 1.00 55.07  ?  191  GLU A CD    1 
ATOM   813   O  OE1   . GLU A 1  191  ? 114.230 147.164 181.863 1.00 55.07  ?  191  GLU A OE1   1 
ATOM   814   O  OE2   . GLU A 1  191  ? 116.098 146.530 180.899 1.00 55.07  -1 191  GLU A OE2   1 
ATOM   815   N  N     . LEU A 1  192  ? 116.801 142.884 185.050 1.00 56.82  ?  192  LEU A N     1 
ATOM   816   C  CA    . LEU A 1  192  ? 117.845 141.883 185.189 1.00 56.82  ?  192  LEU A CA    1 
ATOM   817   C  C     . LEU A 1  192  ? 118.386 141.601 183.798 1.00 56.82  ?  192  LEU A C     1 
ATOM   818   O  O     . LEU A 1  192  ? 117.609 141.384 182.864 1.00 56.82  ?  192  LEU A O     1 
ATOM   819   C  CB    . LEU A 1  192  ? 117.298 140.612 185.827 1.00 56.82  ?  192  LEU A CB    1 
ATOM   820   C  CG    . LEU A 1  192  ? 118.225 139.781 186.706 1.00 56.82  ?  192  LEU A CG    1 
ATOM   821   C  CD1   . LEU A 1  192  ? 118.647 140.574 187.911 1.00 56.82  ?  192  LEU A CD1   1 
ATOM   822   C  CD2   . LEU A 1  192  ? 117.514 138.510 187.135 1.00 56.82  ?  192  LEU A CD2   1 
ATOM   823   N  N     . CYS A 1  193  ? 119.708 141.630 183.647 1.00 50.78  ?  193  CYS A N     1 
ATOM   824   C  CA    . CYS A 1  193  ? 120.315 141.312 182.365 1.00 50.78  ?  193  CYS A CA    1 
ATOM   825   C  C     . CYS A 1  193  ? 121.642 140.629 182.625 1.00 50.78  ?  193  CYS A C     1 
ATOM   826   O  O     . CYS A 1  193  ? 122.188 140.718 183.720 1.00 50.78  ?  193  CYS A O     1 
ATOM   827   C  CB    . CYS A 1  193  ? 120.467 142.569 181.492 1.00 50.78  ?  193  CYS A CB    1 
ATOM   828   S  SG    . CYS A 1  193  ? 121.026 144.027 182.388 1.00 50.78  ?  193  CYS A SG    1 
ATOM   829   N  N     . SER A 1  194  ? 122.139 139.908 181.625 1.00 48.27  ?  194  SER A N     1 
ATOM   830   C  CA    . SER A 1  194  ? 123.353 139.108 181.761 1.00 48.27  ?  194  SER A CA    1 
ATOM   831   C  C     . SER A 1  194  ? 124.432 139.711 180.874 1.00 48.27  ?  194  SER A C     1 
ATOM   832   O  O     . SER A 1  194  ? 124.334 139.648 179.644 1.00 48.27  ?  194  SER A O     1 
ATOM   833   C  CB    . SER A 1  194  ? 123.081 137.652 181.394 1.00 48.27  ?  194  SER A CB    1 
ATOM   834   O  OG    . SER A 1  194  ? 124.274 136.995 181.025 1.00 48.27  ?  194  SER A OG    1 
ATOM   835   N  N     . ARG A 1  195  ? 125.450 140.316 181.490 1.00 43.60  ?  195  ARG A N     1 
ATOM   836   C  CA    . ARG A 1  195  ? 126.467 141.072 180.757 1.00 43.60  ?  195  ARG A CA    1 
ATOM   837   C  C     . ARG A 1  195  ? 127.833 140.812 181.387 1.00 43.60  ?  195  ARG A C     1 
ATOM   838   O  O     . ARG A 1  195  ? 127.990 139.948 182.253 1.00 43.60  ?  195  ARG A O     1 
ATOM   839   C  CB    . ARG A 1  195  ? 126.142 142.573 180.736 1.00 43.60  ?  195  ARG A CB    1 
ATOM   840   C  CG    . ARG A 1  195  ? 124.893 142.918 179.963 1.00 43.60  ?  195  ARG A CG    1 
ATOM   841   C  CD    . ARG A 1  195  ? 124.582 144.369 179.862 1.00 43.60  ?  195  ARG A CD    1 
ATOM   842   N  NE    . ARG A 1  195  ? 123.260 144.496 179.261 1.00 43.60  ?  195  ARG A NE    1 
ATOM   843   C  CZ    . ARG A 1  195  ? 123.022 144.502 177.955 1.00 43.60  ?  195  ARG A CZ    1 
ATOM   844   N  NH1   . ARG A 1  195  ? 124.020 144.393 177.090 1.00 43.60  1  195  ARG A NH1   1 
ATOM   845   N  NH2   . ARG A 1  195  ? 121.777 144.610 177.515 1.00 43.60  ?  195  ARG A NH2   1 
ATOM   846   N  N     . GLU A 1  196  ? 128.828 141.581 180.952 1.00 45.68  ?  196  GLU A N     1 
ATOM   847   C  CA    . GLU A 1  196  ? 130.207 141.398 181.380 1.00 45.68  ?  196  GLU A CA    1 
ATOM   848   C  C     . GLU A 1  196  ? 130.906 142.751 181.495 1.00 45.68  ?  196  GLU A C     1 
ATOM   849   O  O     . GLU A 1  196  ? 130.458 143.754 180.937 1.00 45.68  ?  196  GLU A O     1 
ATOM   850   C  CB    . GLU A 1  196  ? 130.948 140.493 180.401 1.00 45.68  ?  196  GLU A CB    1 
ATOM   851   C  CG    . GLU A 1  196  ? 132.032 139.658 181.012 1.00 45.68  ?  196  GLU A CG    1 
ATOM   852   C  CD    . GLU A 1  196  ? 132.672 138.752 179.994 1.00 45.68  ?  196  GLU A CD    1 
ATOM   853   O  OE1   . GLU A 1  196  ? 132.084 138.582 178.906 1.00 45.68  ?  196  GLU A OE1   1 
ATOM   854   O  OE2   . GLU A 1  196  ? 133.759 138.208 180.280 1.00 45.68  -1 196  GLU A OE2   1 
ATOM   855   N  N     . SER A 1  197  ? 132.011 142.772 182.234 1.00 44.07  ?  197  SER A N     1 
ATOM   856   C  CA    . SER A 1  197  ? 132.849 143.956 182.346 1.00 44.07  ?  197  SER A CA    1 
ATOM   857   C  C     . SER A 1  197  ? 133.979 143.914 181.326 1.00 44.07  ?  197  SER A C     1 
ATOM   858   O  O     . SER A 1  197  ? 134.429 142.842 180.910 1.00 44.07  ?  197  SER A O     1 
ATOM   859   C  CB    . SER A 1  197  ? 133.426 144.101 183.751 1.00 44.07  ?  197  SER A CB    1 
ATOM   860   O  OG    . SER A 1  197  ? 132.405 144.366 184.693 1.00 44.07  ?  197  SER A OG    1 
ATOM   861   N  N     . MET A 1  198  ? 134.433 145.107 180.930 1.00 38.41  ?  198  MET A N     1 
ATOM   862   C  CA    . MET A 1  198  ? 135.399 145.235 179.841 1.00 38.41  ?  198  MET A CA    1 
ATOM   863   C  C     . MET A 1  198  ? 136.792 144.794 180.261 1.00 38.41  ?  198  MET A C     1 
ATOM   864   O  O     . MET A 1  198  ? 137.436 143.993 179.580 1.00 38.41  ?  198  MET A O     1 
ATOM   865   C  CB    . MET A 1  198  ? 135.453 146.682 179.363 1.00 38.41  ?  198  MET A CB    1 
ATOM   866   C  CG    . MET A 1  198  ? 134.585 147.008 178.187 1.00 38.41  ?  198  MET A CG    1 
ATOM   867   S  SD    . MET A 1  198  ? 135.160 148.511 177.402 1.00 38.41  ?  198  MET A SD    1 
ATOM   868   C  CE    . MET A 1  198  ? 136.644 147.888 176.633 1.00 38.41  ?  198  MET A CE    1 
ATOM   869   N  N     . PHE A 1  199  ? 137.261 145.308 181.391 1.00 41.55  ?  199  PHE A N     1 
ATOM   870   C  CA    . PHE A 1  199  ? 138.678 145.386 181.731 1.00 41.55  ?  199  PHE A CA    1 
ATOM   871   C  C     . PHE A 1  199  ? 139.215 144.010 182.097 1.00 41.55  ?  199  PHE A C     1 
ATOM   872   O  O     . PHE A 1  199  ? 138.754 143.393 183.060 1.00 41.55  ?  199  PHE A O     1 
ATOM   873   C  CB    . PHE A 1  199  ? 138.819 146.360 182.892 1.00 41.55  ?  199  PHE A CB    1 
ATOM   874   C  CG    . PHE A 1  199  ? 140.193 146.896 183.088 1.00 41.55  ?  199  PHE A CG    1 
ATOM   875   C  CD1   . PHE A 1  199  ? 140.642 147.961 182.330 1.00 41.55  ?  199  PHE A CD1   1 
ATOM   876   C  CD2   . PHE A 1  199  ? 141.019 146.372 184.064 1.00 41.55  ?  199  PHE A CD2   1 
ATOM   877   C  CE1   . PHE A 1  199  ? 141.900 148.474 182.525 1.00 41.55  ?  199  PHE A CE1   1 
ATOM   878   C  CE2   . PHE A 1  199  ? 142.283 146.881 184.261 1.00 41.55  ?  199  PHE A CE2   1 
ATOM   879   C  CZ    . PHE A 1  199  ? 142.725 147.933 183.488 1.00 41.55  ?  199  PHE A CZ    1 
ATOM   880   N  N     . GLY A 1  200  ? 140.186 143.523 181.338 1.00 33.17  ?  200  GLY A N     1 
ATOM   881   C  CA    . GLY A 1  200  ? 140.820 142.256 181.626 1.00 33.17  ?  200  GLY A CA    1 
ATOM   882   C  C     . GLY A 1  200  ? 140.209 141.117 180.834 1.00 33.17  ?  200  GLY A C     1 
ATOM   883   O  O     . GLY A 1  200  ? 139.298 141.291 180.029 1.00 33.17  ?  200  GLY A O     1 
ATOM   884   N  N     . TYR A 1  201  ? 140.741 139.926 181.064 1.00 39.21  ?  201  TYR A N     1 
ATOM   885   C  CA    . TYR A 1  201  ? 140.184 138.707 180.488 1.00 39.21  ?  201  TYR A CA    1 
ATOM   886   C  C     . TYR A 1  201  ? 139.999 137.691 181.607 1.00 39.21  ?  201  TYR A C     1 
ATOM   887   O  O     . TYR A 1  201  ? 140.970 137.100 182.087 1.00 39.21  ?  201  TYR A O     1 
ATOM   888   C  CB    . TYR A 1  201  ? 141.072 138.141 179.393 1.00 39.21  ?  201  TYR A CB    1 
ATOM   889   C  CG    . TYR A 1  201  ? 140.620 136.792 178.894 1.00 39.21  ?  201  TYR A CG    1 
ATOM   890   C  CD1   . TYR A 1  201  ? 139.508 136.675 178.078 1.00 39.21  ?  201  TYR A CD1   1 
ATOM   891   C  CD2   . TYR A 1  201  ? 141.301 135.639 179.238 1.00 39.21  ?  201  TYR A CD2   1 
ATOM   892   C  CE1   . TYR A 1  201  ? 139.085 135.439 177.614 1.00 39.21  ?  201  TYR A CE1   1 
ATOM   893   C  CE2   . TYR A 1  201  ? 140.886 134.402 178.781 1.00 39.21  ?  201  TYR A CE2   1 
ATOM   894   C  CZ    . TYR A 1  201  ? 139.776 134.310 177.971 1.00 39.21  ?  201  TYR A CZ    1 
ATOM   895   O  OH    . TYR A 1  201  ? 139.362 133.084 177.517 1.00 39.21  ?  201  TYR A OH    1 
ATOM   896   N  N     . HIS A 1  202  ? 138.751 137.466 182.001 1.00 47.95  ?  202  HIS A N     1 
ATOM   897   C  CA    . HIS A 1  202  ? 138.426 136.459 183.001 1.00 47.95  ?  202  HIS A CA    1 
ATOM   898   C  C     . HIS A 1  202  ? 137.847 135.193 182.386 1.00 47.95  ?  202  HIS A C     1 
ATOM   899   O  O     . HIS A 1  202  ? 138.226 134.090 182.784 1.00 47.95  ?  202  HIS A O     1 
ATOM   900   C  CB    . HIS A 1  202  ? 137.454 137.041 184.024 1.00 47.95  ?  202  HIS A CB    1 
ATOM   901   C  CG    . HIS A 1  202  ? 137.789 138.439 184.431 1.00 47.95  ?  202  HIS A CG    1 
ATOM   902   N  ND1   . HIS A 1  202  ? 138.605 138.724 185.502 1.00 47.95  ?  202  HIS A ND1   1 
ATOM   903   C  CD2   . HIS A 1  202  ? 137.436 139.631 183.898 1.00 47.95  ?  202  HIS A CD2   1 
ATOM   904   C  CE1   . HIS A 1  202  ? 138.730 140.033 185.620 1.00 47.95  ?  202  HIS A CE1   1 
ATOM   905   N  NE2   . HIS A 1  202  ? 138.032 140.607 184.659 1.00 47.95  ?  202  HIS A NE2   1 
ATOM   906   N  N     . GLY A 1  203  ? 136.952 135.330 181.416 1.00 59.30  ?  203  GLY A N     1 
ATOM   907   C  CA    . GLY A 1  203  ? 136.447 134.173 180.707 1.00 59.30  ?  203  GLY A CA    1 
ATOM   908   C  C     . GLY A 1  203  ? 135.414 134.577 179.675 1.00 59.30  ?  203  GLY A C     1 
ATOM   909   O  O     . GLY A 1  203  ? 135.150 135.762 179.461 1.00 59.30  ?  203  GLY A O     1 
ATOM   910   N  N     . HIS A 1  204  ? 134.830 133.556 179.045 1.00 67.68  ?  204  HIS A N     1 
ATOM   911   C  CA    . HIS A 1  204  ? 133.735 133.720 178.100 1.00 67.68  ?  204  HIS A CA    1 
ATOM   912   C  C     . HIS A 1  204  ? 132.365 133.748 178.775 1.00 67.68  ?  204  HIS A C     1 
ATOM   913   O  O     . HIS A 1  204  ? 131.348 133.805 178.079 1.00 67.68  ?  204  HIS A O     1 
ATOM   914   C  CB    . HIS A 1  204  ? 133.754 132.588 177.069 1.00 67.68  ?  204  HIS A CB    1 
ATOM   915   C  CG    . HIS A 1  204  ? 134.793 132.745 176.003 1.00 67.68  ?  204  HIS A CG    1 
ATOM   916   N  ND1   . HIS A 1  204  ? 134.795 131.983 174.857 1.00 67.68  ?  204  HIS A ND1   1 
ATOM   917   C  CD2   . HIS A 1  204  ? 135.866 133.564 175.911 1.00 67.68  ?  204  HIS A CD2   1 
ATOM   918   C  CE1   . HIS A 1  204  ? 135.818 132.332 174.099 1.00 67.68  ?  204  HIS A CE1   1 
ATOM   919   N  NE2   . HIS A 1  204  ? 136.490 133.281 174.720 1.00 67.68  ?  204  HIS A NE2   1 
ATOM   920   N  N     . GLY A 1  205  ? 132.314 133.706 180.107 1.00 58.79  ?  205  GLY A N     1 
ATOM   921   C  CA    . GLY A 1  205  ? 131.063 133.597 180.818 1.00 58.79  ?  205  GLY A CA    1 
ATOM   922   C  C     . GLY A 1  205  ? 130.580 134.909 181.407 1.00 58.79  ?  205  GLY A C     1 
ATOM   923   O  O     . GLY A 1  205  ? 131.329 135.630 182.070 1.00 58.79  ?  205  GLY A O     1 
ATOM   924   N  N     . PRO A 1  206  ? 129.306 135.244 181.162 1.00 49.42  ?  206  PRO A N     1 
ATOM   925   C  CA    . PRO A 1  206  ? 128.735 136.483 181.706 1.00 49.42  ?  206  PRO A CA    1 
ATOM   926   C  C     . PRO A 1  206  ? 128.231 136.352 183.134 1.00 49.42  ?  206  PRO A C     1 
ATOM   927   O  O     . PRO A 1  206  ? 128.430 135.320 183.778 1.00 49.42  ?  206  PRO A O     1 
ATOM   928   C  CB    . PRO A 1  206  ? 127.589 136.781 180.739 1.00 49.42  ?  206  PRO A CB    1 
ATOM   929   C  CG    . PRO A 1  206  ? 127.160 135.440 180.285 1.00 49.42  ?  206  PRO A CG    1 
ATOM   930   C  CD    . PRO A 1  206  ? 128.403 134.610 180.187 1.00 49.42  ?  206  PRO A CD    1 
ATOM   931   N  N     . SER A 1  207  ? 127.587 137.399 183.638 1.00 48.42  ?  207  SER A N     1 
ATOM   932   C  CA    . SER A 1  207  ? 127.151 137.483 185.024 1.00 48.42  ?  207  SER A CA    1 
ATOM   933   C  C     . SER A 1  207  ? 125.965 138.437 185.098 1.00 48.42  ?  207  SER A C     1 
ATOM   934   O  O     . SER A 1  207  ? 125.808 139.302 184.227 1.00 48.42  ?  207  SER A O     1 
ATOM   935   C  CB    . SER A 1  207  ? 128.291 137.965 185.936 1.00 48.42  ?  207  SER A CB    1 
ATOM   936   O  OG    . SER A 1  207  ? 129.423 137.112 185.869 1.00 48.42  ?  207  SER A OG    1 
ATOM   937   N  N     . PRO A 1  208  ? 125.102 138.300 186.110 1.00 48.20  ?  208  PRO A N     1 
ATOM   938   C  CA    . PRO A 1  208  ? 123.937 139.192 186.201 1.00 48.20  ?  208  PRO A CA    1 
ATOM   939   C  C     . PRO A 1  208  ? 124.298 140.606 186.631 1.00 48.20  ?  208  PRO A C     1 
ATOM   940   O  O     . PRO A 1  208  ? 125.025 140.817 187.601 1.00 48.20  ?  208  PRO A O     1 
ATOM   941   C  CB    . PRO A 1  208  ? 123.050 138.515 187.256 1.00 48.20  ?  208  PRO A CB    1 
ATOM   942   C  CG    . PRO A 1  208  ? 123.513 137.117 187.316 1.00 48.20  ?  208  PRO A CG    1 
ATOM   943   C  CD    . PRO A 1  208  ? 124.978 137.166 187.043 1.00 48.20  ?  208  PRO A CD    1 
ATOM   944   N  N     . PHE A 1  209  ? 123.749 141.572 185.898 1.00 44.59  ?  209  PHE A N     1 
ATOM   945   C  CA    . PHE A 1  209  ? 123.826 142.992 186.189 1.00 44.59  ?  209  PHE A CA    1 
ATOM   946   C  C     . PHE A 1  209  ? 122.408 143.546 186.259 1.00 44.59  ?  209  PHE A C     1 
ATOM   947   O  O     . PHE A 1  209  ? 121.476 143.019 185.638 1.00 44.59  ?  209  PHE A O     1 
ATOM   948   C  CB    . PHE A 1  209  ? 124.597 143.769 185.103 1.00 44.59  ?  209  PHE A CB    1 
ATOM   949   C  CG    . PHE A 1  209  ? 126.090 143.556 185.102 1.00 44.59  ?  209  PHE A CG    1 
ATOM   950   C  CD1   . PHE A 1  209  ? 126.640 142.381 184.626 1.00 44.59  ?  209  PHE A CD1   1 
ATOM   951   C  CD2   . PHE A 1  209  ? 126.941 144.568 185.515 1.00 44.59  ?  209  PHE A CD2   1 
ATOM   952   C  CE1   . PHE A 1  209  ? 128.001 142.196 184.605 1.00 44.59  ?  209  PHE A CE1   1 
ATOM   953   C  CE2   . PHE A 1  209  ? 128.305 144.390 185.489 1.00 44.59  ?  209  PHE A CE2   1 
ATOM   954   C  CZ    . PHE A 1  209  ? 128.834 143.200 185.033 1.00 44.59  ?  209  PHE A CZ    1 
ATOM   955   N  N     . LEU A 1  210  ? 122.257 144.631 187.010 1.00 46.23  ?  210  LEU A N     1 
ATOM   956   C  CA    . LEU A 1  210  ? 121.008 145.368 187.147 1.00 46.23  ?  210  LEU A CA    1 
ATOM   957   C  C     . LEU A 1  210  ? 121.055 146.578 186.225 1.00 46.23  ?  210  LEU A C     1 
ATOM   958   O  O     . LEU A 1  210  ? 122.036 147.332 186.228 1.00 46.23  ?  210  LEU A O     1 
ATOM   959   C  CB    . LEU A 1  210  ? 120.789 145.830 188.587 1.00 46.23  ?  210  LEU A CB    1 
ATOM   960   C  CG    . LEU A 1  210  ? 120.598 144.849 189.735 1.00 46.23  ?  210  LEU A CG    1 
ATOM   961   C  CD1   . LEU A 1  210  ? 120.267 145.625 190.994 1.00 46.23  ?  210  LEU A CD1   1 
ATOM   962   C  CD2   . LEU A 1  210  ? 119.520 143.833 189.430 1.00 46.23  ?  210  LEU A CD2   1 
ATOM   963   N  N     . ARG A 1  211  ? 119.989 146.771 185.458 1.00 41.19  ?  211  ARG A N     1 
ATOM   964   C  CA    . ARG A 1  211  ? 119.828 147.952 184.625 1.00 41.19  ?  211  ARG A CA    1 
ATOM   965   C  C     . ARG A 1  211  ? 118.874 148.916 185.319 1.00 41.19  ?  211  ARG A C     1 
ATOM   966   O  O     . ARG A 1  211  ? 117.718 148.572 185.584 1.00 41.19  ?  211  ARG A O     1 
ATOM   967   C  CB    . ARG A 1  211  ? 119.309 147.571 183.242 1.00 41.19  ?  211  ARG A CB    1 
ATOM   968   C  CG    . ARG A 1  211  ? 118.795 148.741 182.439 1.00 41.19  ?  211  ARG A CG    1 
ATOM   969   C  CD    . ARG A 1  211  ? 118.682 148.407 180.970 1.00 41.19  ?  211  ARG A CD    1 
ATOM   970   N  NE    . ARG A 1  211  ? 117.690 149.260 180.327 1.00 41.19  ?  211  ARG A NE    1 
ATOM   971   C  CZ    . ARG A 1  211  ? 117.713 149.610 179.048 1.00 41.19  ?  211  ARG A CZ    1 
ATOM   972   N  NH1   . ARG A 1  211  ? 118.688 149.185 178.258 1.00 41.19  1  211  ARG A NH1   1 
ATOM   973   N  NH2   . ARG A 1  211  ? 116.763 150.391 178.561 1.00 41.19  ?  211  ARG A NH2   1 
ATOM   974   N  N     . ILE A 1  212  ? 119.357 150.117 185.606 1.00 36.89  ?  212  ILE A N     1 
ATOM   975   C  CA    . ILE A 1  212  ? 118.632 151.106 186.386 1.00 36.89  ?  212  ILE A CA    1 
ATOM   976   C  C     . ILE A 1  212  ? 118.317 152.264 185.453 1.00 36.89  ?  212  ILE A C     1 
ATOM   977   O  O     . ILE A 1  212  ? 119.216 153.019 185.065 1.00 36.89  ?  212  ILE A O     1 
ATOM   978   C  CB    . ILE A 1  212  ? 119.441 151.585 187.596 1.00 36.89  ?  212  ILE A CB    1 
ATOM   979   C  CG1   . ILE A 1  212  ? 119.906 150.393 188.434 1.00 36.89  ?  212  ILE A CG1   1 
ATOM   980   C  CG2   . ILE A 1  212  ? 118.642 152.579 188.416 1.00 36.89  ?  212  ILE A CG2   1 
ATOM   981   C  CD1   . ILE A 1  212  ? 120.708 150.774 189.655 1.00 36.89  ?  212  ILE A CD1   1 
ATOM   982   N  N     . THR A 1  213  ? 117.046 152.413 185.087 1.00 38.65  ?  213  THR A N     1 
ATOM   983   C  CA    . THR A 1  213  ? 116.617 153.612 184.391 1.00 38.65  ?  213  THR A CA    1 
ATOM   984   C  C     . THR A 1  213  ? 116.464 154.753 185.381 1.00 38.65  ?  213  THR A C     1 
ATOM   985   O  O     . THR A 1  213  ? 116.503 154.558 186.588 1.00 38.65  ?  213  THR A O     1 
ATOM   986   C  CB    . THR A 1  213  ? 115.302 153.385 183.656 1.00 38.65  ?  213  THR A CB    1 
ATOM   987   O  OG1   . THR A 1  213  ? 114.229 153.470 184.590 1.00 38.65  ?  213  THR A OG1   1 
ATOM   988   C  CG2   . THR A 1  213  ? 115.287 152.015 183.004 1.00 38.65  ?  213  THR A CG2   1 
ATOM   989   N  N     . VAL A 1  214  ? 116.378 155.971 184.856 1.00 32.41  ?  214  VAL A N     1 
ATOM   990   C  CA    . VAL A 1  214  ? 116.129 157.182 185.631 1.00 32.41  ?  214  VAL A CA    1 
ATOM   991   C  C     . VAL A 1  214  ? 115.162 157.983 184.772 1.00 32.41  ?  214  VAL A C     1 
ATOM   992   O  O     . VAL A 1  214  ? 115.130 157.816 183.551 1.00 32.41  ?  214  VAL A O     1 
ATOM   993   C  CB    . VAL A 1  214  ? 117.434 157.993 185.943 1.00 32.41  ?  214  VAL A CB    1 
ATOM   994   C  CG1   . VAL A 1  214  ? 117.185 159.225 186.813 1.00 32.41  ?  214  VAL A CG1   1 
ATOM   995   C  CG2   . VAL A 1  214  ? 118.504 157.156 186.631 1.00 32.41  ?  214  VAL A CG2   1 
ATOM   996   N  N     . ALA A 1  215  ? 114.330 158.812 185.405 1.00 36.98  ?  215  ALA A N     1 
ATOM   997   C  CA    . ALA A 1  215  ? 113.461 159.697 184.638 1.00 36.98  ?  215  ALA A CA    1 
ATOM   998   C  C     . ALA A 1  215  ? 114.267 160.775 183.924 1.00 36.98  ?  215  ALA A C     1 
ATOM   999   O  O     . ALA A 1  215  ? 114.298 160.829 182.690 1.00 36.98  ?  215  ALA A O     1 
ATOM   1000  C  CB    . ALA A 1  215  ? 112.405 160.329 185.552 1.00 36.98  ?  215  ALA A CB    1 
ATOM   1001  N  N     . LEU A 1  216  ? 114.952 161.619 184.682 1.00 38.86  ?  216  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1  216  ? 115.575 162.777 184.065 1.00 38.86  ?  216  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1  216  ? 117.079 162.591 183.947 1.00 38.86  ?  216  LEU A C     1 
ATOM   1004  O  O     . LEU A 1  216  ? 117.695 161.927 184.783 1.00 38.86  ?  216  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1  216  ? 115.294 164.045 184.871 1.00 38.86  ?  216  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1  216  ? 113.844 164.316 185.243 1.00 38.86  ?  216  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1  216  ? 113.755 165.653 185.931 1.00 38.86  ?  216  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1  216  ? 112.961 164.285 184.024 1.00 38.86  ?  216  LEU A CD2   1 
ATOM   1009  N  N     . PRO A 1  217  ? 117.688 163.157 182.898 1.00 37.50  ?  217  PRO A N     1 
ATOM   1010  C  CA    . PRO A 1  217  ? 119.152 163.168 182.817 1.00 37.50  ?  217  PRO A CA    1 
ATOM   1011  C  C     . PRO A 1  217  ? 119.826 163.974 183.912 1.00 37.50  ?  217  PRO A C     1 
ATOM   1012  O  O     . PRO A 1  217  ? 120.971 163.661 184.259 1.00 37.50  ?  217  PRO A O     1 
ATOM   1013  C  CB    . PRO A 1  217  ? 119.413 163.770 181.433 1.00 37.50  ?  217  PRO A CB    1 
ATOM   1014  C  CG    . PRO A 1  217  ? 118.206 163.428 180.663 1.00 37.50  ?  217  PRO A CG    1 
ATOM   1015  C  CD    . PRO A 1  217  ? 117.080 163.565 181.621 1.00 37.50  ?  217  PRO A CD    1 
ATOM   1016  N  N     . ARG A 1  218  ? 119.169 164.989 184.472 1.00 54.29  ?  218  ARG A N     1 
ATOM   1017  C  CA    . ARG A 1  218  ? 119.740 165.706 185.612 1.00 54.29  ?  218  ARG A CA    1 
ATOM   1018  C  C     . ARG A 1  218  ? 119.265 165.117 186.936 1.00 54.29  ?  218  ARG A C     1 
ATOM   1019  O  O     . ARG A 1  218  ? 118.882 165.826 187.865 1.00 54.29  ?  218  ARG A O     1 
ATOM   1020  C  CB    . ARG A 1  218  ? 119.391 167.186 185.516 1.00 54.29  ?  218  ARG A CB    1 
ATOM   1021  C  CG    . ARG A 1  218  ? 117.942 167.469 185.135 1.00 54.29  ?  218  ARG A CG    1 
ATOM   1022  C  CD    . ARG A 1  218  ? 117.779 168.855 184.515 1.00 54.29  ?  218  ARG A CD    1 
ATOM   1023  N  NE    . ARG A 1  218  ? 118.170 168.888 183.107 1.00 54.29  ?  218  ARG A NE    1 
ATOM   1024  C  CZ    . ARG A 1  218  ? 118.200 169.991 182.362 1.00 54.29  ?  218  ARG A CZ    1 
ATOM   1025  N  NH1   . ARG A 1  218  ? 117.865 171.158 182.888 1.00 54.29  1  218  ARG A NH1   1 
ATOM   1026  N  NH2   . ARG A 1  218  ? 118.569 169.929 181.091 1.00 54.29  ?  218  ARG A NH2   1 
ATOM   1027  N  N     . LEU A 1  219  ? 119.325 163.786 187.019 1.00 49.08  ?  219  LEU A N     1 
ATOM   1028  C  CA    . LEU A 1  219  ? 119.127 163.044 188.255 1.00 49.08  ?  219  LEU A CA    1 
ATOM   1029  C  C     . LEU A 1  219  ? 120.057 161.849 188.357 1.00 49.08  ?  219  LEU A C     1 
ATOM   1030  O  O     . LEU A 1  219  ? 119.958 161.103 189.332 1.00 49.08  ?  219  LEU A O     1 
ATOM   1031  C  CB    . LEU A 1  219  ? 117.677 162.556 188.383 1.00 49.08  ?  219  LEU A CB    1 
ATOM   1032  C  CG    . LEU A 1  219  ? 116.583 163.554 188.750 1.00 49.08  ?  219  LEU A CG    1 
ATOM   1033  C  CD1   . LEU A 1  219  ? 115.249 162.842 188.820 1.00 49.08  ?  219  LEU A CD1   1 
ATOM   1034  C  CD2   . LEU A 1  219  ? 116.904 164.236 190.059 1.00 49.08  ?  219  LEU A CD2   1 
ATOM   1035  N  N     . VAL A 1  220  ? 120.934 161.630 187.375 1.00 51.41  ?  220  VAL A N     1 
ATOM   1036  C  CA    . VAL A 1  220  ? 121.942 160.582 187.476 1.00 51.41  ?  220  VAL A CA    1 
ATOM   1037  C  C     . VAL A 1  220  ? 123.110 161.046 188.340 1.00 51.41  ?  220  VAL A C     1 
ATOM   1038  O  O     . VAL A 1  220  ? 123.845 160.217 188.888 1.00 51.41  ?  220  VAL A O     1 
ATOM   1039  C  CB    . VAL A 1  220  ? 122.364 160.146 186.056 1.00 51.41  ?  220  VAL A CB    1 
ATOM   1040  C  CG1   . VAL A 1  220  ? 123.097 161.256 185.338 1.00 51.41  ?  220  VAL A CG1   1 
ATOM   1041  C  CG2   . VAL A 1  220  ? 123.184 158.865 186.056 1.00 51.41  ?  220  VAL A CG2   1 
ATOM   1042  N  N     . ALA A 1  221  ? 123.269 162.353 188.526 1.00 60.33  ?  221  ALA A N     1 
ATOM   1043  C  CA    . ALA A 1  221  ? 124.317 162.874 189.398 1.00 60.33  ?  221  ALA A CA    1 
ATOM   1044  C  C     . ALA A 1  221  ? 123.970 162.781 190.887 1.00 60.33  ?  221  ALA A C     1 
ATOM   1045  O  O     . ALA A 1  221  ? 124.852 162.370 191.653 1.00 60.33  ?  221  ALA A O     1 
ATOM   1046  C  CB    . ALA A 1  221  ? 124.686 164.314 189.006 1.00 60.33  ?  221  ALA A CB    1 
ATOM   1047  N  N     . PRO A 1  222  ? 122.763 163.136 191.374 1.00 64.64  ?  222  PRO A N     1 
ATOM   1048  C  CA    . PRO A 1  222  ? 122.510 162.898 192.802 1.00 64.64  ?  222  PRO A CA    1 
ATOM   1049  C  C     . PRO A 1  222  ? 122.342 161.434 193.150 1.00 64.64  ?  222  PRO A C     1 
ATOM   1050  O  O     . PRO A 1  222  ? 122.680 161.043 194.274 1.00 64.64  ?  222  PRO A O     1 
ATOM   1051  C  CB    . PRO A 1  222  ? 121.228 163.694 193.068 1.00 64.64  ?  222  PRO A CB    1 
ATOM   1052  C  CG    . PRO A 1  222  ? 121.174 164.674 192.008 1.00 64.64  ?  222  PRO A CG    1 
ATOM   1053  C  CD    . PRO A 1  222  ? 121.647 163.933 190.831 1.00 64.64  ?  222  PRO A CD    1 
ATOM   1054  N  N     . ALA A 1  223  ? 121.829 160.615 192.224 1.00 64.78  ?  223  ALA A N     1 
ATOM   1055  C  CA    . ALA A 1  223  ? 121.730 159.177 192.464 1.00 64.78  ?  223  ALA A CA    1 
ATOM   1056  C  C     . ALA A 1  223  ? 123.102 158.558 192.640 1.00 64.78  ?  223  ALA A C     1 
ATOM   1057  O  O     . ALA A 1  223  ? 123.304 157.718 193.522 1.00 64.78  ?  223  ALA A O     1 
ATOM   1058  C  CB    . ALA A 1  223  ? 120.990 158.496 191.319 1.00 64.78  ?  223  ALA A CB    1 
ATOM   1059  N  N     . ARG A 1  224  ? 124.069 159.011 191.843 1.00 74.18  ?  224  ARG A N     1 
ATOM   1060  C  CA    . ARG A 1  224  ? 125.455 158.608 192.024 1.00 74.18  ?  224  ARG A CA    1 
ATOM   1061  C  C     . ARG A 1  224  ? 126.015 159.141 193.338 1.00 74.18  ?  224  ARG A C     1 
ATOM   1062  O  O     . ARG A 1  224  ? 126.912 158.529 193.925 1.00 74.18  ?  224  ARG A O     1 
ATOM   1063  C  CB    . ARG A 1  224  ? 126.287 159.118 190.853 1.00 74.18  ?  224  ARG A CB    1 
ATOM   1064  C  CG    . ARG A 1  224  ? 127.508 158.292 190.504 1.00 74.18  ?  224  ARG A CG    1 
ATOM   1065  C  CD    . ARG A 1  224  ? 128.286 158.954 189.374 1.00 74.18  ?  224  ARG A CD    1 
ATOM   1066  N  NE    . ARG A 1  224  ? 128.597 160.354 189.660 1.00 74.18  ?  224  ARG A NE    1 
ATOM   1067  C  CZ    . ARG A 1  224  ? 128.165 161.396 188.955 1.00 74.18  ?  224  ARG A CZ    1 
ATOM   1068  N  NH1   . ARG A 1  224  ? 127.359 161.211 187.922 1.00 74.18  1  224  ARG A NH1   1 
ATOM   1069  N  NH2   . ARG A 1  224  ? 128.516 162.623 189.301 1.00 74.18  ?  224  ARG A NH2   1 
ATOM   1070  N  N     . ARG A 1  225  ? 125.490 160.265 193.823 1.00 82.89  ?  225  ARG A N     1 
ATOM   1071  C  CA    . ARG A 1  225  ? 125.902 160.739 195.132 1.00 82.89  ?  225  ARG A CA    1 
ATOM   1072  C  C     . ARG A 1  225  ? 125.076 160.132 196.252 1.00 82.89  ?  225  ARG A C     1 
ATOM   1073  O  O     . ARG A 1  225  ? 125.300 160.477 197.416 1.00 82.89  ?  225  ARG A O     1 
ATOM   1074  C  CB    . ARG A 1  225  ? 125.830 162.264 195.203 1.00 82.89  ?  225  ARG A CB    1 
ATOM   1075  C  CG    . ARG A 1  225  ? 126.836 162.963 194.307 1.00 82.89  ?  225  ARG A CG    1 
ATOM   1076  C  CD    . ARG A 1  225  ? 126.698 164.463 194.436 1.00 82.89  ?  225  ARG A CD    1 
ATOM   1077  N  NE    . ARG A 1  225  ? 127.284 165.212 193.332 1.00 82.89  ?  225  ARG A NE    1 
ATOM   1078  C  CZ    . ARG A 1  225  ? 127.127 166.524 193.184 1.00 82.89  ?  225  ARG A CZ    1 
ATOM   1079  N  NH1   . ARG A 1  225  ? 126.407 167.198 194.072 1.00 82.89  1  225  ARG A NH1   1 
ATOM   1080  N  NH2   . ARG A 1  225  ? 127.681 167.164 192.159 1.00 82.89  ?  225  ARG A NH2   1 
ATOM   1081  N  N     . LEU A 1  226  ? 124.138 159.238 195.937 1.00 84.19  ?  226  LEU A N     1 
ATOM   1082  C  CA    . LEU A 1  226  ? 123.298 158.633 196.960 1.00 84.19  ?  226  LEU A CA    1 
ATOM   1083  C  C     . LEU A 1  226  ? 123.266 157.120 196.912 1.00 84.19  ?  226  LEU A C     1 
ATOM   1084  O  O     . LEU A 1  226  ? 122.651 156.509 197.786 1.00 84.19  ?  226  LEU A O     1 
ATOM   1085  C  CB    . LEU A 1  226  ? 121.864 159.151 196.854 1.00 84.19  ?  226  LEU A CB    1 
ATOM   1086  C  CG    . LEU A 1  226  ? 121.374 160.207 197.843 1.00 84.19  ?  226  LEU A CG    1 
ATOM   1087  C  CD1   . LEU A 1  226  ? 122.140 161.504 197.739 1.00 84.19  ?  226  LEU A CD1   1 
ATOM   1088  C  CD2   . LEU A 1  226  ? 119.908 160.446 197.593 1.00 84.19  ?  226  LEU A CD2   1 
ATOM   1089  N  N     . LEU A 1  227  ? 123.898 156.495 195.924 1.00 82.57  ?  227  LEU A N     1 
ATOM   1090  C  CA    . LEU A 1  227  ? 123.978 155.043 195.883 1.00 82.57  ?  227  LEU A CA    1 
ATOM   1091  C  C     . LEU A 1  227  ? 125.355 154.523 196.269 1.00 82.57  ?  227  LEU A C     1 
ATOM   1092  O  O     . LEU A 1  227  ? 125.473 153.365 196.681 1.00 82.57  ?  227  LEU A O     1 
ATOM   1093  C  CB    . LEU A 1  227  ? 123.587 154.536 194.489 1.00 82.57  ?  227  LEU A CB    1 
ATOM   1094  C  CG    . LEU A 1  227  ? 123.346 153.045 194.215 1.00 82.57  ?  227  LEU A CG    1 
ATOM   1095  C  CD1   . LEU A 1  227  ? 122.169 152.858 193.281 1.00 82.57  ?  227  LEU A CD1   1 
ATOM   1096  C  CD2   . LEU A 1  227  ? 124.578 152.402 193.613 1.00 82.57  ?  227  LEU A CD2   1 
ATOM   1097  N  N     . GLU A 1  228  ? 126.390 155.351 196.169 1.00 93.63  ?  228  GLU A N     1 
ATOM   1098  C  CA    . GLU A 1  228  ? 127.749 154.950 196.506 1.00 93.63  ?  228  GLU A CA    1 
ATOM   1099  C  C     . GLU A 1  228  ? 128.179 155.435 197.883 1.00 93.63  ?  228  GLU A C     1 
ATOM   1100  O  O     . GLU A 1  228  ? 128.585 154.627 198.725 1.00 93.63  ?  228  GLU A O     1 
ATOM   1101  C  CB    . GLU A 1  228  ? 128.721 155.461 195.431 1.00 93.63  ?  228  GLU A CB    1 
ATOM   1102  C  CG    . GLU A 1  228  ? 128.810 154.550 194.213 1.00 93.63  ?  228  GLU A CG    1 
ATOM   1103  C  CD    . GLU A 1  228  ? 127.643 154.724 193.261 1.00 93.63  ?  228  GLU A CD    1 
ATOM   1104  O  OE1   . GLU A 1  228  ? 126.951 155.754 193.345 1.00 93.63  ?  228  GLU A OE1   1 
ATOM   1105  O  OE2   . GLU A 1  228  ? 127.397 153.819 192.440 1.00 93.63  -1 228  GLU A OE2   1 
ATOM   1106  N  N     . GLN A 1  229  ? 128.099 156.740 198.141 1.00 99.84  ?  229  GLN A N     1 
ATOM   1107  C  CA    . GLN A 1  229  ? 128.335 157.279 199.471 1.00 99.84  ?  229  GLN A CA    1 
ATOM   1108  C  C     . GLN A 1  229  ? 127.058 157.605 200.224 1.00 99.84  ?  229  GLN A C     1 
ATOM   1109  O  O     . GLN A 1  229  ? 127.131 157.984 201.396 1.00 99.84  ?  229  GLN A O     1 
ATOM   1110  C  CB    . GLN A 1  229  ? 129.212 158.542 199.404 1.00 99.84  ?  229  GLN A CB    1 
ATOM   1111  C  CG    . GLN A 1  229  ? 128.548 159.770 198.792 1.00 99.84  ?  229  GLN A CG    1 
ATOM   1112  C  CD    . GLN A 1  229  ? 128.588 159.772 197.272 1.00 99.84  ?  229  GLN A CD    1 
ATOM   1113  O  OE1   . GLN A 1  229  ? 128.094 158.853 196.619 1.00 99.84  ?  229  GLN A OE1   1 
ATOM   1114  N  NE2   . GLN A 1  229  ? 129.177 160.815 196.703 1.00 99.84  ?  229  GLN A NE2   1 
ATOM   1115  N  N     . GLY A 1  230  ? 125.902 157.477 199.587 1.00 99.67  ?  230  GLY A N     1 
ATOM   1116  C  CA    . GLY A 1  230  ? 124.641 157.565 200.285 1.00 99.67  ?  230  GLY A CA    1 
ATOM   1117  C  C     . GLY A 1  230  ? 124.277 156.234 200.909 1.00 99.67  ?  230  GLY A C     1 
ATOM   1118  O  O     . GLY A 1  230  ? 125.067 155.288 200.960 1.00 99.67  ?  230  GLY A O     1 
ATOM   1119  N  N     . ILE A 1  231  ? 123.051 156.158 201.390 1.00 110.18 ?  231  ILE A N     1 
ATOM   1120  C  CA    . ILE A 1  231  ? 122.604 154.956 202.081 1.00 110.18 ?  231  ILE A CA    1 
ATOM   1121  C  C     . ILE A 1  231  ? 122.103 153.926 201.075 1.00 110.18 ?  231  ILE A C     1 
ATOM   1122  O  O     . ILE A 1  231  ? 121.394 154.250 200.112 1.00 110.18 ?  231  ILE A O     1 
ATOM   1123  C  CB    . ILE A 1  231  ? 121.538 155.305 203.140 1.00 110.18 ?  231  ILE A CB    1 
ATOM   1124  C  CG1   . ILE A 1  231  ? 120.378 156.093 202.535 1.00 110.18 ?  231  ILE A CG1   1 
ATOM   1125  C  CG2   . ILE A 1  231  ? 122.161 156.082 204.290 1.00 110.18 ?  231  ILE A CG2   1 
ATOM   1126  C  CD1   . ILE A 1  231  ? 119.095 155.891 203.256 1.00 110.18 ?  231  ILE A CD1   1 
ATOM   1127  N  N     . ARG A 1  232  ? 122.502 152.676 201.279 1.00 100.53 ?  232  ARG A N     1 
ATOM   1128  C  CA    . ARG A 1  232  ? 121.963 151.559 200.514 1.00 100.53 ?  232  ARG A CA    1 
ATOM   1129  C  C     . ARG A 1  232  ? 121.556 150.440 201.461 1.00 100.53 ?  232  ARG A C     1 
ATOM   1130  O  O     . ARG A 1  232  ? 121.476 149.270 201.088 1.00 100.53 ?  232  ARG A O     1 
ATOM   1131  C  CB    . ARG A 1  232  ? 122.947 151.056 199.463 1.00 100.53 ?  232  ARG A CB    1 
ATOM   1132  C  CG    . ARG A 1  232  ? 122.266 150.770 198.135 1.00 100.53 ?  232  ARG A CG    1 
ATOM   1133  C  CD    . ARG A 1  232  ? 123.255 150.446 197.030 1.00 100.53 ?  232  ARG A CD    1 
ATOM   1134  N  NE    . ARG A 1  232  ? 122.583 149.992 195.815 1.00 100.53 ?  232  ARG A NE    1 
ATOM   1135  C  CZ    . ARG A 1  232  ? 123.201 149.396 194.802 1.00 100.53 ?  232  ARG A CZ    1 
ATOM   1136  N  NH1   . ARG A 1  232  ? 124.510 149.193 194.851 1.00 100.53 1  232  ARG A NH1   1 
ATOM   1137  N  NH2   . ARG A 1  232  ? 122.516 149.011 193.735 1.00 100.53 ?  232  ARG A NH2   1 
ATOM   1138  N  N     . VAL A 1  233  ? 121.267 150.806 202.706 1.00 92.08  ?  233  VAL A N     1 
ATOM   1139  C  CA    . VAL A 1  233  ? 120.613 149.904 203.645 1.00 92.08  ?  233  VAL A CA    1 
ATOM   1140  C  C     . VAL A 1  233  ? 119.134 149.958 203.283 1.00 92.08  ?  233  VAL A C     1 
ATOM   1141  O  O     . VAL A 1  233  ? 118.429 150.916 203.608 1.00 92.08  ?  233  VAL A O     1 
ATOM   1142  C  CB    . VAL A 1  233  ? 120.875 150.305 205.100 1.00 92.08  ?  233  VAL A CB    1 
ATOM   1143  C  CG1   . VAL A 1  233  ? 119.997 149.505 206.067 1.00 92.08  ?  233  VAL A CG1   1 
ATOM   1144  C  CG2   . VAL A 1  233  ? 122.350 150.144 205.439 1.00 92.08  ?  233  VAL A CG2   1 
ATOM   1145  N  N     . ALA A 1  234  ? 118.674 148.954 202.540 1.00 88.01  ?  234  ALA A N     1 
ATOM   1146  C  CA    . ALA A 1  234  ? 117.258 148.870 202.188 1.00 88.01  ?  234  ALA A CA    1 
ATOM   1147  C  C     . ALA A 1  234  ? 116.881 147.391 202.216 1.00 88.01  ?  234  ALA A C     1 
ATOM   1148  O  O     . ALA A 1  234  ? 116.991 146.692 201.206 1.00 88.01  ?  234  ALA A O     1 
ATOM   1149  C  CB    . ALA A 1  234  ? 116.985 149.503 200.833 1.00 88.01  ?  234  ALA A CB    1 
ATOM   1150  N  N     . GLY A 1  235  ? 116.434 146.935 203.386 1.00 92.94  ?  235  GLY A N     1 
ATOM   1151  C  CA    . GLY A 1  235  ? 116.051 145.554 203.626 1.00 92.94  ?  235  GLY A CA    1 
ATOM   1152  C  C     . GLY A 1  235  ? 117.136 144.520 203.434 1.00 92.94  ?  235  GLY A C     1 
ATOM   1153  O  O     . GLY A 1  235  ? 116.809 143.331 203.336 1.00 92.94  ?  235  GLY A O     1 
ATOM   1154  N  N     . LEU A 1  236  ? 118.406 144.936 203.418 1.00 98.17  ?  236  LEU A N     1 
ATOM   1155  C  CA    . LEU A 1  236  ? 119.566 144.133 203.027 1.00 98.17  ?  236  LEU A CA    1 
ATOM   1156  C  C     . LEU A 1  236  ? 119.326 143.488 201.656 1.00 98.17  ?  236  LEU A C     1 
ATOM   1157  O  O     . LEU A 1  236  ? 119.149 142.282 201.507 1.00 98.17  ?  236  LEU A O     1 
ATOM   1158  C  CB    . LEU A 1  236  ? 119.919 143.101 204.109 1.00 98.17  ?  236  LEU A CB    1 
ATOM   1159  C  CG    . LEU A 1  236  ? 121.329 142.501 204.252 1.00 98.17  ?  236  LEU A CG    1 
ATOM   1160  C  CD1   . LEU A 1  236  ? 121.475 141.939 205.661 1.00 98.17  ?  236  LEU A CD1   1 
ATOM   1161  C  CD2   . LEU A 1  236  ? 121.700 141.420 203.239 1.00 98.17  ?  236  LEU A CD2   1 
ATOM   1162  N  N     . GLY A 1  237  ? 119.213 144.355 200.662 1.00 99.90  ?  237  GLY A N     1 
ATOM   1163  C  CA    . GLY A 1  237  ? 119.256 143.871 199.304 1.00 99.90  ?  237  GLY A CA    1 
ATOM   1164  C  C     . GLY A 1  237  ? 120.565 144.203 198.624 1.00 99.90  ?  237  GLY A C     1 
ATOM   1165  O  O     . GLY A 1  237  ? 121.188 143.333 198.015 1.00 99.90  ?  237  GLY A O     1 
ATOM   1166  N  N     . THR A 1  238  ? 121.033 145.439 198.772 1.00 104.96 ?  238  THR A N     1 
ATOM   1167  C  CA    . THR A 1  238  ? 122.250 145.902 198.102 1.00 104.96 ?  238  THR A CA    1 
ATOM   1168  C  C     . THR A 1  238  ? 123.170 146.540 199.128 1.00 104.96 ?  238  THR A C     1 
ATOM   1169  O  O     . THR A 1  238  ? 123.139 147.756 199.344 1.00 104.96 ?  238  THR A O     1 
ATOM   1170  C  CB    . THR A 1  238  ? 121.926 146.883 196.970 1.00 104.96 ?  238  THR A CB    1 
ATOM   1171  O  OG1   . THR A 1  238  ? 120.940 147.821 197.410 1.00 104.96 ?  238  THR A OG1   1 
ATOM   1172  C  CG2   . THR A 1  238  ? 121.409 146.159 195.733 1.00 104.96 ?  238  THR A CG2   1 
ATOM   1173  N  N     . PRO A 1  239  ? 124.010 145.745 199.782 1.00 109.69 ?  239  PRO A N     1 
ATOM   1174  C  CA    . PRO A 1  239  ? 124.971 146.322 200.724 1.00 109.69 ?  239  PRO A CA    1 
ATOM   1175  C  C     . PRO A 1  239  ? 126.047 147.102 199.990 1.00 109.69 ?  239  PRO A C     1 
ATOM   1176  O  O     . PRO A 1  239  ? 126.513 146.707 198.918 1.00 109.69 ?  239  PRO A O     1 
ATOM   1177  C  CB    . PRO A 1  239  ? 125.555 145.096 201.440 1.00 109.69 ?  239  PRO A CB    1 
ATOM   1178  C  CG    . PRO A 1  239  ? 124.641 143.953 201.087 1.00 109.69 ?  239  PRO A CG    1 
ATOM   1179  C  CD    . PRO A 1  239  ? 124.104 144.279 199.736 1.00 109.69 ?  239  PRO A CD    1 
ATOM   1180  N  N     . SER A 1  240  ? 126.423 148.235 200.577 1.00 117.97 ?  240  SER A N     1 
ATOM   1181  C  CA    . SER A 1  240  ? 127.390 149.125 199.951 1.00 117.97 ?  240  SER A CA    1 
ATOM   1182  C  C     . SER A 1  240  ? 128.786 148.504 199.982 1.00 117.97 ?  240  SER A C     1 
ATOM   1183  O  O     . SER A 1  240  ? 129.228 147.992 201.014 1.00 117.97 ?  240  SER A O     1 
ATOM   1184  C  CB    . SER A 1  240  ? 127.387 150.483 200.659 1.00 117.97 ?  240  SER A CB    1 
ATOM   1185  O  OG    . SER A 1  240  ? 126.245 151.242 200.295 1.00 117.97 ?  240  SER A OG    1 
ATOM   1186  N  N     . PHE A 1  241  ? 129.490 148.543 198.845 1.00 124.88 ?  241  PHE A N     1 
ATOM   1187  C  CA    . PHE A 1  241  ? 129.064 149.251 197.632 1.00 124.88 ?  241  PHE A CA    1 
ATOM   1188  C  C     . PHE A 1  241  ? 129.147 148.399 196.367 1.00 124.88 ?  241  PHE A C     1 
ATOM   1189  O  O     . PHE A 1  241  ? 129.944 147.466 196.278 1.00 124.88 ?  241  PHE A O     1 
ATOM   1190  C  CB    . PHE A 1  241  ? 129.901 150.525 197.446 1.00 124.88 ?  241  PHE A CB    1 
ATOM   1191  C  CG    . PHE A 1  241  ? 131.259 150.284 196.833 1.00 124.88 ?  241  PHE A CG    1 
ATOM   1192  C  CD1   . PHE A 1  241  ? 132.270 149.678 197.566 1.00 124.88 ?  241  PHE A CD1   1 
ATOM   1193  C  CD2   . PHE A 1  241  ? 131.527 150.679 195.528 1.00 124.88 ?  241  PHE A CD2   1 
ATOM   1194  C  CE1   . PHE A 1  241  ? 133.517 149.457 197.007 1.00 124.88 ?  241  PHE A CE1   1 
ATOM   1195  C  CE2   . PHE A 1  241  ? 132.772 150.459 194.962 1.00 124.88 ?  241  PHE A CE2   1 
ATOM   1196  C  CZ    . PHE A 1  241  ? 133.768 149.849 195.705 1.00 124.88 ?  241  PHE A CZ    1 
ATOM   1197  N  N     . ALA A 1  242  ? 128.306 148.737 195.393 1.00 107.86 ?  242  ALA A N     1 
ATOM   1198  C  CA    . ALA A 1  242  ? 128.428 148.251 194.034 1.00 107.86 ?  242  ALA A CA    1 
ATOM   1199  C  C     . ALA A 1  242  ? 128.666 149.440 193.115 1.00 107.86 ?  242  ALA A C     1 
ATOM   1200  O  O     . ALA A 1  242  ? 127.930 150.433 193.199 1.00 107.86 ?  242  ALA A O     1 
ATOM   1201  C  CB    . ALA A 1  242  ? 127.175 147.486 193.600 1.00 107.86 ?  242  ALA A CB    1 
ATOM   1202  N  N     . PRO A 1  243  ? 129.674 149.399 192.251 1.00 90.57  ?  243  PRO A N     1 
ATOM   1203  C  CA    . PRO A 1  243  ? 130.026 150.598 191.483 1.00 90.57  ?  243  PRO A CA    1 
ATOM   1204  C  C     . PRO A 1  243  ? 129.101 150.852 190.306 1.00 90.57  ?  243  PRO A C     1 
ATOM   1205  O  O     . PRO A 1  243  ? 128.382 149.957 189.854 1.00 90.57  ?  243  PRO A O     1 
ATOM   1206  C  CB    . PRO A 1  243  ? 131.457 150.304 191.007 1.00 90.57  ?  243  PRO A CB    1 
ATOM   1207  C  CG    . PRO A 1  243  ? 131.877 149.048 191.711 1.00 90.57  ?  243  PRO A CG    1 
ATOM   1208  C  CD    . PRO A 1  243  ? 130.618 148.307 191.999 1.00 90.57  ?  243  PRO A CD    1 
ATOM   1209  N  N     . TYR A 1  244  ? 129.127 152.079 189.805 1.00 70.13  ?  244  TYR A N     1 
ATOM   1210  C  CA    . TYR A 1  244  ? 128.374 152.477 188.631 1.00 70.13  ?  244  TYR A CA    1 
ATOM   1211  C  C     . TYR A 1  244  ? 129.199 152.205 187.379 1.00 70.13  ?  244  TYR A C     1 
ATOM   1212  O  O     . TYR A 1  244  ? 130.413 152.416 187.357 1.00 70.13  ?  244  TYR A O     1 
ATOM   1213  C  CB    . TYR A 1  244  ? 127.983 153.958 188.704 1.00 70.13  ?  244  TYR A CB    1 
ATOM   1214  C  CG    . TYR A 1  244  ? 129.111 154.904 189.066 1.00 70.13  ?  244  TYR A CG    1 
ATOM   1215  C  CD1   . TYR A 1  244  ? 129.387 155.212 190.388 1.00 70.13  ?  244  TYR A CD1   1 
ATOM   1216  C  CD2   . TYR A 1  244  ? 129.886 155.502 188.085 1.00 70.13  ?  244  TYR A CD2   1 
ATOM   1217  C  CE1   . TYR A 1  244  ? 130.410 156.071 190.730 1.00 70.13  ?  244  TYR A CE1   1 
ATOM   1218  C  CE2   . TYR A 1  244  ? 130.923 156.369 188.414 1.00 70.13  ?  244  TYR A CE2   1 
ATOM   1219  C  CZ    . TYR A 1  244  ? 131.175 156.648 189.744 1.00 70.13  ?  244  TYR A CZ    1 
ATOM   1220  O  OH    . TYR A 1  244  ? 132.194 157.506 190.087 1.00 70.13  ?  244  TYR A OH    1 
ATOM   1221  N  N     . GLU A 1  245  ? 128.537 151.702 186.344 1.00 47.29  ?  245  GLU A N     1 
ATOM   1222  C  CA    . GLU A 1  245  ? 129.177 151.402 185.071 1.00 47.29  ?  245  GLU A CA    1 
ATOM   1223  C  C     . GLU A 1  245  ? 128.392 152.061 183.945 1.00 47.29  ?  245  GLU A C     1 
ATOM   1224  O  O     . GLU A 1  245  ? 127.161 152.089 183.968 1.00 47.29  ?  245  GLU A O     1 
ATOM   1225  C  CB    . GLU A 1  245  ? 129.294 149.883 184.839 1.00 47.29  ?  245  GLU A CB    1 
ATOM   1226  C  CG    . GLU A 1  245  ? 129.931 149.117 186.003 1.00 47.29  ?  245  GLU A CG    1 
ATOM   1227  C  CD    . GLU A 1  245  ? 130.827 147.975 185.563 1.00 47.29  ?  245  GLU A CD    1 
ATOM   1228  O  OE1   . GLU A 1  245  ? 131.313 147.226 186.433 1.00 47.29  ?  245  GLU A OE1   1 
ATOM   1229  O  OE2   . GLU A 1  245  ? 131.053 147.825 184.348 1.00 47.29  -1 245  GLU A OE2   1 
ATOM   1230  N  N     . ALA A 1  246  ? 129.133 152.616 182.982 1.00 41.82  ?  246  ALA A N     1 
ATOM   1231  C  CA    . ALA A 1  246  ? 128.609 153.268 181.774 1.00 41.82  ?  246  ALA A CA    1 
ATOM   1232  C  C     . ALA A 1  246  ? 127.727 154.466 182.103 1.00 41.82  ?  246  ALA A C     1 
ATOM   1233  O  O     . ALA A 1  246  ? 126.552 154.521 181.743 1.00 41.82  ?  246  ALA A O     1 
ATOM   1234  C  CB    . ALA A 1  246  ? 127.878 152.281 180.856 1.00 41.82  ?  246  ALA A CB    1 
ATOM   1235  N  N     . ASN A 1  247  ? 128.316 155.441 182.786 1.00 41.72  ?  247  ASN A N     1 
ATOM   1236  C  CA    . ASN A 1  247  ? 127.731 156.772 182.936 1.00 41.72  ?  247  ASN A CA    1 
ATOM   1237  C  C     . ASN A 1  247  ? 128.263 157.660 181.811 1.00 41.72  ?  247  ASN A C     1 
ATOM   1238  O  O     . ASN A 1  247  ? 129.388 158.163 181.862 1.00 41.72  ?  247  ASN A O     1 
ATOM   1239  C  CB    . ASN A 1  247  ? 128.072 157.345 184.300 1.00 41.72  ?  247  ASN A CB    1 
ATOM   1240  C  CG    . ASN A 1  247  ? 127.357 158.639 184.590 1.00 41.72  ?  247  ASN A CG    1 
ATOM   1241  O  OD1   . ASN A 1  247  ? 126.557 159.134 183.801 1.00 41.72  ?  247  ASN A OD1   1 
ATOM   1242  N  ND2   . ASN A 1  247  ? 127.676 159.223 185.722 1.00 41.72  ?  247  ASN A ND2   1 
ATOM   1243  N  N     . VAL A 1  248  ? 127.430 157.874 180.788 1.00 36.69  ?  248  VAL A N     1 
ATOM   1244  C  CA    . VAL A 1  248  ? 127.818 158.610 179.584 1.00 36.69  ?  248  VAL A CA    1 
ATOM   1245  C  C     . VAL A 1  248  ? 126.821 159.734 179.317 1.00 36.69  ?  248  VAL A C     1 
ATOM   1246  O  O     . VAL A 1  248  ? 125.874 159.930 180.085 1.00 36.69  ?  248  VAL A O     1 
ATOM   1247  C  CB    . VAL A 1  248  ? 127.913 157.677 178.361 1.00 36.69  ?  248  VAL A CB    1 
ATOM   1248  C  CG1   . VAL A 1  248  ? 128.892 156.551 178.599 1.00 36.69  ?  248  VAL A CG1   1 
ATOM   1249  C  CG2   . VAL A 1  248  ? 126.555 157.119 178.018 1.00 36.69  ?  248  VAL A CG2   1 
ATOM   1250  N  N     . ASP A 1  249  ? 127.014 160.465 178.220 1.00 36.82  ?  249  ASP A N     1 
ATOM   1251  C  CA    . ASP A 1  249  ? 126.184 161.624 177.912 1.00 36.82  ?  249  ASP A CA    1 
ATOM   1252  C  C     . ASP A 1  249  ? 124.909 161.207 177.185 1.00 36.82  ?  249  ASP A C     1 
ATOM   1253  O  O     . ASP A 1  249  ? 124.868 160.193 176.483 1.00 36.82  ?  249  ASP A O     1 
ATOM   1254  C  CB    . ASP A 1  249  ? 126.972 162.635 177.076 1.00 36.82  ?  249  ASP A CB    1 
ATOM   1255  C  CG    . ASP A 1  249  ? 126.318 164.018 177.029 1.00 36.82  ?  249  ASP A CG    1 
ATOM   1256  O  OD1   . ASP A 1  249  ? 125.234 164.216 177.621 1.00 36.82  ?  249  ASP A OD1   1 
ATOM   1257  O  OD2   . ASP A 1  249  ? 126.900 164.916 176.389 1.00 36.82  -1 249  ASP A OD2   1 
ATOM   1258  N  N     . PHE A 1  250  ? 123.872 162.038 177.340 1.00 32.39  ?  250  PHE A N     1 
ATOM   1259  C  CA    . PHE A 1  250  ? 122.510 161.670 176.967 1.00 32.39  ?  250  PHE A CA    1 
ATOM   1260  C  C     . PHE A 1  250  ? 122.356 161.538 175.454 1.00 32.39  ?  250  PHE A C     1 
ATOM   1261  O  O     . PHE A 1  250  ? 121.919 160.492 174.956 1.00 32.39  ?  250  PHE A O     1 
ATOM   1262  C  CB    . PHE A 1  250  ? 121.545 162.711 177.547 1.00 32.39  ?  250  PHE A CB    1 
ATOM   1263  C  CG    . PHE A 1  250  ? 120.089 162.411 177.324 1.00 32.39  ?  250  PHE A CG    1 
ATOM   1264  C  CD1   . PHE A 1  250  ? 119.610 161.113 177.341 1.00 32.39  ?  250  PHE A CD1   1 
ATOM   1265  C  CD2   . PHE A 1  250  ? 119.181 163.443 177.132 1.00 32.39  ?  250  PHE A CD2   1 
ATOM   1266  C  CE1   . PHE A 1  250  ? 118.272 160.854 177.136 1.00 32.39  ?  250  PHE A CE1   1 
ATOM   1267  C  CE2   . PHE A 1  250  ? 117.851 163.178 176.915 1.00 32.39  ?  250  PHE A CE2   1 
ATOM   1268  C  CZ    . PHE A 1  250  ? 117.396 161.885 176.938 1.00 32.39  ?  250  PHE A CZ    1 
ATOM   1269  N  N     . GLU A 1  251  ? 122.718 162.588 174.711 1.00 33.53  ?  251  GLU A N     1 
ATOM   1270  C  CA    . GLU A 1  251  ? 122.631 162.556 173.251 1.00 33.53  ?  251  GLU A CA    1 
ATOM   1271  C  C     . GLU A 1  251  ? 123.566 161.515 172.654 1.00 33.53  ?  251  GLU A C     1 
ATOM   1272  O  O     . GLU A 1  251  ? 123.225 160.873 171.652 1.00 33.53  ?  251  GLU A O     1 
ATOM   1273  C  CB    . GLU A 1  251  ? 122.946 163.937 172.680 1.00 33.53  ?  251  GLU A CB    1 
ATOM   1274  C  CG    . GLU A 1  251  ? 121.870 164.964 172.935 1.00 33.53  ?  251  GLU A CG    1 
ATOM   1275  C  CD    . GLU A 1  251  ? 122.039 165.701 174.249 1.00 33.53  ?  251  GLU A CD    1 
ATOM   1276  O  OE1   . GLU A 1  251  ? 121.424 166.772 174.406 1.00 33.53  ?  251  GLU A OE1   1 
ATOM   1277  O  OE2   . GLU A 1  251  ? 122.781 165.227 175.127 1.00 33.53  -1 251  GLU A OE2   1 
ATOM   1278  N  N     . ILE A 1  252  ? 124.732 161.305 173.272 1.00 28.64  ?  252  ILE A N     1 
ATOM   1279  C  CA    . ILE A 1  252  ? 125.642 160.262 172.806 1.00 28.64  ?  252  ILE A CA    1 
ATOM   1280  C  C     . ILE A 1  252  ? 125.048 158.882 173.056 1.00 28.64  ?  252  ILE A C     1 
ATOM   1281  O  O     . ILE A 1  252  ? 125.210 157.974 172.235 1.00 28.64  ?  252  ILE A O     1 
ATOM   1282  C  CB    . ILE A 1  252  ? 127.024 160.416 173.464 1.00 28.64  ?  252  ILE A CB    1 
ATOM   1283  C  CG1   . ILE A 1  252  ? 127.519 161.851 173.313 1.00 28.64  ?  252  ILE A CG1   1 
ATOM   1284  C  CG2   . ILE A 1  252  ? 128.036 159.458 172.844 1.00 28.64  ?  252  ILE A CG2   1 
ATOM   1285  C  CD1   . ILE A 1  252  ? 127.736 162.266 171.882 1.00 28.64  ?  252  ILE A CD1   1 
ATOM   1286  N  N     . ARG A 1  253  ? 124.315 158.712 174.166 1.00 30.72  ?  253  ARG A N     1 
ATOM   1287  C  CA    . ARG A 1  253  ? 123.649 157.438 174.441 1.00 30.72  ?  253  ARG A CA    1 
ATOM   1288  C  C     . ARG A 1  253  ? 122.504 157.184 173.467 1.00 30.72  ?  253  ARG A C     1 
ATOM   1289  O  O     . ARG A 1  253  ? 122.308 156.046 173.030 1.00 30.72  ?  253  ARG A O     1 
ATOM   1290  C  CB    . ARG A 1  253  ? 123.146 157.419 175.885 1.00 30.72  ?  253  ARG A CB    1 
ATOM   1291  C  CG    . ARG A 1  253  ? 122.517 156.117 176.370 1.00 30.72  ?  253  ARG A CG    1 
ATOM   1292  C  CD    . ARG A 1  253  ? 123.508 155.157 176.978 1.00 30.72  ?  253  ARG A CD    1 
ATOM   1293  N  NE    . ARG A 1  253  ? 123.963 154.145 176.036 1.00 30.72  ?  253  ARG A NE    1 
ATOM   1294  C  CZ    . ARG A 1  253  ? 124.829 153.185 176.339 1.00 30.72  ?  253  ARG A CZ    1 
ATOM   1295  N  NH1   . ARG A 1  253  ? 125.332 153.117 177.557 1.00 30.72  1  253  ARG A NH1   1 
ATOM   1296  N  NH2   . ARG A 1  253  ? 125.190 152.295 175.431 1.00 30.72  ?  253  ARG A NH2   1 
ATOM   1297  N  N     . PHE A 1  254  ? 121.779 158.242 173.090 1.00 27.59  ?  254  PHE A N     1 
ATOM   1298  C  CA    . PHE A 1  254  ? 120.752 158.152 172.051 1.00 27.59  ?  254  PHE A CA    1 
ATOM   1299  C  C     . PHE A 1  254  ? 121.336 157.719 170.709 1.00 27.59  ?  254  PHE A C     1 
ATOM   1300  O  O     . PHE A 1  254  ? 120.811 156.812 170.046 1.00 27.59  ?  254  PHE A O     1 
ATOM   1301  C  CB    . PHE A 1  254  ? 120.068 159.511 171.922 1.00 27.59  ?  254  PHE A CB    1 
ATOM   1302  C  CG    . PHE A 1  254  ? 118.859 159.511 171.041 1.00 27.59  ?  254  PHE A CG    1 
ATOM   1303  C  CD1   . PHE A 1  254  ? 117.635 159.078 171.522 1.00 27.59  ?  254  PHE A CD1   1 
ATOM   1304  C  CD2   . PHE A 1  254  ? 118.934 159.970 169.739 1.00 27.59  ?  254  PHE A CD2   1 
ATOM   1305  C  CE1   . PHE A 1  254  ? 116.510 159.092 170.718 1.00 27.59  ?  254  PHE A CE1   1 
ATOM   1306  C  CE2   . PHE A 1  254  ? 117.808 159.985 168.931 1.00 27.59  ?  254  PHE A CE2   1 
ATOM   1307  C  CZ    . PHE A 1  254  ? 116.599 159.542 169.423 1.00 27.59  ?  254  PHE A CZ    1 
ATOM   1308  N  N     . MET A 1  255  ? 122.435 158.348 170.306 1.00 26.04  ?  255  MET A N     1 
ATOM   1309  C  CA    . MET A 1  255  ? 123.038 158.044 169.019 1.00 26.04  ?  255  MET A CA    1 
ATOM   1310  C  C     . MET A 1  255  ? 123.728 156.687 169.006 1.00 26.04  ?  255  MET A C     1 
ATOM   1311  O  O     . MET A 1  255  ? 123.753 156.027 167.965 1.00 26.04  ?  255  MET A O     1 
ATOM   1312  C  CB    . MET A 1  255  ? 124.003 159.162 168.642 1.00 26.04  ?  255  MET A CB    1 
ATOM   1313  C  CG    . MET A 1  255  ? 123.303 160.488 168.416 1.00 26.04  ?  255  MET A CG    1 
ATOM   1314  S  SD    . MET A 1  255  ? 124.354 161.941 168.561 1.00 26.04  ?  255  MET A SD    1 
ATOM   1315  C  CE    . MET A 1  255  ? 124.919 162.112 166.875 1.00 26.04  ?  255  MET A CE    1 
ATOM   1316  N  N     . VAL A 1  256  ? 124.278 156.249 170.137 1.00 27.11  ?  256  VAL A N     1 
ATOM   1317  C  CA    . VAL A 1  256  ? 124.821 154.901 170.233 1.00 27.11  ?  256  VAL A CA    1 
ATOM   1318  C  C     . VAL A 1  256  ? 123.694 153.873 170.190 1.00 27.11  ?  256  VAL A C     1 
ATOM   1319  O  O     . VAL A 1  256  ? 123.839 152.806 169.572 1.00 27.11  ?  256  VAL A O     1 
ATOM   1320  C  CB    . VAL A 1  256  ? 125.688 154.790 171.505 1.00 27.11  ?  256  VAL A CB    1 
ATOM   1321  C  CG1   . VAL A 1  256  ? 125.910 153.353 171.928 1.00 27.11  ?  256  VAL A CG1   1 
ATOM   1322  C  CG2   . VAL A 1  256  ? 127.015 155.453 171.279 1.00 27.11  ?  256  VAL A CG2   1 
ATOM   1323  N  N     . ASP A 1  257  ? 122.537 154.206 170.784 1.00 32.43  ?  257  ASP A N     1 
ATOM   1324  C  CA    . ASP A 1  257  ? 121.367 153.335 170.746 1.00 32.43  ?  257  ASP A CA    1 
ATOM   1325  C  C     . ASP A 1  257  ? 120.855 153.105 169.330 1.00 32.43  ?  257  ASP A C     1 
ATOM   1326  O  O     . ASP A 1  257  ? 120.763 151.957 168.887 1.00 32.43  ?  257  ASP A O     1 
ATOM   1327  C  CB    . ASP A 1  257  ? 120.251 153.933 171.596 1.00 32.43  ?  257  ASP A CB    1 
ATOM   1328  C  CG    . ASP A 1  257  ? 120.370 153.567 173.048 1.00 32.43  ?  257  ASP A CG    1 
ATOM   1329  O  OD1   . ASP A 1  257  ? 121.454 153.103 173.449 1.00 32.43  ?  257  ASP A OD1   1 
ATOM   1330  O  OD2   . ASP A 1  257  ? 119.382 153.728 173.787 1.00 32.43  -1 257  ASP A OD2   1 
ATOM   1331  N  N     . THR A 1  258  ? 120.546 154.172 168.598 1.00 33.65  ?  258  THR A N     1 
ATOM   1332  C  CA    . THR A 1  258  ? 119.826 154.023 167.346 1.00 33.65  ?  258  THR A CA    1 
ATOM   1333  C  C     . THR A 1  258  ? 120.686 154.033 166.087 1.00 33.65  ?  258  THR A C     1 
ATOM   1334  O  O     . THR A 1  258  ? 120.120 154.022 164.990 1.00 33.65  ?  258  THR A O     1 
ATOM   1335  C  CB    . THR A 1  258  ? 118.762 155.118 167.236 1.00 33.65  ?  258  THR A CB    1 
ATOM   1336  O  OG1   . THR A 1  258  ? 119.395 156.399 167.285 1.00 33.65  ?  258  THR A OG1   1 
ATOM   1337  C  CG2   . THR A 1  258  ? 117.786 155.015 168.386 1.00 33.65  ?  258  THR A CG2   1 
ATOM   1338  N  N     . ASP A 1  259  ? 122.021 154.062 166.214 1.00 35.77  ?  259  ASP A N     1 
ATOM   1339  C  CA    . ASP A 1  259  ? 122.985 154.085 165.095 1.00 35.77  ?  259  ASP A CA    1 
ATOM   1340  C  C     . ASP A 1  259  ? 122.807 155.309 164.193 1.00 35.77  ?  259  ASP A C     1 
ATOM   1341  O  O     . ASP A 1  259  ? 122.811 155.213 162.968 1.00 35.77  ?  259  ASP A O     1 
ATOM   1342  C  CB    . ASP A 1  259  ? 122.944 152.790 164.273 1.00 35.77  ?  259  ASP A CB    1 
ATOM   1343  C  CG    . ASP A 1  259  ? 123.664 151.652 164.946 1.00 35.77  ?  259  ASP A CG    1 
ATOM   1344  O  OD1   . ASP A 1  259  ? 123.971 151.759 166.151 1.00 35.77  ?  259  ASP A OD1   1 
ATOM   1345  O  OD2   . ASP A 1  259  ? 123.934 150.640 164.269 1.00 35.77  -1 259  ASP A OD2   1 
ATOM   1346  N  N     . ILE A 1  260  ? 122.672 156.461 164.797 1.00 27.39  ?  260  ILE A N     1 
ATOM   1347  C  CA    . ILE A 1  260  ? 122.663 157.709 164.053 1.00 27.39  ?  260  ILE A CA    1 
ATOM   1348  C  C     . ILE A 1  260  ? 123.957 158.454 164.336 1.00 27.39  ?  260  ILE A C     1 
ATOM   1349  O  O     . ILE A 1  260  ? 124.434 158.506 165.470 1.00 27.39  ?  260  ILE A O     1 
ATOM   1350  C  CB    . ILE A 1  260  ? 121.402 158.544 164.369 1.00 27.39  ?  260  ILE A CB    1 
ATOM   1351  C  CG1   . ILE A 1  260  ? 121.247 158.808 165.853 1.00 27.39  ?  260  ILE A CG1   1 
ATOM   1352  C  CG2   . ILE A 1  260  ? 120.161 157.836 163.909 1.00 27.39  ?  260  ILE A CG2   1 
ATOM   1353  C  CD1   . ILE A 1  260  ? 120.124 159.767 166.165 1.00 27.39  ?  260  ILE A CD1   1 
ATOM   1354  N  N     . VAL A 1  261  ? 124.569 158.987 163.280 1.00 24.47  ?  261  VAL A N     1 
ATOM   1355  C  CA    . VAL A 1  261  ? 125.886 159.611 163.372 1.00 24.47  ?  261  VAL A CA    1 
ATOM   1356  C  C     . VAL A 1  261  ? 125.739 161.085 163.025 1.00 24.47  ?  261  VAL A C     1 
ATOM   1357  O  O     . VAL A 1  261  ? 124.622 161.564 162.802 1.00 24.47  ?  261  VAL A O     1 
ATOM   1358  C  CB    . VAL A 1  261  ? 126.918 158.911 162.465 1.00 24.47  ?  261  VAL A CB    1 
ATOM   1359  C  CG1   . VAL A 1  261  ? 126.932 157.418 162.725 1.00 24.47  ?  261  VAL A CG1   1 
ATOM   1360  C  CG2   . VAL A 1  261  ? 126.623 159.167 161.011 1.00 24.47  ?  261  VAL A CG2   1 
ATOM   1361  N  N     . GLY A 1  262  ? 126.842 161.827 163.036 1.00 20.68  ?  262  GLY A N     1 
ATOM   1362  C  CA    . GLY A 1  262  ? 126.778 163.231 162.678 1.00 20.68  ?  262  GLY A CA    1 
ATOM   1363  C  C     . GLY A 1  262  ? 126.468 163.385 161.205 1.00 20.68  ?  262  GLY A C     1 
ATOM   1364  O  O     . GLY A 1  262  ? 127.020 162.663 160.366 1.00 20.68  ?  262  GLY A O     1 
ATOM   1365  N  N     . CYS A 1  263  ? 125.547 164.308 160.892 1.00 26.37  ?  263  CYS A N     1 
ATOM   1366  C  CA    . CYS A 1  263  ? 125.136 164.701 159.536 1.00 26.37  ?  263  CYS A CA    1 
ATOM   1367  C  C     . CYS A 1  263  ? 124.662 163.495 158.717 1.00 26.37  ?  263  CYS A C     1 
ATOM   1368  O  O     . CYS A 1  263  ? 125.254 163.103 157.719 1.00 26.37  ?  263  CYS A O     1 
ATOM   1369  C  CB    . CYS A 1  263  ? 126.267 165.456 158.832 1.00 26.37  ?  263  CYS A CB    1 
ATOM   1370  S  SG    . CYS A 1  263  ? 126.932 166.793 159.812 1.00 26.37  ?  263  CYS A SG    1 
ATOM   1371  N  N     . ASN A 1  264  ? 123.565 162.919 159.187 1.00 31.09  ?  264  ASN A N     1 
ATOM   1372  C  CA    . ASN A 1  264  ? 123.070 161.629 158.734 1.00 31.09  ?  264  ASN A CA    1 
ATOM   1373  C  C     . ASN A 1  264  ? 121.727 161.779 158.030 1.00 31.09  ?  264  ASN A C     1 
ATOM   1374  O  O     . ASN A 1  264  ? 121.015 162.762 158.221 1.00 31.09  ?  264  ASN A O     1 
ATOM   1375  C  CB    . ASN A 1  264  ? 122.933 160.685 159.929 1.00 31.09  ?  264  ASN A CB    1 
ATOM   1376  C  CG    . ASN A 1  264  ? 123.063 159.248 159.548 1.00 31.09  ?  264  ASN A CG    1 
ATOM   1377  O  OD1   . ASN A 1  264  ? 123.573 158.915 158.481 1.00 31.09  ?  264  ASN A OD1   1 
ATOM   1378  N  ND2   . ASN A 1  264  ? 122.602 158.375 160.419 1.00 31.09  ?  264  ASN A ND2   1 
ATOM   1379  N  N     . TRP A 1  265  ? 121.373 160.774 157.229 1.00 33.04  ?  265  TRP A N     1 
ATOM   1380  C  CA    . TRP A 1  265  ? 120.092 160.752 156.524 1.00 33.04  ?  265  TRP A CA    1 
ATOM   1381  C  C     . TRP A 1  265  ? 119.061 159.980 157.343 1.00 33.04  ?  265  TRP A C     1 
ATOM   1382  O  O     . TRP A 1  265  ? 119.249 158.789 157.625 1.00 33.04  ?  265  TRP A O     1 
ATOM   1383  C  CB    . TRP A 1  265  ? 120.247 160.135 155.136 1.00 33.04  ?  265  TRP A CB    1 
ATOM   1384  C  CG    . TRP A 1  265  ? 120.805 161.087 154.116 1.00 33.04  ?  265  TRP A CG    1 
ATOM   1385  C  CD1   . TRP A 1  265  ? 122.038 161.031 153.535 1.00 33.04  ?  265  TRP A CD1   1 
ATOM   1386  C  CD2   . TRP A 1  265  ? 120.151 162.234 153.552 1.00 33.04  ?  265  TRP A CD2   1 
ATOM   1387  N  NE1   . TRP A 1  265  ? 122.191 162.065 152.652 1.00 33.04  ?  265  TRP A NE1   1 
ATOM   1388  C  CE2   . TRP A 1  265  ? 121.048 162.819 152.643 1.00 33.04  ?  265  TRP A CE2   1 
ATOM   1389  C  CE3   . TRP A 1  265  ? 118.897 162.817 153.726 1.00 33.04  ?  265  TRP A CE3   1 
ATOM   1390  C  CZ2   . TRP A 1  265  ? 120.731 163.964 151.917 1.00 33.04  ?  265  TRP A CZ2   1 
ATOM   1391  C  CZ3   . TRP A 1  265  ? 118.587 163.954 152.997 1.00 33.04  ?  265  TRP A CZ3   1 
ATOM   1392  C  CH2   . TRP A 1  265  ? 119.498 164.514 152.110 1.00 33.04  ?  265  TRP A CH2   1 
ATOM   1393  N  N     . LEU A 1  266  ? 117.971 160.658 157.713 1.00 29.64  ?  266  LEU A N     1 
ATOM   1394  C  CA    . LEU A 1  266  ? 116.957 160.124 158.612 1.00 29.64  ?  266  LEU A CA    1 
ATOM   1395  C  C     . LEU A 1  266  ? 115.623 160.065 157.891 1.00 29.64  ?  266  LEU A C     1 
ATOM   1396  O  O     . LEU A 1  266  ? 115.288 160.970 157.116 1.00 29.64  ?  266  LEU A O     1 
ATOM   1397  C  CB    . LEU A 1  266  ? 116.822 160.983 159.868 1.00 29.64  ?  266  LEU A CB    1 
ATOM   1398  C  CG    . LEU A 1  266  ? 118.015 161.012 160.815 1.00 29.64  ?  266  LEU A CG    1 
ATOM   1399  C  CD1   . LEU A 1  266  ? 117.615 161.649 162.122 1.00 29.64  ?  266  LEU A CD1   1 
ATOM   1400  C  CD2   . LEU A 1  266  ? 118.557 159.623 161.038 1.00 29.64  ?  266  LEU A CD2   1 
ATOM   1401  N  N     . GLU A 1  267  ? 114.854 159.017 158.177 1.00 32.44  ?  267  GLU A N     1 
ATOM   1402  C  CA    . GLU A 1  267  ? 113.626 158.720 157.457 1.00 32.44  ?  267  GLU A CA    1 
ATOM   1403  C  C     . GLU A 1  267  ? 112.497 158.409 158.425 1.00 32.44  ?  267  GLU A C     1 
ATOM   1404  O  O     . GLU A 1  267  ? 112.638 157.544 159.295 1.00 32.44  ?  267  GLU A O     1 
ATOM   1405  C  CB    . GLU A 1  267  ? 113.848 157.545 156.512 1.00 32.44  ?  267  GLU A CB    1 
ATOM   1406  C  CG    . GLU A 1  267  ? 112.610 157.069 155.803 1.00 32.44  ?  267  GLU A CG    1 
ATOM   1407  C  CD    . GLU A 1  267  ? 112.944 156.071 154.726 1.00 32.44  ?  267  GLU A CD    1 
ATOM   1408  O  OE1   . GLU A 1  267  ? 113.836 156.365 153.906 1.00 32.44  ?  267  GLU A OE1   1 
ATOM   1409  O  OE2   . GLU A 1  267  ? 112.331 154.986 154.709 1.00 32.44  -1 267  GLU A OE2   1 
ATOM   1410  N  N     . LEU A 1  268  ? 111.384 159.122 158.269 1.00 30.55  ?  268  LEU A N     1 
ATOM   1411  C  CA    . LEU A 1  268  ? 110.144 158.827 158.974 1.00 30.55  ?  268  LEU A CA    1 
ATOM   1412  C  C     . LEU A 1  268  ? 109.209 158.098 158.031 1.00 30.55  ?  268  LEU A C     1 
ATOM   1413  O  O     . LEU A 1  268  ? 108.811 158.680 157.012 1.00 30.55  ?  268  LEU A O     1 
ATOM   1414  C  CB    . LEU A 1  268  ? 109.480 160.103 159.476 1.00 30.55  ?  268  LEU A CB    1 
ATOM   1415  C  CG    . LEU A 1  268  ? 110.342 161.140 160.177 1.00 30.55  ?  268  LEU A CG    1 
ATOM   1416  C  CD1   . LEU A 1  268  ? 109.558 162.393 160.439 1.00 30.55  ?  268  LEU A CD1   1 
ATOM   1417  C  CD2   . LEU A 1  268  ? 110.863 160.581 161.465 1.00 30.55  ?  268  LEU A CD2   1 
ATOM   1418  N  N     . PRO A 1  269  ? 108.819 156.859 158.322 1.00 37.38  ?  269  PRO A N     1 
ATOM   1419  C  CA    . PRO A 1  269  ? 107.990 156.093 157.385 1.00 37.38  ?  269  PRO A CA    1 
ATOM   1420  C  C     . PRO A 1  269  ? 106.549 156.577 157.389 1.00 37.38  ?  269  PRO A C     1 
ATOM   1421  O  O     . PRO A 1  269  ? 106.147 157.432 158.179 1.00 37.38  ?  269  PRO A O     1 
ATOM   1422  C  CB    . PRO A 1  269  ? 108.092 154.656 157.904 1.00 37.38  ?  269  PRO A CB    1 
ATOM   1423  C  CG    . PRO A 1  269  ? 109.200 154.677 158.922 1.00 37.38  ?  269  PRO A CG    1 
ATOM   1424  C  CD    . PRO A 1  269  ? 109.202 156.050 159.486 1.00 37.38  ?  269  PRO A CD    1 
ATOM   1425  N  N     . ALA A 1  270  ? 105.762 155.995 156.487 1.00 38.44  ?  270  ALA A N     1 
ATOM   1426  C  CA    . ALA A 1  270  ? 104.403 156.455 156.243 1.00 38.44  ?  270  ALA A CA    1 
ATOM   1427  C  C     . ALA A 1  270  ? 103.470 156.009 157.360 1.00 38.44  ?  270  ALA A C     1 
ATOM   1428  O  O     . ALA A 1  270  ? 103.495 154.849 157.777 1.00 38.44  ?  270  ALA A O     1 
ATOM   1429  C  CB    . ALA A 1  270  ? 103.906 155.933 154.897 1.00 38.44  ?  270  ALA A CB    1 
ATOM   1430  N  N     . GLY A 1  271  ? 102.638 156.932 157.835 1.00 39.04  ?  271  GLY A N     1 
ATOM   1431  C  CA    . GLY A 1  271  ? 101.715 156.643 158.910 1.00 39.04  ?  271  GLY A CA    1 
ATOM   1432  C  C     . GLY A 1  271  ? 102.303 156.723 160.298 1.00 39.04  ?  271  GLY A C     1 
ATOM   1433  O  O     . GLY A 1  271  ? 101.576 156.502 161.272 1.00 39.04  ?  271  GLY A O     1 
ATOM   1434  N  N     . LYS A 1  272  ? 103.590 157.044 160.424 1.00 39.73  ?  272  LYS A N     1 
ATOM   1435  C  CA    . LYS A 1  272  ? 104.269 157.039 161.709 1.00 39.73  ?  272  LYS A CA    1 
ATOM   1436  C  C     . LYS A 1  272  ? 104.382 158.413 162.343 1.00 39.73  ?  272  LYS A C     1 
ATOM   1437  O  O     . LYS A 1  272  ? 104.566 158.496 163.559 1.00 39.73  ?  272  LYS A O     1 
ATOM   1438  C  CB    . LYS A 1  272  ? 105.669 156.443 161.568 1.00 39.73  ?  272  LYS A CB    1 
ATOM   1439  C  CG    . LYS A 1  272  ? 105.691 155.028 161.040 1.00 39.73  ?  272  LYS A CG    1 
ATOM   1440  C  CD    . LYS A 1  272  ? 104.724 154.123 161.793 1.00 39.73  ?  272  LYS A CD    1 
ATOM   1441  C  CE    . LYS A 1  272  ? 105.226 152.691 161.814 1.00 39.73  ?  272  LYS A CE    1 
ATOM   1442  N  NZ    . LYS A 1  272  ? 105.835 152.335 160.505 1.00 39.73  1  272  LYS A NZ    1 
ATOM   1443  N  N     . TYR A 1  273  ? 104.264 159.480 161.566 1.00 38.32  ?  273  TYR A N     1 
ATOM   1444  C  CA    . TYR A 1  273  ? 104.542 160.824 162.040 1.00 38.32  ?  273  TYR A CA    1 
ATOM   1445  C  C     . TYR A 1  273  ? 103.325 161.710 161.839 1.00 38.32  ?  273  TYR A C     1 
ATOM   1446  O  O     . TYR A 1  273  ? 102.558 161.529 160.895 1.00 38.32  ?  273  TYR A O     1 
ATOM   1447  C  CB    . TYR A 1  273  ? 105.753 161.416 161.317 1.00 38.32  ?  273  TYR A CB    1 
ATOM   1448  C  CG    . TYR A 1  273  ? 105.592 161.602 159.820 1.00 38.32  ?  273  TYR A CG    1 
ATOM   1449  C  CD1   . TYR A 1  273  ? 105.808 160.549 158.940 1.00 38.32  ?  273  TYR A CD1   1 
ATOM   1450  C  CD2   . TYR A 1  273  ? 105.260 162.841 159.291 1.00 38.32  ?  273  TYR A CD2   1 
ATOM   1451  C  CE1   . TYR A 1  273  ? 105.669 160.724 157.583 1.00 38.32  ?  273  TYR A CE1   1 
ATOM   1452  C  CE2   . TYR A 1  273  ? 105.123 163.019 157.937 1.00 38.32  ?  273  TYR A CE2   1 
ATOM   1453  C  CZ    . TYR A 1  273  ? 105.326 161.962 157.090 1.00 38.32  ?  273  TYR A CZ    1 
ATOM   1454  O  OH    . TYR A 1  273  ? 105.187 162.153 155.741 1.00 38.32  ?  273  TYR A OH    1 
ATOM   1455  N  N     . ALA A 1  274  ? 103.160 162.681 162.728 1.00 40.51  ?  274  ALA A N     1 
ATOM   1456  C  CA    . ALA A 1  274  ? 102.016 163.583 162.697 1.00 40.51  ?  274  ALA A CA    1 
ATOM   1457  C  C     . ALA A 1  274  ? 102.513 165.018 162.668 1.00 40.51  ?  274  ALA A C     1 
ATOM   1458  O  O     . ALA A 1  274  ? 103.152 165.468 163.620 1.00 40.51  ?  274  ALA A O     1 
ATOM   1459  C  CB    . ALA A 1  274  ? 101.105 163.352 163.905 1.00 40.51  ?  274  ALA A CB    1 
ATOM   1460  N  N     . LEU A 1  275  ? 102.209 165.736 161.583 1.00 44.55  ?  275  LEU A N     1 
ATOM   1461  C  CA    . LEU A 1  275  ? 102.681 167.108 161.433 1.00 44.55  ?  275  LEU A CA    1 
ATOM   1462  C  C     . LEU A 1  275  ? 101.914 168.092 162.296 1.00 44.55  ?  275  LEU A C     1 
ATOM   1463  O  O     . LEU A 1  275  ? 102.531 168.931 162.954 1.00 44.55  ?  275  LEU A O     1 
ATOM   1464  C  CB    . LEU A 1  275  ? 102.575 167.561 159.982 1.00 44.55  ?  275  LEU A CB    1 
ATOM   1465  C  CG    . LEU A 1  275  ? 103.067 166.644 158.871 1.00 44.55  ?  275  LEU A CG    1 
ATOM   1466  C  CD1   . LEU A 1  275  ? 102.590 167.191 157.546 1.00 44.55  ?  275  LEU A CD1   1 
ATOM   1467  C  CD2   . LEU A 1  275  ? 104.586 166.490 158.881 1.00 44.55  ?  275  LEU A CD2   1 
ATOM   1468  N  N     . ARG A 1  276  ? 100.585 168.011 162.302 1.00 58.63  ?  276  ARG A N     1 
ATOM   1469  C  CA    . ARG A 1  276  ? 99.742  168.956 163.024 1.00 58.63  ?  276  ARG A CA    1 
ATOM   1470  C  C     . ARG A 1  276  ? 99.406  168.492 164.435 1.00 58.63  ?  276  ARG A C     1 
ATOM   1471  O  O     . ARG A 1  276  ? 98.496  169.049 165.060 1.00 58.63  ?  276  ARG A O     1 
ATOM   1472  C  CB    . ARG A 1  276  ? 98.462  169.242 162.231 1.00 58.63  ?  276  ARG A CB    1 
ATOM   1473  C  CG    . ARG A 1  276  ? 98.685  169.972 160.895 1.00 58.63  ?  276  ARG A CG    1 
ATOM   1474  C  CD    . ARG A 1  276  ? 99.445  171.276 161.125 1.00 58.63  ?  276  ARG A CD    1 
ATOM   1475  N  NE    . ARG A 1  276  ? 100.863 171.136 160.812 1.00 58.63  ?  276  ARG A NE    1 
ATOM   1476  C  CZ    . ARG A 1  276  ? 101.841 171.641 161.552 1.00 58.63  ?  276  ARG A CZ    1 
ATOM   1477  N  NH1   . ARG A 1  276  ? 101.563 172.277 162.680 1.00 58.63  1  276  ARG A NH1   1 
ATOM   1478  N  NH2   . ARG A 1  276  ? 103.095 171.463 161.186 1.00 58.63  ?  276  ARG A NH2   1 
ATOM   1479  N  N     . LEU A 1  277  ? 100.119 167.488 164.952 1.00 64.74  ?  277  LEU A N     1 
ATOM   1480  C  CA    . LEU A 1  277  ? 100.039 167.198 166.376 1.00 64.74  ?  277  LEU A CA    1 
ATOM   1481  C  C     . LEU A 1  277  ? 100.756 168.270 167.190 1.00 64.74  ?  277  LEU A C     1 
ATOM   1482  O  O     . LEU A 1  277  ? 100.347 168.560 168.320 1.00 64.74  ?  277  LEU A O     1 
ATOM   1483  C  CB    . LEU A 1  277  ? 100.622 165.811 166.654 1.00 64.74  ?  277  LEU A CB    1 
ATOM   1484  C  CG    . LEU A 1  277  ? 100.982 165.320 168.056 1.00 64.74  ?  277  LEU A CG    1 
ATOM   1485  C  CD1   . LEU A 1  277  ? 99.799  165.383 169.017 1.00 64.74  ?  277  LEU A CD1   1 
ATOM   1486  C  CD2   . LEU A 1  277  ? 101.531 163.905 167.981 1.00 64.74  ?  277  LEU A CD2   1 
ATOM   1487  N  N     . LYS A 1  278  ? 101.778 168.899 166.615 1.00 63.61  ?  278  LYS A N     1 
ATOM   1488  C  CA    . LYS A 1  278  ? 102.545 169.949 167.274 1.00 63.61  ?  278  LYS A CA    1 
ATOM   1489  C  C     . LYS A 1  278  ? 102.103 171.301 166.734 1.00 63.61  ?  278  LYS A C     1 
ATOM   1490  O  O     . LYS A 1  278  ? 102.452 171.665 165.604 1.00 63.61  ?  278  LYS A O     1 
ATOM   1491  C  CB    . LYS A 1  278  ? 104.042 169.754 167.062 1.00 63.61  ?  278  LYS A CB    1 
ATOM   1492  C  CG    . LYS A 1  278  ? 104.881 170.699 167.888 1.00 63.61  ?  278  LYS A CG    1 
ATOM   1493  C  CD    . LYS A 1  278  ? 104.839 170.364 169.356 1.00 63.61  ?  278  LYS A CD    1 
ATOM   1494  C  CE    . LYS A 1  278  ? 104.723 171.628 170.192 1.00 63.61  ?  278  LYS A CE    1 
ATOM   1495  N  NZ    . LYS A 1  278  ? 104.613 171.340 171.649 1.00 63.61  1  278  LYS A NZ    1 
ATOM   1496  N  N     . GLU A 1  279  ? 101.326 172.030 167.535 1.00 67.93  ?  279  GLU A N     1 
ATOM   1497  C  CA    . GLU A 1  279  ? 101.091 173.438 167.252 1.00 67.93  ?  279  GLU A CA    1 
ATOM   1498  C  C     . GLU A 1  279  ? 102.408 174.195 167.364 1.00 67.93  ?  279  GLU A C     1 
ATOM   1499  O  O     . GLU A 1  279  ? 103.185 173.977 168.299 1.00 67.93  ?  279  GLU A O     1 
ATOM   1500  C  CB    . GLU A 1  279  ? 100.045 174.015 168.210 1.00 67.93  ?  279  GLU A CB    1 
ATOM   1501  C  CG    . GLU A 1  279  ? 99.601  175.433 167.876 1.00 67.93  ?  279  GLU A CG    1 
ATOM   1502  C  CD    . GLU A 1  279  ? 99.006  175.551 166.486 1.00 67.93  ?  279  GLU A CD    1 
ATOM   1503  O  OE1   . GLU A 1  279  ? 98.227  174.662 166.084 1.00 67.93  ?  279  GLU A OE1   1 
ATOM   1504  O  OE2   . GLU A 1  279  ? 99.325  176.533 165.789 1.00 67.93  -1 279  GLU A OE2   1 
ATOM   1505  N  N     . LYS A 1  280  ? 102.647 175.088 166.404 1.00 51.16  ?  280  LYS A N     1 
ATOM   1506  C  CA    . LYS A 1  280  ? 103.982 175.566 166.044 1.00 51.16  ?  280  LYS A CA    1 
ATOM   1507  C  C     . LYS A 1  280  ? 104.606 176.372 167.172 1.00 51.16  ?  280  LYS A C     1 
ATOM   1508  O  O     . LYS A 1  280  ? 104.166 177.476 167.488 1.00 51.16  ?  280  LYS A O     1 
ATOM   1509  C  CB    . LYS A 1  280  ? 103.901 176.393 164.770 1.00 51.16  ?  280  LYS A CB    1 
ATOM   1510  C  CG    . LYS A 1  280  ? 103.496 175.587 163.568 1.00 51.16  ?  280  LYS A CG    1 
ATOM   1511  C  CD    . LYS A 1  280  ? 104.686 175.234 162.711 1.00 51.16  ?  280  LYS A CD    1 
ATOM   1512  C  CE    . LYS A 1  280  ? 104.217 174.601 161.427 1.00 51.16  ?  280  LYS A CE    1 
ATOM   1513  N  NZ    . LYS A 1  280  ? 105.220 174.669 160.338 1.00 51.16  1  280  LYS A NZ    1 
ATOM   1514  N  N     . ALA A 1  281  ? 105.647 175.809 167.784 1.00 44.21  ?  281  ALA A N     1 
ATOM   1515  C  CA    . ALA A 1  281  ? 106.441 176.501 168.786 1.00 44.21  ?  281  ALA A CA    1 
ATOM   1516  C  C     . ALA A 1  281  ? 107.820 176.908 168.278 1.00 44.21  ?  281  ALA A C     1 
ATOM   1517  O  O     . ALA A 1  281  ? 108.423 177.821 168.848 1.00 44.21  ?  281  ALA A O     1 
ATOM   1518  C  CB    . ALA A 1  281  ? 106.591 175.629 170.037 1.00 44.21  ?  281  ALA A CB    1 
ATOM   1519  N  N     . THR A 1  282  ? 108.329 176.260 167.235 1.00 35.27  ?  282  THR A N     1 
ATOM   1520  C  CA    . THR A 1  282  ? 109.517 176.715 166.538 1.00 35.27  ?  282  THR A CA    1 
ATOM   1521  C  C     . THR A 1  282  ? 109.096 177.414 165.245 1.00 35.27  ?  282  THR A C     1 
ATOM   1522  O  O     . THR A 1  282  ? 107.909 177.620 164.982 1.00 35.27  ?  282  THR A O     1 
ATOM   1523  C  CB    . THR A 1  282  ? 110.474 175.547 166.282 1.00 35.27  ?  282  THR A CB    1 
ATOM   1524  O  OG1   . THR A 1  282  ? 110.012 174.773 165.170 1.00 35.27  ?  282  THR A OG1   1 
ATOM   1525  C  CG2   . THR A 1  282  ? 110.560 174.649 167.508 1.00 35.27  ?  282  THR A CG2   1 
ATOM   1526  N  N     . GLN A 1  283  ? 110.071 177.795 164.424 1.00 29.87  ?  283  GLN A N     1 
ATOM   1527  C  CA    . GLN A 1  283  ? 109.810 178.576 163.222 1.00 29.87  ?  283  GLN A CA    1 
ATOM   1528  C  C     . GLN A 1  283  ? 110.212 177.873 161.932 1.00 29.87  ?  283  GLN A C     1 
ATOM   1529  O  O     . GLN A 1  283  ? 110.456 178.550 160.932 1.00 29.87  ?  283  GLN A O     1 
ATOM   1530  C  CB    . GLN A 1  283  ? 110.529 179.923 163.304 1.00 29.87  ?  283  GLN A CB    1 
ATOM   1531  C  CG    . GLN A 1  283  ? 110.340 180.627 164.608 1.00 29.87  ?  283  GLN A CG    1 
ATOM   1532  C  CD    . GLN A 1  283  ? 110.812 182.045 164.564 1.00 29.87  ?  283  GLN A CD    1 
ATOM   1533  O  OE1   . GLN A 1  283  ? 111.518 182.441 163.644 1.00 29.87  ?  283  GLN A OE1   1 
ATOM   1534  N  NE2   . GLN A 1  283  ? 110.432 182.824 165.562 1.00 29.87  ?  283  GLN A NE2   1 
ATOM   1535  N  N     . CYS A 1  284  ? 110.291 176.552 161.921 1.00 28.48  ?  284  CYS A N     1 
ATOM   1536  C  CA    . CYS A 1  284  ? 110.627 175.855 160.693 1.00 28.48  ?  284  CYS A CA    1 
ATOM   1537  C  C     . CYS A 1  284  ? 109.373 175.604 159.859 1.00 28.48  ?  284  CYS A C     1 
ATOM   1538  O  O     . CYS A 1  284  ? 108.247 175.889 160.270 1.00 28.48  ?  284  CYS A O     1 
ATOM   1539  C  CB    . CYS A 1  284  ? 111.339 174.542 161.007 1.00 28.48  ?  284  CYS A CB    1 
ATOM   1540  S  SG    . CYS A 1  284  ? 112.664 174.704 162.210 1.00 28.48  ?  284  CYS A SG    1 
ATOM   1541  N  N     . GLN A 1  285  ? 109.579 175.060 158.663 1.00 29.57  ?  285  GLN A N     1 
ATOM   1542  C  CA    . GLN A 1  285  ? 108.466 174.840 157.750 1.00 29.57  ?  285  GLN A CA    1 
ATOM   1543  C  C     . GLN A 1  285  ? 107.719 173.556 158.079 1.00 29.57  ?  285  GLN A C     1 
ATOM   1544  O  O     . GLN A 1  285  ? 106.525 173.590 158.383 1.00 29.57  ?  285  GLN A O     1 
ATOM   1545  C  CB    . GLN A 1  285  ? 108.969 174.834 156.309 1.00 29.57  ?  285  GLN A CB    1 
ATOM   1546  C  CG    . GLN A 1  285  ? 109.260 176.232 155.804 1.00 29.57  ?  285  GLN A CG    1 
ATOM   1547  C  CD    . GLN A 1  285  ? 109.810 176.255 154.403 1.00 29.57  ?  285  GLN A CD    1 
ATOM   1548  O  OE1   . GLN A 1  285  ? 110.472 175.318 153.975 1.00 29.57  ?  285  GLN A OE1   1 
ATOM   1549  N  NE2   . GLN A 1  285  ? 109.550 177.333 153.685 1.00 29.57  ?  285  GLN A NE2   1 
ATOM   1550  N  N     . LEU A 1  286  ? 108.401 172.418 158.028 1.00 27.75  ?  286  LEU A N     1 
ATOM   1551  C  CA    . LEU A 1  286  ? 107.817 171.136 158.402 1.00 27.75  ?  286  LEU A CA    1 
ATOM   1552  C  C     . LEU A 1  286  ? 108.150 170.834 159.856 1.00 27.75  ?  286  LEU A C     1 
ATOM   1553  O  O     . LEU A 1  286  ? 109.317 170.874 160.248 1.00 27.75  ?  286  LEU A O     1 
ATOM   1554  C  CB    . LEU A 1  286  ? 108.338 170.016 157.500 1.00 27.75  ?  286  LEU A CB    1 
ATOM   1555  C  CG    . LEU A 1  286  ? 108.217 170.242 155.996 1.00 27.75  ?  286  LEU A CG    1 
ATOM   1556  C  CD1   . LEU A 1  286  ? 108.887 169.138 155.203 1.00 27.75  ?  286  LEU A CD1   1 
ATOM   1557  C  CD2   . LEU A 1  286  ? 106.765 170.368 155.609 1.00 27.75  ?  286  LEU A CD2   1 
ATOM   1558  N  N     . GLU A 1  287  ? 107.132 170.527 160.652 1.00 33.84  ?  287  GLU A N     1 
ATOM   1559  C  CA    . GLU A 1  287  ? 107.344 170.162 162.049 1.00 33.84  ?  287  GLU A CA    1 
ATOM   1560  C  C     . GLU A 1  287  ? 106.644 168.841 162.326 1.00 33.84  ?  287  GLU A C     1 
ATOM   1561  O  O     . GLU A 1  287  ? 105.417 168.797 162.414 1.00 33.84  ?  287  GLU A O     1 
ATOM   1562  C  CB    . GLU A 1  287  ? 106.833 171.245 162.984 1.00 33.84  ?  287  GLU A CB    1 
ATOM   1563  C  CG    . GLU A 1  287  ? 107.042 170.902 164.420 1.00 33.84  ?  287  GLU A CG    1 
ATOM   1564  C  CD    . GLU A 1  287  ? 107.200 172.124 165.268 1.00 33.84  ?  287  GLU A CD    1 
ATOM   1565  O  OE1   . GLU A 1  287  ? 106.998 173.232 164.734 1.00 33.84  ?  287  GLU A OE1   1 
ATOM   1566  O  OE2   . GLU A 1  287  ? 107.536 171.984 166.461 1.00 33.84  -1 287  GLU A OE2   1 
ATOM   1567  N  N     . ALA A 1  288  ? 107.419 167.775 162.474 1.00 36.16  ?  288  ALA A N     1 
ATOM   1568  C  CA    . ALA A 1  288  ? 106.913 166.440 162.745 1.00 36.16  ?  288  ALA A CA    1 
ATOM   1569  C  C     . ALA A 1  288  ? 106.928 166.166 164.241 1.00 36.16  ?  288  ALA A C     1 
ATOM   1570  O  O     . ALA A 1  288  ? 107.481 166.932 165.030 1.00 36.16  ?  288  ALA A O     1 
ATOM   1571  C  CB    . ALA A 1  288  ? 107.743 165.391 162.006 1.00 36.16  ?  288  ALA A CB    1 
ATOM   1572  N  N     . ASP A 1  289  ? 106.293 165.063 164.636 1.00 42.29  ?  289  ASP A N     1 
ATOM   1573  C  CA    . ASP A 1  289  ? 106.159 164.745 166.056 1.00 42.29  ?  289  ASP A CA    1 
ATOM   1574  C  C     . ASP A 1  289  ? 106.100 163.224 166.192 1.00 42.29  ?  289  ASP A C     1 
ATOM   1575  O  O     . ASP A 1  289  ? 105.014 162.648 166.130 1.00 42.29  ?  289  ASP A O     1 
ATOM   1576  C  CB    . ASP A 1  289  ? 104.911 165.415 166.607 1.00 42.29  ?  289  ASP A CB    1 
ATOM   1577  C  CG    . ASP A 1  289  ? 104.992 165.671 168.075 1.00 42.29  ?  289  ASP A CG    1 
ATOM   1578  O  OD1   . ASP A 1  289  ? 105.973 165.228 168.689 1.00 42.29  ?  289  ASP A OD1   1 
ATOM   1579  O  OD2   . ASP A 1  289  ? 104.096 166.345 168.619 1.00 42.29  -1 289  ASP A OD2   1 
ATOM   1580  N  N     . VAL A 1  290  ? 107.257 162.587 166.413 1.00 36.83  ?  290  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1  290  ? 107.440 161.161 166.154 1.00 36.83  ?  290  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1  290  ? 107.842 160.484 167.463 1.00 36.83  ?  290  VAL A C     1 
ATOM   1583  O  O     . VAL A 1  290  ? 108.302 161.141 168.400 1.00 36.83  ?  290  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1  290  ? 108.515 160.958 165.046 1.00 36.83  ?  290  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1  290  ? 108.608 159.523 164.506 1.00 36.83  ?  290  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1  290  ? 108.346 161.941 163.911 1.00 36.83  ?  290  VAL A CG2   1 
ATOM   1587  N  N     . LEU A 1  291  ? 107.633 159.169 167.542 1.00 43.20  ?  291  LEU A N     1 
ATOM   1588  C  CA    . LEU A 1  291  ? 108.095 158.324 168.634 1.00 43.20  ?  291  LEU A CA    1 
ATOM   1589  C  C     . LEU A 1  291  ? 109.465 157.735 168.299 1.00 43.20  ?  291  LEU A C     1 
ATOM   1590  O  O     . LEU A 1  291  ? 109.795 157.519 167.132 1.00 43.20  ?  291  LEU A O     1 
ATOM   1591  C  CB    . LEU A 1  291  ? 107.091 157.201 168.885 1.00 43.20  ?  291  LEU A CB    1 
ATOM   1592  C  CG    . LEU A 1  291  ? 107.102 156.503 170.237 1.00 43.20  ?  291  LEU A CG    1 
ATOM   1593  C  CD1   . LEU A 1  291  ? 106.519 157.400 171.315 1.00 43.20  ?  291  LEU A CD1   1 
ATOM   1594  C  CD2   . LEU A 1  291  ? 106.343 155.190 170.141 1.00 43.20  ?  291  LEU A CD2   1 
ATOM   1595  N  N     . TRP A 1  292  ? 110.257 157.448 169.336 1.00 40.32  ?  292  TRP A N     1 
ATOM   1596  C  CA    . TRP A 1  292  ? 111.682 157.203 169.139 1.00 40.32  ?  292  TRP A CA    1 
ATOM   1597  C  C     . TRP A 1  292  ? 112.013 155.835 168.563 1.00 40.32  ?  292  TRP A C     1 
ATOM   1598  O  O     . TRP A 1  292  ? 113.191 155.554 168.340 1.00 40.32  ?  292  TRP A O     1 
ATOM   1599  C  CB    . TRP A 1  292  ? 112.449 157.406 170.447 1.00 40.32  ?  292  TRP A CB    1 
ATOM   1600  C  CG    . TRP A 1  292  ? 112.332 156.329 171.454 1.00 40.32  ?  292  TRP A CG    1 
ATOM   1601  C  CD1   . TRP A 1  292  ? 111.316 156.140 172.327 1.00 40.32  ?  292  TRP A CD1   1 
ATOM   1602  C  CD2   . TRP A 1  292  ? 113.301 155.318 171.738 1.00 40.32  ?  292  TRP A CD2   1 
ATOM   1603  N  NE1   . TRP A 1  292  ? 111.573 155.058 173.129 1.00 40.32  ?  292  TRP A NE1   1 
ATOM   1604  C  CE2   . TRP A 1  292  ? 112.789 154.537 172.785 1.00 40.32  ?  292  TRP A CE2   1 
ATOM   1605  C  CE3   . TRP A 1  292  ? 114.548 154.994 171.201 1.00 40.32  ?  292  TRP A CE3   1 
ATOM   1606  C  CZ2   . TRP A 1  292  ? 113.477 153.450 173.304 1.00 40.32  ?  292  TRP A CZ2   1 
ATOM   1607  C  CZ3   . TRP A 1  292  ? 115.226 153.916 171.713 1.00 40.32  ?  292  TRP A CZ3   1 
ATOM   1608  C  CH2   . TRP A 1  292  ? 114.691 153.155 172.754 1.00 40.32  ?  292  TRP A CH2   1 
ATOM   1609  N  N     . SER A 1  293  ? 111.031 154.986 168.292 1.00 42.97  ?  293  SER A N     1 
ATOM   1610  C  CA    . SER A 1  293  ? 111.311 153.701 167.671 1.00 42.97  ?  293  SER A CA    1 
ATOM   1611  C  C     . SER A 1  293  ? 110.913 153.658 166.205 1.00 42.97  ?  293  SER A C     1 
ATOM   1612  O  O     . SER A 1  293  ? 111.068 152.612 165.567 1.00 42.97  ?  293  SER A O     1 
ATOM   1613  C  CB    . SER A 1  293  ? 110.601 152.583 168.432 1.00 42.97  ?  293  SER A CB    1 
ATOM   1614  O  OG    . SER A 1  293  ? 110.864 151.328 167.837 1.00 42.97  ?  293  SER A OG    1 
ATOM   1615  N  N     . ASP A 1  294  ? 110.422 154.768 165.654 1.00 44.31  ?  294  ASP A N     1 
ATOM   1616  C  CA    . ASP A 1  294  ? 109.919 154.787 164.289 1.00 44.31  ?  294  ASP A CA    1 
ATOM   1617  C  C     . ASP A 1  294  ? 110.967 155.171 163.263 1.00 44.31  ?  294  ASP A C     1 
ATOM   1618  O  O     . ASP A 1  294  ? 110.798 154.839 162.085 1.00 44.31  ?  294  ASP A O     1 
ATOM   1619  C  CB    . ASP A 1  294  ? 108.741 155.755 164.172 1.00 44.31  ?  294  ASP A CB    1 
ATOM   1620  C  CG    . ASP A 1  294  ? 107.738 155.585 165.288 1.00 44.31  ?  294  ASP A CG    1 
ATOM   1621  O  OD1   . ASP A 1  294  ? 107.677 154.483 165.867 1.00 44.31  ?  294  ASP A OD1   1 
ATOM   1622  O  OD2   . ASP A 1  294  ? 106.999 156.550 165.580 1.00 44.31  -1 294  ASP A OD2   1 
ATOM   1623  N  N     . VAL A 1  295  ? 112.044 155.845 163.683 1.00 35.32  ?  295  VAL A N     1 
ATOM   1624  C  CA    . VAL A 1  295  ? 113.002 156.421 162.748 1.00 35.32  ?  295  VAL A CA    1 
ATOM   1625  C  C     . VAL A 1  295  ? 113.806 155.327 162.054 1.00 35.32  ?  295  VAL A C     1 
ATOM   1626  O  O     . VAL A 1  295  ? 113.977 154.216 162.571 1.00 35.32  ?  295  VAL A O     1 
ATOM   1627  C  CB    . VAL A 1  295  ? 113.929 157.412 163.478 1.00 35.32  ?  295  VAL A CB    1 
ATOM   1628  C  CG1   . VAL A 1  295  ? 113.109 158.474 164.196 1.00 35.32  ?  295  VAL A CG1   1 
ATOM   1629  C  CG2   . VAL A 1  295  ? 114.842 156.696 164.452 1.00 35.32  ?  295  VAL A CG2   1 
ATOM   1630  N  N     . VAL A 1  296  ? 114.260 155.623 160.841 1.00 33.20  ?  296  VAL A N     1 
ATOM   1631  C  CA    . VAL A 1  296  ? 115.182 154.759 160.116 1.00 33.20  ?  296  VAL A CA    1 
ATOM   1632  C  C     . VAL A 1  296  ? 116.416 155.584 159.774 1.00 33.20  ?  296  VAL A C     1 
ATOM   1633  O  O     . VAL A 1  296  ? 116.299 156.686 159.224 1.00 33.20  ?  296  VAL A O     1 
ATOM   1634  C  CB    . VAL A 1  296  ? 114.547 154.164 158.845 1.00 33.20  ?  296  VAL A CB    1 
ATOM   1635  C  CG1   . VAL A 1  296  ? 115.536 153.264 158.117 1.00 33.20  ?  296  VAL A CG1   1 
ATOM   1636  C  CG2   . VAL A 1  296  ? 113.298 153.377 159.186 1.00 33.20  ?  296  VAL A CG2   1 
ATOM   1637  N  N     . SER A 1  297  ? 117.585 155.055 160.109 1.00 33.88  ?  297  SER A N     1 
ATOM   1638  C  CA    . SER A 1  297  ? 118.858 155.702 159.848 1.00 33.88  ?  297  SER A CA    1 
ATOM   1639  C  C     . SER A 1  297  ? 119.511 155.077 158.628 1.00 33.88  ?  297  SER A C     1 
ATOM   1640  O  O     . SER A 1  297  ? 119.651 153.856 158.562 1.00 33.88  ?  297  SER A O     1 
ATOM   1641  C  CB    . SER A 1  297  ? 119.782 155.558 161.051 1.00 33.88  ?  297  SER A CB    1 
ATOM   1642  O  OG    . SER A 1  297  ? 121.133 155.670 160.658 1.00 33.88  ?  297  SER A OG    1 
ATOM   1643  N  N     . HIS A 1  298  ? 119.916 155.907 157.678 1.00 44.39  ?  298  HIS A N     1 
ATOM   1644  C  CA    . HIS A 1  298  ? 120.612 155.357 156.525 1.00 44.39  ?  298  HIS A CA    1 
ATOM   1645  C  C     . HIS A 1  298  ? 122.109 155.529 156.697 1.00 44.39  ?  298  HIS A C     1 
ATOM   1646  O  O     . HIS A 1  298  ? 122.568 156.654 156.926 1.00 44.39  ?  298  HIS A O     1 
ATOM   1647  C  CB    . HIS A 1  298  ? 120.162 156.053 155.249 1.00 44.39  ?  298  HIS A CB    1 
ATOM   1648  C  CG    . HIS A 1  298  ? 118.732 155.804 154.902 1.00 44.39  ?  298  HIS A CG    1 
ATOM   1649  N  ND1   . HIS A 1  298  ? 118.326 154.714 154.165 1.00 44.39  ?  298  HIS A ND1   1 
ATOM   1650  C  CD2   . HIS A 1  298  ? 117.612 156.501 155.196 1.00 44.39  ?  298  HIS A CD2   1 
ATOM   1651  C  CE1   . HIS A 1  298  ? 117.015 154.754 154.017 1.00 44.39  ?  298  HIS A CE1   1 
ATOM   1652  N  NE2   . HIS A 1  298  ? 116.558 155.828 154.632 1.00 44.39  ?  298  HIS A NE2   1 
ATOM   1653  N  N     . PRO A 1  299  ? 122.894 154.463 156.606 1.00 50.55  ?  299  PRO A N     1 
ATOM   1654  C  CA    . PRO A 1  299  ? 124.338 154.597 156.756 1.00 50.55  ?  299  PRO A CA    1 
ATOM   1655  C  C     . PRO A 1  299  ? 124.940 155.266 155.536 1.00 50.55  ?  299  PRO A C     1 
ATOM   1656  O  O     . PRO A 1  299  ? 124.686 154.833 154.403 1.00 50.55  ?  299  PRO A O     1 
ATOM   1657  C  CB    . PRO A 1  299  ? 124.819 153.144 156.893 1.00 50.55  ?  299  PRO A CB    1 
ATOM   1658  C  CG    . PRO A 1  299  ? 123.587 152.345 157.167 1.00 50.55  ?  299  PRO A CG    1 
ATOM   1659  C  CD    . PRO A 1  299  ? 122.485 153.062 156.469 1.00 50.55  ?  299  PRO A CD    1 
ATOM   1660  N  N     . PRO A 1  300  ? 125.727 156.341 155.726 1.00 53.42  ?  300  PRO A N     1 
ATOM   1661  C  CA    . PRO A 1  300  ? 126.268 157.067 154.571 1.00 53.42  ?  300  PRO A CA    1 
ATOM   1662  C  C     . PRO A 1  300  ? 127.296 156.277 153.773 1.00 53.42  ?  300  PRO A C     1 
ATOM   1663  O  O     . PRO A 1  300  ? 128.448 156.105 154.180 1.00 53.42  ?  300  PRO A O     1 
ATOM   1664  C  CB    . PRO A 1  300  ? 126.884 158.324 155.207 1.00 53.42  ?  300  PRO A CB    1 
ATOM   1665  C  CG    . PRO A 1  300  ? 127.006 158.025 156.649 1.00 53.42  ?  300  PRO A CG    1 
ATOM   1666  C  CD    . PRO A 1  300  ? 125.901 157.099 156.976 1.00 53.42  ?  300  PRO A CD    1 
ATOM   1667  N  N     . GLU A 1  301  ? 126.836 155.814 152.607 1.00 65.09  ?  301  GLU A N     1 
ATOM   1668  C  CA    . GLU A 1  301  ? 127.555 155.030 151.608 1.00 65.09  ?  301  GLU A CA    1 
ATOM   1669  C  C     . GLU A 1  301  ? 126.642 154.878 150.394 1.00 65.09  ?  301  GLU A C     1 
ATOM   1670  O  O     . GLU A 1  301  ? 125.415 154.913 150.540 1.00 65.09  ?  301  GLU A O     1 
ATOM   1671  C  CB    . GLU A 1  301  ? 127.964 153.666 152.163 1.00 65.09  ?  301  GLU A CB    1 
ATOM   1672  C  CG    . GLU A 1  301  ? 126.825 152.854 152.738 1.00 65.09  ?  301  GLU A CG    1 
ATOM   1673  C  CD    . GLU A 1  301  ? 126.281 151.848 151.750 1.00 65.09  ?  301  GLU A CD    1 
ATOM   1674  O  OE1   . GLU A 1  301  ? 127.005 151.522 150.787 1.00 65.09  ?  301  GLU A OE1   1 
ATOM   1675  O  OE2   . GLU A 1  301  ? 125.132 151.390 151.932 1.00 65.09  -1 301  GLU A OE2   1 
ATOM   1676  N  N     . GLY A 1  302  ? 127.207 154.703 149.201 1.00 61.24  ?  302  GLY A N     1 
ATOM   1677  C  CA    . GLY A 1  302  ? 126.412 154.633 147.996 1.00 61.24  ?  302  GLY A CA    1 
ATOM   1678  C  C     . GLY A 1  302  ? 125.751 155.960 147.651 1.00 61.24  ?  302  GLY A C     1 
ATOM   1679  O  O     . GLY A 1  302  ? 126.403 157.005 147.607 1.00 61.24  ?  302  GLY A O     1 
ATOM   1680  N  N     . PRO A 1  303  ? 124.436 155.939 147.392 1.00 55.85  ?  303  PRO A N     1 
ATOM   1681  C  CA    . PRO A 1  303  ? 123.712 157.197 147.141 1.00 55.85  ?  303  PRO A CA    1 
ATOM   1682  C  C     . PRO A 1  303  ? 123.504 158.044 148.379 1.00 55.85  ?  303  PRO A C     1 
ATOM   1683  O  O     . PRO A 1  303  ? 123.180 159.229 148.241 1.00 55.85  ?  303  PRO A O     1 
ATOM   1684  C  CB    . PRO A 1  303  ? 122.366 156.722 146.585 1.00 55.85  ?  303  PRO A CB    1 
ATOM   1685  C  CG    . PRO A 1  303  ? 122.202 155.351 147.144 1.00 55.85  ?  303  PRO A CG    1 
ATOM   1686  C  CD    . PRO A 1  303  ? 123.584 154.763 147.142 1.00 55.85  ?  303  PRO A CD    1 
ATOM   1687  N  N     . TRP A 1  304  ? 123.679 157.489 149.576 1.00 53.75  ?  304  TRP A N     1 
ATOM   1688  C  CA    . TRP A 1  304  ? 123.490 158.225 150.819 1.00 53.75  ?  304  TRP A CA    1 
ATOM   1689  C  C     . TRP A 1  304  ? 124.753 158.942 151.268 1.00 53.75  ?  304  TRP A C     1 
ATOM   1690  O  O     . TRP A 1  304  ? 124.887 159.263 152.455 1.00 53.75  ?  304  TRP A O     1 
ATOM   1691  C  CB    . TRP A 1  304  ? 122.988 157.285 151.908 1.00 53.75  ?  304  TRP A CB    1 
ATOM   1692  C  CG    . TRP A 1  304  ? 121.739 156.579 151.513 1.00 53.75  ?  304  TRP A CG    1 
ATOM   1693  C  CD1   . TRP A 1  304  ? 121.607 155.254 151.200 1.00 53.75  ?  304  TRP A CD1   1 
ATOM   1694  C  CD2   . TRP A 1  304  ? 120.437 157.157 151.366 1.00 53.75  ?  304  TRP A CD2   1 
ATOM   1695  N  NE1   . TRP A 1  304  ? 120.306 154.976 150.879 1.00 53.75  ?  304  TRP A NE1   1 
ATOM   1696  C  CE2   . TRP A 1  304  ? 119.566 156.125 150.975 1.00 53.75  ?  304  TRP A CE2   1 
ATOM   1697  C  CE3   . TRP A 1  304  ? 119.923 158.444 151.535 1.00 53.75  ?  304  TRP A CE3   1 
ATOM   1698  C  CZ2   . TRP A 1  304  ? 118.209 156.341 150.749 1.00 53.75  ?  304  TRP A CZ2   1 
ATOM   1699  C  CZ3   . TRP A 1  304  ? 118.577 158.656 151.308 1.00 53.75  ?  304  TRP A CZ3   1 
ATOM   1700  C  CH2   . TRP A 1  304  ? 117.736 157.609 150.920 1.00 53.75  ?  304  TRP A CH2   1 
ATOM   1701  N  N     . GLN A 1  305  ? 125.667 159.214 150.341 1.00 47.92  ?  305  GLN A N     1 
ATOM   1702  C  CA    . GLN A 1  305  ? 126.909 159.920 150.605 1.00 47.92  ?  305  GLN A CA    1 
ATOM   1703  C  C     . GLN A 1  305  ? 126.867 161.368 150.120 1.00 47.92  ?  305  GLN A C     1 
ATOM   1704  O  O     . GLN A 1  305  ? 127.913 162.013 150.027 1.00 47.92  ?  305  GLN A O     1 
ATOM   1705  C  CB    . GLN A 1  305  ? 128.059 159.158 149.946 1.00 47.92  ?  305  GLN A CB    1 
ATOM   1706  C  CG    . GLN A 1  305  ? 129.342 159.174 150.723 1.00 47.92  ?  305  GLN A CG    1 
ATOM   1707  C  CD    . GLN A 1  305  ? 130.379 158.269 150.128 1.00 47.92  ?  305  GLN A CD    1 
ATOM   1708  O  OE1   . GLN A 1  305  ? 130.155 157.647 149.093 1.00 47.92  ?  305  GLN A OE1   1 
ATOM   1709  N  NE2   . GLN A 1  305  ? 131.530 158.188 150.779 1.00 47.92  ?  305  GLN A NE2   1 
ATOM   1710  N  N     . ARG A 1  306  ? 125.686 161.893 149.811 1.00 40.94  ?  306  ARG A N     1 
ATOM   1711  C  CA    . ARG A 1  306  ? 125.564 163.242 149.286 1.00 40.94  ?  306  ARG A CA    1 
ATOM   1712  C  C     . ARG A 1  306  ? 125.629 164.265 150.414 1.00 40.94  ?  306  ARG A C     1 
ATOM   1713  O  O     . ARG A 1  306  ? 125.844 163.934 151.577 1.00 40.94  ?  306  ARG A O     1 
ATOM   1714  C  CB    . ARG A 1  306  ? 124.259 163.398 148.513 1.00 40.94  ?  306  ARG A CB    1 
ATOM   1715  C  CG    . ARG A 1  306  ? 124.043 162.354 147.448 1.00 40.94  ?  306  ARG A CG    1 
ATOM   1716  C  CD    . ARG A 1  306  ? 122.604 162.309 146.996 1.00 40.94  ?  306  ARG A CD    1 
ATOM   1717  N  NE    . ARG A 1  306  ? 121.684 161.956 148.068 1.00 40.94  ?  306  ARG A NE    1 
ATOM   1718  C  CZ    . ARG A 1  306  ? 120.663 161.118 147.923 1.00 40.94  ?  306  ARG A CZ    1 
ATOM   1719  N  NH1   . ARG A 1  306  ? 120.445 160.544 146.754 1.00 40.94  1  306  ARG A NH1   1 
ATOM   1720  N  NH2   . ARG A 1  306  ? 119.863 160.847 148.943 1.00 40.94  ?  306  ARG A NH2   1 
ATOM   1721  N  N     . ILE A 1  307  ? 125.449 165.535 150.058 1.00 28.12  ?  307  ILE A N     1 
ATOM   1722  C  CA    . ILE A 1  307  ? 125.298 166.634 151.003 1.00 28.12  ?  307  ILE A CA    1 
ATOM   1723  C  C     . ILE A 1  307  ? 124.144 167.493 150.505 1.00 28.12  ?  307  ILE A C     1 
ATOM   1724  O  O     . ILE A 1  307  ? 124.102 167.843 149.323 1.00 28.12  ?  307  ILE A O     1 
ATOM   1725  C  CB    . ILE A 1  307  ? 126.586 167.477 151.131 1.00 28.12  ?  307  ILE A CB    1 
ATOM   1726  C  CG1   . ILE A 1  307  ? 127.760 166.650 151.648 1.00 28.12  ?  307  ILE A CG1   1 
ATOM   1727  C  CG2   . ILE A 1  307  ? 126.385 168.649 152.073 1.00 28.12  ?  307  ILE A CG2   1 
ATOM   1728  C  CD1   . ILE A 1  307  ? 129.104 167.310 151.470 1.00 28.12  ?  307  ILE A CD1   1 
ATOM   1729  N  N     . ALA A 1  308  ? 123.211 167.824 151.398 1.00 24.50  ?  308  ALA A N     1 
ATOM   1730  C  CA    . ALA A 1  308  ? 122.069 168.665 151.063 1.00 24.50  ?  308  ALA A CA    1 
ATOM   1731  C  C     . ALA A 1  308  ? 122.501 170.105 150.753 1.00 24.50  ?  308  ALA A C     1 
ATOM   1732  O  O     . ALA A 1  308  ? 123.617 170.509 151.079 1.00 24.50  ?  308  ALA A O     1 
ATOM   1733  C  CB    . ALA A 1  308  ? 121.073 168.636 152.219 1.00 24.50  ?  308  ALA A CB    1 
ATOM   1734  N  N     . PRO A 1  309  ? 121.631 170.905 150.096 1.00 21.56  ?  309  PRO A N     1 
ATOM   1735  C  CA    . PRO A 1  309  ? 121.951 172.330 149.888 1.00 21.56  ?  309  PRO A CA    1 
ATOM   1736  C  C     . PRO A 1  309  ? 121.754 173.232 151.096 1.00 21.56  ?  309  PRO A C     1 
ATOM   1737  O  O     . PRO A 1  309  ? 120.719 173.888 151.219 1.00 21.56  ?  309  PRO A O     1 
ATOM   1738  C  CB    . PRO A 1  309  ? 120.992 172.735 148.764 1.00 21.56  ?  309  PRO A CB    1 
ATOM   1739  C  CG    . PRO A 1  309  ? 119.894 171.753 148.838 1.00 21.56  ?  309  PRO A CG    1 
ATOM   1740  C  CD    . PRO A 1  309  ? 120.559 170.476 149.180 1.00 21.56  ?  309  PRO A CD    1 
ATOM   1741  N  N     . LEU A 1  310  ? 122.756 173.304 151.965 1.00 21.00  ?  310  LEU A N     1 
ATOM   1742  C  CA    . LEU A 1  310  ? 122.741 174.136 153.156 1.00 21.00  ?  310  LEU A CA    1 
ATOM   1743  C  C     . LEU A 1  310  ? 122.887 175.614 152.798 1.00 21.00  ?  310  LEU A C     1 
ATOM   1744  O  O     . LEU A 1  310  ? 123.309 175.970 151.701 1.00 21.00  ?  310  LEU A O     1 
ATOM   1745  C  CB    . LEU A 1  310  ? 123.880 173.732 154.082 1.00 21.00  ?  310  LEU A CB    1 
ATOM   1746  C  CG    . LEU A 1  310  ? 124.177 172.245 154.220 1.00 21.00  ?  310  LEU A CG    1 
ATOM   1747  C  CD1   . LEU A 1  310  ? 125.430 172.068 155.032 1.00 21.00  ?  310  LEU A CD1   1 
ATOM   1748  C  CD2   . LEU A 1  310  ? 123.030 171.530 154.877 1.00 21.00  ?  310  LEU A CD2   1 
ATOM   1749  N  N     . ARG A 1  311  ? 122.555 176.478 153.754 1.00 27.36  ?  311  ARG A N     1 
ATOM   1750  C  CA    . ARG A 1  311  ? 122.639 177.927 153.596 1.00 27.36  ?  311  ARG A CA    1 
ATOM   1751  C  C     . ARG A 1  311  ? 123.685 178.479 154.559 1.00 27.36  ?  311  ARG A C     1 
ATOM   1752  O  O     . ARG A 1  311  ? 123.591 178.270 155.774 1.00 27.36  ?  311  ARG A O     1 
ATOM   1753  C  CB    . ARG A 1  311  ? 121.286 178.582 153.841 1.00 27.36  ?  311  ARG A CB    1 
ATOM   1754  C  CG    . ARG A 1  311  ? 120.293 178.333 152.749 1.00 27.36  ?  311  ARG A CG    1 
ATOM   1755  C  CD    . ARG A 1  311  ? 119.105 179.254 152.860 1.00 27.36  ?  311  ARG A CD    1 
ATOM   1756  N  NE    . ARG A 1  311  ? 118.366 179.297 151.611 1.00 27.36  ?  311  ARG A NE    1 
ATOM   1757  C  CZ    . ARG A 1  311  ? 117.399 180.162 151.342 1.00 27.36  ?  311  ARG A CZ    1 
ATOM   1758  N  NH1   . ARG A 1  311  ? 116.793 180.122 150.172 1.00 27.36  1  311  ARG A NH1   1 
ATOM   1759  N  NH2   . ARG A 1  311  ? 117.045 181.070 152.235 1.00 27.36  ?  311  ARG A NH2   1 
ATOM   1760  N  N     . VAL A 1  312  ? 124.669 179.194 154.024 1.00 40.62  ?  312  VAL A N     1 
ATOM   1761  C  CA    . VAL A 1  312  ? 125.797 179.698 154.794 1.00 40.62  ?  312  VAL A CA    1 
ATOM   1762  C  C     . VAL A 1  312  ? 125.779 181.219 154.757 1.00 40.62  ?  312  VAL A C     1 
ATOM   1763  O  O     . VAL A 1  312  ? 125.634 181.822 153.682 1.00 40.62  ?  312  VAL A O     1 
ATOM   1764  C  CB    . VAL A 1  312  ? 127.118 179.145 154.235 1.00 40.62  ?  312  VAL A CB    1 
ATOM   1765  C  CG1   . VAL A 1  312  ? 128.279 179.540 155.106 1.00 40.62  ?  312  VAL A CG1   1 
ATOM   1766  C  CG2   . VAL A 1  312  ? 127.053 177.642 154.082 1.00 40.62  ?  312  VAL A CG2   1 
ATOM   1767  N  N     . LEU A 1  313  ? 125.915 181.846 155.926 1.00 30.55  ?  313  LEU A N     1 
ATOM   1768  C  CA    . LEU A 1  313  ? 126.003 183.295 156.060 1.00 30.55  ?  313  LEU A CA    1 
ATOM   1769  C  C     . LEU A 1  313  ? 127.389 183.685 156.565 1.00 30.55  ?  313  LEU A C     1 
ATOM   1770  O  O     . LEU A 1  313  ? 127.995 182.952 157.347 1.00 30.55  ?  313  LEU A O     1 
ATOM   1771  C  CB    . LEU A 1  313  ? 124.957 183.825 157.038 1.00 30.55  ?  313  LEU A CB    1 
ATOM   1772  C  CG    . LEU A 1  313  ? 124.873 185.336 157.213 1.00 30.55  ?  313  LEU A CG    1 
ATOM   1773  C  CD1   . LEU A 1  313  ? 123.921 185.981 156.232 1.00 30.55  ?  313  LEU A CD1   1 
ATOM   1774  C  CD2   . LEU A 1  313  ? 124.597 185.738 158.627 1.00 30.55  ?  313  LEU A CD2   1 
ATOM   1775  N  N     . SER A 1  314  ? 127.902 184.830 156.096 1.00 35.90  ?  314  SER A N     1 
ATOM   1776  C  CA    . SER A 1  314  ? 129.050 185.490 156.710 1.00 35.90  ?  314  SER A CA    1 
ATOM   1777  C  C     . SER A 1  314  ? 128.765 186.969 156.893 1.00 35.90  ?  314  SER A C     1 
ATOM   1778  O  O     . SER A 1  314  ? 128.087 187.576 156.068 1.00 35.90  ?  314  SER A O     1 
ATOM   1779  C  CB    . SER A 1  314  ? 130.306 185.323 155.879 1.00 35.90  ?  314  SER A CB    1 
ATOM   1780  O  OG    . SER A 1  314  ? 130.460 183.981 155.511 1.00 35.90  ?  314  SER A OG    1 
ATOM   1781  N  N     . PHE A 1  315  ? 129.284 187.559 157.965 1.00 40.62  ?  315  PHE A N     1 
ATOM   1782  C  CA    . PHE A 1  315  ? 129.009 188.966 158.210 1.00 40.62  ?  315  PHE A CA    1 
ATOM   1783  C  C     . PHE A 1  315  ? 130.213 189.635 158.860 1.00 40.62  ?  315  PHE A C     1 
ATOM   1784  O  O     . PHE A 1  315  ? 131.163 188.981 159.293 1.00 40.62  ?  315  PHE A O     1 
ATOM   1785  C  CB    . PHE A 1  315  ? 127.731 189.140 159.051 1.00 40.62  ?  315  PHE A CB    1 
ATOM   1786  C  CG    . PHE A 1  315  ? 127.913 188.889 160.519 1.00 40.62  ?  315  PHE A CG    1 
ATOM   1787  C  CD1   . PHE A 1  315  ? 127.962 187.602 161.009 1.00 40.62  ?  315  PHE A CD1   1 
ATOM   1788  C  CD2   . PHE A 1  315  ? 127.998 189.944 161.409 1.00 40.62  ?  315  PHE A CD2   1 
ATOM   1789  C  CE1   . PHE A 1  315  ? 128.120 187.366 162.353 1.00 40.62  ?  315  PHE A CE1   1 
ATOM   1790  C  CE2   . PHE A 1  315  ? 128.158 189.714 162.755 1.00 40.62  ?  315  PHE A CE2   1 
ATOM   1791  C  CZ    . PHE A 1  315  ? 128.218 188.426 163.225 1.00 40.62  ?  315  PHE A CZ    1 
ATOM   1792  N  N     . ASP A 1  316  ? 130.156 190.965 158.902 1.00 39.03  ?  316  ASP A N     1 
ATOM   1793  C  CA    . ASP A 1  316  ? 131.186 191.772 159.541 1.00 39.03  ?  316  ASP A CA    1 
ATOM   1794  C  C     . ASP A 1  316  ? 130.563 193.094 159.955 1.00 39.03  ?  316  ASP A C     1 
ATOM   1795  O  O     . ASP A 1  316  ? 129.596 193.541 159.343 1.00 39.03  ?  316  ASP A O     1 
ATOM   1796  C  CB    . ASP A 1  316  ? 132.371 191.994 158.595 1.00 39.03  ?  316  ASP A CB    1 
ATOM   1797  C  CG    . ASP A 1  316  ? 133.658 192.299 159.327 1.00 39.03  ?  316  ASP A CG    1 
ATOM   1798  O  OD1   . ASP A 1  316  ? 134.228 191.362 159.919 1.00 39.03  ?  316  ASP A OD1   1 
ATOM   1799  O  OD2   . ASP A 1  316  ? 134.115 193.459 159.299 1.00 39.03  -1 316  ASP A OD2   1 
ATOM   1800  N  N     . ILE A 1  317  ? 131.091 193.702 161.019 1.00 40.62  ?  317  ILE A N     1 
ATOM   1801  C  CA    . ILE A 1  317  ? 130.550 194.956 161.542 1.00 40.62  ?  317  ILE A CA    1 
ATOM   1802  C  C     . ILE A 1  317  ? 131.651 196.018 161.607 1.00 40.62  ?  317  ILE A C     1 
ATOM   1803  O  O     . ILE A 1  317  ? 132.838 195.721 161.549 1.00 40.62  ?  317  ILE A O     1 
ATOM   1804  C  CB    . ILE A 1  317  ? 129.884 194.803 162.932 1.00 40.62  ?  317  ILE A CB    1 
ATOM   1805  C  CG1   . ILE A 1  317  ? 130.929 194.798 164.045 1.00 40.62  ?  317  ILE A CG1   1 
ATOM   1806  C  CG2   . ILE A 1  317  ? 129.027 193.552 163.016 1.00 40.62  ?  317  ILE A CG2   1 
ATOM   1807  C  CD1   . ILE A 1  317  ? 130.381 195.018 165.423 1.00 40.62  ?  317  ILE A CD1   1 
ATOM   1808  N  N     . GLU A 1  318  ? 131.221 197.277 161.735 1.00 33.28  ?  318  GLU A N     1 
ATOM   1809  C  CA    . GLU A 1  318  ? 132.111 198.417 161.937 1.00 33.28  ?  318  GLU A CA    1 
ATOM   1810  C  C     . GLU A 1  318  ? 131.637 199.249 163.122 1.00 33.28  ?  318  GLU A C     1 
ATOM   1811  O  O     . GLU A 1  318  ? 130.433 199.389 163.343 1.00 33.28  ?  318  GLU A O     1 
ATOM   1812  C  CB    . GLU A 1  318  ? 132.169 199.315 160.705 1.00 33.28  ?  318  GLU A CB    1 
ATOM   1813  C  CG    . GLU A 1  318  ? 132.760 198.678 159.481 1.00 33.28  ?  318  GLU A CG    1 
ATOM   1814  C  CD    . GLU A 1  318  ? 134.219 198.320 159.656 1.00 33.28  ?  318  GLU A CD    1 
ATOM   1815  O  OE1   . GLU A 1  318  ? 134.972 199.146 160.205 1.00 33.28  ?  318  GLU A OE1   1 
ATOM   1816  O  OE2   . GLU A 1  318  ? 134.613 197.207 159.247 1.00 33.28  -1 318  GLU A OE2   1 
ATOM   1817  N  N     . CYS A 1  319  ? 132.583 199.813 163.876 1.00 25.51  ?  319  CYS A N     1 
ATOM   1818  C  CA    . CYS A 1  319  ? 132.286 200.712 164.987 1.00 25.51  ?  319  CYS A CA    1 
ATOM   1819  C  C     . CYS A 1  319  ? 133.138 201.967 164.872 1.00 25.51  ?  319  CYS A C     1 
ATOM   1820  O  O     . CYS A 1  319  ? 134.220 201.947 164.288 1.00 25.51  ?  319  CYS A O     1 
ATOM   1821  C  CB    . CYS A 1  319  ? 132.547 200.062 166.348 1.00 25.51  ?  319  CYS A CB    1 
ATOM   1822  S  SG    . CYS A 1  319  ? 132.047 198.345 166.497 1.00 25.51  ?  319  CYS A SG    1 
ATOM   1823  N  N     . ALA A 1  320  ? 132.652 203.056 165.452 1.00 29.72  ?  320  ALA A N     1 
ATOM   1824  C  CA    . ALA A 1  320  ? 133.312 204.354 165.364 1.00 29.72  ?  320  ALA A CA    1 
ATOM   1825  C  C     . ALA A 1  320  ? 133.833 204.739 166.741 1.00 29.72  ?  320  ALA A C     1 
ATOM   1826  O  O     . ALA A 1  320  ? 133.049 205.030 167.649 1.00 29.72  ?  320  ALA A O     1 
ATOM   1827  C  CB    . ALA A 1  320  ? 132.354 205.410 164.827 1.00 29.72  ?  320  ALA A CB    1 
ATOM   1828  N  N     . GLY A 1  321  ? 135.157 204.770 166.887 1.00 37.26  ?  321  GLY A N     1 
ATOM   1829  C  CA    . GLY A 1  321  ? 135.799 204.940 168.169 1.00 37.26  ?  321  GLY A CA    1 
ATOM   1830  C  C     . GLY A 1  321  ? 136.344 206.338 168.404 1.00 37.26  ?  321  GLY A C     1 
ATOM   1831  O  O     . GLY A 1  321  ? 136.105 207.279 167.653 1.00 37.26  ?  321  GLY A O     1 
ATOM   1832  N  N     . ARG A 1  322  ? 137.078 206.457 169.506 1.00 40.68  ?  322  ARG A N     1 
ATOM   1833  C  CA    . ARG A 1  322  ? 137.791 207.679 169.835 1.00 40.68  ?  322  ARG A CA    1 
ATOM   1834  C  C     . ARG A 1  322  ? 139.268 207.518 169.475 1.00 40.68  ?  322  ARG A C     1 
ATOM   1835  O  O     . ARG A 1  322  ? 139.703 206.475 168.984 1.00 40.68  ?  322  ARG A O     1 
ATOM   1836  C  CB    . ARG A 1  322  ? 137.583 208.026 171.307 1.00 40.68  ?  322  ARG A CB    1 
ATOM   1837  C  CG    . ARG A 1  322  ? 136.201 208.557 171.613 1.00 40.68  ?  322  ARG A CG    1 
ATOM   1838  C  CD    . ARG A 1  322  ? 135.879 208.496 173.097 1.00 40.68  ?  322  ARG A CD    1 
ATOM   1839  N  NE    . ARG A 1  322  ? 135.336 207.202 173.501 1.00 40.68  ?  322  ARG A NE    1 
ATOM   1840  C  CZ    . ARG A 1  322  ? 135.484 206.673 174.708 1.00 40.68  ?  322  ARG A CZ    1 
ATOM   1841  N  NH1   . ARG A 1  322  ? 136.153 207.325 175.642 1.00 40.68  1  322  ARG A NH1   1 
ATOM   1842  N  NH2   . ARG A 1  322  ? 134.960 205.490 174.986 1.00 40.68  ?  322  ARG A NH2   1 
ATOM   1843  N  N     . LYS A 1  323  ? 140.054 208.567 169.699 1.00 41.85  ?  323  LYS A N     1 
ATOM   1844  C  CA    . LYS A 1  323  ? 141.475 208.519 169.376 1.00 41.85  ?  323  LYS A CA    1 
ATOM   1845  C  C     . LYS A 1  323  ? 142.237 207.824 170.495 1.00 41.85  ?  323  LYS A C     1 
ATOM   1846  O  O     . LYS A 1  323  ? 142.118 208.202 171.665 1.00 41.85  ?  323  LYS A O     1 
ATOM   1847  C  CB    . LYS A 1  323  ? 142.022 209.927 169.154 1.00 41.85  ?  323  LYS A CB    1 
ATOM   1848  C  CG    . LYS A 1  323  ? 142.002 210.372 167.705 1.00 41.85  ?  323  LYS A CG    1 
ATOM   1849  C  CD    . LYS A 1  323  ? 142.813 211.635 167.502 1.00 41.85  ?  323  LYS A CD    1 
ATOM   1850  C  CE    . LYS A 1  323  ? 144.281 211.400 167.792 1.00 41.85  ?  323  LYS A CE    1 
ATOM   1851  N  NZ    . LYS A 1  323  ? 144.970 210.673 166.691 1.00 41.85  1  323  LYS A NZ    1 
ATOM   1852  N  N     . GLY A 1  324  ? 142.996 206.796 170.140 1.00 52.09  ?  324  GLY A N     1 
ATOM   1853  C  CA    . GLY A 1  324  ? 143.694 205.946 171.096 1.00 52.09  ?  324  GLY A CA    1 
ATOM   1854  C  C     . GLY A 1  324  ? 142.842 204.854 171.728 1.00 52.09  ?  324  GLY A C     1 
ATOM   1855  O  O     . GLY A 1  324  ? 143.302 203.724 171.902 1.00 52.09  ?  324  GLY A O     1 
ATOM   1856  N  N     . ILE A 1  325  ? 141.596 205.171 172.036 1.00 44.58  ?  325  ILE A N     1 
ATOM   1857  C  CA    . ILE A 1  325  ? 140.725 204.334 172.851 1.00 44.58  ?  325  ILE A CA    1 
ATOM   1858  C  C     . ILE A 1  325  ? 140.106 203.233 171.995 1.00 44.58  ?  325  ILE A C     1 
ATOM   1859  O  O     . ILE A 1  325  ? 139.396 203.515 171.022 1.00 44.58  ?  325  ILE A O     1 
ATOM   1860  C  CB    . ILE A 1  325  ? 139.646 205.203 173.515 1.00 44.58  ?  325  ILE A CB    1 
ATOM   1861  C  CG1   . ILE A 1  325  ? 140.330 206.355 174.257 1.00 44.58  ?  325  ILE A CG1   1 
ATOM   1862  C  CG2   . ILE A 1  325  ? 138.769 204.392 174.432 1.00 44.58  ?  325  ILE A CG2   1 
ATOM   1863  C  CD1   . ILE A 1  325  ? 139.394 207.421 174.773 1.00 44.58  ?  325  ILE A CD1   1 
ATOM   1864  N  N     . PHE A 1  326  ? 140.383 201.981 172.360 1.00 43.63  ?  326  PHE A N     1 
ATOM   1865  C  CA    . PHE A 1  326  ? 139.787 200.824 171.706 1.00 43.63  ?  326  PHE A CA    1 
ATOM   1866  C  C     . PHE A 1  326  ? 138.284 200.797 171.992 1.00 43.63  ?  326  PHE A C     1 
ATOM   1867  O  O     . PHE A 1  326  ? 137.851 201.276 173.040 1.00 43.63  ?  326  PHE A O     1 
ATOM   1868  C  CB    . PHE A 1  326  ? 140.460 199.552 172.218 1.00 43.63  ?  326  PHE A CB    1 
ATOM   1869  C  CG    . PHE A 1  326  ? 140.121 198.316 171.449 1.00 43.63  ?  326  PHE A CG    1 
ATOM   1870  C  CD1   . PHE A 1  326  ? 140.747 198.036 170.248 1.00 43.63  ?  326  PHE A CD1   1 
ATOM   1871  C  CD2   . PHE A 1  326  ? 139.160 197.437 171.916 1.00 43.63  ?  326  PHE A CD2   1 
ATOM   1872  C  CE1   . PHE A 1  326  ? 140.428 196.900 169.532 1.00 43.63  ?  326  PHE A CE1   1 
ATOM   1873  C  CE2   . PHE A 1  326  ? 138.839 196.301 171.207 1.00 43.63  ?  326  PHE A CE2   1 
ATOM   1874  C  CZ    . PHE A 1  326  ? 139.476 196.035 170.009 1.00 43.63  ?  326  PHE A CZ    1 
ATOM   1875  N  N     . PRO A 1  327  ? 137.465 200.288 171.056 1.00 38.93  ?  327  PRO A N     1 
ATOM   1876  C  CA    . PRO A 1  327  ? 136.006 200.405 171.208 1.00 38.93  ?  327  PRO A CA    1 
ATOM   1877  C  C     . PRO A 1  327  ? 135.418 199.652 172.398 1.00 38.93  ?  327  PRO A C     1 
ATOM   1878  O  O     . PRO A 1  327  ? 135.874 198.574 172.781 1.00 38.93  ?  327  PRO A O     1 
ATOM   1879  C  CB    . PRO A 1  327  ? 135.475 199.839 169.889 1.00 38.93  ?  327  PRO A CB    1 
ATOM   1880  C  CG    . PRO A 1  327  ? 136.518 200.145 168.926 1.00 38.93  ?  327  PRO A CG    1 
ATOM   1881  C  CD    . PRO A 1  327  ? 137.810 199.981 169.653 1.00 38.93  ?  327  PRO A CD    1 
ATOM   1882  N  N     . GLU A 1  328  ? 134.380 200.259 172.978 1.00 41.29  ?  328  GLU A N     1 
ATOM   1883  C  CA    . GLU A 1  328  ? 133.752 199.817 174.217 1.00 41.29  ?  328  GLU A CA    1 
ATOM   1884  C  C     . GLU A 1  328  ? 132.243 199.824 174.011 1.00 41.29  ?  328  GLU A C     1 
ATOM   1885  O  O     . GLU A 1  328  ? 131.686 200.849 173.581 1.00 41.29  ?  328  GLU A O     1 
ATOM   1886  C  CB    . GLU A 1  328  ? 134.132 200.737 175.388 1.00 41.29  ?  328  GLU A CB    1 
ATOM   1887  C  CG    . GLU A 1  328  ? 135.624 200.747 175.708 1.00 41.29  ?  328  GLU A CG    1 
ATOM   1888  C  CD    . GLU A 1  328  ? 136.005 201.718 176.808 1.00 41.29  ?  328  GLU A CD    1 
ATOM   1889  O  OE1   . GLU A 1  328  ? 135.139 202.493 177.263 1.00 41.29  ?  328  GLU A OE1   1 
ATOM   1890  O  OE2   . GLU A 1  328  ? 137.184 201.699 177.219 1.00 41.29  -1 328  GLU A OE2   1 
ATOM   1891  N  N     . PRO A 1  329  ? 131.535 198.735 174.343 1.00 41.54  ?  329  PRO A N     1 
ATOM   1892  C  CA    . PRO A 1  329  ? 130.117 198.611 173.965 1.00 41.54  ?  329  PRO A CA    1 
ATOM   1893  C  C     . PRO A 1  329  ? 129.141 199.535 174.678 1.00 41.54  ?  329  PRO A C     1 
ATOM   1894  O  O     . PRO A 1  329  ? 127.932 199.399 174.489 1.00 41.54  ?  329  PRO A O     1 
ATOM   1895  C  CB    . PRO A 1  329  ? 129.798 197.152 174.305 1.00 41.54  ?  329  PRO A CB    1 
ATOM   1896  C  CG    . PRO A 1  329  ? 131.096 196.461 174.307 1.00 41.54  ?  329  PRO A CG    1 
ATOM   1897  C  CD    . PRO A 1  329  ? 132.095 197.449 174.788 1.00 41.54  ?  329  PRO A CD    1 
ATOM   1898  N  N     . GLU A 1  330  ? 129.624 200.474 175.483 1.00 42.32  ?  330  GLU A N     1 
ATOM   1899  C  CA    . GLU A 1  330  ? 128.762 201.411 176.176 1.00 42.32  ?  330  GLU A CA    1 
ATOM   1900  C  C     . GLU A 1  330  ? 128.952 202.842 175.707 1.00 42.32  ?  330  GLU A C     1 
ATOM   1901  O  O     . GLU A 1  330  ? 128.264 203.736 176.210 1.00 42.32  ?  330  GLU A O     1 
ATOM   1902  C  CB    . GLU A 1  330  ? 129.001 201.336 177.687 1.00 42.32  ?  330  GLU A CB    1 
ATOM   1903  C  CG    . GLU A 1  330  ? 128.431 200.103 178.347 1.00 42.32  ?  330  GLU A CG    1 
ATOM   1904  C  CD    . GLU A 1  330  ? 129.395 198.944 178.321 1.00 42.32  ?  330  GLU A CD    1 
ATOM   1905  O  OE1   . GLU A 1  330  ? 130.544 199.149 177.883 1.00 42.32  ?  330  GLU A OE1   1 
ATOM   1906  O  OE2   . GLU A 1  330  ? 129.009 197.831 178.738 1.00 42.32  -1 330  GLU A OE2   1 
ATOM   1907  N  N     . ARG A 1  331  ? 129.858 203.086 174.762 1.00 50.13  ?  331  ARG A N     1 
ATOM   1908  C  CA    . ARG A 1  331  ? 130.074 204.422 174.219 1.00 50.13  ?  331  ARG A CA    1 
ATOM   1909  C  C     . ARG A 1  331  ? 130.170 204.482 172.701 1.00 50.13  ?  331  ARG A C     1 
ATOM   1910  O  O     . ARG A 1  331  ? 129.917 205.555 172.137 1.00 50.13  ?  331  ARG A O     1 
ATOM   1911  C  CB    . ARG A 1  331  ? 131.351 205.040 174.808 1.00 50.13  ?  331  ARG A CB    1 
ATOM   1912  C  CG    . ARG A 1  331  ? 131.196 205.588 176.218 1.00 50.13  ?  331  ARG A CG    1 
ATOM   1913  C  CD    . ARG A 1  331  ? 130.061 206.576 176.289 1.00 50.13  ?  331  ARG A CD    1 
ATOM   1914  N  NE    . ARG A 1  331  ? 128.962 206.069 177.104 1.00 50.13  ?  331  ARG A NE    1 
ATOM   1915  C  CZ    . ARG A 1  331  ? 127.794 206.686 177.256 1.00 50.13  ?  331  ARG A CZ    1 
ATOM   1916  N  NH1   . ARG A 1  331  ? 127.563 207.835 176.636 1.00 50.13  1  331  ARG A NH1   1 
ATOM   1917  N  NH2   . ARG A 1  331  ? 126.854 206.149 178.023 1.00 50.13  ?  331  ARG A NH2   1 
ATOM   1918  N  N     . ASP A 1  332  ? 130.509 203.395 172.022 1.00 36.02  ?  332  ASP A N     1 
ATOM   1919  C  CA    . ASP A 1  332  ? 130.853 203.444 170.601 1.00 36.02  ?  332  ASP A CA    1 
ATOM   1920  C  C     . ASP A 1  332  ? 129.787 202.773 169.752 1.00 36.02  ?  332  ASP A C     1 
ATOM   1921  O  O     . ASP A 1  332  ? 129.599 201.545 169.854 1.00 36.02  ?  332  ASP A O     1 
ATOM   1922  C  CB    . ASP A 1  332  ? 132.211 202.790 170.371 1.00 36.02  ?  332  ASP A CB    1 
ATOM   1923  C  CG    . ASP A 1  332  ? 133.246 203.256 171.361 1.00 36.02  ?  332  ASP A CG    1 
ATOM   1924  O  OD1   . ASP A 1  332  ? 133.588 204.452 171.344 1.00 36.02  ?  332  ASP A OD1   1 
ATOM   1925  O  OD2   . ASP A 1  332  ? 133.695 202.438 172.180 1.00 36.02  -1 332  ASP A OD2   1 
ATOM   1926  N  N     . PRO A 1  333  ? 129.084 203.528 168.906 1.00 27.23  ?  333  PRO A N     1 
ATOM   1927  C  CA    . PRO A 1  333  ? 127.978 202.962 168.135 1.00 27.23  ?  333  PRO A CA    1 
ATOM   1928  C  C     . PRO A 1  333  ? 128.432 201.986 167.066 1.00 27.23  ?  333  PRO A C     1 
ATOM   1929  O  O     . PRO A 1  333  ? 129.560 202.045 166.576 1.00 27.23  ?  333  PRO A O     1 
ATOM   1930  C  CB    . PRO A 1  333  ? 127.335 204.198 167.500 1.00 27.23  ?  333  PRO A CB    1 
ATOM   1931  C  CG    . PRO A 1  333  ? 128.367 205.246 167.565 1.00 27.23  ?  333  PRO A CG    1 
ATOM   1932  C  CD    . PRO A 1  333  ? 129.112 204.995 168.810 1.00 27.23  ?  333  PRO A CD    1 
ATOM   1933  N  N     . VAL A 1  334  ? 127.538 201.068 166.719 1.00 23.41  ?  334  VAL A N     1 
ATOM   1934  C  CA    . VAL A 1  334  ? 127.736 200.174 165.584 1.00 23.41  ?  334  VAL A CA    1 
ATOM   1935  C  C     . VAL A 1  334  ? 127.177 200.886 164.365 1.00 23.41  ?  334  VAL A C     1 
ATOM   1936  O  O     . VAL A 1  334  ? 126.013 201.287 164.368 1.00 23.41  ?  334  VAL A O     1 
ATOM   1937  C  CB    . VAL A 1  334  ? 127.036 198.827 165.801 1.00 23.41  ?  334  VAL A CB    1 
ATOM   1938  C  CG1   . VAL A 1  334  ? 127.213 197.938 164.599 1.00 23.41  ?  334  VAL A CG1   1 
ATOM   1939  C  CG2   . VAL A 1  334  ? 127.571 198.142 167.021 1.00 23.41  ?  334  VAL A CG2   1 
ATOM   1940  N  N     . ILE A 1  335  ? 127.990 201.053 163.322 1.00 24.72  ?  335  ILE A N     1 
ATOM   1941  C  CA    . ILE A 1  335  ? 127.617 201.931 162.223 1.00 24.72  ?  335  ILE A CA    1 
ATOM   1942  C  C     . ILE A 1  335  ? 127.358 201.210 160.909 1.00 24.72  ?  335  ILE A C     1 
ATOM   1943  O  O     . ILE A 1  335  ? 126.625 201.753 160.073 1.00 24.72  ?  335  ILE A O     1 
ATOM   1944  C  CB    . ILE A 1  335  ? 128.658 203.048 162.010 1.00 24.72  ?  335  ILE A CB    1 
ATOM   1945  C  CG1   . ILE A 1  335  ? 130.066 202.461 161.936 1.00 24.72  ?  335  ILE A CG1   1 
ATOM   1946  C  CG2   . ILE A 1  335  ? 128.517 204.114 163.086 1.00 24.72  ?  335  ILE A CG2   1 
ATOM   1947  C  CD1   . ILE A 1  335  ? 131.058 203.358 161.253 1.00 24.72  ?  335  ILE A CD1   1 
ATOM   1948  N  N     . GLN A 1  336  ? 127.907 200.021 160.695 1.00 40.62  ?  336  GLN A N     1 
ATOM   1949  C  CA    . GLN A 1  336  ? 127.663 199.304 159.455 1.00 40.62  ?  336  GLN A CA    1 
ATOM   1950  C  C     . GLN A 1  336  ? 127.707 197.808 159.711 1.00 40.62  ?  336  GLN A C     1 
ATOM   1951  O  O     . GLN A 1  336  ? 128.603 197.326 160.400 1.00 40.62  ?  336  GLN A O     1 
ATOM   1952  C  CB    . GLN A 1  336  ? 128.702 199.662 158.385 1.00 40.62  ?  336  GLN A CB    1 
ATOM   1953  C  CG    . GLN A 1  336  ? 128.428 200.932 157.592 1.00 40.62  ?  336  GLN A CG    1 
ATOM   1954  C  CD    . GLN A 1  336  ? 129.291 201.039 156.375 1.00 40.62  ?  336  GLN A CD    1 
ATOM   1955  O  OE1   . GLN A 1  336  ? 130.036 200.118 156.059 1.00 40.62  ?  336  GLN A OE1   1 
ATOM   1956  N  NE2   . GLN A 1  336  ? 129.206 202.169 155.683 1.00 40.62  ?  336  GLN A NE2   1 
ATOM   1957  N  N     . ILE A 1  337  ? 126.747 197.075 159.144 1.00 31.47  ?  337  ILE A N     1 
ATOM   1958  C  CA    . ILE A 1  337  ? 126.758 195.613 159.154 1.00 31.47  ?  337  ILE A CA    1 
ATOM   1959  C  C     . ILE A 1  337  ? 126.667 195.135 157.717 1.00 31.47  ?  337  ILE A C     1 
ATOM   1960  O  O     . ILE A 1  337  ? 125.818 195.614 156.963 1.00 31.47  ?  337  ILE A O     1 
ATOM   1961  C  CB    . ILE A 1  337  ? 125.596 195.014 159.972 1.00 31.47  ?  337  ILE A CB    1 
ATOM   1962  C  CG1   . ILE A 1  337  ? 125.418 195.721 161.309 1.00 31.47  ?  337  ILE A CG1   1 
ATOM   1963  C  CG2   . ILE A 1  337  ? 125.829 193.551 160.225 1.00 31.47  ?  337  ILE A CG2   1 
ATOM   1964  C  CD1   . ILE A 1  337  ? 124.167 195.330 162.037 1.00 31.47  ?  337  ILE A CD1   1 
ATOM   1965  N  N     . CYS A 1  338  ? 127.508 194.172 157.338 1.00 40.62  ?  338  CYS A N     1 
ATOM   1966  C  CA    . CYS A 1  338  ? 127.563 193.714 155.954 1.00 40.62  ?  338  CYS A CA    1 
ATOM   1967  C  C     . CYS A 1  338  ? 127.572 192.196 155.898 1.00 40.62  ?  338  CYS A C     1 
ATOM   1968  O  O     . CYS A 1  338  ? 128.336 191.557 156.625 1.00 40.62  ?  338  CYS A O     1 
ATOM   1969  C  CB    . CYS A 1  338  ? 128.790 194.281 155.243 1.00 40.62  ?  338  CYS A CB    1 
ATOM   1970  S  SG    . CYS A 1  338  ? 128.703 196.053 154.919 1.00 40.62  ?  338  CYS A SG    1 
ATOM   1971  N  N     . SER A 1  339  ? 126.748 191.624 155.003 1.00 40.62  ?  339  SER A N     1 
ATOM   1972  C  CA    . SER A 1  339  ? 126.413 190.206 155.002 1.00 40.62  ?  339  SER A CA    1 
ATOM   1973  C  C     . SER A 1  339  ? 126.481 189.610 153.602 1.00 40.62  ?  339  SER A C     1 
ATOM   1974  O  O     . SER A 1  339  ? 126.030 190.223 152.631 1.00 40.62  ?  339  SER A O     1 
ATOM   1975  C  CB    . SER A 1  339  ? 125.005 189.985 155.555 1.00 40.62  ?  339  SER A CB    1 
ATOM   1976  O  OG    . SER A 1  339  ? 124.832 190.605 156.810 1.00 40.62  ?  339  SER A OG    1 
ATOM   1977  N  N     . LEU A 1  340  ? 126.994 188.382 153.532 1.00 40.62  ?  340  LEU A N     1 
ATOM   1978  C  CA    . LEU A 1  340  ? 127.101 187.608 152.296 1.00 40.62  ?  340  LEU A CA    1 
ATOM   1979  C  C     . LEU A 1  340  ? 126.435 186.254 152.550 1.00 40.62  ?  340  LEU A C     1 
ATOM   1980  O  O     . LEU A 1  340  ? 126.590 185.685 153.629 1.00 40.62  ?  340  LEU A O     1 
ATOM   1981  C  CB    . LEU A 1  340  ? 128.566 187.418 151.902 1.00 40.62  ?  340  LEU A CB    1 
ATOM   1982  C  CG    . LEU A 1  340  ? 129.103 188.353 150.817 1.00 40.62  ?  340  LEU A CG    1 
ATOM   1983  C  CD1   . LEU A 1  340  ? 128.356 188.143 149.508 1.00 40.62  ?  340  LEU A CD1   1 
ATOM   1984  C  CD2   . LEU A 1  340  ? 129.013 189.804 151.262 1.00 40.62  ?  340  LEU A CD2   1 
ATOM   1985  N  N     . GLY A 1  341  ? 125.697 185.730 151.571 1.00 24.94  ?  341  GLY A N     1 
ATOM   1986  C  CA    . GLY A 1  341  ? 125.010 184.471 151.766 1.00 24.94  ?  341  GLY A CA    1 
ATOM   1987  C  C     . GLY A 1  341  ? 124.966 183.585 150.546 1.00 24.94  ?  341  GLY A C     1 
ATOM   1988  O  O     . GLY A 1  341  ? 124.726 184.080 149.438 1.00 24.94  ?  341  GLY A O     1 
ATOM   1989  N  N     . LEU A 1  342  ? 125.158 182.279 150.735 1.00 20.74  ?  342  LEU A N     1 
ATOM   1990  C  CA    . LEU A 1  342  ? 125.174 181.360 149.605 1.00 20.74  ?  342  LEU A CA    1 
ATOM   1991  C  C     . LEU A 1  342  ? 124.565 180.010 149.960 1.00 20.74  ?  342  LEU A C     1 
ATOM   1992  O  O     . LEU A 1  342  ? 124.511 179.610 151.122 1.00 20.74  ?  342  LEU A O     1 
ATOM   1993  C  CB    . LEU A 1  342  ? 126.591 181.169 149.054 1.00 20.74  ?  342  LEU A CB    1 
ATOM   1994  C  CG    . LEU A 1  342  ? 127.748 180.536 149.811 1.00 20.74  ?  342  LEU A CG    1 
ATOM   1995  C  CD1   . LEU A 1  342  ? 127.908 179.068 149.502 1.00 20.74  ?  342  LEU A CD1   1 
ATOM   1996  C  CD2   . LEU A 1  342  ? 128.997 181.260 149.417 1.00 20.74  ?  342  LEU A CD2   1 
ATOM   1997  N  N     . ARG A 1  343  ? 124.082 179.319 148.924 1.00 25.39  ?  343  ARG A N     1 
ATOM   1998  C  CA    . ARG A 1  343  ? 123.687 177.919 148.998 1.00 25.39  ?  343  ARG A CA    1 
ATOM   1999  C  C     . ARG A 1  343  ? 124.885 177.061 148.649 1.00 25.39  ?  343  ARG A C     1 
ATOM   2000  O  O     . ARG A 1  343  ? 125.646 177.393 147.741 1.00 25.39  ?  343  ARG A O     1 
ATOM   2001  C  CB    . ARG A 1  343  ? 122.553 177.575 148.034 1.00 25.39  ?  343  ARG A CB    1 
ATOM   2002  C  CG    . ARG A 1  343  ? 121.272 178.338 148.203 1.00 25.39  ?  343  ARG A CG    1 
ATOM   2003  C  CD    . ARG A 1  343  ? 120.235 177.859 147.194 1.00 25.39  ?  343  ARG A CD    1 
ATOM   2004  N  NE    . ARG A 1  343  ? 119.100 178.764 147.135 1.00 25.39  ?  343  ARG A NE    1 
ATOM   2005  C  CZ    . ARG A 1  343  ? 119.023 179.807 146.318 1.00 25.39  ?  343  ARG A CZ    1 
ATOM   2006  N  NH1   . ARG A 1  343  ? 120.017 180.066 145.481 1.00 25.39  1  343  ARG A NH1   1 
ATOM   2007  N  NH2   . ARG A 1  343  ? 117.954 180.591 146.344 1.00 25.39  ?  343  ARG A NH2   1 
ATOM   2008  N  N     . TRP A 1  344  ? 125.040 175.944 149.346 1.00 25.41  ?  344  TRP A N     1 
ATOM   2009  C  CA    . TRP A 1  344  ? 126.283 175.199 149.249 1.00 25.41  ?  344  TRP A CA    1 
ATOM   2010  C  C     . TRP A 1  344  ? 126.242 174.316 148.013 1.00 25.41  ?  344  TRP A C     1 
ATOM   2011  O  O     . TRP A 1  344  ? 125.304 173.537 147.828 1.00 25.41  ?  344  TRP A O     1 
ATOM   2012  C  CB    . TRP A 1  344  ? 126.525 174.345 150.487 1.00 25.41  ?  344  TRP A CB    1 
ATOM   2013  C  CG    . TRP A 1  344  ? 127.907 173.834 150.473 1.00 25.41  ?  344  TRP A CG    1 
ATOM   2014  C  CD1   . TRP A 1  344  ? 129.047 174.555 150.708 1.00 25.41  ?  344  TRP A CD1   1 
ATOM   2015  C  CD2   . TRP A 1  344  ? 128.334 172.536 150.071 1.00 25.41  ?  344  TRP A CD2   1 
ATOM   2016  N  NE1   . TRP A 1  344  ? 130.151 173.765 150.546 1.00 25.41  ?  344  TRP A NE1   1 
ATOM   2017  C  CE2   . TRP A 1  344  ? 129.742 172.521 150.143 1.00 25.41  ?  344  TRP A CE2   1 
ATOM   2018  C  CE3   . TRP A 1  344  ? 127.663 171.375 149.680 1.00 25.41  ?  344  TRP A CE3   1 
ATOM   2019  C  CZ2   . TRP A 1  344  ? 130.482 171.393 149.843 1.00 25.41  ?  344  TRP A CZ2   1 
ATOM   2020  C  CZ3   . TRP A 1  344  ? 128.402 170.261 149.371 1.00 25.41  ?  344  TRP A CZ3   1 
ATOM   2021  C  CH2   . TRP A 1  344  ? 129.798 170.275 149.458 1.00 25.41  ?  344  TRP A CH2   1 
ATOM   2022  N  N     . GLY A 1  345  ? 127.266 174.425 147.176 1.00 31.82  ?  345  GLY A N     1 
ATOM   2023  C  CA    . GLY A 1  345  ? 127.338 173.705 145.920 1.00 31.82  ?  345  GLY A CA    1 
ATOM   2024  C  C     . GLY A 1  345  ? 127.304 174.592 144.695 1.00 31.82  ?  345  GLY A C     1 
ATOM   2025  O  O     . GLY A 1  345  ? 127.621 174.123 143.597 1.00 31.82  ?  345  GLY A O     1 
ATOM   2026  N  N     . GLU A 1  346  ? 126.938 175.847 144.844 1.00 30.06  ?  346  GLU A N     1 
ATOM   2027  C  CA    . GLU A 1  346  ? 126.876 176.790 143.747 1.00 30.06  ?  346  GLU A CA    1 
ATOM   2028  C  C     . GLU A 1  346  ? 128.062 177.741 143.801 1.00 30.06  ?  346  GLU A C     1 
ATOM   2029  O  O     . GLU A 1  346  ? 128.378 178.275 144.866 1.00 30.06  ?  346  GLU A O     1 
ATOM   2030  C  CB    . GLU A 1  346  ? 125.570 177.582 143.791 1.00 30.06  ?  346  GLU A CB    1 
ATOM   2031  C  CG    . GLU A 1  346  ? 124.363 176.680 143.805 1.00 30.06  ?  346  GLU A CG    1 
ATOM   2032  C  CD    . GLU A 1  346  ? 123.069 177.439 143.819 1.00 30.06  ?  346  GLU A CD    1 
ATOM   2033  O  OE1   . GLU A 1  346  ? 123.084 178.635 143.479 1.00 30.06  ?  346  GLU A OE1   1 
ATOM   2034  O  OE2   . GLU A 1  346  ? 122.033 176.844 144.171 1.00 30.06  -1 346  GLU A OE2   1 
ATOM   2035  N  N     . PRO A 1  347  ? 128.729 177.979 142.668 1.00 33.66  ?  347  PRO A N     1 
ATOM   2036  C  CA    . PRO A 1  347  ? 130.067 178.585 142.705 1.00 33.66  ?  347  PRO A CA    1 
ATOM   2037  C  C     . PRO A 1  347  ? 130.104 180.081 142.976 1.00 33.66  ?  347  PRO A C     1 
ATOM   2038  O  O     . PRO A 1  347  ? 131.203 180.644 143.046 1.00 33.66  ?  347  PRO A O     1 
ATOM   2039  C  CB    . PRO A 1  347  ? 130.616 178.272 141.310 1.00 33.66  ?  347  PRO A CB    1 
ATOM   2040  C  CG    . PRO A 1  347  ? 129.414 178.215 140.457 1.00 33.66  ?  347  PRO A CG    1 
ATOM   2041  C  CD    . PRO A 1  347  ? 128.303 177.670 141.294 1.00 33.66  ?  347  PRO A CD    1 
ATOM   2042  N  N     . GLU A 1  348  ? 128.967 180.742 143.127 1.00 30.39  ?  348  GLU A N     1 
ATOM   2043  C  CA    . GLU A 1  348  ? 128.894 182.147 143.490 1.00 30.39  ?  348  GLU A CA    1 
ATOM   2044  C  C     . GLU A 1  348  ? 127.860 182.305 144.588 1.00 30.39  ?  348  GLU A C     1 
ATOM   2045  O  O     . GLU A 1  348  ? 126.996 181.440 144.764 1.00 30.39  ?  348  GLU A O     1 
ATOM   2046  C  CB    . GLU A 1  348  ? 128.506 183.027 142.290 1.00 30.39  ?  348  GLU A CB    1 
ATOM   2047  C  CG    . GLU A 1  348  ? 129.378 182.873 141.061 1.00 30.39  ?  348  GLU A CG    1 
ATOM   2048  C  CD    . GLU A 1  348  ? 128.648 182.190 139.922 1.00 30.39  ?  348  GLU A CD    1 
ATOM   2049  O  OE1   . GLU A 1  348  ? 128.785 182.649 138.770 1.00 30.39  ?  348  GLU A OE1   1 
ATOM   2050  O  OE2   . GLU A 1  348  ? 127.930 181.203 140.182 1.00 30.39  -1 348  GLU A OE2   1 
ATOM   2051  N  N     . PRO A 1  349  ? 127.918 183.398 145.351 1.00 22.98  ?  349  PRO A N     1 
ATOM   2052  C  CA    . PRO A 1  349  ? 126.840 183.701 146.296 1.00 22.98  ?  349  PRO A CA    1 
ATOM   2053  C  C     . PRO A 1  349  ? 125.534 184.030 145.593 1.00 22.98  ?  349  PRO A C     1 
ATOM   2054  O  O     . PRO A 1  349  ? 125.453 184.157 144.374 1.00 22.98  ?  349  PRO A O     1 
ATOM   2055  C  CB    . PRO A 1  349  ? 127.377 184.915 147.060 1.00 22.98  ?  349  PRO A CB    1 
ATOM   2056  C  CG    . PRO A 1  349  ? 128.543 185.383 146.292 1.00 22.98  ?  349  PRO A CG    1 
ATOM   2057  C  CD    . PRO A 1  349  ? 129.121 184.177 145.678 1.00 22.98  ?  349  PRO A CD    1 
ATOM   2058  N  N     . PHE A 1  350  ? 124.484 184.161 146.392 1.00 20.19  ?  350  PHE A N     1 
ATOM   2059  C  CA    . PHE A 1  350  ? 123.224 184.655 145.880 1.00 20.19  ?  350  PHE A CA    1 
ATOM   2060  C  C     . PHE A 1  350  ? 122.694 185.847 146.647 1.00 20.19  ?  350  PHE A C     1 
ATOM   2061  O  O     . PHE A 1  350  ? 121.725 186.460 146.196 1.00 20.19  ?  350  PHE A O     1 
ATOM   2062  C  CB    . PHE A 1  350  ? 122.158 183.537 145.832 1.00 20.19  ?  350  PHE A CB    1 
ATOM   2063  C  CG    . PHE A 1  350  ? 121.543 183.165 147.167 1.00 20.19  ?  350  PHE A CG    1 
ATOM   2064  C  CD1   . PHE A 1  350  ? 122.107 182.176 147.943 1.00 20.19  ?  350  PHE A CD1   1 
ATOM   2065  C  CD2   . PHE A 1  350  ? 120.349 183.738 147.599 1.00 20.19  ?  350  PHE A CD2   1 
ATOM   2066  C  CE1   . PHE A 1  350  ? 121.547 181.816 149.143 1.00 20.19  ?  350  PHE A CE1   1 
ATOM   2067  C  CE2   . PHE A 1  350  ? 119.794 183.384 148.811 1.00 20.19  ?  350  PHE A CE2   1 
ATOM   2068  C  CZ    . PHE A 1  350  ? 120.395 182.423 149.575 1.00 20.19  ?  350  PHE A CZ    1 
ATOM   2069  N  N     . LEU A 1  351  ? 123.285 186.201 147.780 1.00 25.48  ?  351  LEU A N     1 
ATOM   2070  C  CA    . LEU A 1  351  ? 122.783 187.359 148.497 1.00 25.48  ?  351  LEU A CA    1 
ATOM   2071  C  C     . LEU A 1  351  ? 123.944 188.205 148.986 1.00 25.48  ?  351  LEU A C     1 
ATOM   2072  O  O     . LEU A 1  351  ? 124.953 187.670 149.457 1.00 25.48  ?  351  LEU A O     1 
ATOM   2073  C  CB    . LEU A 1  351  ? 121.904 186.932 149.669 1.00 25.48  ?  351  LEU A CB    1 
ATOM   2074  C  CG    . LEU A 1  351  ? 120.893 187.939 150.184 1.00 25.48  ?  351  LEU A CG    1 
ATOM   2075  C  CD1   . LEU A 1  351  ? 119.950 188.326 149.082 1.00 25.48  ?  351  LEU A CD1   1 
ATOM   2076  C  CD2   . LEU A 1  351  ? 120.137 187.317 151.310 1.00 25.48  ?  351  LEU A CD2   1 
ATOM   2077  N  N     . ARG A 1  352  ? 123.763 189.527 148.922 1.00 40.62  ?  352  ARG A N     1 
ATOM   2078  C  CA    . ARG A 1  352  ? 124.839 190.483 149.174 1.00 40.62  ?  352  ARG A CA    1 
ATOM   2079  C  C     . ARG A 1  352  ? 124.202 191.759 149.704 1.00 40.62  ?  352  ARG A C     1 
ATOM   2080  O  O     . ARG A 1  352  ? 123.694 192.558 148.921 1.00 40.62  ?  352  ARG A O     1 
ATOM   2081  C  CB    . ARG A 1  352  ? 125.611 190.733 147.892 1.00 40.62  ?  352  ARG A CB    1 
ATOM   2082  C  CG    . ARG A 1  352  ? 127.015 191.172 148.074 1.00 40.62  ?  352  ARG A CG    1 
ATOM   2083  C  CD    . ARG A 1  352  ? 127.685 191.367 146.734 1.00 40.62  ?  352  ARG A CD    1 
ATOM   2084  N  NE    . ARG A 1  352  ? 127.969 190.117 146.031 1.00 40.62  ?  352  ARG A NE    1 
ATOM   2085  C  CZ    . ARG A 1  352  ? 129.192 189.627 145.868 1.00 40.62  ?  352  ARG A CZ    1 
ATOM   2086  N  NH1   . ARG A 1  352  ? 130.230 190.277 146.365 1.00 40.62  1  352  ARG A NH1   1 
ATOM   2087  N  NH2   . ARG A 1  352  ? 129.383 188.498 145.204 1.00 40.62  ?  352  ARG A NH2   1 
ATOM   2088  N  N     . LEU A 1  353  ? 124.228 191.957 151.017 1.00 40.62  ?  353  LEU A N     1 
ATOM   2089  C  CA    . LEU A 1  353  ? 123.472 193.043 151.626 1.00 40.62  ?  353  LEU A CA    1 
ATOM   2090  C  C     . LEU A 1  353  ? 124.374 193.878 152.529 1.00 40.62  ?  353  LEU A C     1 
ATOM   2091  O  O     . LEU A 1  353  ? 125.304 193.361 153.147 1.00 40.62  ?  353  LEU A O     1 
ATOM   2092  C  CB    . LEU A 1  353  ? 122.281 192.477 152.408 1.00 40.62  ?  353  LEU A CB    1 
ATOM   2093  C  CG    . LEU A 1  353  ? 121.381 193.304 153.319 1.00 40.62  ?  353  LEU A CG    1 
ATOM   2094  C  CD1   . LEU A 1  353  ? 120.450 194.176 152.531 1.00 40.62  ?  353  LEU A CD1   1 
ATOM   2095  C  CD2   . LEU A 1  353  ? 120.591 192.392 154.218 1.00 40.62  ?  353  LEU A CD2   1 
ATOM   2096  N  N     . ALA A 1  354  ? 124.096 195.177 152.600 1.00 40.62  ?  354  ALA A N     1 
ATOM   2097  C  CA    . ALA A 1  354  ? 124.879 196.092 153.417 1.00 40.62  ?  354  ALA A CA    1 
ATOM   2098  C  C     . ALA A 1  354  ? 123.965 197.117 154.067 1.00 40.62  ?  354  ALA A C     1 
ATOM   2099  O  O     . ALA A 1  354  ? 123.240 197.826 153.369 1.00 40.62  ?  354  ALA A O     1 
ATOM   2100  C  CB    . ALA A 1  354  ? 125.940 196.793 152.574 1.00 40.62  ?  354  ALA A CB    1 
ATOM   2101  N  N     . LEU A 1  355  ? 124.009 197.216 155.396 1.00 27.09  ?  355  LEU A N     1 
ATOM   2102  C  CA    . LEU A 1  355  ? 123.107 198.075 156.157 1.00 27.09  ?  355  LEU A CA    1 
ATOM   2103  C  C     . LEU A 1  355  ? 123.927 199.124 156.885 1.00 27.09  ?  355  LEU A C     1 
ATOM   2104  O  O     . LEU A 1  355  ? 124.774 198.786 157.718 1.00 27.09  ?  355  LEU A O     1 
ATOM   2105  C  CB    . LEU A 1  355  ? 122.287 197.253 157.152 1.00 27.09  ?  355  LEU A CB    1 
ATOM   2106  C  CG    . LEU A 1  355  ? 121.250 196.267 156.606 1.00 27.09  ?  355  LEU A CG    1 
ATOM   2107  C  CD1   . LEU A 1  355  ? 121.058 195.083 157.542 1.00 27.09  ?  355  LEU A CD1   1 
ATOM   2108  C  CD2   . LEU A 1  355  ? 119.944 196.975 156.372 1.00 27.09  ?  355  LEU A CD2   1 
ATOM   2109  N  N     . THR A 1  356  ? 123.676 200.391 156.575 1.00 18.06  ?  356  THR A N     1 
ATOM   2110  C  CA    . THR A 1  356  ? 124.484 201.508 157.032 1.00 18.06  ?  356  THR A CA    1 
ATOM   2111  C  C     . THR A 1  356  ? 123.640 202.412 157.915 1.00 18.06  ?  356  THR A C     1 
ATOM   2112  O  O     . THR A 1  356  ? 122.446 202.198 158.079 1.00 18.06  ?  356  THR A O     1 
ATOM   2113  C  CB    . THR A 1  356  ? 125.055 202.302 155.849 1.00 18.06  ?  356  THR A CB    1 
ATOM   2114  O  OG1   . THR A 1  356  ? 124.013 203.056 155.227 1.00 18.06  ?  356  THR A OG1   1 
ATOM   2115  C  CG2   . THR A 1  356  ? 125.676 201.374 154.814 1.00 18.06  ?  356  THR A CG2   1 
ATOM   2116  N  N     . LEU A 1  357  ? 124.262 203.438 158.488 1.00 31.57  ?  357  LEU A N     1 
ATOM   2117  C  CA    . LEU A 1  357  ? 123.573 204.279 159.455 1.00 31.57  ?  357  LEU A CA    1 
ATOM   2118  C  C     . LEU A 1  357  ? 123.511 205.740 159.017 1.00 31.57  ?  357  LEU A C     1 
ATOM   2119  O  O     . LEU A 1  357  ? 122.955 206.576 159.724 1.00 31.57  ?  357  LEU A O     1 
ATOM   2120  C  CB    . LEU A 1  357  ? 124.234 204.118 160.832 1.00 31.57  ?  357  LEU A CB    1 
ATOM   2121  C  CG    . LEU A 1  357  ? 123.568 204.528 162.155 1.00 31.57  ?  357  LEU A CG    1 
ATOM   2122  C  CD1   . LEU A 1  357  ? 124.045 203.548 163.163 1.00 31.57  ?  357  LEU A CD1   1 
ATOM   2123  C  CD2   . LEU A 1  357  ? 123.898 205.920 162.671 1.00 31.57  ?  357  LEU A CD2   1 
ATOM   2124  N  N     . ARG A 1  358  ? 124.012 206.063 157.865 1.00 25.17  ?  358  ARG A N     1 
ATOM   2125  C  CA    . ARG A 1  358  ? 123.713 207.385 157.343 1.00 25.17  ?  358  ARG A CA    1 
ATOM   2126  C  C     . ARG A 1  358  ? 123.286 207.158 155.893 1.00 25.17  ?  358  ARG A C     1 
ATOM   2127  O  O     . ARG A 1  358  ? 123.372 206.012 155.436 1.00 25.17  ?  358  ARG A O     1 
ATOM   2128  C  CB    . ARG A 1  358  ? 124.932 208.295 157.507 1.00 25.17  ?  358  ARG A CB    1 
ATOM   2129  C  CG    . ARG A 1  358  ? 125.114 208.911 158.882 1.00 25.17  ?  358  ARG A CG    1 
ATOM   2130  C  CD    . ARG A 1  358  ? 124.119 210.008 159.147 1.00 25.17  ?  358  ARG A CD    1 
ATOM   2131  N  NE    . ARG A 1  358  ? 124.380 211.238 158.403 1.00 25.17  ?  358  ARG A NE    1 
ATOM   2132  C  CZ    . ARG A 1  358  ? 125.278 212.159 158.747 1.00 25.17  ?  358  ARG A CZ    1 
ATOM   2133  N  NH1   . ARG A 1  358  ? 126.031 211.996 159.826 1.00 25.17  1  358  ARG A NH1   1 
ATOM   2134  N  NH2   . ARG A 1  358  ? 125.424 213.249 158.005 1.00 25.17  ?  358  ARG A NH2   1 
ATOM   2135  N  N     . PRO A 1  359  ? 122.787 208.155 155.146 1.00 27.72  ?  359  PRO A N     1 
ATOM   2136  C  CA    . PRO A 1  359  ? 122.499 207.908 153.726 1.00 27.72  ?  359  PRO A CA    1 
ATOM   2137  C  C     . PRO A 1  359  ? 123.771 207.703 152.919 1.00 27.72  ?  359  PRO A C     1 
ATOM   2138  O  O     . PRO A 1  359  ? 124.777 208.378 153.128 1.00 27.72  ?  359  PRO A O     1 
ATOM   2139  C  CB    . PRO A 1  359  ? 121.759 209.173 153.290 1.00 27.72  ?  359  PRO A CB    1 
ATOM   2140  C  CG    . PRO A 1  359  ? 122.131 210.183 154.275 1.00 27.72  ?  359  PRO A CG    1 
ATOM   2141  C  CD    . PRO A 1  359  ? 122.225 209.450 155.559 1.00 27.72  ?  359  PRO A CD    1 
ATOM   2142  N  N     . CYS A 1  360  ? 123.712 206.767 151.983 1.00 34.24  ?  360  CYS A N     1 
ATOM   2143  C  CA    . CYS A 1  360  ? 124.910 206.281 151.314 1.00 34.24  ?  360  CYS A CA    1 
ATOM   2144  C  C     . CYS A 1  360  ? 124.761 206.390 149.803 1.00 34.24  ?  360  CYS A C     1 
ATOM   2145  O  O     . CYS A 1  360  ? 123.841 207.055 149.317 1.00 34.24  ?  360  CYS A O     1 
ATOM   2146  C  CB    . CYS A 1  360  ? 125.191 204.840 151.731 1.00 34.24  ?  360  CYS A CB    1 
ATOM   2147  S  SG    . CYS A 1  360  ? 126.727 204.163 151.144 1.00 34.24  ?  360  CYS A SG    1 
ATOM   2148  N  N     . ALA A 1  361  ? 125.667 205.773 149.053 1.00 36.97  ?  361  ALA A N     1 
ATOM   2149  C  CA    . ALA A 1  361  ? 125.646 205.814 147.601 1.00 36.97  ?  361  ALA A CA    1 
ATOM   2150  C  C     . ALA A 1  361  ? 125.628 204.397 147.045 1.00 36.97  ?  361  ALA A C     1 
ATOM   2151  O  O     . ALA A 1  361  ? 126.189 203.493 147.659 1.00 36.97  ?  361  ALA A O     1 
ATOM   2152  C  CB    . ALA A 1  361  ? 126.862 206.578 147.069 1.00 36.97  ?  361  ALA A CB    1 
ATOM   2153  N  N     . PRO A 1  362  ? 124.976 204.170 145.900 1.00 30.08  ?  362  PRO A N     1 
ATOM   2154  C  CA    . PRO A 1  362  ? 124.692 202.794 145.475 1.00 30.08  ?  362  PRO A CA    1 
ATOM   2155  C  C     . PRO A 1  362  ? 125.916 202.028 145.015 1.00 30.08  ?  362  PRO A C     1 
ATOM   2156  O  O     . PRO A 1  362  ? 126.859 202.587 144.453 1.00 30.08  ?  362  PRO A O     1 
ATOM   2157  C  CB    . PRO A 1  362  ? 123.705 202.981 144.318 1.00 30.08  ?  362  PRO A CB    1 
ATOM   2158  C  CG    . PRO A 1  362  ? 123.104 204.296 144.549 1.00 30.08  ?  362  PRO A CG    1 
ATOM   2159  C  CD    . PRO A 1  362  ? 124.185 205.135 145.116 1.00 30.08  ?  362  PRO A CD    1 
ATOM   2160  N  N     . ILE A 1  363  ? 125.884 200.725 145.265 1.00 31.57  ?  363  ILE A N     1 
ATOM   2161  C  CA    . ILE A 1  363  ? 126.955 199.805 144.908 1.00 31.57  ?  363  ILE A CA    1 
ATOM   2162  C  C     . ILE A 1  363  ? 126.371 198.757 143.974 1.00 31.57  ?  363  ILE A C     1 
ATOM   2163  O  O     . ILE A 1  363  ? 125.315 198.184 144.261 1.00 31.57  ?  363  ILE A O     1 
ATOM   2164  C  CB    . ILE A 1  363  ? 127.573 199.140 146.151 1.00 31.57  ?  363  ILE A CB    1 
ATOM   2165  C  CG1   . ILE A 1  363  ? 128.021 200.187 147.161 1.00 31.57  ?  363  ILE A CG1   1 
ATOM   2166  C  CG2   . ILE A 1  363  ? 128.744 198.259 145.770 1.00 31.57  ?  363  ILE A CG2   1 
ATOM   2167  C  CD1   . ILE A 1  363  ? 128.585 199.599 148.408 1.00 31.57  ?  363  ILE A CD1   1 
ATOM   2168  N  N     . LEU A 1  364  ? 127.050 198.508 142.862 1.00 44.57  ?  364  LEU A N     1 
ATOM   2169  C  CA    . LEU A 1  364  ? 126.536 197.610 141.836 1.00 44.57  ?  364  LEU A CA    1 
ATOM   2170  C  C     . LEU A 1  364  ? 126.797 196.170 142.260 1.00 44.57  ?  364  LEU A C     1 
ATOM   2171  O  O     . LEU A 1  364  ? 127.951 195.769 142.444 1.00 44.57  ?  364  LEU A O     1 
ATOM   2172  C  CB    . LEU A 1  364  ? 127.191 197.918 140.493 1.00 44.57  ?  364  LEU A CB    1 
ATOM   2173  C  CG    . LEU A 1  364  ? 126.701 197.163 139.258 1.00 44.57  ?  364  LEU A CG    1 
ATOM   2174  C  CD1   . LEU A 1  364  ? 125.256 197.526 138.962 1.00 44.57  ?  364  LEU A CD1   1 
ATOM   2175  C  CD2   . LEU A 1  364  ? 127.593 197.447 138.063 1.00 44.57  ?  364  LEU A CD2   1 
ATOM   2176  N  N     . GLY A 1  365  ? 125.731 195.389 142.410 1.00 43.11  ?  365  GLY A N     1 
ATOM   2177  C  CA    . GLY A 1  365  ? 125.824 194.008 142.851 1.00 43.11  ?  365  GLY A CA    1 
ATOM   2178  C  C     . GLY A 1  365  ? 125.270 193.751 144.234 1.00 43.11  ?  365  GLY A C     1 
ATOM   2179  O  O     . GLY A 1  365  ? 125.187 192.587 144.644 1.00 43.11  ?  365  GLY A O     1 
ATOM   2180  N  N     . ALA A 1  366  ? 124.873 194.789 144.965 1.00 31.87  ?  366  ALA A N     1 
ATOM   2181  C  CA    . ALA A 1  366  ? 124.423 194.647 146.335 1.00 31.87  ?  366  ALA A CA    1 
ATOM   2182  C  C     . ALA A 1  366  ? 123.277 195.609 146.593 1.00 31.87  ?  366  ALA A C     1 
ATOM   2183  O  O     . ALA A 1  366  ? 123.103 196.600 145.886 1.00 31.87  ?  366  ALA A O     1 
ATOM   2184  C  CB    . ALA A 1  366  ? 125.562 194.907 147.322 1.00 31.87  ?  366  ALA A CB    1 
ATOM   2185  N  N     . LYS A 1  367  ? 122.494 195.303 147.616 1.00 26.61  ?  367  LYS A N     1 
ATOM   2186  C  CA    . LYS A 1  367  ? 121.433 196.180 148.074 1.00 26.61  ?  367  LYS A CA    1 
ATOM   2187  C  C     . LYS A 1  367  ? 121.973 197.052 149.197 1.00 26.61  ?  367  LYS A C     1 
ATOM   2188  O  O     . LYS A 1  367  ? 122.848 196.627 149.947 1.00 26.61  ?  367  LYS A O     1 
ATOM   2189  C  CB    . LYS A 1  367  ? 120.226 195.365 148.546 1.00 26.61  ?  367  LYS A CB    1 
ATOM   2190  C  CG    . LYS A 1  367  ? 118.963 196.173 148.789 1.00 26.61  ?  367  LYS A CG    1 
ATOM   2191  C  CD    . LYS A 1  367  ? 117.719 195.313 148.700 1.00 26.61  ?  367  LYS A CD    1 
ATOM   2192  C  CE    . LYS A 1  367  ? 116.516 196.020 149.309 1.00 26.61  ?  367  LYS A CE    1 
ATOM   2193  N  NZ    . LYS A 1  367  ? 116.209 197.309 148.649 1.00 26.61  1  367  LYS A NZ    1 
ATOM   2194  N  N     . VAL A 1  368  ? 121.484 198.282 149.283 1.00 23.70  ?  368  VAL A N     1 
ATOM   2195  C  CA    . VAL A 1  368  ? 121.925 199.242 150.285 1.00 23.70  ?  368  VAL A CA    1 
ATOM   2196  C  C     . VAL A 1  368  ? 120.683 199.881 150.891 1.00 23.70  ?  368  VAL A C     1 
ATOM   2197  O  O     . VAL A 1  368  ? 119.850 200.429 150.162 1.00 23.70  ?  368  VAL A O     1 
ATOM   2198  C  CB    . VAL A 1  368  ? 122.853 200.314 149.681 1.00 23.70  ?  368  VAL A CB    1 
ATOM   2199  C  CG1   . VAL A 1  368  ? 122.953 201.532 150.582 1.00 23.70  ?  368  VAL A CG1   1 
ATOM   2200  C  CG2   . VAL A 1  368  ? 124.222 199.747 149.425 1.00 23.70  ?  368  VAL A CG2   1 
ATOM   2201  N  N     . GLN A 1  369  ? 120.547 199.797 152.214 1.00 21.79  ?  369  GLN A N     1 
ATOM   2202  C  CA    . GLN A 1  369  ? 119.480 200.470 152.942 1.00 21.79  ?  369  GLN A CA    1 
ATOM   2203  C  C     . GLN A 1  369  ? 120.099 201.366 154.001 1.00 21.79  ?  369  GLN A C     1 
ATOM   2204  O  O     . GLN A 1  369  ? 121.199 201.107 154.477 1.00 21.79  ?  369  GLN A O     1 
ATOM   2205  C  CB    . GLN A 1  369  ? 118.511 199.468 153.594 1.00 21.79  ?  369  GLN A CB    1 
ATOM   2206  C  CG    . GLN A 1  369  ? 118.021 198.369 152.651 1.00 21.79  ?  369  GLN A CG    1 
ATOM   2207  C  CD    . GLN A 1  369  ? 117.288 197.240 153.356 1.00 21.79  ?  369  GLN A CD    1 
ATOM   2208  O  OE1   . GLN A 1  369  ? 116.824 197.389 154.484 1.00 21.79  ?  369  GLN A OE1   1 
ATOM   2209  N  NE2   . GLN A 1  369  ? 117.183 196.103 152.685 1.00 21.79  ?  369  GLN A NE2   1 
ATOM   2210  N  N     . SER A 1  370  ? 119.396 202.426 154.365 1.00 21.67  ?  370  SER A N     1 
ATOM   2211  C  CA    . SER A 1  370  ? 119.932 203.415 155.284 1.00 21.67  ?  370  SER A CA    1 
ATOM   2212  C  C     . SER A 1  370  ? 118.901 203.783 156.335 1.00 21.67  ?  370  SER A C     1 
ATOM   2213  O  O     . SER A 1  370  ? 117.700 203.802 156.060 1.00 21.67  ?  370  SER A O     1 
ATOM   2214  C  CB    . SER A 1  370  ? 120.367 204.660 154.545 1.00 21.67  ?  370  SER A CB    1 
ATOM   2215  O  OG    . SER A 1  370  ? 121.324 204.338 153.564 1.00 21.67  ?  370  SER A OG    1 
ATOM   2216  N  N     . TYR A 1  371  ? 119.374 204.080 157.541 1.00 20.46  ?  371  TYR A N     1 
ATOM   2217  C  CA    . TYR A 1  371  ? 118.522 204.384 158.677 1.00 20.46  ?  371  TYR A CA    1 
ATOM   2218  C  C     . TYR A 1  371  ? 119.080 205.597 159.392 1.00 20.46  ?  371  TYR A C     1 
ATOM   2219  O  O     . TYR A 1  371  ? 120.269 205.875 159.302 1.00 20.46  ?  371  TYR A O     1 
ATOM   2220  C  CB    . TYR A 1  371  ? 118.446 203.208 159.638 1.00 20.46  ?  371  TYR A CB    1 
ATOM   2221  C  CG    . TYR A 1  371  ? 117.988 201.947 158.973 1.00 20.46  ?  371  TYR A CG    1 
ATOM   2222  C  CD1   . TYR A 1  371  ? 116.641 201.709 158.752 1.00 20.46  ?  371  TYR A CD1   1 
ATOM   2223  C  CD2   . TYR A 1  371  ? 118.894 201.002 158.549 1.00 20.46  ?  371  TYR A CD2   1 
ATOM   2224  C  CE1   . TYR A 1  371  ? 116.219 200.568 158.134 1.00 20.46  ?  371  TYR A CE1   1 
ATOM   2225  C  CE2   . TYR A 1  371  ? 118.478 199.858 157.934 1.00 20.46  ?  371  TYR A CE2   1 
ATOM   2226  C  CZ    . TYR A 1  371  ? 117.141 199.648 157.730 1.00 20.46  ?  371  TYR A CZ    1 
ATOM   2227  O  OH    . TYR A 1  371  ? 116.723 198.509 157.111 1.00 20.46  ?  371  TYR A OH    1 
ATOM   2228  N  N     . GLU A 1  372  ? 118.228 206.323 160.098 1.00 32.00  ?  372  GLU A N     1 
ATOM   2229  C  CA    . GLU A 1  372  ? 118.722 207.477 160.835 1.00 32.00  ?  372  GLU A CA    1 
ATOM   2230  C  C     . GLU A 1  372  ? 118.995 207.184 162.301 1.00 32.00  ?  372  GLU A C     1 
ATOM   2231  O  O     . GLU A 1  372  ? 119.430 208.087 163.018 1.00 32.00  ?  372  GLU A O     1 
ATOM   2232  C  CB    . GLU A 1  372  ? 117.749 208.656 160.725 1.00 32.00  ?  372  GLU A CB    1 
ATOM   2233  C  CG    . GLU A 1  372  ? 117.828 209.412 159.404 1.00 32.00  ?  372  GLU A CG    1 
ATOM   2234  C  CD    . GLU A 1  372  ? 119.255 209.774 159.000 1.00 32.00  ?  372  GLU A CD    1 
ATOM   2235  O  OE1   . GLU A 1  372  ? 119.788 210.785 159.506 1.00 32.00  ?  372  GLU A OE1   1 
ATOM   2236  O  OE2   . GLU A 1  372  ? 119.843 209.049 158.163 1.00 32.00  -1 372  GLU A OE2   1 
ATOM   2237  N  N     . LYS A 1  373  ? 118.769 205.954 162.761 1.00 35.76  ?  373  LYS A N     1 
ATOM   2238  C  CA    . LYS A 1  373  ? 118.977 205.601 164.158 1.00 35.76  ?  373  LYS A CA    1 
ATOM   2239  C  C     . LYS A 1  373  ? 119.418 204.150 164.247 1.00 35.76  ?  373  LYS A C     1 
ATOM   2240  O  O     . LYS A 1  373  ? 119.077 203.336 163.392 1.00 35.76  ?  373  LYS A O     1 
ATOM   2241  C  CB    . LYS A 1  373  ? 117.706 205.835 164.978 1.00 35.76  ?  373  LYS A CB    1 
ATOM   2242  C  CG    . LYS A 1  373  ? 117.614 207.218 165.585 1.00 35.76  ?  373  LYS A CG    1 
ATOM   2243  C  CD    . LYS A 1  373  ? 116.183 207.603 165.853 1.00 35.76  ?  373  LYS A CD    1 
ATOM   2244  C  CE    . LYS A 1  373  ? 115.568 206.720 166.921 1.00 35.76  ?  373  LYS A CE    1 
ATOM   2245  N  NZ    . LYS A 1  373  ? 114.176 207.140 167.232 1.00 35.76  1  373  LYS A NZ    1 
ATOM   2246  N  N     . GLU A 1  374  ? 120.173 203.830 165.300 1.00 31.03  ?  374  GLU A N     1 
ATOM   2247  C  CA    . GLU A 1  374  ? 120.782 202.512 165.423 1.00 31.03  ?  374  GLU A CA    1 
ATOM   2248  C  C     . GLU A 1  374  ? 119.785 201.430 165.796 1.00 31.03  ?  374  GLU A C     1 
ATOM   2249  O  O     . GLU A 1  374  ? 120.039 200.247 165.514 1.00 31.03  ?  374  GLU A O     1 
ATOM   2250  C  CB    . GLU A 1  374  ? 121.882 202.534 166.473 1.00 31.03  ?  374  GLU A CB    1 
ATOM   2251  C  CG    . GLU A 1  374  ? 122.603 203.845 166.576 1.00 31.03  ?  374  GLU A CG    1 
ATOM   2252  C  CD    . GLU A 1  374  ? 123.742 203.791 167.559 1.00 31.03  ?  374  GLU A CD    1 
ATOM   2253  O  OE1   . GLU A 1  374  ? 124.190 202.674 167.879 1.00 31.03  ?  374  GLU A OE1   1 
ATOM   2254  O  OE2   . GLU A 1  374  ? 124.173 204.865 168.027 1.00 31.03  -1 374  GLU A OE2   1 
ATOM   2255  N  N     . GLU A 1  375  ? 118.678 201.813 166.444 1.00 34.50  ?  375  GLU A N     1 
ATOM   2256  C  CA    . GLU A 1  375  ? 117.639 200.857 166.819 1.00 34.50  ?  375  GLU A CA    1 
ATOM   2257  C  C     . GLU A 1  375  ? 117.022 200.209 165.593 1.00 34.50  ?  375  GLU A C     1 
ATOM   2258  O  O     . GLU A 1  375  ? 116.791 198.992 165.571 1.00 34.50  ?  375  GLU A O     1 
ATOM   2259  C  CB    . GLU A 1  375  ? 116.567 201.563 167.644 1.00 34.50  ?  375  GLU A CB    1 
ATOM   2260  C  CG    . GLU A 1  375  ? 117.061 202.166 168.941 1.00 34.50  ?  375  GLU A CG    1 
ATOM   2261  C  CD    . GLU A 1  375  ? 117.520 203.607 168.796 1.00 34.50  ?  375  GLU A CD    1 
ATOM   2262  O  OE1   . GLU A 1  375  ? 118.046 203.964 167.727 1.00 34.50  ?  375  GLU A OE1   1 
ATOM   2263  O  OE2   . GLU A 1  375  ? 117.365 204.387 169.754 1.00 34.50  -1 375  GLU A OE2   1 
ATOM   2264  N  N     . ASP A 1  376  ? 116.802 201.005 164.545 1.00 31.52  ?  376  ASP A N     1 
ATOM   2265  C  CA    . ASP A 1  376  ? 116.284 200.480 163.295 1.00 31.52  ?  376  ASP A CA    1 
ATOM   2266  C  C     . ASP A 1  376  ? 117.287 199.562 162.620 1.00 31.52  ?  376  ASP A C     1 
ATOM   2267  O  O     . ASP A 1  376  ? 116.895 198.572 162.004 1.00 31.52  ?  376  ASP A O     1 
ATOM   2268  C  CB    . ASP A 1  376  ? 115.916 201.629 162.369 1.00 31.52  ?  376  ASP A CB    1 
ATOM   2269  C  CG    . ASP A 1  376  ? 115.029 202.651 163.036 1.00 31.52  ?  376  ASP A CG    1 
ATOM   2270  O  OD1   . ASP A 1  376  ? 114.366 202.314 164.036 1.00 31.52  ?  376  ASP A OD1   1 
ATOM   2271  O  OD2   . ASP A 1  376  ? 114.995 203.795 162.550 1.00 31.52  -1 376  ASP A OD2   1 
ATOM   2272  N  N     . LEU A 1  377  ? 118.577 199.854 162.769 1.00 23.83  ?  377  LEU A N     1 
ATOM   2273  C  CA    . LEU A 1  377  ? 119.613 199.034 162.157 1.00 23.83  ?  377  LEU A CA    1 
ATOM   2274  C  C     . LEU A 1  377  ? 119.705 197.662 162.817 1.00 23.83  ?  377  LEU A C     1 
ATOM   2275  O  O     . LEU A 1  377  ? 119.763 196.630 162.125 1.00 23.83  ?  377  LEU A O     1 
ATOM   2276  C  CB    . LEU A 1  377  ? 120.942 199.775 162.243 1.00 23.83  ?  377  LEU A CB    1 
ATOM   2277  C  CG    . LEU A 1  377  ? 122.129 199.220 161.477 1.00 23.83  ?  377  LEU A CG    1 
ATOM   2278  C  CD1   . LEU A 1  377  ? 121.849 199.452 160.049 1.00 23.83  ?  377  LEU A CD1   1 
ATOM   2279  C  CD2   . LEU A 1  377  ? 123.396 199.929 161.895 1.00 23.83  ?  377  LEU A CD2   1 
ATOM   2280  N  N     . LEU A 1  378  ? 119.670 197.621 164.151 1.00 25.04  ?  378  LEU A N     1 
ATOM   2281  C  CA    . LEU A 1  378  ? 119.716 196.335 164.847 1.00 25.04  ?  378  LEU A CA    1 
ATOM   2282  C  C     . LEU A 1  378  ? 118.432 195.531 164.636 1.00 25.04  ?  378  LEU A C     1 
ATOM   2283  O  O     . LEU A 1  378  ? 118.482 194.304 164.453 1.00 25.04  ?  378  LEU A O     1 
ATOM   2284  C  CB    . LEU A 1  378  ? 119.981 196.565 166.328 1.00 25.04  ?  378  LEU A CB    1 
ATOM   2285  C  CG    . LEU A 1  378  ? 121.373 197.091 166.680 1.00 25.04  ?  378  LEU A CG    1 
ATOM   2286  C  CD1   . LEU A 1  378  ? 121.344 197.776 168.021 1.00 25.04  ?  378  LEU A CD1   1 
ATOM   2287  C  CD2   . LEU A 1  378  ? 122.383 195.975 166.688 1.00 25.04  ?  378  LEU A CD2   1 
ATOM   2288  N  N     . GLN A 1  379  ? 117.281 196.212 164.608 1.00 24.05  ?  379  GLN A N     1 
ATOM   2289  C  CA    . GLN A 1  379  ? 116.018 195.538 164.320 1.00 24.05  ?  379  GLN A CA    1 
ATOM   2290  C  C     . GLN A 1  379  ? 115.992 194.957 162.912 1.00 24.05  ?  379  GLN A C     1 
ATOM   2291  O  O     . GLN A 1  379  ? 115.539 193.827 162.708 1.00 24.05  ?  379  GLN A O     1 
ATOM   2292  C  CB    . GLN A 1  379  ? 114.862 196.513 164.505 1.00 24.05  ?  379  GLN A CB    1 
ATOM   2293  C  CG    . GLN A 1  379  ? 114.388 196.625 165.910 1.00 24.05  ?  379  GLN A CG    1 
ATOM   2294  C  CD    . GLN A 1  379  ? 112.946 197.018 165.971 1.00 24.05  ?  379  GLN A CD    1 
ATOM   2295  O  OE1   . GLN A 1  379  ? 112.261 197.032 164.954 1.00 24.05  ?  379  GLN A OE1   1 
ATOM   2296  N  NE2   . GLN A 1  379  ? 112.468 197.342 167.164 1.00 24.05  ?  379  GLN A NE2   1 
ATOM   2297  N  N     . ALA A 1  380  ? 116.463 195.729 161.930 1.00 20.69  ?  380  ALA A N     1 
ATOM   2298  C  CA    . ALA A 1  380  ? 116.496 195.274 160.549 1.00 20.69  ?  380  ALA A CA    1 
ATOM   2299  C  C     . ALA A 1  380  ? 117.397 194.063 160.378 1.00 20.69  ?  380  ALA A C     1 
ATOM   2300  O  O     . ALA A 1  380  ? 117.053 193.131 159.638 1.00 20.69  ?  380  ALA A O     1 
ATOM   2301  C  CB    . ALA A 1  380  ? 116.966 196.410 159.650 1.00 20.69  ?  380  ALA A CB    1 
ATOM   2302  N  N     . TRP A 1  381  ? 118.528 194.035 161.085 1.00 23.08  ?  381  TRP A N     1 
ATOM   2303  C  CA    . TRP A 1  381  ? 119.391 192.867 160.969 1.00 23.08  ?  381  TRP A CA    1 
ATOM   2304  C  C     . TRP A 1  381  ? 118.773 191.639 161.627 1.00 23.08  ?  381  TRP A C     1 
ATOM   2305  O  O     . TRP A 1  381  ? 118.887 190.525 161.095 1.00 23.08  ?  381  TRP A O     1 
ATOM   2306  C  CB    . TRP A 1  381  ? 120.767 193.142 161.551 1.00 23.08  ?  381  TRP A CB    1 
ATOM   2307  C  CG    . TRP A 1  381  ? 121.707 192.079 161.130 1.00 23.08  ?  381  TRP A CG    1 
ATOM   2308  C  CD1   . TRP A 1  381  ? 122.100 191.802 159.857 1.00 23.08  ?  381  TRP A CD1   1 
ATOM   2309  C  CD2   . TRP A 1  381  ? 122.331 191.104 161.963 1.00 23.08  ?  381  TRP A CD2   1 
ATOM   2310  N  NE1   . TRP A 1  381  ? 122.947 190.734 159.848 1.00 23.08  ?  381  TRP A NE1   1 
ATOM   2311  C  CE2   . TRP A 1  381  ? 123.106 190.283 161.131 1.00 23.08  ?  381  TRP A CE2   1 
ATOM   2312  C  CE3   . TRP A 1  381  ? 122.317 190.852 163.334 1.00 23.08  ?  381  TRP A CE3   1 
ATOM   2313  C  CZ2   . TRP A 1  381  ? 123.863 189.228 161.623 1.00 23.08  ?  381  TRP A CZ2   1 
ATOM   2314  C  CZ3   . TRP A 1  381  ? 123.064 189.811 163.823 1.00 23.08  ?  381  TRP A CZ3   1 
ATOM   2315  C  CH2   . TRP A 1  381  ? 123.827 189.008 162.971 1.00 23.08  ?  381  TRP A CH2   1 
ATOM   2316  N  N     . SER A 1  382  ? 118.079 191.821 162.763 1.00 35.22  ?  382  SER A N     1 
ATOM   2317  C  CA    . SER A 1  382  ? 117.430 190.680 163.414 1.00 35.22  ?  382  SER A CA    1 
ATOM   2318  C  C     . SER A 1  382  ? 116.279 190.117 162.577 1.00 35.22  ?  382  SER A C     1 
ATOM   2319  O  O     . SER A 1  382  ? 116.090 188.893 162.503 1.00 35.22  ?  382  SER A O     1 
ATOM   2320  C  CB    . SER A 1  382  ? 116.941 191.090 164.796 1.00 35.22  ?  382  SER A CB    1 
ATOM   2321  O  OG    . SER A 1  382  ? 115.875 192.012 164.686 1.00 35.22  ?  382  SER A OG    1 
ATOM   2322  N  N     . THR A 1  383  ? 115.522 190.990 161.907 1.00 21.98  ?  383  THR A N     1 
ATOM   2323  C  CA    . THR A 1  383  ? 114.436 190.521 161.052 1.00 21.98  ?  383  THR A CA    1 
ATOM   2324  C  C     . THR A 1  383  ? 114.961 189.812 159.808 1.00 21.98  ?  383  THR A C     1 
ATOM   2325  O  O     . THR A 1  383  ? 114.400 188.786 159.398 1.00 21.98  ?  383  THR A O     1 
ATOM   2326  C  CB    . THR A 1  383  ? 113.536 191.686 160.673 1.00 21.98  ?  383  THR A CB    1 
ATOM   2327  O  OG1   . THR A 1  383  ? 113.142 192.378 161.856 1.00 21.98  ?  383  THR A OG1   1 
ATOM   2328  C  CG2   . THR A 1  383  ? 112.300 191.194 159.989 1.00 21.98  ?  383  THR A CG2   1 
ATOM   2329  N  N     . PHE A 1  384  ? 116.050 190.319 159.214 1.00 11.60  ?  384  PHE A N     1 
ATOM   2330  C  CA    . PHE A 1  384  ? 116.666 189.628 158.081 1.00 11.60  ?  384  PHE A CA    1 
ATOM   2331  C  C     . PHE A 1  384  ? 117.191 188.259 158.476 1.00 11.60  ?  384  PHE A C     1 
ATOM   2332  O  O     . PHE A 1  384  ? 117.066 187.289 157.714 1.00 11.60  ?  384  PHE A O     1 
ATOM   2333  C  CB    . PHE A 1  384  ? 117.806 190.462 157.499 1.00 11.60  ?  384  PHE A CB    1 
ATOM   2334  C  CG    . PHE A 1  384  ? 118.762 189.675 156.646 1.00 11.60  ?  384  PHE A CG    1 
ATOM   2335  C  CD1   . PHE A 1  384  ? 118.376 189.189 155.413 1.00 11.60  ?  384  PHE A CD1   1 
ATOM   2336  C  CD2   . PHE A 1  384  ? 120.055 189.421 157.073 1.00 11.60  ?  384  PHE A CD2   1 
ATOM   2337  C  CE1   . PHE A 1  384  ? 119.259 188.462 154.634 1.00 11.60  ?  384  PHE A CE1   1 
ATOM   2338  C  CE2   . PHE A 1  384  ? 120.927 188.700 156.295 1.00 11.60  ?  384  PHE A CE2   1 
ATOM   2339  C  CZ    . PHE A 1  384  ? 120.531 188.223 155.078 1.00 11.60  ?  384  PHE A CZ    1 
ATOM   2340  N  N     . ILE A 1  385  ? 117.781 188.154 159.664 1.00 23.77  ?  385  ILE A N     1 
ATOM   2341  C  CA    . ILE A 1  385  ? 118.344 186.875 160.064 1.00 23.77  ?  385  ILE A CA    1 
ATOM   2342  C  C     . ILE A 1  385  ? 117.261 185.882 160.480 1.00 23.77  ?  385  ILE A C     1 
ATOM   2343  O  O     . ILE A 1  385  ? 117.494 184.670 160.419 1.00 23.77  ?  385  ILE A O     1 
ATOM   2344  C  CB    . ILE A 1  385  ? 119.420 187.103 161.142 1.00 23.77  ?  385  ILE A CB    1 
ATOM   2345  C  CG1   . ILE A 1  385  ? 120.466 186.004 161.091 1.00 23.77  ?  385  ILE A CG1   1 
ATOM   2346  C  CG2   . ILE A 1  385  ? 118.847 187.138 162.498 1.00 23.77  ?  385  ILE A CG2   1 
ATOM   2347  C  CD1   . ILE A 1  385  ? 121.177 185.980 159.817 1.00 23.77  ?  385  ILE A CD1   1 
ATOM   2348  N  N     . ARG A 1  386  ? 116.072 186.358 160.868 1.00 40.62  ?  386  ARG A N     1 
ATOM   2349  C  CA    . ARG A 1  386  ? 114.947 185.444 161.050 1.00 40.62  ?  386  ARG A CA    1 
ATOM   2350  C  C     . ARG A 1  386  ? 114.396 184.959 159.711 1.00 40.62  ?  386  ARG A C     1 
ATOM   2351  O  O     . ARG A 1  386  ? 114.114 183.767 159.546 1.00 40.62  ?  386  ARG A O     1 
ATOM   2352  C  CB    . ARG A 1  386  ? 113.850 186.124 161.865 1.00 40.62  ?  386  ARG A CB    1 
ATOM   2353  C  CG    . ARG A 1  386  ? 112.499 185.472 161.759 1.00 40.62  ?  386  ARG A CG    1 
ATOM   2354  C  CD    . ARG A 1  386  ? 111.598 185.893 162.880 1.00 40.62  ?  386  ARG A CD    1 
ATOM   2355  N  NE    . ARG A 1  386  ? 110.784 187.040 162.518 1.00 40.62  ?  386  ARG A NE    1 
ATOM   2356  C  CZ    . ARG A 1  386  ? 110.898 188.229 163.093 1.00 40.62  ?  386  ARG A CZ    1 
ATOM   2357  N  NH1   . ARG A 1  386  ? 111.798 188.415 164.049 1.00 40.62  1  386  ARG A NH1   1 
ATOM   2358  N  NH2   . ARG A 1  386  ? 110.120 189.234 162.714 1.00 40.62  ?  386  ARG A NH2   1 
ATOM   2359  N  N     . ILE A 1  387  ? 114.262 185.860 158.734 1.00 29.20  ?  387  ILE A N     1 
ATOM   2360  C  CA    . ILE A 1  387  ? 113.560 185.521 157.499 1.00 29.20  ?  387  ILE A CA    1 
ATOM   2361  C  C     . ILE A 1  387  ? 114.419 184.661 156.565 1.00 29.20  ?  387  ILE A C     1 
ATOM   2362  O  O     . ILE A 1  387  ? 113.928 183.675 156.003 1.00 29.20  ?  387  ILE A O     1 
ATOM   2363  C  CB    . ILE A 1  387  ? 113.077 186.816 156.829 1.00 29.20  ?  387  ILE A CB    1 
ATOM   2364  C  CG1   . ILE A 1  387  ? 111.889 187.360 157.607 1.00 29.20  ?  387  ILE A CG1   1 
ATOM   2365  C  CG2   . ILE A 1  387  ? 112.693 186.595 155.393 1.00 29.20  ?  387  ILE A CG2   1 
ATOM   2366  C  CD1   . ILE A 1  387  ? 111.421 188.684 157.134 1.00 29.20  ?  387  ILE A CD1   1 
ATOM   2367  N  N     . MET A 1  388  ? 115.705 184.998 156.386 1.00 24.85  ?  388  MET A N     1 
ATOM   2368  C  CA    . MET A 1  388  ? 116.573 184.167 155.550 1.00 24.85  ?  388  MET A CA    1 
ATOM   2369  C  C     . MET A 1  388  ? 116.783 182.783 156.155 1.00 24.85  ?  388  MET A C     1 
ATOM   2370  O  O     . MET A 1  388  ? 116.851 181.787 155.421 1.00 24.85  ?  388  MET A O     1 
ATOM   2371  C  CB    . MET A 1  388  ? 117.923 184.850 155.339 1.00 24.85  ?  388  MET A CB    1 
ATOM   2372  C  CG    . MET A 1  388  ? 118.922 184.022 154.542 1.00 24.85  ?  388  MET A CG    1 
ATOM   2373  S  SD    . MET A 1  388  ? 120.661 184.395 154.814 1.00 24.85  ?  388  MET A SD    1 
ATOM   2374  C  CE    . MET A 1  388  ? 121.422 182.936 154.102 1.00 24.85  ?  388  MET A CE    1 
ATOM   2375  N  N     . ASP A 1  389  ? 116.854 182.712 157.490 1.00 40.62  ?  389  ASP A N     1 
ATOM   2376  C  CA    . ASP A 1  389  ? 116.922 181.503 158.309 1.00 40.62  ?  389  ASP A CA    1 
ATOM   2377  C  C     . ASP A 1  389  ? 118.097 180.609 157.925 1.00 40.62  ?  389  ASP A C     1 
ATOM   2378  O  O     . ASP A 1  389  ? 117.880 179.521 157.385 1.00 40.62  ?  389  ASP A O     1 
ATOM   2379  C  CB    . ASP A 1  389  ? 115.598 180.738 158.192 1.00 40.62  ?  389  ASP A CB    1 
ATOM   2380  C  CG    . ASP A 1  389  ? 115.367 179.780 159.333 1.00 40.62  ?  389  ASP A CG    1 
ATOM   2381  O  OD1   . ASP A 1  389  ? 115.322 180.228 160.496 1.00 40.62  ?  389  ASP A OD1   1 
ATOM   2382  O  OD2   . ASP A 1  389  ? 115.217 178.571 159.065 1.00 40.62  -1 389  ASP A OD2   1 
ATOM   2383  N  N     . PRO A 1  390  ? 119.341 181.014 158.181 1.00 25.05  ?  390  PRO A N     1 
ATOM   2384  C  CA    . PRO A 1  390  ? 120.483 180.255 157.667 1.00 25.05  ?  390  PRO A CA    1 
ATOM   2385  C  C     . PRO A 1  390  ? 120.801 179.018 158.489 1.00 25.05  ?  390  PRO A C     1 
ATOM   2386  O  O     . PRO A 1  390  ? 120.464 178.901 159.665 1.00 25.05  ?  390  PRO A O     1 
ATOM   2387  C  CB    . PRO A 1  390  ? 121.627 181.264 157.759 1.00 25.05  ?  390  PRO A CB    1 
ATOM   2388  C  CG    . PRO A 1  390  ? 121.266 182.112 158.859 1.00 25.05  ?  390  PRO A CG    1 
ATOM   2389  C  CD    . PRO A 1  390  ? 119.787 182.241 158.855 1.00 25.05  ?  390  PRO A CD    1 
ATOM   2390  N  N     . ASP A 1  391  ? 121.487 178.088 157.837 1.00 27.63  ?  391  ASP A N     1 
ATOM   2391  C  CA    . ASP A 1  391  ? 121.965 176.893 158.516 1.00 27.63  ?  391  ASP A CA    1 
ATOM   2392  C  C     . ASP A 1  391  ? 123.223 177.198 159.314 1.00 27.63  ?  391  ASP A C     1 
ATOM   2393  O  O     . ASP A 1  391  ? 123.282 176.945 160.519 1.00 27.63  ?  391  ASP A O     1 
ATOM   2394  C  CB    . ASP A 1  391  ? 122.256 175.786 157.505 1.00 27.63  ?  391  ASP A CB    1 
ATOM   2395  C  CG    . ASP A 1  391  ? 121.034 175.002 157.128 1.00 27.63  ?  391  ASP A CG    1 
ATOM   2396  O  OD1   . ASP A 1  391  ? 119.925 175.574 157.163 1.00 27.63  ?  391  ASP A OD1   1 
ATOM   2397  O  OD2   . ASP A 1  391  ? 121.179 173.817 156.772 1.00 27.63  -1 391  ASP A OD2   1 
ATOM   2398  N  N     . VAL A 1  392  ? 124.245 177.739 158.646 1.00 31.36  ?  392  VAL A N     1 
ATOM   2399  C  CA    . VAL A 1  392  ? 125.569 177.922 159.230 1.00 31.36  ?  392  VAL A CA    1 
ATOM   2400  C  C     . VAL A 1  392  ? 125.910 179.411 159.260 1.00 31.36  ?  392  VAL A C     1 
ATOM   2401  O  O     . VAL A 1  392  ? 125.581 180.157 158.331 1.00 31.36  ?  392  VAL A O     1 
ATOM   2402  C  CB    . VAL A 1  392  ? 126.635 177.121 158.443 1.00 31.36  ?  392  VAL A CB    1 
ATOM   2403  C  CG1   . VAL A 1  392  ? 127.961 177.068 159.185 1.00 31.36  ?  392  VAL A CG1   1 
ATOM   2404  C  CG2   . VAL A 1  392  ? 126.154 175.708 158.162 1.00 31.36  ?  392  VAL A CG2   1 
ATOM   2405  N  N     . ILE A 1  393  ? 126.570 179.843 160.340 1.00 31.44  ?  393  ILE A N     1 
ATOM   2406  C  CA    . ILE A 1  393  ? 127.055 181.215 160.485 1.00 31.44  ?  393  ILE A CA    1 
ATOM   2407  C  C     . ILE A 1  393  ? 128.571 181.179 160.632 1.00 31.44  ?  393  ILE A C     1 
ATOM   2408  O  O     . ILE A 1  393  ? 129.092 180.522 161.542 1.00 31.44  ?  393  ILE A O     1 
ATOM   2409  C  CB    . ILE A 1  393  ? 126.414 181.926 161.687 1.00 31.44  ?  393  ILE A CB    1 
ATOM   2410  C  CG1   . ILE A 1  393  ? 124.890 181.930 161.551 1.00 31.44  ?  393  ILE A CG1   1 
ATOM   2411  C  CG2   . ILE A 1  393  ? 126.947 183.338 161.810 1.00 31.44  ?  393  ILE A CG2   1 
ATOM   2412  C  CD1   . ILE A 1  393  ? 124.177 182.709 162.623 1.00 31.44  ?  393  ILE A CD1   1 
ATOM   2413  N  N     . THR A 1  394  ? 129.281 181.877 159.747 1.00 28.18  ?  394  THR A N     1 
ATOM   2414  C  CA    . THR A 1  394  ? 130.736 181.967 159.820 1.00 28.18  ?  394  THR A CA    1 
ATOM   2415  C  C     . THR A 1  394  ? 131.174 183.430 159.866 1.00 28.18  ?  394  THR A C     1 
ATOM   2416  O  O     . THR A 1  394  ? 130.364 184.354 159.901 1.00 28.18  ?  394  THR A O     1 
ATOM   2417  C  CB    . THR A 1  394  ? 131.419 181.256 158.645 1.00 28.18  ?  394  THR A CB    1 
ATOM   2418  O  OG1   . THR A 1  394  ? 131.016 181.853 157.413 1.00 28.18  ?  394  THR A OG1   1 
ATOM   2419  C  CG2   . THR A 1  394  ? 131.071 179.789 158.610 1.00 28.18  ?  394  THR A CG2   1 
ATOM   2420  N  N     . GLY A 1  395  ? 132.484 183.617 159.852 1.00 27.80  ?  395  GLY A N     1 
ATOM   2421  C  CA    . GLY A 1  395  ? 133.073 184.929 160.025 1.00 27.80  ?  395  GLY A CA    1 
ATOM   2422  C  C     . GLY A 1  395  ? 134.514 184.769 160.464 1.00 27.80  ?  395  GLY A C     1 
ATOM   2423  O  O     . GLY A 1  395  ? 135.098 183.702 160.325 1.00 27.80  ?  395  GLY A O     1 
ATOM   2424  N  N     . TYR A 1  396  ? 135.067 185.856 160.986 1.00 40.62  ?  396  TYR A N     1 
ATOM   2425  C  CA    . TYR A 1  396  ? 136.428 185.848 161.516 1.00 40.62  ?  396  TYR A CA    1 
ATOM   2426  C  C     . TYR A 1  396  ? 136.426 186.656 162.801 1.00 40.62  ?  396  TYR A C     1 
ATOM   2427  O  O     . TYR A 1  396  ? 136.205 187.872 162.761 1.00 40.62  ?  396  TYR A O     1 
ATOM   2428  C  CB    . TYR A 1  396  ? 137.417 186.419 160.513 1.00 40.62  ?  396  TYR A CB    1 
ATOM   2429  C  CG    . TYR A 1  396  ? 138.792 185.834 160.609 1.00 40.62  ?  396  TYR A CG    1 
ATOM   2430  C  CD1   . TYR A 1  396  ? 139.124 184.695 159.908 1.00 40.62  ?  396  TYR A CD1   1 
ATOM   2431  C  CD2   . TYR A 1  396  ? 139.761 186.430 161.391 1.00 40.62  ?  396  TYR A CD2   1 
ATOM   2432  C  CE1   . TYR A 1  396  ? 140.391 184.153 159.991 1.00 40.62  ?  396  TYR A CE1   1 
ATOM   2433  C  CE2   . TYR A 1  396  ? 141.024 185.900 161.482 1.00 40.62  ?  396  TYR A CE2   1 
ATOM   2434  C  CZ    . TYR A 1  396  ? 141.336 184.763 160.780 1.00 40.62  ?  396  TYR A CZ    1 
ATOM   2435  O  OH    . TYR A 1  396  ? 142.599 184.238 160.867 1.00 40.62  ?  396  TYR A OH    1 
ATOM   2436  N  N     . ASN A 1  397  ? 136.666 185.966 163.922 1.00 24.94  ?  397  ASN A N     1 
ATOM   2437  C  CA    . ASN A 1  397  ? 136.599 186.512 165.280 1.00 24.94  ?  397  ASN A CA    1 
ATOM   2438  C  C     . ASN A 1  397  ? 135.218 187.082 165.592 1.00 24.94  ?  397  ASN A C     1 
ATOM   2439  O  O     . ASN A 1  397  ? 135.082 188.156 166.175 1.00 24.94  ?  397  ASN A O     1 
ATOM   2440  C  CB    . ASN A 1  397  ? 137.696 187.551 165.521 1.00 24.94  ?  397  ASN A CB    1 
ATOM   2441  C  CG    . ASN A 1  397  ? 138.068 187.686 166.974 1.00 24.94  ?  397  ASN A CG    1 
ATOM   2442  O  OD1   . ASN A 1  397  ? 138.251 186.694 167.678 1.00 24.94  ?  397  ASN A OD1   1 
ATOM   2443  N  ND2   . ASN A 1  397  ? 138.190 188.920 167.434 1.00 24.94  ?  397  ASN A ND2   1 
ATOM   2444  N  N     . ILE A 1  398  ? 134.177 186.350 165.199 1.00 22.99  ?  398  ILE A N     1 
ATOM   2445  C  CA    . ILE A 1  398  ? 132.812 186.778 165.496 1.00 22.99  ?  398  ILE A CA    1 
ATOM   2446  C  C     . ILE A 1  398  ? 132.414 186.410 166.920 1.00 22.99  ?  398  ILE A C     1 
ATOM   2447  O  O     . ILE A 1  398  ? 131.595 187.109 167.524 1.00 22.99  ?  398  ILE A O     1 
ATOM   2448  C  CB    . ILE A 1  398  ? 131.799 186.197 164.486 1.00 22.99  ?  398  ILE A CB    1 
ATOM   2449  C  CG1   . ILE A 1  398  ? 132.086 184.733 164.199 1.00 22.99  ?  398  ILE A CG1   1 
ATOM   2450  C  CG2   . ILE A 1  398  ? 131.824 186.940 163.186 1.00 22.99  ?  398  ILE A CG2   1 
ATOM   2451  C  CD1   . ILE A 1  398  ? 130.944 184.018 163.572 1.00 22.99  ?  398  ILE A CD1   1 
ATOM   2452  N  N     . GLN A 1  399  ? 132.982 185.324 167.464 1.00 20.33  ?  399  GLN A N     1 
ATOM   2453  C  CA    . GLN A 1  399  ? 132.654 184.878 168.817 1.00 20.33  ?  399  GLN A CA    1 
ATOM   2454  C  C     . GLN A 1  399  ? 133.154 185.857 169.868 1.00 20.33  ?  399  GLN A C     1 
ATOM   2455  O  O     . GLN A 1  399  ? 132.399 186.278 170.751 1.00 20.33  ?  399  GLN A O     1 
ATOM   2456  C  CB    . GLN A 1  399  ? 133.247 183.498 169.083 1.00 20.33  ?  399  GLN A CB    1 
ATOM   2457  C  CG    . GLN A 1  399  ? 132.675 182.408 168.222 1.00 20.33  ?  399  GLN A CG    1 
ATOM   2458  C  CD    . GLN A 1  399  ? 133.065 181.018 168.677 1.00 20.33  ?  399  GLN A CD    1 
ATOM   2459  O  OE1   . GLN A 1  399  ? 133.855 180.848 169.603 1.00 20.33  ?  399  GLN A OE1   1 
ATOM   2460  N  NE2   . GLN A 1  399  ? 132.506 180.012 168.021 1.00 20.33  ?  399  GLN A NE2   1 
ATOM   2461  N  N     . ASN A 1  400  ? 134.427 186.213 169.804 1.00 23.43  ?  400  ASN A N     1 
ATOM   2462  C  CA    . ASN A 1  400  ? 135.030 187.033 170.837 1.00 23.43  ?  400  ASN A CA    1 
ATOM   2463  C  C     . ASN A 1  400  ? 134.934 188.524 170.562 1.00 23.43  ?  400  ASN A C     1 
ATOM   2464  O  O     . ASN A 1  400  ? 135.295 189.314 171.435 1.00 23.43  ?  400  ASN A O     1 
ATOM   2465  C  CB    . ASN A 1  400  ? 136.495 186.640 171.028 1.00 23.43  ?  400  ASN A CB    1 
ATOM   2466  C  CG    . ASN A 1  400  ? 136.651 185.359 171.807 1.00 23.43  ?  400  ASN A CG    1 
ATOM   2467  O  OD1   . ASN A 1  400  ? 136.020 185.178 172.837 1.00 23.43  ?  400  ASN A OD1   1 
ATOM   2468  N  ND2   . ASN A 1  400  ? 137.496 184.463 171.323 1.00 23.43  ?  400  ASN A ND2   1 
ATOM   2469  N  N     . PHE A 1  401  ? 134.478 188.946 169.388 1.00 23.43  ?  401  PHE A N     1 
ATOM   2470  C  CA    . PHE A 1  401  ? 134.249 190.373 169.218 1.00 23.43  ?  401  PHE A CA    1 
ATOM   2471  C  C     . PHE A 1  401  ? 132.830 190.735 168.810 1.00 23.43  ?  401  PHE A C     1 
ATOM   2472  O  O     . PHE A 1  401  ? 132.231 191.612 169.439 1.00 23.43  ?  401  PHE A O     1 
ATOM   2473  C  CB    . PHE A 1  401  ? 135.237 190.974 168.213 1.00 23.43  ?  401  PHE A CB    1 
ATOM   2474  C  CG    . PHE A 1  401  ? 135.087 192.452 168.065 1.00 23.43  ?  401  PHE A CG    1 
ATOM   2475  C  CD1   . PHE A 1  401  ? 135.327 193.286 169.135 1.00 23.43  ?  401  PHE A CD1   1 
ATOM   2476  C  CD2   . PHE A 1  401  ? 134.666 193.003 166.876 1.00 23.43  ?  401  PHE A CD2   1 
ATOM   2477  C  CE1   . PHE A 1  401  ? 135.166 194.651 169.020 1.00 23.43  ?  401  PHE A CE1   1 
ATOM   2478  C  CE2   . PHE A 1  401  ? 134.508 194.360 166.755 1.00 23.43  ?  401  PHE A CE2   1 
ATOM   2479  C  CZ    . PHE A 1  401  ? 134.755 195.186 167.832 1.00 23.43  ?  401  PHE A CZ    1 
ATOM   2480  N  N     . ASP A 1  402  ? 132.261 190.095 167.785 1.00 29.79  ?  402  ASP A N     1 
ATOM   2481  C  CA    . ASP A 1  402  ? 131.131 190.692 167.062 1.00 29.79  ?  402  ASP A CA    1 
ATOM   2482  C  C     . ASP A 1  402  ? 129.795 190.512 167.779 1.00 29.79  ?  402  ASP A C     1 
ATOM   2483  O  O     . ASP A 1  402  ? 129.091 191.491 168.060 1.00 29.79  ?  402  ASP A O     1 
ATOM   2484  C  CB    . ASP A 1  402  ? 131.053 190.096 165.655 1.00 29.79  ?  402  ASP A CB    1 
ATOM   2485  C  CG    . ASP A 1  402  ? 132.106 190.647 164.732 1.00 29.79  ?  402  ASP A CG    1 
ATOM   2486  O  OD1   . ASP A 1  402  ? 132.193 191.877 164.618 1.00 29.79  ?  402  ASP A OD1   1 
ATOM   2487  O  OD2   . ASP A 1  402  ? 132.854 189.866 164.125 1.00 29.79  -1 402  ASP A OD2   1 
ATOM   2488  N  N     . LEU A 1  403  ? 129.422 189.258 168.054 1.00 22.69  ?  403  LEU A N     1 
ATOM   2489  C  CA    . LEU A 1  403  ? 128.128 188.966 168.673 1.00 22.69  ?  403  LEU A CA    1 
ATOM   2490  C  C     . LEU A 1  403  ? 127.960 189.529 170.090 1.00 22.69  ?  403  LEU A C     1 
ATOM   2491  O  O     . LEU A 1  403  ? 126.886 190.096 170.363 1.00 22.69  ?  403  LEU A O     1 
ATOM   2492  C  CB    . LEU A 1  403  ? 127.877 187.454 168.612 1.00 22.69  ?  403  LEU A CB    1 
ATOM   2493  C  CG    . LEU A 1  403  ? 127.708 186.842 167.231 1.00 22.69  ?  403  LEU A CG    1 
ATOM   2494  C  CD1   . LEU A 1  403  ? 127.829 185.343 167.303 1.00 22.69  ?  403  LEU A CD1   1 
ATOM   2495  C  CD2   . LEU A 1  403  ? 126.365 187.216 166.689 1.00 22.69  ?  403  LEU A CD2   1 
ATOM   2496  N  N     . PRO A 1  404  ? 128.928 189.433 171.022 1.00 29.92  ?  404  PRO A N     1 
ATOM   2497  C  CA    . PRO A 1  404  ? 128.723 190.104 172.312 1.00 29.92  ?  404  PRO A CA    1 
ATOM   2498  C  C     . PRO A 1  404  ? 128.740 191.616 172.239 1.00 29.92  ?  404  PRO A C     1 
ATOM   2499  O  O     . PRO A 1  404  ? 128.086 192.252 173.074 1.00 29.92  ?  404  PRO A O     1 
ATOM   2500  C  CB    . PRO A 1  404  ? 129.875 189.577 173.167 1.00 29.92  ?  404  PRO A CB    1 
ATOM   2501  C  CG    . PRO A 1  404  ? 130.855 189.156 172.224 1.00 29.92  ?  404  PRO A CG    1 
ATOM   2502  C  CD    . PRO A 1  404  ? 130.095 188.544 171.140 1.00 29.92  ?  404  PRO A CD    1 
ATOM   2503  N  N     . TYR A 1  405  ? 129.434 192.212 171.262 1.00 40.62  ?  405  TYR A N     1 
ATOM   2504  C  CA    . TYR A 1  405  ? 129.306 193.650 171.057 1.00 40.62  ?  405  TYR A CA    1 
ATOM   2505  C  C     . TYR A 1  405  ? 127.892 194.020 170.650 1.00 40.62  ?  405  TYR A C     1 
ATOM   2506  O  O     . TYR A 1  405  ? 127.334 194.995 171.162 1.00 40.62  ?  405  TYR A O     1 
ATOM   2507  C  CB    . TYR A 1  405  ? 130.296 194.144 170.007 1.00 40.62  ?  405  TYR A CB    1 
ATOM   2508  C  CG    . TYR A 1  405  ? 130.586 195.623 170.115 1.00 40.62  ?  405  TYR A CG    1 
ATOM   2509  C  CD1   . TYR A 1  405  ? 129.721 196.561 169.584 1.00 40.62  ?  405  TYR A CD1   1 
ATOM   2510  C  CD2   . TYR A 1  405  ? 131.723 196.080 170.750 1.00 40.62  ?  405  TYR A CD2   1 
ATOM   2511  C  CE1   . TYR A 1  405  ? 129.963 197.882 169.695 1.00 40.62  ?  405  TYR A CE1   1 
ATOM   2512  C  CE2   . TYR A 1  405  ? 131.975 197.417 170.852 1.00 40.62  ?  405  TYR A CE2   1 
ATOM   2513  C  CZ    . TYR A 1  405  ? 131.088 198.308 170.320 1.00 40.62  ?  405  TYR A CZ    1 
ATOM   2514  O  OH    . TYR A 1  405  ? 131.302 199.655 170.403 1.00 40.62  ?  405  TYR A OH    1 
ATOM   2515  N  N     . LEU A 1  406  ? 127.297 193.248 169.737 1.00 29.81  ?  406  LEU A N     1 
ATOM   2516  C  CA    . LEU A 1  406  ? 125.928 193.523 169.309 1.00 29.81  ?  406  LEU A CA    1 
ATOM   2517  C  C     . LEU A 1  406  ? 124.935 193.342 170.451 1.00 29.81  ?  406  LEU A C     1 
ATOM   2518  O  O     . LEU A 1  406  ? 124.016 194.151 170.622 1.00 29.81  ?  406  LEU A O     1 
ATOM   2519  C  CB    . LEU A 1  406  ? 125.561 192.613 168.146 1.00 29.81  ?  406  LEU A CB    1 
ATOM   2520  C  CG    . LEU A 1  406  ? 126.277 192.870 166.830 1.00 29.81  ?  406  LEU A CG    1 
ATOM   2521  C  CD1   . LEU A 1  406  ? 126.255 191.612 165.993 1.00 29.81  ?  406  LEU A CD1   1 
ATOM   2522  C  CD2   . LEU A 1  406  ? 125.625 194.029 166.110 1.00 29.81  ?  406  LEU A CD2   1 
ATOM   2523  N  N     . ILE A 1  407  ? 125.140 192.308 171.266 1.00 25.85  ?  407  ILE A N     1 
ATOM   2524  C  CA    . ILE A 1  407  ? 124.226 192.000 172.362 1.00 25.85  ?  407  ILE A CA    1 
ATOM   2525  C  C     . ILE A 1  407  ? 124.298 193.068 173.452 1.00 25.85  ?  407  ILE A C     1 
ATOM   2526  O  O     . ILE A 1  407  ? 123.266 193.552 173.938 1.00 25.85  ?  407  ILE A O     1 
ATOM   2527  C  CB    . ILE A 1  407  ? 124.536 190.592 172.895 1.00 25.85  ?  407  ILE A CB    1 
ATOM   2528  C  CG1   . ILE A 1  407  ? 124.028 189.564 171.890 1.00 25.85  ?  407  ILE A CG1   1 
ATOM   2529  C  CG2   . ILE A 1  407  ? 123.932 190.370 174.254 1.00 25.85  ?  407  ILE A CG2   1 
ATOM   2530  C  CD1   . ILE A 1  407  ? 124.239 188.157 172.287 1.00 25.85  ?  407  ILE A CD1   1 
ATOM   2531  N  N     . SER A 1  408  ? 125.513 193.490 173.814 1.00 26.29  ?  408  SER A N     1 
ATOM   2532  C  CA    . SER A 1  408  ? 125.664 194.535 174.819 1.00 26.29  ?  408  SER A CA    1 
ATOM   2533  C  C     . SER A 1  408  ? 125.161 195.879 174.308 1.00 26.29  ?  408  SER A C     1 
ATOM   2534  O  O     . SER A 1  408  ? 124.543 196.646 175.062 1.00 26.29  ?  408  SER A O     1 
ATOM   2535  C  CB    . SER A 1  408  ? 127.126 194.636 175.233 1.00 26.29  ?  408  SER A CB    1 
ATOM   2536  O  OG    . SER A 1  408  ? 127.582 193.414 175.788 1.00 26.29  ?  408  SER A OG    1 
ATOM   2537  N  N     . ARG A 1  409  ? 125.373 196.163 173.023 1.00 29.33  ?  409  ARG A N     1 
ATOM   2538  C  CA    . ARG A 1  409  ? 124.906 197.422 172.463 1.00 29.33  ?  409  ARG A CA    1 
ATOM   2539  C  C     . ARG A 1  409  ? 123.387 197.460 172.366 1.00 29.33  ?  409  ARG A C     1 
ATOM   2540  O  O     . ARG A 1  409  ? 122.785 198.532 172.501 1.00 29.33  ?  409  ARG A O     1 
ATOM   2541  C  CB    . ARG A 1  409  ? 125.549 197.638 171.091 1.00 29.33  ?  409  ARG A CB    1 
ATOM   2542  C  CG    . ARG A 1  409  ? 125.435 199.046 170.547 1.00 29.33  ?  409  ARG A CG    1 
ATOM   2543  C  CD    . ARG A 1  409  ? 125.772 200.082 171.598 1.00 29.33  ?  409  ARG A CD    1 
ATOM   2544  N  NE    . ARG A 1  409  ? 125.582 201.441 171.120 1.00 29.33  ?  409  ARG A NE    1 
ATOM   2545  C  CZ    . ARG A 1  409  ? 125.943 202.515 171.807 1.00 29.33  ?  409  ARG A CZ    1 
ATOM   2546  N  NH1   . ARG A 1  409  ? 126.507 202.372 172.987 1.00 29.33  1  409  ARG A NH1   1 
ATOM   2547  N  NH2   . ARG A 1  409  ? 125.752 203.726 171.314 1.00 29.33  ?  409  ARG A NH2   1 
ATOM   2548  N  N     . ALA A 1  410  ? 122.749 196.307 172.147 1.00 25.12  ?  410  ALA A N     1 
ATOM   2549  C  CA    . ALA A 1  410  ? 121.295 196.268 172.150 1.00 25.12  ?  410  ALA A CA    1 
ATOM   2550  C  C     . ALA A 1  410  ? 120.736 196.391 173.562 1.00 25.12  ?  410  ALA A C     1 
ATOM   2551  O  O     . ALA A 1  410  ? 119.662 196.972 173.748 1.00 25.12  ?  410  ALA A O     1 
ATOM   2552  C  CB    . ALA A 1  410  ? 120.809 194.987 171.489 1.00 25.12  ?  410  ALA A CB    1 
ATOM   2553  N  N     . GLN A 1  411  ? 121.448 195.848 174.558 1.00 26.43  ?  411  GLN A N     1 
ATOM   2554  C  CA    . GLN A 1  411  ? 121.032 196.013 175.950 1.00 26.43  ?  411  GLN A CA    1 
ATOM   2555  C  C     . GLN A 1  411  ? 121.119 197.460 176.411 1.00 26.43  ?  411  GLN A C     1 
ATOM   2556  O  O     . GLN A 1  411  ? 120.290 197.897 177.212 1.00 26.43  ?  411  GLN A O     1 
ATOM   2557  C  CB    . GLN A 1  411  ? 121.878 195.142 176.867 1.00 26.43  ?  411  GLN A CB    1 
ATOM   2558  C  CG    . GLN A 1  411  ? 121.498 193.685 176.840 1.00 26.43  ?  411  GLN A CG    1 
ATOM   2559  C  CD    . GLN A 1  411  ? 122.368 192.847 177.742 1.00 26.43  ?  411  GLN A CD    1 
ATOM   2560  O  OE1   . GLN A 1  411  ? 123.278 193.355 178.389 1.00 26.43  ?  411  GLN A OE1   1 
ATOM   2561  N  NE2   . GLN A 1  411  ? 122.093 191.553 177.788 1.00 26.43  ?  411  GLN A NE2   1 
ATOM   2562  N  N     . THR A 1  412  ? 122.112 198.210 175.940 1.00 29.40  ?  412  THR A N     1 
ATOM   2563  C  CA    . THR A 1  412  ? 122.269 199.583 176.416 1.00 29.40  ?  412  THR A CA    1 
ATOM   2564  C  C     . THR A 1  412  ? 121.196 200.514 175.851 1.00 29.40  ?  412  THR A C     1 
ATOM   2565  O  O     . THR A 1  412  ? 120.719 201.410 176.558 1.00 29.40  ?  412  THR A O     1 
ATOM   2566  C  CB    . THR A 1  412  ? 123.675 200.082 176.068 1.00 29.40  ?  412  THR A CB    1 
ATOM   2567  O  OG1   . THR A 1  412  ? 124.640 199.213 176.670 1.00 29.40  ?  412  THR A OG1   1 
ATOM   2568  C  CG2   . THR A 1  412  ? 123.924 201.494 176.572 1.00 29.40  ?  412  THR A CG2   1 
ATOM   2569  N  N     . LEU A 1  413  ? 120.763 200.299 174.612 1.00 30.45  ?  413  LEU A N     1 
ATOM   2570  C  CA    . LEU A 1  413  ? 119.866 201.241 173.949 1.00 30.45  ?  413  LEU A CA    1 
ATOM   2571  C  C     . LEU A 1  413  ? 118.385 200.936 174.150 1.00 30.45  ?  413  LEU A C     1 
ATOM   2572  O  O     . LEU A 1  413  ? 117.553 201.641 173.567 1.00 30.45  ?  413  LEU A O     1 
ATOM   2573  C  CB    . LEU A 1  413  ? 120.167 201.293 172.449 1.00 30.45  ?  413  LEU A CB    1 
ATOM   2574  C  CG    . LEU A 1  413  ? 121.459 201.972 172.001 1.00 30.45  ?  413  LEU A CG    1 
ATOM   2575  C  CD1   . LEU A 1  413  ? 121.485 202.072 170.497 1.00 30.45  ?  413  LEU A CD1   1 
ATOM   2576  C  CD2   . LEU A 1  413  ? 121.597 203.338 172.625 1.00 30.45  ?  413  LEU A CD2   1 
ATOM   2577  N  N     . LYS A 1  414  ? 118.049 199.921 174.956 1.00 36.87  ?  414  LYS A N     1 
ATOM   2578  C  CA    . LYS A 1  414  ? 116.678 199.509 175.282 1.00 36.87  ?  414  LYS A CA    1 
ATOM   2579  C  C     . LYS A 1  414  ? 115.880 199.135 174.030 1.00 36.87  ?  414  LYS A C     1 
ATOM   2580  O  O     . LYS A 1  414  ? 114.902 199.783 173.660 1.00 36.87  ?  414  LYS A O     1 
ATOM   2581  C  CB    . LYS A 1  414  ? 115.939 200.575 176.102 1.00 36.87  ?  414  LYS A CB    1 
ATOM   2582  C  CG    . LYS A 1  414  ? 116.723 201.133 177.272 1.00 36.87  ?  414  LYS A CG    1 
ATOM   2583  C  CD    . LYS A 1  414  ? 116.421 202.605 177.456 1.00 36.87  ?  414  LYS A CD    1 
ATOM   2584  C  CE    . LYS A 1  414  ? 117.357 203.239 178.455 1.00 36.87  ?  414  LYS A CE    1 
ATOM   2585  N  NZ    . LYS A 1  414  ? 117.366 204.723 178.346 1.00 36.87  1  414  LYS A NZ    1 
ATOM   2586  N  N     . VAL A 1  415  ? 116.338 198.080 173.364 1.00 35.29  ?  415  VAL A N     1 
ATOM   2587  C  CA    . VAL A 1  415  ? 115.607 197.451 172.273 1.00 35.29  ?  415  VAL A CA    1 
ATOM   2588  C  C     . VAL A 1  415  ? 115.337 196.023 172.729 1.00 35.29  ?  415  VAL A C     1 
ATOM   2589  O  O     . VAL A 1  415  ? 116.263 195.214 172.851 1.00 35.29  ?  415  VAL A O     1 
ATOM   2590  C  CB    . VAL A 1  415  ? 116.378 197.487 170.946 1.00 35.29  ?  415  VAL A CB    1 
ATOM   2591  C  CG1   . VAL A 1  415  ? 115.463 197.151 169.792 1.00 35.29  ?  415  VAL A CG1   1 
ATOM   2592  C  CG2   . VAL A 1  415  ? 116.998 198.851 170.722 1.00 35.29  ?  415  VAL A CG2   1 
ATOM   2593  N  N     . GLN A 1  416  ? 114.071 195.703 172.983 1.00 36.59  ?  416  GLN A N     1 
ATOM   2594  C  CA    . GLN A 1  416  ? 113.722 194.458 173.654 1.00 36.59  ?  416  GLN A CA    1 
ATOM   2595  C  C     . GLN A 1  416  ? 113.734 193.244 172.735 1.00 36.59  ?  416  GLN A C     1 
ATOM   2596  O  O     . GLN A 1  416  ? 113.862 192.121 173.231 1.00 36.59  ?  416  GLN A O     1 
ATOM   2597  C  CB    . GLN A 1  416  ? 112.342 194.580 174.306 1.00 36.59  ?  416  GLN A CB    1 
ATOM   2598  C  CG    . GLN A 1  416  ? 111.214 194.879 173.333 1.00 36.59  ?  416  GLN A CG    1 
ATOM   2599  C  CD    . GLN A 1  416  ? 110.716 196.318 173.396 1.00 36.59  ?  416  GLN A CD    1 
ATOM   2600  O  OE1   . GLN A 1  416  ? 111.245 197.146 174.140 1.00 36.59  ?  416  GLN A OE1   1 
ATOM   2601  N  NE2   . GLN A 1  416  ? 109.703 196.620 172.597 1.00 36.59  ?  416  GLN A NE2   1 
ATOM   2602  N  N     . THR A 1  417  ? 113.627 193.429 171.426 1.00 29.65  ?  417  THR A N     1 
ATOM   2603  C  CA    . THR A 1  417  ? 113.309 192.337 170.521 1.00 29.65  ?  417  THR A CA    1 
ATOM   2604  C  C     . THR A 1  417  ? 114.558 191.829 169.802 1.00 29.65  ?  417  THR A C     1 
ATOM   2605  O  O     . THR A 1  417  ? 114.478 190.881 169.018 1.00 29.65  ?  417  THR A O     1 
ATOM   2606  C  CB    . THR A 1  417  ? 112.232 192.829 169.536 1.00 29.65  ?  417  THR A CB    1 
ATOM   2607  O  OG1   . THR A 1  417  ? 111.230 193.525 170.282 1.00 29.65  ?  417  THR A OG1   1 
ATOM   2608  C  CG2   . THR A 1  417  ? 111.465 191.687 168.882 1.00 29.65  ?  417  THR A CG2   1 
ATOM   2609  N  N     . PHE A 1  418  ? 115.731 192.393 170.103 1.00 24.41  ?  418  PHE A N     1 
ATOM   2610  C  CA    . PHE A 1  418  ? 116.951 191.953 169.430 1.00 24.41  ?  418  PHE A CA    1 
ATOM   2611  C  C     . PHE A 1  418  ? 117.385 190.529 169.775 1.00 24.41  ?  418  PHE A C     1 
ATOM   2612  O  O     . PHE A 1  418  ? 117.525 189.716 168.847 1.00 24.41  ?  418  PHE A O     1 
ATOM   2613  C  CB    . PHE A 1  418  ? 118.089 192.953 169.664 1.00 24.41  ?  418  PHE A CB    1 
ATOM   2614  C  CG    . PHE A 1  418  ? 119.319 192.640 168.862 1.00 24.41  ?  418  PHE A CG    1 
ATOM   2615  C  CD1   . PHE A 1  418  ? 119.378 192.937 167.512 1.00 24.41  ?  418  PHE A CD1   1 
ATOM   2616  C  CD2   . PHE A 1  418  ? 120.401 192.003 169.441 1.00 24.41  ?  418  PHE A CD2   1 
ATOM   2617  C  CE1   . PHE A 1  418  ? 120.500 192.612 166.765 1.00 24.41  ?  418  PHE A CE1   1 
ATOM   2618  C  CE2   . PHE A 1  418  ? 121.514 191.677 168.695 1.00 24.41  ?  418  PHE A CE2   1 
ATOM   2619  C  CZ    . PHE A 1  418  ? 121.562 191.987 167.362 1.00 24.41  ?  418  PHE A CZ    1 
ATOM   2620  N  N     . PRO A 1  419  ? 117.627 190.141 171.062 1.00 24.16  ?  419  PRO A N     1 
ATOM   2621  C  CA    . PRO A 1  419  ? 118.412 188.919 171.262 1.00 24.16  ?  419  PRO A CA    1 
ATOM   2622  C  C     . PRO A 1  419  ? 117.662 187.603 171.137 1.00 24.16  ?  419  PRO A C     1 
ATOM   2623  O  O     . PRO A 1  419  ? 117.954 186.670 171.881 1.00 24.16  ?  419  PRO A O     1 
ATOM   2624  C  CB    . PRO A 1  419  ? 118.935 189.099 172.684 1.00 24.16  ?  419  PRO A CB    1 
ATOM   2625  C  CG    . PRO A 1  419  ? 117.840 189.736 173.350 1.00 24.16  ?  419  PRO A CG    1 
ATOM   2626  C  CD    . PRO A 1  419  ? 117.259 190.706 172.376 1.00 24.16  ?  419  PRO A CD    1 
ATOM   2627  N  N     . PHE A 1  420  ? 116.802 187.463 170.135 1.00 22.24  ?  420  PHE A N     1 
ATOM   2628  C  CA    . PHE A 1  420  ? 116.004 186.263 169.913 1.00 22.24  ?  420  PHE A CA    1 
ATOM   2629  C  C     . PHE A 1  420  ? 116.474 185.517 168.671 1.00 22.24  ?  420  PHE A C     1 
ATOM   2630  O  O     . PHE A 1  420  ? 115.671 185.006 167.895 1.00 22.24  ?  420  PHE A O     1 
ATOM   2631  C  CB    . PHE A 1  420  ? 114.523 186.612 169.792 1.00 22.24  ?  420  PHE A CB    1 
ATOM   2632  C  CG    . PHE A 1  420  ? 113.915 187.136 171.058 1.00 22.24  ?  420  PHE A CG    1 
ATOM   2633  C  CD1   . PHE A 1  420  ? 113.375 186.271 171.987 1.00 22.24  ?  420  PHE A CD1   1 
ATOM   2634  C  CD2   . PHE A 1  420  ? 113.881 188.489 171.322 1.00 22.24  ?  420  PHE A CD2   1 
ATOM   2635  C  CE1   . PHE A 1  420  ? 112.812 186.747 173.149 1.00 22.24  ?  420  PHE A CE1   1 
ATOM   2636  C  CE2   . PHE A 1  420  ? 113.321 188.969 172.486 1.00 22.24  ?  420  PHE A CE2   1 
ATOM   2637  C  CZ    . PHE A 1  420  ? 112.787 188.100 173.399 1.00 22.24  ?  420  PHE A CZ    1 
ATOM   2638  N  N     . LEU A 1  421  ? 117.764 185.558 168.402 1.00 20.39  ?  421  LEU A N     1 
ATOM   2639  C  CA    . LEU A 1  421  ? 118.284 185.106 167.108 1.00 20.39  ?  421  LEU A CA    1 
ATOM   2640  C  C     . LEU A 1  421  ? 118.131 183.649 166.726 1.00 20.39  ?  421  LEU A C     1 
ATOM   2641  O  O     . LEU A 1  421  ? 118.405 183.269 165.589 1.00 20.39  ?  421  LEU A O     1 
ATOM   2642  C  CB    . LEU A 1  421  ? 119.756 185.511 166.972 1.00 20.39  ?  421  LEU A CB    1 
ATOM   2643  C  CG    . LEU A 1  421  ? 120.049 187.012 166.954 1.00 20.39  ?  421  LEU A CG    1 
ATOM   2644  C  CD1   . LEU A 1  421  ? 119.086 187.736 166.025 1.00 20.39  ?  421  LEU A CD1   1 
ATOM   2645  C  CD2   . LEU A 1  421  ? 119.980 187.591 168.359 1.00 20.39  ?  421  LEU A CD2   1 
ATOM   2646  N  N     . GLY A 1  422  ? 117.702 182.831 167.667 1.00 21.15  ?  422  GLY A N     1 
ATOM   2647  C  CA    . GLY A 1  422  ? 117.726 181.397 167.430 1.00 21.15  ?  422  GLY A CA    1 
ATOM   2648  C  C     . GLY A 1  422  ? 116.514 180.928 166.648 1.00 21.15  ?  422  GLY A C     1 
ATOM   2649  O  O     . GLY A 1  422  ? 115.808 181.716 166.022 1.00 21.15  ?  422  GLY A O     1 
ATOM   2650  N  N     . ARG A 1  423  ? 116.276 179.614 166.681 1.00 25.01  ?  423  ARG A N     1 
ATOM   2651  C  CA    . ARG A 1  423  ? 115.134 179.048 165.971 1.00 25.01  ?  423  ARG A CA    1 
ATOM   2652  C  C     . ARG A 1  423  ? 113.894 178.918 166.845 1.00 25.01  ?  423  ARG A C     1 
ATOM   2653  O  O     . ARG A 1  423  ? 112.778 178.989 166.328 1.00 25.01  ?  423  ARG A O     1 
ATOM   2654  C  CB    . ARG A 1  423  ? 115.496 177.686 165.387 1.00 25.01  ?  423  ARG A CB    1 
ATOM   2655  C  CG    . ARG A 1  423  ? 115.759 177.742 163.916 1.00 25.01  ?  423  ARG A CG    1 
ATOM   2656  C  CD    . ARG A 1  423  ? 116.583 176.595 163.422 1.00 25.01  ?  423  ARG A CD    1 
ATOM   2657  N  NE    . ARG A 1  423  ? 116.729 176.662 161.976 1.00 25.01  ?  423  ARG A NE    1 
ATOM   2658  C  CZ    . ARG A 1  423  ? 117.533 175.885 161.265 1.00 25.01  ?  423  ARG A CZ    1 
ATOM   2659  N  NH1   . ARG A 1  423  ? 118.269 174.963 161.863 1.00 25.01  1  423  ARG A NH1   1 
ATOM   2660  N  NH2   . ARG A 1  423  ? 117.597 176.024 159.949 1.00 25.01  ?  423  ARG A NH2   1 
ATOM   2661  N  N     . VAL A 1  424  ? 114.058 178.721 168.145 1.00 25.13  ?  424  VAL A N     1 
ATOM   2662  C  CA    . VAL A 1  424  ? 112.934 178.561 169.060 1.00 25.13  ?  424  VAL A CA    1 
ATOM   2663  C  C     . VAL A 1  424  ? 112.337 179.935 169.329 1.00 25.13  ?  424  VAL A C     1 
ATOM   2664  O  O     . VAL A 1  424  ? 113.067 180.894 169.602 1.00 25.13  ?  424  VAL A O     1 
ATOM   2665  C  CB    . VAL A 1  424  ? 113.391 177.866 170.352 1.00 25.13  ?  424  VAL A CB    1 
ATOM   2666  C  CG1   . VAL A 1  424  ? 112.344 177.955 171.438 1.00 25.13  ?  424  VAL A CG1   1 
ATOM   2667  C  CG2   . VAL A 1  424  ? 113.723 176.417 170.057 1.00 25.13  ?  424  VAL A CG2   1 
ATOM   2668  N  N     . ALA A 1  425  ? 111.005 180.032 169.240 1.00 30.54  ?  425  ALA A N     1 
ATOM   2669  C  CA    . ALA A 1  425  ? 110.340 181.330 169.132 1.00 30.54  ?  425  ALA A CA    1 
ATOM   2670  C  C     . ALA A 1  425  ? 110.346 182.121 170.435 1.00 30.54  ?  425  ALA A C     1 
ATOM   2671  O  O     . ALA A 1  425  ? 110.239 183.352 170.402 1.00 30.54  ?  425  ALA A O     1 
ATOM   2672  C  CB    . ALA A 1  425  ? 108.904 181.141 168.650 1.00 30.54  ?  425  ALA A CB    1 
ATOM   2673  N  N     . GLY A 1  426  ? 110.460 181.458 171.582 1.00 32.28  ?  426  GLY A N     1 
ATOM   2674  C  CA    . GLY A 1  426  ? 110.402 182.148 172.856 1.00 32.28  ?  426  GLY A CA    1 
ATOM   2675  C  C     . GLY A 1  426  ? 111.672 182.187 173.673 1.00 32.28  ?  426  GLY A C     1 
ATOM   2676  O  O     . GLY A 1  426  ? 111.591 182.258 174.906 1.00 32.28  ?  426  GLY A O     1 
ATOM   2677  N  N     . LEU A 1  427  ? 112.843 182.165 173.049 1.00 28.30  ?  427  LEU A N     1 
ATOM   2678  C  CA    . LEU A 1  427  ? 114.104 181.997 173.753 1.00 28.30  ?  427  LEU A CA    1 
ATOM   2679  C  C     . LEU A 1  427  ? 115.052 183.133 173.403 1.00 28.30  ?  427  LEU A C     1 
ATOM   2680  O  O     . LEU A 1  427  ? 115.252 183.428 172.223 1.00 28.30  ?  427  LEU A O     1 
ATOM   2681  C  CB    . LEU A 1  427  ? 114.731 180.650 173.389 1.00 28.30  ?  427  LEU A CB    1 
ATOM   2682  C  CG    . LEU A 1  427  ? 115.650 179.968 174.388 1.00 28.30  ?  427  LEU A CG    1 
ATOM   2683  C  CD1   . LEU A 1  427  ? 115.053 180.038 175.771 1.00 28.30  ?  427  LEU A CD1   1 
ATOM   2684  C  CD2   . LEU A 1  427  ? 115.853 178.533 173.974 1.00 28.30  ?  427  LEU A CD2   1 
ATOM   2685  N  N     . CYS A 1  428  ? 115.646 183.755 174.418 1.00 32.82  ?  428  CYS A N     1 
ATOM   2686  C  CA    . CYS A 1  428  ? 116.631 184.806 174.211 1.00 32.82  ?  428  CYS A CA    1 
ATOM   2687  C  C     . CYS A 1  428  ? 118.031 184.284 174.519 1.00 32.82  ?  428  CYS A C     1 
ATOM   2688  O  O     . CYS A 1  428  ? 118.207 183.302 175.242 1.00 32.82  ?  428  CYS A O     1 
ATOM   2689  C  CB    . CYS A 1  428  ? 116.329 186.041 175.061 1.00 32.82  ?  428  CYS A CB    1 
ATOM   2690  S  SG    . CYS A 1  428  ? 116.455 185.780 176.824 1.00 32.82  ?  428  CYS A SG    1 
ATOM   2691  N  N     . SER A 1  429  ? 119.033 184.963 173.959 1.00 33.26  ?  429  SER A N     1 
ATOM   2692  C  CA    . SER A 1  429  ? 120.413 184.494 173.925 1.00 33.26  ?  429  SER A CA    1 
ATOM   2693  C  C     . SER A 1  429  ? 121.271 185.178 174.985 1.00 33.26  ?  429  SER A C     1 
ATOM   2694  O  O     . SER A 1  429  ? 120.966 186.279 175.444 1.00 33.26  ?  429  SER A O     1 
ATOM   2695  C  CB    . SER A 1  429  ? 121.014 184.729 172.540 1.00 33.26  ?  429  SER A CB    1 
ATOM   2696  O  OG    . SER A 1  429  ? 120.669 183.679 171.657 1.00 33.26  ?  429  SER A OG    1 
ATOM   2697  N  N     . ASN A 1  430  ? 122.365 184.508 175.367 1.00 38.70  ?  430  ASN A N     1 
ATOM   2698  C  CA    . ASN A 1  430  ? 123.166 184.949 176.503 1.00 38.70  ?  430  ASN A CA    1 
ATOM   2699  C  C     . ASN A 1  430  ? 124.641 184.596 176.326 1.00 38.70  ?  430  ASN A C     1 
ATOM   2700  O  O     . ASN A 1  430  ? 124.988 183.581 175.720 1.00 38.70  ?  430  ASN A O     1 
ATOM   2701  C  CB    . ASN A 1  430  ? 122.637 184.343 177.809 1.00 38.70  ?  430  ASN A CB    1 
ATOM   2702  C  CG    . ASN A 1  430  ? 121.370 185.026 178.294 1.00 38.70  ?  430  ASN A CG    1 
ATOM   2703  O  OD1   . ASN A 1  430  ? 120.462 184.382 178.821 1.00 38.70  ?  430  ASN A OD1   1 
ATOM   2704  N  ND2   . ASN A 1  430  ? 121.298 186.341 178.096 1.00 38.70  ?  430  ASN A ND2   1 
ATOM   2705  N  N     . ILE A 1  431  ? 125.500 185.436 176.909 1.00 38.48  ?  431  ILE A N     1 
ATOM   2706  C  CA    . ILE A 1  431  ? 126.954 185.350 176.780 1.00 38.48  ?  431  ILE A CA    1 
ATOM   2707  C  C     . ILE A 1  431  ? 127.504 184.536 177.944 1.00 38.48  ?  431  ILE A C     1 
ATOM   2708  O  O     . ILE A 1  431  ? 127.146 184.785 179.103 1.00 38.48  ?  431  ILE A O     1 
ATOM   2709  C  CB    . ILE A 1  431  ? 127.576 186.758 176.766 1.00 38.48  ?  431  ILE A CB    1 
ATOM   2710  C  CG1   . ILE A 1  431  ? 126.879 187.647 175.745 1.00 38.48  ?  431  ILE A CG1   1 
ATOM   2711  C  CG2   . ILE A 1  431  ? 129.044 186.702 176.434 1.00 38.48  ?  431  ILE A CG2   1 
ATOM   2712  C  CD1   . ILE A 1  431  ? 127.180 189.116 175.936 1.00 38.48  ?  431  ILE A CD1   1 
ATOM   2713  N  N     . ARG A 1  432  ? 128.392 183.585 177.659 1.00 53.19  ?  432  ARG A N     1 
ATOM   2714  C  CA    . ARG A 1  432  ? 128.863 182.657 178.685 1.00 53.19  ?  432  ARG A CA    1 
ATOM   2715  C  C     . ARG A 1  432  ? 130.305 182.243 178.432 1.00 53.19  ?  432  ARG A C     1 
ATOM   2716  O  O     . ARG A 1  432  ? 130.640 181.828 177.326 1.00 53.19  ?  432  ARG A O     1 
ATOM   2717  C  CB    . ARG A 1  432  ? 127.963 181.420 178.724 1.00 53.19  ?  432  ARG A CB    1 
ATOM   2718  C  CG    . ARG A 1  432  ? 128.326 180.401 179.778 1.00 53.19  ?  432  ARG A CG    1 
ATOM   2719  C  CD    . ARG A 1  432  ? 128.142 178.988 179.250 1.00 53.19  ?  432  ARG A CD    1 
ATOM   2720  N  NE    . ARG A 1  432  ? 129.350 178.437 178.641 1.00 53.19  ?  432  ARG A NE    1 
ATOM   2721  C  CZ    . ARG A 1  432  ? 129.372 177.310 177.936 1.00 53.19  ?  432  ARG A CZ    1 
ATOM   2722  N  NH1   . ARG A 1  432  ? 128.257 176.622 177.749 1.00 53.19  1  432  ARG A NH1   1 
ATOM   2723  N  NH2   . ARG A 1  432  ? 130.510 176.870 177.417 1.00 53.19  ?  432  ARG A NH2   1 
ATOM   2724  N  N     . ASP A 1  433  ? 131.145 182.309 179.456 1.00 53.57  ?  433  ASP A N     1 
ATOM   2725  C  CA    . ASP A 1  433  ? 132.570 182.052 179.286 1.00 53.57  ?  433  ASP A CA    1 
ATOM   2726  C  C     . ASP A 1  433  ? 132.878 180.558 179.306 1.00 53.57  ?  433  ASP A C     1 
ATOM   2727  O  O     . ASP A 1  433  ? 132.146 179.766 179.903 1.00 53.57  ?  433  ASP A O     1 
ATOM   2728  C  CB    . ASP A 1  433  ? 133.364 182.762 180.377 1.00 53.57  ?  433  ASP A CB    1 
ATOM   2729  C  CG    . ASP A 1  433  ? 133.063 184.244 180.431 1.00 53.57  ?  433  ASP A CG    1 
ATOM   2730  O  OD1   . ASP A 1  433  ? 132.262 184.715 179.596 1.00 53.57  ?  433  ASP A OD1   1 
ATOM   2731  O  OD2   . ASP A 1  433  ? 133.618 184.935 181.308 1.00 53.57  -1 433  ASP A OD2   1 
ATOM   2732  N  N     . SER A 1  434  ? 133.968 180.177 178.639 1.00 48.21  ?  434  SER A N     1 
ATOM   2733  C  CA    . SER A 1  434  ? 134.422 178.795 178.635 1.00 48.21  ?  434  SER A CA    1 
ATOM   2734  C  C     . SER A 1  434  ? 135.916 178.758 178.375 1.00 48.21  ?  434  SER A C     1 
ATOM   2735  O  O     . SER A 1  434  ? 136.480 179.657 177.751 1.00 48.21  ?  434  SER A O     1 
ATOM   2736  C  CB    . SER A 1  434  ? 133.699 177.957 177.579 1.00 48.21  ?  434  SER A CB    1 
ATOM   2737  O  OG    . SER A 1  434  ? 134.411 176.760 177.313 1.00 48.21  ?  434  SER A OG    1 
ATOM   2738  N  N     . SER A 1  435  ? 136.559 177.700 178.857 1.00 40.40  ?  435  SER A N     1 
ATOM   2739  C  CA    . SER A 1  435  ? 137.981 177.516 178.648 1.00 40.40  ?  435  SER A CA    1 
ATOM   2740  C  C     . SER A 1  435  ? 138.255 176.102 178.168 1.00 40.40  ?  435  SER A C     1 
ATOM   2741  O  O     . SER A 1  435  ? 137.520 175.166 178.482 1.00 40.40  ?  435  SER A O     1 
ATOM   2742  C  CB    . SER A 1  435  ? 138.783 177.789 179.918 1.00 40.40  ?  435  SER A CB    1 
ATOM   2743  O  OG    . SER A 1  435  ? 138.521 176.815 180.907 1.00 40.40  ?  435  SER A OG    1 
ATOM   2744  N  N     . PHE A 1  436  ? 139.325 175.963 177.396 1.00 32.22  ?  436  PHE A N     1 
ATOM   2745  C  CA    . PHE A 1  436  ? 139.800 174.682 176.912 1.00 32.22  ?  436  PHE A CA    1 
ATOM   2746  C  C     . PHE A 1  436  ? 141.301 174.649 177.129 1.00 32.22  ?  436  PHE A C     1 
ATOM   2747  O  O     . PHE A 1  436  ? 141.972 175.668 176.958 1.00 32.22  ?  436  PHE A O     1 
ATOM   2748  C  CB    . PHE A 1  436  ? 139.457 174.490 175.423 1.00 32.22  ?  436  PHE A CB    1 
ATOM   2749  C  CG    . PHE A 1  436  ? 139.878 173.166 174.862 1.00 32.22  ?  436  PHE A CG    1 
ATOM   2750  C  CD1   . PHE A 1  436  ? 139.073 172.050 175.010 1.00 32.22  ?  436  PHE A CD1   1 
ATOM   2751  C  CD2   . PHE A 1  436  ? 141.071 173.032 174.176 1.00 32.22  ?  436  PHE A CD2   1 
ATOM   2752  C  CE1   . PHE A 1  436  ? 139.457 170.829 174.496 1.00 32.22  ?  436  PHE A CE1   1 
ATOM   2753  C  CE2   . PHE A 1  436  ? 141.454 171.814 173.667 1.00 32.22  ?  436  PHE A CE2   1 
ATOM   2754  C  CZ    . PHE A 1  436  ? 140.645 170.713 173.829 1.00 32.22  ?  436  PHE A CZ    1 
ATOM   2755  N  N     . GLN A 1  437  ? 141.832 173.489 177.515 1.00 28.79  ?  437  GLN A N     1 
ATOM   2756  C  CA    . GLN A 1  437  ? 143.276 173.371 177.642 1.00 28.79  ?  437  GLN A CA    1 
ATOM   2757  C  C     . GLN A 1  437  ? 143.725 171.944 177.378 1.00 28.79  ?  437  GLN A C     1 
ATOM   2758  O  O     . GLN A 1  437  ? 143.051 170.983 177.749 1.00 28.79  ?  437  GLN A O     1 
ATOM   2759  C  CB    . GLN A 1  437  ? 143.777 173.837 179.014 1.00 28.79  ?  437  GLN A CB    1 
ATOM   2760  C  CG    . GLN A 1  437  ? 143.291 173.043 180.194 1.00 28.79  ?  437  GLN A CG    1 
ATOM   2761  C  CD    . GLN A 1  437  ? 144.209 173.173 181.383 1.00 28.79  ?  437  GLN A CD    1 
ATOM   2762  O  OE1   . GLN A 1  437  ? 145.287 173.758 181.287 1.00 28.79  ?  437  GLN A OE1   1 
ATOM   2763  N  NE2   . GLN A 1  437  ? 143.793 172.618 182.515 1.00 28.79  ?  437  GLN A NE2   1 
ATOM   2764  N  N     . SER A 1  438  ? 144.867 171.831 176.714 1.00 28.20  ?  438  SER A N     1 
ATOM   2765  C  CA    . SER A 1  438  ? 145.506 170.556 176.448 1.00 28.20  ?  438  SER A CA    1 
ATOM   2766  C  C     . SER A 1  438  ? 146.979 170.817 176.180 1.00 28.20  ?  438  SER A C     1 
ATOM   2767  O  O     . SER A 1  438  ? 147.393 171.945 175.909 1.00 28.20  ?  438  SER A O     1 
ATOM   2768  C  CB    . SER A 1  438  ? 144.849 169.832 175.271 1.00 28.20  ?  438  SER A CB    1 
ATOM   2769  O  OG    . SER A 1  438  ? 145.596 168.695 174.885 1.00 28.20  ?  438  SER A OG    1 
ATOM   2770  N  N     . LYS A 1  439  ? 147.775 169.755 176.250 1.00 31.16  ?  439  LYS A N     1 
ATOM   2771  C  CA    . LYS A 1  439  ? 149.190 169.852 175.917 1.00 31.16  ?  439  LYS A CA    1 
ATOM   2772  C  C     . LYS A 1  439  ? 149.442 169.840 174.417 1.00 31.16  ?  439  LYS A C     1 
ATOM   2773  O  O     . LYS A 1  439  ? 150.599 169.859 173.997 1.00 31.16  ?  439  LYS A O     1 
ATOM   2774  C  CB    . LYS A 1  439  ? 149.968 168.708 176.564 1.00 31.16  ?  439  LYS A CB    1 
ATOM   2775  C  CG    . LYS A 1  439  ? 149.952 168.723 178.076 1.00 31.16  ?  439  LYS A CG    1 
ATOM   2776  C  CD    . LYS A 1  439  ? 150.374 167.374 178.625 1.00 31.16  ?  439  LYS A CD    1 
ATOM   2777  C  CE    . LYS A 1  439  ? 150.173 167.309 180.122 1.00 31.16  ?  439  LYS A CE    1 
ATOM   2778  N  NZ    . LYS A 1  439  ? 150.547 165.979 180.655 1.00 31.16  1  439  LYS A NZ    1 
ATOM   2779  N  N     . GLN A 1  440  ? 148.387 169.795 173.608 1.00 36.91  ?  440  GLN A N     1 
ATOM   2780  C  CA    . GLN A 1  440  ? 148.537 169.685 172.169 1.00 36.91  ?  440  GLN A CA    1 
ATOM   2781  C  C     . GLN A 1  440  ? 148.297 171.019 171.488 1.00 36.91  ?  440  GLN A C     1 
ATOM   2782  O  O     . GLN A 1  440  ? 148.959 171.348 170.503 1.00 36.91  ?  440  GLN A O     1 
ATOM   2783  C  CB    . GLN A 1  440  ? 147.565 168.642 171.639 1.00 36.91  ?  440  GLN A CB    1 
ATOM   2784  C  CG    . GLN A 1  440  ? 148.150 167.798 170.566 1.00 36.91  ?  440  GLN A CG    1 
ATOM   2785  C  CD    . GLN A 1  440  ? 149.211 166.901 171.128 1.00 36.91  ?  440  GLN A CD    1 
ATOM   2786  O  OE1   . GLN A 1  440  ? 149.079 166.388 172.241 1.00 36.91  ?  440  GLN A OE1   1 
ATOM   2787  N  NE2   . GLN A 1  440  ? 150.287 166.718 170.377 1.00 36.91  ?  440  GLN A NE2   1 
ATOM   2788  N  N     . THR A 1  441  ? 147.329 171.779 171.976 1.00 39.94  ?  441  THR A N     1 
ATOM   2789  C  CA    . THR A 1  441  ? 147.006 173.097 171.452 1.00 39.94  ?  441  THR A CA    1 
ATOM   2790  C  C     . THR A 1  441  ? 147.234 174.202 172.465 1.00 39.94  ?  441  THR A C     1 
ATOM   2791  O  O     . THR A 1  441  ? 147.066 175.377 172.134 1.00 39.94  ?  441  THR A O     1 
ATOM   2792  C  CB    . THR A 1  441  ? 145.543 173.151 170.982 1.00 39.94  ?  441  THR A CB    1 
ATOM   2793  O  OG1   . THR A 1  441  ? 144.676 173.356 172.108 1.00 39.94  ?  441  THR A OG1   1 
ATOM   2794  C  CG2   . THR A 1  441  ? 145.144 171.867 170.268 1.00 39.94  ?  441  THR A CG2   1 
ATOM   2795  N  N     . GLY A 1  442  ? 147.594 173.866 173.697 1.00 34.86  ?  442  GLY A N     1 
ATOM   2796  C  CA    . GLY A 1  442  ? 147.725 174.891 174.707 1.00 34.86  ?  442  GLY A CA    1 
ATOM   2797  C  C     . GLY A 1  442  ? 146.396 175.182 175.357 1.00 34.86  ?  442  GLY A C     1 
ATOM   2798  O  O     . GLY A 1  442  ? 145.517 174.320 175.376 1.00 34.86  ?  442  GLY A O     1 
ATOM   2799  N  N     . ARG A 1  443  ? 146.235 176.391 175.885 1.00 37.62  ?  443  ARG A N     1 
ATOM   2800  C  CA    . ARG A 1  443  ? 145.043 176.796 176.611 1.00 37.62  ?  443  ARG A CA    1 
ATOM   2801  C  C     . ARG A 1  443  ? 144.448 178.039 175.967 1.00 37.62  ?  443  ARG A C     1 
ATOM   2802  O  O     . ARG A 1  443  ? 145.173 178.988 175.662 1.00 37.62  ?  443  ARG A O     1 
ATOM   2803  C  CB    . ARG A 1  443  ? 145.378 177.074 178.082 1.00 37.62  ?  443  ARG A CB    1 
ATOM   2804  C  CG    . ARG A 1  443  ? 144.278 177.780 178.841 1.00 37.62  ?  443  ARG A CG    1 
ATOM   2805  C  CD    . ARG A 1  443  ? 144.735 178.290 180.176 1.00 37.62  ?  443  ARG A CD    1 
ATOM   2806  N  NE    . ARG A 1  443  ? 143.620 178.885 180.905 1.00 37.62  ?  443  ARG A NE    1 
ATOM   2807  C  CZ    . ARG A 1  443  ? 143.642 179.164 182.202 1.00 37.62  ?  443  ARG A CZ    1 
ATOM   2808  N  NH1   . ARG A 1  443  ? 144.725 178.901 182.917 1.00 37.62  1  443  ARG A NH1   1 
ATOM   2809  N  NH2   . ARG A 1  443  ? 142.581 179.703 182.783 1.00 37.62  ?  443  ARG A NH2   1 
ATOM   2810  N  N     . ARG A 1  444  ? 143.129 178.030 175.752 1.00 40.39  ?  444  ARG A N     1 
ATOM   2811  C  CA    . ARG A 1  444  ? 142.422 179.166 175.171 1.00 40.39  ?  444  ARG A CA    1 
ATOM   2812  C  C     . ARG A 1  444  ? 141.094 179.403 175.882 1.00 40.39  ?  444  ARG A C     1 
ATOM   2813  O  O     . ARG A 1  444  ? 140.378 178.460 176.227 1.00 40.39  ?  444  ARG A O     1 
ATOM   2814  C  CB    . ARG A 1  444  ? 142.190 178.972 173.669 1.00 40.39  ?  444  ARG A CB    1 
ATOM   2815  C  CG    . ARG A 1  444  ? 143.445 179.219 172.852 1.00 40.39  ?  444  ARG A CG    1 
ATOM   2816  C  CD    . ARG A 1  444  ? 143.325 178.877 171.388 1.00 40.39  ?  444  ARG A CD    1 
ATOM   2817  N  NE    . ARG A 1  444  ? 144.664 178.785 170.817 1.00 40.39  ?  444  ARG A NE    1 
ATOM   2818  C  CZ    . ARG A 1  444  ? 145.357 177.655 170.735 1.00 40.39  ?  444  ARG A CZ    1 
ATOM   2819  N  NH1   . ARG A 1  444  ? 146.578 177.652 170.222 1.00 40.39  1  444  ARG A NH1   1 
ATOM   2820  N  NH2   . ARG A 1  444  ? 144.825 176.522 171.163 1.00 40.39  ?  444  ARG A NH2   1 
ATOM   2821  N  N     . ASP A 1  445  ? 140.770 180.681 176.068 1.00 49.10  ?  445  ASP A N     1 
ATOM   2822  C  CA    . ASP A 1  445  ? 139.579 181.126 176.779 1.00 49.10  ?  445  ASP A CA    1 
ATOM   2823  C  C     . ASP A 1  445  ? 138.677 181.924 175.846 1.00 49.10  ?  445  ASP A C     1 
ATOM   2824  O  O     . ASP A 1  445  ? 139.073 182.974 175.333 1.00 49.10  ?  445  ASP A O     1 
ATOM   2825  C  CB    . ASP A 1  445  ? 139.957 181.988 177.983 1.00 49.10  ?  445  ASP A CB    1 
ATOM   2826  C  CG    . ASP A 1  445  ? 138.749 182.440 178.778 1.00 49.10  ?  445  ASP A CG    1 
ATOM   2827  O  OD1   . ASP A 1  445  ? 137.992 181.579 179.263 1.00 49.10  ?  445  ASP A OD1   1 
ATOM   2828  O  OD2   . ASP A 1  445  ? 138.556 183.665 178.918 1.00 49.10  -1 445  ASP A OD2   1 
ATOM   2829  N  N     . THR A 1  446  ? 137.449 181.449 175.663 1.00 42.01  ?  446  THR A N     1 
ATOM   2830  C  CA    . THR A 1  446  ? 136.555 181.998 174.662 1.00 42.01  ?  446  THR A CA    1 
ATOM   2831  C  C     . THR A 1  446  ? 135.221 182.279 175.349 1.00 42.01  ?  446  THR A C     1 
ATOM   2832  O  O     . THR A 1  446  ? 134.938 181.748 176.423 1.00 42.01  ?  446  THR A O     1 
ATOM   2833  C  CB    . THR A 1  446  ? 136.439 181.005 173.485 1.00 42.01  ?  446  THR A CB    1 
ATOM   2834  O  OG1   . THR A 1  446  ? 137.754 180.623 173.078 1.00 42.01  ?  446  THR A OG1   1 
ATOM   2835  C  CG2   . THR A 1  446  ? 135.814 181.634 172.257 1.00 42.01  ?  446  THR A CG2   1 
ATOM   2836  N  N     . LYS A 1  447  ? 134.423 183.170 174.769 1.00 32.06  ?  447  LYS A N     1 
ATOM   2837  C  CA    . LYS A 1  447  ? 133.019 183.336 175.126 1.00 32.06  ?  447  LYS A CA    1 
ATOM   2838  C  C     . LYS A 1  447  ? 132.200 182.512 174.147 1.00 32.06  ?  447  LYS A C     1 
ATOM   2839  O  O     . LYS A 1  447  ? 132.681 182.196 173.058 1.00 32.06  ?  447  LYS A O     1 
ATOM   2840  C  CB    . LYS A 1  447  ? 132.616 184.808 175.080 1.00 32.06  ?  447  LYS A CB    1 
ATOM   2841  C  CG    . LYS A 1  447  ? 133.587 185.677 175.819 1.00 32.06  ?  447  LYS A CG    1 
ATOM   2842  C  CD    . LYS A 1  447  ? 133.821 187.003 175.148 1.00 32.06  ?  447  LYS A CD    1 
ATOM   2843  C  CE    . LYS A 1  447  ? 132.900 188.065 175.705 1.00 32.06  ?  447  LYS A CE    1 
ATOM   2844  N  NZ    . LYS A 1  447  ? 133.342 189.446 175.341 1.00 32.06  1  447  LYS A NZ    1 
ATOM   2845  N  N     . VAL A 1  448  ? 130.995 182.125 174.541 1.00 33.35  ?  448  VAL A N     1 
ATOM   2846  C  CA    . VAL A 1  448  ? 130.042 181.517 173.625 1.00 33.35  ?  448  VAL A CA    1 
ATOM   2847  C  C     . VAL A 1  448  ? 128.714 182.249 173.762 1.00 33.35  ?  448  VAL A C     1 
ATOM   2848  O  O     . VAL A 1  448  ? 128.398 182.840 174.799 1.00 33.35  ?  448  VAL A O     1 
ATOM   2849  C  CB    . VAL A 1  448  ? 129.865 179.988 173.837 1.00 33.35  ?  448  VAL A CB    1 
ATOM   2850  C  CG1   . VAL A 1  448  ? 131.167 179.237 173.601 1.00 33.35  ?  448  VAL A CG1   1 
ATOM   2851  C  CG2   . VAL A 1  448  ? 129.326 179.679 175.210 1.00 33.35  ?  448  VAL A CG2   1 
ATOM   2852  N  N     . VAL A 1  449  ? 127.947 182.245 172.670 1.00 30.43  ?  449  VAL A N     1 
ATOM   2853  C  CA    . VAL A 1  449  ? 126.629 182.866 172.582 1.00 30.43  ?  449  VAL A CA    1 
ATOM   2854  C  C     . VAL A 1  449  ? 125.661 181.804 172.080 1.00 30.43  ?  449  VAL A C     1 
ATOM   2855  O  O     . VAL A 1  449  ? 125.983 181.057 171.152 1.00 30.43  ?  449  VAL A O     1 
ATOM   2856  C  CB    . VAL A 1  449  ? 126.642 184.105 171.656 1.00 30.43  ?  449  VAL A CB    1 
ATOM   2857  C  CG1   . VAL A 1  449  ? 125.258 184.669 171.452 1.00 30.43  ?  449  VAL A CG1   1 
ATOM   2858  C  CG2   . VAL A 1  449  ? 127.535 185.184 172.224 1.00 30.43  ?  449  VAL A CG2   1 
ATOM   2859  N  N     . SER A 1  450  ? 124.486 181.719 172.702 1.00 36.76  ?  450  SER A N     1 
ATOM   2860  C  CA    . SER A 1  450  ? 123.571 180.605 172.475 1.00 36.76  ?  450  SER A CA    1 
ATOM   2861  C  C     . SER A 1  450  ? 122.689 180.843 171.251 1.00 36.76  ?  450  SER A C     1 
ATOM   2862  O  O     . SER A 1  450  ? 122.025 181.881 171.143 1.00 36.76  ?  450  SER A O     1 
ATOM   2863  C  CB    . SER A 1  450  ? 122.719 180.375 173.721 1.00 36.76  ?  450  SER A CB    1 
ATOM   2864  O  OG    . SER A 1  450  ? 121.886 181.489 173.975 1.00 36.76  ?  450  SER A OG    1 
ATOM   2865  N  N     . MET A 1  451  ? 122.690 179.873 170.332 1.00 34.12  ?  451  MET A N     1 
ATOM   2866  C  CA    . MET A 1  451  ? 121.815 179.826 169.167 1.00 34.12  ?  451  MET A CA    1 
ATOM   2867  C  C     . MET A 1  451  ? 121.349 178.391 169.009 1.00 34.12  ?  451  MET A C     1 
ATOM   2868  O  O     . MET A 1  451  ? 122.171 177.509 168.741 1.00 34.12  ?  451  MET A O     1 
ATOM   2869  C  CB    . MET A 1  451  ? 122.543 180.220 167.880 1.00 34.12  ?  451  MET A CB    1 
ATOM   2870  C  CG    . MET A 1  451  ? 123.100 181.618 167.754 1.00 34.12  ?  451  MET A CG    1 
ATOM   2871  S  SD    . MET A 1  451  ? 121.913 182.945 167.681 1.00 34.12  ?  451  MET A SD    1 
ATOM   2872  C  CE    . MET A 1  451  ? 123.046 184.319 167.644 1.00 34.12  ?  451  MET A CE    1 
ATOM   2873  N  N     . VAL A 1  452  ? 120.055 178.139 169.158 1.00 25.66  ?  452  VAL A N     1 
ATOM   2874  C  CA    . VAL A 1  452  ? 119.534 176.780 169.053 1.00 25.66  ?  452  VAL A CA    1 
ATOM   2875  C  C     . VAL A 1  452  ? 119.063 176.539 167.621 1.00 25.66  ?  452  VAL A C     1 
ATOM   2876  O  O     . VAL A 1  452  ? 118.414 177.389 167.008 1.00 25.66  ?  452  VAL A O     1 
ATOM   2877  C  CB    . VAL A 1  452  ? 118.436 176.503 170.091 1.00 25.66  ?  452  VAL A CB    1 
ATOM   2878  C  CG1   . VAL A 1  452  ? 119.041 176.467 171.469 1.00 25.66  ?  452  VAL A CG1   1 
ATOM   2879  C  CG2   . VAL A 1  452  ? 117.361 177.580 170.072 1.00 25.66  ?  452  VAL A CG2   1 
ATOM   2880  N  N     . GLY A 1  453  ? 119.425 175.382 167.075 1.00 26.61  ?  453  GLY A N     1 
ATOM   2881  C  CA    . GLY A 1  453  ? 119.186 175.082 165.684 1.00 26.61  ?  453  GLY A CA    1 
ATOM   2882  C  C     . GLY A 1  453  ? 120.337 175.410 164.758 1.00 26.61  ?  453  GLY A C     1 
ATOM   2883  O  O     . GLY A 1  453  ? 120.663 174.597 163.889 1.00 26.61  ?  453  GLY A O     1 
ATOM   2884  N  N     . ARG A 1  454  ? 120.976 176.562 164.929 1.00 21.62  ?  454  ARG A N     1 
ATOM   2885  C  CA    . ARG A 1  454  ? 122.015 177.033 164.030 1.00 21.62  ?  454  ARG A CA    1 
ATOM   2886  C  C     . ARG A 1  454  ? 123.392 176.621 164.533 1.00 21.62  ?  454  ARG A C     1 
ATOM   2887  O  O     . ARG A 1  454  ? 123.587 176.369 165.721 1.00 21.62  ?  454  ARG A O     1 
ATOM   2888  C  CB    . ARG A 1  454  ? 121.936 178.551 163.878 1.00 21.62  ?  454  ARG A CB    1 
ATOM   2889  C  CG    . ARG A 1  454  ? 120.520 179.056 163.751 1.00 21.62  ?  454  ARG A CG    1 
ATOM   2890  C  CD    . ARG A 1  454  ? 120.455 180.382 163.041 1.00 21.62  ?  454  ARG A CD    1 
ATOM   2891  N  NE    . ARG A 1  454  ? 119.192 181.071 163.278 1.00 21.62  ?  454  ARG A NE    1 
ATOM   2892  C  CZ    . ARG A 1  454  ? 118.079 180.863 162.586 1.00 21.62  ?  454  ARG A CZ    1 
ATOM   2893  N  NH1   . ARG A 1  454  ? 116.982 181.536 162.875 1.00 21.62  1  454  ARG A NH1   1 
ATOM   2894  N  NH2   . ARG A 1  454  ? 118.060 179.986 161.604 1.00 21.62  ?  454  ARG A NH2   1 
ATOM   2895  N  N     . VAL A 1  455  ? 124.346 176.552 163.604 1.00 28.89  ?  455  VAL A N     1 
ATOM   2896  C  CA    . VAL A 1  455  ? 125.712 176.108 163.869 1.00 28.89  ?  455  VAL A CA    1 
ATOM   2897  C  C     . VAL A 1  455  ? 126.666 177.275 163.613 1.00 28.89  ?  455  VAL A C     1 
ATOM   2898  O  O     . VAL A 1  455  ? 126.446 178.073 162.694 1.00 28.89  ?  455  VAL A O     1 
ATOM   2899  C  CB    . VAL A 1  455  ? 126.063 174.892 162.987 1.00 28.89  ?  455  VAL A CB    1 
ATOM   2900  C  CG1   . VAL A 1  455  ? 127.357 174.227 163.440 1.00 28.89  ?  455  VAL A CG1   1 
ATOM   2901  C  CG2   . VAL A 1  455  ? 124.921 173.887 162.966 1.00 28.89  ?  455  VAL A CG2   1 
ATOM   2902  N  N     . GLN A 1  456  ? 127.715 177.382 164.434 1.00 30.20  ?  456  GLN A N     1 
ATOM   2903  C  CA    . GLN A 1  456  ? 128.713 178.439 164.327 1.00 30.20  ?  456  GLN A CA    1 
ATOM   2904  C  C     . GLN A 1  456  ? 130.059 177.867 163.912 1.00 30.20  ?  456  GLN A C     1 
ATOM   2905  O  O     . GLN A 1  456  ? 130.477 176.822 164.414 1.00 30.20  ?  456  GLN A O     1 
ATOM   2906  C  CB    . GLN A 1  456  ? 128.887 179.177 165.647 1.00 30.20  ?  456  GLN A CB    1 
ATOM   2907  C  CG    . GLN A 1  456  ? 127.655 179.862 166.145 1.00 30.20  ?  456  GLN A CG    1 
ATOM   2908  C  CD    . GLN A 1  456  ? 127.980 180.932 167.153 1.00 30.20  ?  456  GLN A CD    1 
ATOM   2909  O  OE1   . GLN A 1  456  ? 129.009 181.598 167.052 1.00 30.20  ?  456  GLN A OE1   1 
ATOM   2910  N  NE2   . GLN A 1  456  ? 127.107 181.106 168.140 1.00 30.20  ?  456  GLN A NE2   1 
ATOM   2911  N  N     . MET A 1  457  ? 130.736 178.548 162.980 1.00 37.33  ?  457  MET A N     1 
ATOM   2912  C  CA    . MET A 1  457  ? 132.103 178.187 162.583 1.00 37.33  ?  457  MET A CA    1 
ATOM   2913  C  C     . MET A 1  457  ? 132.911 179.474 162.429 1.00 37.33  ?  457  MET A C     1 
ATOM   2914  O  O     . MET A 1  457  ? 132.995 180.033 161.338 1.00 37.33  ?  457  MET A O     1 
ATOM   2915  C  CB    . MET A 1  457  ? 132.123 177.383 161.292 1.00 37.33  ?  457  MET A CB    1 
ATOM   2916  C  CG    . MET A 1  457  ? 131.522 176.002 161.382 1.00 37.33  ?  457  MET A CG    1 
ATOM   2917  S  SD    . MET A 1  457  ? 132.131 174.898 160.100 1.00 37.33  ?  457  MET A SD    1 
ATOM   2918  C  CE    . MET A 1  457  ? 133.879 174.909 160.471 1.00 37.33  ?  457  MET A CE    1 
ATOM   2919  N  N     . ASP A 1  458  ? 133.522 179.923 163.515 1.00 26.40  ?  458  ASP A N     1 
ATOM   2920  C  CA    . ASP A 1  458  ? 134.537 180.962 163.429 1.00 26.40  ?  458  ASP A CA    1 
ATOM   2921  C  C     . ASP A 1  458  ? 135.778 180.362 162.780 1.00 26.40  ?  458  ASP A C     1 
ATOM   2922  O  O     . ASP A 1  458  ? 136.295 179.350 163.257 1.00 26.40  ?  458  ASP A O     1 
ATOM   2923  C  CB    . ASP A 1  458  ? 134.844 181.489 164.827 1.00 26.40  ?  458  ASP A CB    1 
ATOM   2924  C  CG    . ASP A 1  458  ? 135.410 182.887 164.823 1.00 26.40  ?  458  ASP A CG    1 
ATOM   2925  O  OD1   . ASP A 1  458  ? 136.354 183.156 164.065 1.00 26.40  ?  458  ASP A OD1   1 
ATOM   2926  O  OD2   . ASP A 1  458  ? 134.918 183.722 165.600 1.00 26.40  -1 458  ASP A OD2   1 
ATOM   2927  N  N     . MET A 1  459  ? 136.243 180.956 161.677 1.00 25.31  ?  459  MET A N     1 
ATOM   2928  C  CA    . MET A 1  459  ? 137.396 180.406 160.967 1.00 25.31  ?  459  MET A CA    1 
ATOM   2929  C  C     . MET A 1  459  ? 138.705 180.637 161.713 1.00 25.31  ?  459  MET A C     1 
ATOM   2930  O  O     . MET A 1  459  ? 139.682 179.918 161.466 1.00 25.31  ?  459  MET A O     1 
ATOM   2931  C  CB    . MET A 1  459  ? 137.489 181.006 159.563 1.00 25.31  ?  459  MET A CB    1 
ATOM   2932  C  CG    . MET A 1  459  ? 136.603 180.354 158.532 1.00 25.31  ?  459  MET A CG    1 
ATOM   2933  S  SD    . MET A 1  459  ? 136.998 178.626 158.185 1.00 25.31  ?  459  MET A SD    1 
ATOM   2934  C  CE    . MET A 1  459  ? 138.710 178.735 157.692 1.00 25.31  ?  459  MET A CE    1 
ATOM   2935  N  N     . LEU A 1  460  ? 138.729 181.609 162.628 1.00 23.22  ?  460  LEU A N     1 
ATOM   2936  C  CA    . LEU A 1  460  ? 139.911 181.861 163.441 1.00 23.22  ?  460  LEU A CA    1 
ATOM   2937  C  C     . LEU A 1  460  ? 140.217 180.673 164.339 1.00 23.22  ?  460  LEU A C     1 
ATOM   2938  O  O     . LEU A 1  460  ? 141.376 180.267 164.462 1.00 23.22  ?  460  LEU A O     1 
ATOM   2939  C  CB    . LEU A 1  460  ? 139.712 183.141 164.259 1.00 23.22  ?  460  LEU A CB    1 
ATOM   2940  C  CG    . LEU A 1  460  ? 140.866 183.820 165.005 1.00 23.22  ?  460  LEU A CG    1 
ATOM   2941  C  CD1   . LEU A 1  460  ? 140.618 185.296 165.069 1.00 23.22  ?  460  LEU A CD1   1 
ATOM   2942  C  CD2   . LEU A 1  460  ? 141.032 183.327 166.405 1.00 23.22  ?  460  LEU A CD2   1 
ATOM   2943  N  N     . GLN A 1  461  ? 139.188 180.087 164.954 1.00 24.85  ?  461  GLN A N     1 
ATOM   2944  C  CA    . GLN A 1  461  ? 139.390 178.950 165.841 1.00 24.85  ?  461  GLN A CA    1 
ATOM   2945  C  C     . GLN A 1  461  ? 139.802 177.701 165.078 1.00 24.85  ?  461  GLN A C     1 
ATOM   2946  O  O     . GLN A 1  461  ? 140.597 176.906 165.583 1.00 24.85  ?  461  GLN A O     1 
ATOM   2947  C  CB    . GLN A 1  461  ? 138.122 178.689 166.641 1.00 24.85  ?  461  GLN A CB    1 
ATOM   2948  C  CG    . GLN A 1  461  ? 137.755 179.799 167.596 1.00 24.85  ?  461  GLN A CG    1 
ATOM   2949  C  CD    . GLN A 1  461  ? 138.791 180.000 168.675 1.00 24.85  ?  461  GLN A CD    1 
ATOM   2950  O  OE1   . GLN A 1  461  ? 139.484 181.010 168.712 1.00 24.85  ?  461  GLN A OE1   1 
ATOM   2951  N  NE2   . GLN A 1  461  ? 138.912 179.022 169.557 1.00 24.85  ?  461  GLN A NE2   1 
ATOM   2952  N  N     . VAL A 1  462  ? 139.317 177.538 163.849 1.00 22.99  ?  462  VAL A N     1 
ATOM   2953  C  CA    . VAL A 1  462  ? 139.728 176.417 163.011 1.00 22.99  ?  462  VAL A CA    1 
ATOM   2954  C  C     . VAL A 1  462  ? 141.195 176.549 162.609 1.00 22.99  ?  462  VAL A C     1 
ATOM   2955  O  O     . VAL A 1  462  ? 141.945 175.560 162.593 1.00 22.99  ?  462  VAL A O     1 
ATOM   2956  C  CB    . VAL A 1  462  ? 138.805 176.328 161.784 1.00 22.99  ?  462  VAL A CB    1 
ATOM   2957  C  CG1   . VAL A 1  462  ? 139.086 175.080 160.979 1.00 22.99  ?  462  VAL A CG1   1 
ATOM   2958  C  CG2   . VAL A 1  462  ? 137.368 176.365 162.223 1.00 22.99  ?  462  VAL A CG2   1 
ATOM   2959  N  N     . LEU A 1  463  ? 141.635 177.775 162.298 1.00 25.62  ?  463  LEU A N     1 
ATOM   2960  C  CA    . LEU A 1  463  ? 143.044 177.988 161.978 1.00 25.62  ?  463  LEU A CA    1 
ATOM   2961  C  C     . LEU A 1  463  ? 143.925 177.762 163.201 1.00 25.62  ?  463  LEU A C     1 
ATOM   2962  O  O     . LEU A 1  463  ? 144.940 177.062 163.122 1.00 25.62  ?  463  LEU A O     1 
ATOM   2963  C  CB    . LEU A 1  463  ? 143.253 179.394 161.419 1.00 25.62  ?  463  LEU A CB    1 
ATOM   2964  C  CG    . LEU A 1  463  ? 142.741 179.743 160.024 1.00 25.62  ?  463  LEU A CG    1 
ATOM   2965  C  CD1   . LEU A 1  463  ? 143.266 181.095 159.644 1.00 25.62  ?  463  LEU A CD1   1 
ATOM   2966  C  CD2   . LEU A 1  463  ? 143.142 178.722 159.002 1.00 25.62  ?  463  LEU A CD2   1 
ATOM   2967  N  N     . LEU A 1  464  ? 143.524 178.320 164.351 1.00 26.83  ?  464  LEU A N     1 
ATOM   2968  C  CA    . LEU A 1  464  ? 144.287 178.194 165.590 1.00 26.83  ?  464  LEU A CA    1 
ATOM   2969  C  C     . LEU A 1  464  ? 144.340 176.772 166.104 1.00 26.83  ?  464  LEU A C     1 
ATOM   2970  O  O     . LEU A 1  464  ? 145.252 176.435 166.860 1.00 26.83  ?  464  LEU A O     1 
ATOM   2971  C  CB    . LEU A 1  464  ? 143.692 179.085 166.675 1.00 26.83  ?  464  LEU A CB    1 
ATOM   2972  C  CG    . LEU A 1  464  ? 144.314 180.447 166.968 1.00 26.83  ?  464  LEU A CG    1 
ATOM   2973  C  CD1   . LEU A 1  464  ? 144.293 181.350 165.773 1.00 26.83  ?  464  LEU A CD1   1 
ATOM   2974  C  CD2   . LEU A 1  464  ? 143.566 181.096 168.098 1.00 26.83  ?  464  LEU A CD2   1 
ATOM   2975  N  N     . ARG A 1  465  ? 143.385 175.934 165.729 1.00 28.91  ?  465  ARG A N     1 
ATOM   2976  C  CA    . ARG A 1  465  ? 143.460 174.541 166.133 1.00 28.91  ?  465  ARG A CA    1 
ATOM   2977  C  C     . ARG A 1  465  ? 144.251 173.689 165.155 1.00 28.91  ?  465  ARG A C     1 
ATOM   2978  O  O     . ARG A 1  465  ? 144.964 172.777 165.587 1.00 28.91  ?  465  ARG A O     1 
ATOM   2979  C  CB    . ARG A 1  465  ? 142.056 173.962 166.304 1.00 28.91  ?  465  ARG A CB    1 
ATOM   2980  C  CG    . ARG A 1  465  ? 141.346 174.375 167.589 1.00 28.91  ?  465  ARG A CG    1 
ATOM   2981  C  CD    . ARG A 1  465  ? 139.886 173.938 167.583 1.00 28.91  ?  465  ARG A CD    1 
ATOM   2982  N  NE    . ARG A 1  465  ? 139.732 172.503 167.340 1.00 28.91  ?  465  ARG A NE    1 
ATOM   2983  C  CZ    . ARG A 1  465  ? 139.152 171.981 166.263 1.00 28.91  ?  465  ARG A CZ    1 
ATOM   2984  N  NH1   . ARG A 1  465  ? 138.663 172.775 165.318 1.00 28.91  1  465  ARG A NH1   1 
ATOM   2985  N  NH2   . ARG A 1  465  ? 139.056 170.667 166.126 1.00 28.91  ?  465  ARG A NH2   1 
ATOM   2986  N  N     . GLU A 1  466  ? 144.162 173.943 163.847 1.00 43.07  ?  466  GLU A N     1 
ATOM   2987  C  CA    . GLU A 1  466  ? 144.795 172.967 162.967 1.00 43.07  ?  466  GLU A CA    1 
ATOM   2988  C  C     . GLU A 1  466  ? 146.212 173.374 162.575 1.00 43.07  ?  466  GLU A C     1 
ATOM   2989  O  O     . GLU A 1  466  ? 147.083 172.510 162.441 1.00 43.07  ?  466  GLU A O     1 
ATOM   2990  C  CB    . GLU A 1  466  ? 143.969 172.759 161.698 1.00 43.07  ?  466  GLU A CB    1 
ATOM   2991  C  CG    . GLU A 1  466  ? 144.143 171.376 161.040 1.00 43.07  ?  466  GLU A CG    1 
ATOM   2992  C  CD    . GLU A 1  466  ? 145.409 171.170 160.224 1.00 43.07  ?  466  GLU A CD    1 
ATOM   2993  O  OE1   . GLU A 1  466  ? 145.978 172.145 159.711 1.00 43.07  ?  466  GLU A OE1   1 
ATOM   2994  O  OE2   . GLU A 1  466  ? 145.827 170.002 160.093 1.00 43.07  -1 466  GLU A OE2   1 
ATOM   2995  N  N     . TYR A 1  467  ? 146.469 174.672 162.402 1.00 38.69  ?  467  TYR A N     1 
ATOM   2996  C  CA    . TYR A 1  467  ? 147.663 175.160 161.726 1.00 38.69  ?  467  TYR A CA    1 
ATOM   2997  C  C     . TYR A 1  467  ? 148.620 175.853 162.689 1.00 38.69  ?  467  TYR A C     1 
ATOM   2998  O  O     . TYR A 1  467  ? 148.200 176.543 163.623 1.00 38.69  ?  467  TYR A O     1 
ATOM   2999  C  CB    . TYR A 1  467  ? 147.276 176.118 160.582 1.00 38.69  ?  467  TYR A CB    1 
ATOM   3000  C  CG    . TYR A 1  467  ? 146.734 175.386 159.371 1.00 38.69  ?  467  TYR A CG    1 
ATOM   3001  C  CD1   . TYR A 1  467  ? 147.589 174.757 158.476 1.00 38.69  ?  467  TYR A CD1   1 
ATOM   3002  C  CD2   . TYR A 1  467  ? 145.366 175.285 159.147 1.00 38.69  ?  467  TYR A CD2   1 
ATOM   3003  C  CE1   . TYR A 1  467  ? 147.101 174.074 157.385 1.00 38.69  ?  467  TYR A CE1   1 
ATOM   3004  C  CE2   . TYR A 1  467  ? 144.867 174.599 158.057 1.00 38.69  ?  467  TYR A CE2   1 
ATOM   3005  C  CZ    . TYR A 1  467  ? 145.743 173.995 157.183 1.00 38.69  ?  467  TYR A CZ    1 
ATOM   3006  O  OH    . TYR A 1  467  ? 145.258 173.310 156.097 1.00 38.69  ?  467  TYR A OH    1 
ATOM   3007  N  N     . LYS A 1  468  ? 149.923 175.666 162.444 1.00 34.48  ?  468  LYS A N     1 
ATOM   3008  C  CA    . LYS A 1  468  ? 150.997 176.267 163.241 1.00 34.48  ?  468  LYS A CA    1 
ATOM   3009  C  C     . LYS A 1  468  ? 151.730 177.298 162.387 1.00 34.48  ?  468  LYS A C     1 
ATOM   3010  O  O     . LYS A 1  468  ? 152.626 176.952 161.613 1.00 34.48  ?  468  LYS A O     1 
ATOM   3011  C  CB    . LYS A 1  468  ? 151.950 175.198 163.768 1.00 34.48  ?  468  LYS A CB    1 
ATOM   3012  C  CG    . LYS A 1  468  ? 151.324 174.296 164.825 1.00 34.48  ?  468  LYS A CG    1 
ATOM   3013  C  CD    . LYS A 1  468  ? 152.358 173.487 165.575 1.00 34.48  ?  468  LYS A CD    1 
ATOM   3014  C  CE    . LYS A 1  468  ? 153.217 172.664 164.626 1.00 34.48  ?  468  LYS A CE    1 
ATOM   3015  N  NZ    . LYS A 1  468  ? 154.306 171.937 165.352 1.00 34.48  1  468  LYS A NZ    1 
ATOM   3016  N  N     . LEU A 1  469  ? 151.353 178.561 162.540 1.00 33.08  ?  469  LEU A N     1 
ATOM   3017  C  CA    . LEU A 1  469  ? 151.847 179.657 161.723 1.00 33.08  ?  469  LEU A CA    1 
ATOM   3018  C  C     . LEU A 1  469  ? 152.528 180.698 162.608 1.00 33.08  ?  469  LEU A C     1 
ATOM   3019  O  O     . LEU A 1  469  ? 152.655 180.528 163.821 1.00 33.08  ?  469  LEU A O     1 
ATOM   3020  C  CB    . LEU A 1  469  ? 150.705 180.275 160.910 1.00 33.08  ?  469  LEU A CB    1 
ATOM   3021  C  CG    . LEU A 1  469  ? 149.774 179.326 160.148 1.00 33.08  ?  469  LEU A CG    1 
ATOM   3022  C  CD1   . LEU A 1  469  ? 148.516 180.025 159.684 1.00 33.08  ?  469  LEU A CD1   1 
ATOM   3023  C  CD2   . LEU A 1  469  ? 150.495 178.685 158.979 1.00 33.08  ?  469  LEU A CD2   1 
ATOM   3024  N  N     . ARG A 1  470  ? 152.950 181.794 161.987 1.00 27.63  ?  470  ARG A N     1 
ATOM   3025  C  CA    . ARG A 1  470  ? 153.755 182.825 162.622 1.00 27.63  ?  470  ARG A CA    1 
ATOM   3026  C  C     . ARG A 1  470  ? 152.932 184.006 163.092 1.00 27.63  ?  470  ARG A C     1 
ATOM   3027  O  O     . ARG A 1  470  ? 153.173 184.529 164.177 1.00 27.63  ?  470  ARG A O     1 
ATOM   3028  C  CB    . ARG A 1  470  ? 154.831 183.307 161.648 1.00 27.63  ?  470  ARG A CB    1 
ATOM   3029  C  CG    . ARG A 1  470  ? 156.115 183.791 162.271 1.00 27.63  ?  470  ARG A CG    1 
ATOM   3030  C  CD    . ARG A 1  470  ? 157.196 183.982 161.218 1.00 27.63  ?  470  ARG A CD    1 
ATOM   3031  N  NE    . ARG A 1  470  ? 158.374 184.669 161.745 1.00 27.63  ?  470  ARG A NE    1 
ATOM   3032  C  CZ    . ARG A 1  470  ? 159.566 184.106 161.923 1.00 27.63  ?  470  ARG A CZ    1 
ATOM   3033  N  NH1   . ARG A 1  470  ? 160.557 184.822 162.415 1.00 27.63  1  470  ARG A NH1   1 
ATOM   3034  N  NH2   . ARG A 1  470  ? 159.773 182.839 161.605 1.00 27.63  ?  470  ARG A NH2   1 
ATOM   3035  N  N     . SER A 1  471  ? 151.970 184.448 162.297 1.00 34.02  ?  471  SER A N     1 
ATOM   3036  C  CA    . SER A 1  471  ? 150.983 185.419 162.730 1.00 34.02  ?  471  SER A CA    1 
ATOM   3037  C  C     . SER A 1  471  ? 149.613 184.927 162.298 1.00 34.02  ?  471  SER A C     1 
ATOM   3038  O  O     . SER A 1  471  ? 149.476 184.285 161.255 1.00 34.02  ?  471  SER A O     1 
ATOM   3039  C  CB    . SER A 1  471  ? 151.270 186.807 162.157 1.00 34.02  ?  471  SER A CB    1 
ATOM   3040  O  OG    . SER A 1  471  ? 150.118 187.621 162.173 1.00 34.02  ?  471  SER A OG    1 
ATOM   3041  N  N     . TYR A 1  472  ? 148.603 185.208 163.116 1.00 40.62  ?  472  TYR A N     1 
ATOM   3042  C  CA    . TYR A 1  472  ? 147.239 184.763 162.859 1.00 40.62  ?  472  TYR A CA    1 
ATOM   3043  C  C     . TYR A 1  472  ? 146.308 185.935 162.588 1.00 40.62  ?  472  TYR A C     1 
ATOM   3044  O  O     . TYR A 1  472  ? 145.180 185.961 163.064 1.00 40.62  ?  472  TYR A O     1 
ATOM   3045  C  CB    . TYR A 1  472  ? 146.713 183.930 164.023 1.00 40.62  ?  472  TYR A CB    1 
ATOM   3046  C  CG    . TYR A 1  472  ? 147.265 182.532 164.065 1.00 40.62  ?  472  TYR A CG    1 
ATOM   3047  C  CD1   . TYR A 1  472  ? 146.836 181.573 163.172 1.00 40.62  ?  472  TYR A CD1   1 
ATOM   3048  C  CD2   . TYR A 1  472  ? 148.234 182.177 164.995 1.00 40.62  ?  472  TYR A CD2   1 
ATOM   3049  C  CE1   . TYR A 1  472  ? 147.347 180.302 163.209 1.00 40.62  ?  472  TYR A CE1   1 
ATOM   3050  C  CE2   . TYR A 1  472  ? 148.742 180.912 165.039 1.00 40.62  ?  472  TYR A CE2   1 
ATOM   3051  C  CZ    . TYR A 1  472  ? 148.295 179.978 164.145 1.00 40.62  ?  472  TYR A CZ    1 
ATOM   3052  O  OH    . TYR A 1  472  ? 148.806 178.707 164.180 1.00 40.62  ?  472  TYR A OH    1 
ATOM   3053  N  N     . THR A 1  473  ? 146.779 186.925 161.849 1.00 46.49  ?  473  THR A N     1 
ATOM   3054  C  CA    . THR A 1  473  ? 145.930 188.021 161.413 1.00 46.49  ?  473  THR A CA    1 
ATOM   3055  C  C     . THR A 1  473  ? 145.316 187.652 160.065 1.00 46.49  ?  473  THR A C     1 
ATOM   3056  O  O     . THR A 1  473  ? 145.827 186.786 159.354 1.00 46.49  ?  473  THR A O     1 
ATOM   3057  C  CB    . THR A 1  473  ? 146.750 189.313 161.320 1.00 46.49  ?  473  THR A CB    1 
ATOM   3058  O  OG1   . THR A 1  473  ? 147.672 189.356 162.412 1.00 46.49  ?  473  THR A OG1   1 
ATOM   3059  C  CG2   . THR A 1  473  ? 145.869 190.544 161.437 1.00 46.49  ?  473  THR A CG2   1 
ATOM   3060  N  N     . LEU A 1  474  ? 144.192 188.298 159.732 1.00 35.92  ?  474  LEU A N     1 
ATOM   3061  C  CA    . LEU A 1  474  ? 143.500 188.021 158.476 1.00 35.92  ?  474  LEU A CA    1 
ATOM   3062  C  C     . LEU A 1  474  ? 144.368 188.375 157.276 1.00 35.92  ?  474  LEU A C     1 
ATOM   3063  O  O     . LEU A 1  474  ? 144.357 187.666 156.263 1.00 35.92  ?  474  LEU A O     1 
ATOM   3064  C  CB    . LEU A 1  474  ? 142.174 188.783 158.436 1.00 35.92  ?  474  LEU A CB    1 
ATOM   3065  C  CG    . LEU A 1  474  ? 141.203 188.479 157.290 1.00 35.92  ?  474  LEU A CG    1 
ATOM   3066  C  CD1   . LEU A 1  474  ? 141.075 186.994 157.049 1.00 35.92  ?  474  LEU A CD1   1 
ATOM   3067  C  CD2   . LEU A 1  474  ? 139.852 189.078 157.556 1.00 35.92  ?  474  LEU A CD2   1 
ATOM   3068  N  N     . ASN A 1  475  ? 145.165 189.440 157.399 1.00 36.85  ?  475  ASN A N     1 
ATOM   3069  C  CA    . ASN A 1  475  ? 146.099 189.822 156.350 1.00 36.85  ?  475  ASN A CA    1 
ATOM   3070  C  C     . ASN A 1  475  ? 147.203 188.792 156.188 1.00 36.85  ?  475  ASN A C     1 
ATOM   3071  O  O     . ASN A 1  475  ? 147.571 188.441 155.063 1.00 36.85  ?  475  ASN A O     1 
ATOM   3072  C  CB    . ASN A 1  475  ? 146.681 191.190 156.668 1.00 36.85  ?  475  ASN A CB    1 
ATOM   3073  C  CG    . ASN A 1  475  ? 145.617 192.192 157.053 1.00 36.85  ?  475  ASN A CG    1 
ATOM   3074  O  OD1   . ASN A 1  475  ? 145.523 192.605 158.201 1.00 36.85  ?  475  ASN A OD1   1 
ATOM   3075  N  ND2   . ASN A 1  475  ? 144.804 192.585 156.092 1.00 36.85  ?  475  ASN A ND2   1 
ATOM   3076  N  N     . ALA A 1  476  ? 147.703 188.254 157.298 1.00 40.62  ?  476  ALA A N     1 
ATOM   3077  C  CA    . ALA A 1  476  ? 148.803 187.301 157.231 1.00 40.62  ?  476  ALA A CA    1 
ATOM   3078  C  C     . ALA A 1  476  ? 148.355 185.953 156.678 1.00 40.62  ?  476  ALA A C     1 
ATOM   3079  O  O     . ALA A 1  476  ? 149.074 185.336 155.886 1.00 40.62  ?  476  ALA A O     1 
ATOM   3080  C  CB    . ALA A 1  476  ? 149.431 187.139 158.608 1.00 40.62  ?  476  ALA A CB    1 
ATOM   3081  N  N     . VAL A 1  477  ? 147.160 185.485 157.041 1.00 33.55  ?  477  VAL A N     1 
ATOM   3082  C  CA    . VAL A 1  477  ? 146.736 184.196 156.500 1.00 33.55  ?  477  VAL A CA    1 
ATOM   3083  C  C     . VAL A 1  477  ? 146.187 184.357 155.088 1.00 33.55  ?  477  VAL A C     1 
ATOM   3084  O  O     . VAL A 1  477  ? 146.248 183.418 154.288 1.00 33.55  ?  477  VAL A O     1 
ATOM   3085  C  CB    . VAL A 1  477  ? 145.726 183.492 157.425 1.00 33.55  ?  477  VAL A CB    1 
ATOM   3086  C  CG1   . VAL A 1  477  ? 146.392 183.096 158.736 1.00 33.55  ?  477  VAL A CG1   1 
ATOM   3087  C  CG2   . VAL A 1  477  ? 144.491 184.348 157.661 1.00 33.55  ?  477  VAL A CG2   1 
ATOM   3088  N  N     . SER A 1  478  ? 145.689 185.546 154.740 1.00 40.62  ?  478  SER A N     1 
ATOM   3089  C  CA    . SER A 1  478  ? 145.280 185.786 153.363 1.00 40.62  ?  478  SER A CA    1 
ATOM   3090  C  C     . SER A 1  478  ? 146.480 185.937 152.445 1.00 40.62  ?  478  SER A C     1 
ATOM   3091  O  O     . SER A 1  478  ? 146.375 185.651 151.253 1.00 40.62  ?  478  SER A O     1 
ATOM   3092  C  CB    . SER A 1  478  ? 144.401 187.019 153.274 1.00 40.62  ?  478  SER A CB    1 
ATOM   3093  O  OG    . SER A 1  478  ? 145.184 188.167 153.049 1.00 40.62  ?  478  SER A OG    1 
ATOM   3094  N  N     . PHE A 1  479  ? 147.620 186.391 152.958 1.00 30.10  ?  479  PHE A N     1 
ATOM   3095  C  CA    . PHE A 1  479  ? 148.809 186.332 152.121 1.00 30.10  ?  479  PHE A CA    1 
ATOM   3096  C  C     . PHE A 1  479  ? 149.369 184.921 152.061 1.00 30.10  ?  479  PHE A C     1 
ATOM   3097  O  O     . PHE A 1  479  ? 149.811 184.478 151.001 1.00 30.10  ?  479  PHE A O     1 
ATOM   3098  C  CB    . PHE A 1  479  ? 149.883 187.303 152.608 1.00 30.10  ?  479  PHE A CB    1 
ATOM   3099  C  CG    . PHE A 1  479  ? 151.072 187.367 151.693 1.00 30.10  ?  479  PHE A CG    1 
ATOM   3100  C  CD1   . PHE A 1  479  ? 151.007 188.083 150.509 1.00 30.10  ?  479  PHE A CD1   1 
ATOM   3101  C  CD2   . PHE A 1  479  ? 152.241 186.683 151.988 1.00 30.10  ?  479  PHE A CD2   1 
ATOM   3102  C  CE1   . PHE A 1  479  ? 152.088 188.133 149.647 1.00 30.10  ?  479  PHE A CE1   1 
ATOM   3103  C  CE2   . PHE A 1  479  ? 153.318 186.724 151.129 1.00 30.10  ?  479  PHE A CE2   1 
ATOM   3104  C  CZ    . PHE A 1  479  ? 153.241 187.456 149.959 1.00 30.10  ?  479  PHE A CZ    1 
ATOM   3105  N  N     . HIS A 1  480  ? 149.365 184.209 153.188 1.00 40.62  ?  480  HIS A N     1 
ATOM   3106  C  CA    . HIS A 1  480  ? 149.930 182.869 153.235 1.00 40.62  ?  480  HIS A CA    1 
ATOM   3107  C  C     . HIS A 1  480  ? 149.146 181.876 152.386 1.00 40.62  ?  480  HIS A C     1 
ATOM   3108  O  O     . HIS A 1  480  ? 149.726 180.923 151.860 1.00 40.62  ?  480  HIS A O     1 
ATOM   3109  C  CB    . HIS A 1  480  ? 149.997 182.394 154.684 1.00 40.62  ?  480  HIS A CB    1 
ATOM   3110  C  CG    . HIS A 1  480  ? 150.441 180.975 154.831 1.00 40.62  ?  480  HIS A CG    1 
ATOM   3111  N  ND1   . HIS A 1  480  ? 151.634 180.517 154.322 1.00 40.62  ?  480  HIS A ND1   1 
ATOM   3112  C  CD2   . HIS A 1  480  ? 149.856 179.914 155.428 1.00 40.62  ?  480  HIS A CD2   1 
ATOM   3113  C  CE1   . HIS A 1  480  ? 151.762 179.232 154.594 1.00 40.62  ?  480  HIS A CE1   1 
ATOM   3114  N  NE2   . HIS A 1  480  ? 150.694 178.842 155.263 1.00 40.62  ?  480  HIS A NE2   1 
ATOM   3115  N  N     . PHE A 1  481  ? 147.843 182.085 152.222 1.00 40.62  ?  481  PHE A N     1 
ATOM   3116  C  CA    . PHE A 1  481  ? 147.015 181.163 151.457 1.00 40.62  ?  481  PHE A CA    1 
ATOM   3117  C  C     . PHE A 1  481  ? 146.547 181.718 150.121 1.00 40.62  ?  481  PHE A C     1 
ATOM   3118  O  O     . PHE A 1  481  ? 146.399 180.950 149.171 1.00 40.62  ?  481  PHE A O     1 
ATOM   3119  C  CB    . PHE A 1  481  ? 145.799 180.737 152.286 1.00 40.62  ?  481  PHE A CB    1 
ATOM   3120  C  CG    . PHE A 1  481  ? 146.131 179.829 153.439 1.00 40.62  ?  481  PHE A CG    1 
ATOM   3121  C  CD1   . PHE A 1  481  ? 146.602 178.551 153.221 1.00 40.62  ?  481  PHE A CD1   1 
ATOM   3122  C  CD2   . PHE A 1  481  ? 145.955 180.257 154.745 1.00 40.62  ?  481  PHE A CD2   1 
ATOM   3123  C  CE1   . PHE A 1  481  ? 146.894 177.724 154.276 1.00 40.62  ?  481  PHE A CE1   1 
ATOM   3124  C  CE2   . PHE A 1  481  ? 146.251 179.436 155.803 1.00 40.62  ?  481  PHE A CE2   1 
ATOM   3125  C  CZ    . PHE A 1  481  ? 146.717 178.168 155.564 1.00 40.62  ?  481  PHE A CZ    1 
ATOM   3126  N  N     . LEU A 1  482  ? 146.311 183.027 149.999 1.00 38.02  ?  482  LEU A N     1 
ATOM   3127  C  CA    . LEU A 1  482  ? 145.844 183.606 148.741 1.00 38.02  ?  482  LEU A CA    1 
ATOM   3128  C  C     . LEU A 1  482  ? 146.837 184.579 148.113 1.00 38.02  ?  482  LEU A C     1 
ATOM   3129  O  O     . LEU A 1  482  ? 147.248 184.371 146.972 1.00 38.02  ?  482  LEU A O     1 
ATOM   3130  C  CB    . LEU A 1  482  ? 144.497 184.300 148.953 1.00 38.02  ?  482  LEU A CB    1 
ATOM   3131  C  CG    . LEU A 1  482  ? 143.422 183.559 149.729 1.00 38.02  ?  482  LEU A CG    1 
ATOM   3132  C  CD1   . LEU A 1  482  ? 142.178 184.375 149.685 1.00 38.02  ?  482  LEU A CD1   1 
ATOM   3133  C  CD2   . LEU A 1  482  ? 143.175 182.202 149.123 1.00 38.02  ?  482  LEU A CD2   1 
ATOM   3134  N  N     . GLY A 1  483  ? 147.272 185.625 148.825 1.00 28.80  ?  483  GLY A N     1 
ATOM   3135  C  CA    . GLY A 1  483  ? 148.166 186.591 148.205 1.00 28.80  ?  483  GLY A CA    1 
ATOM   3136  C  C     . GLY A 1  483  ? 147.929 188.096 148.242 1.00 28.80  ?  483  GLY A C     1 
ATOM   3137  O  O     . GLY A 1  483  ? 148.355 188.770 147.307 1.00 28.80  ?  483  GLY A O     1 
ATOM   3138  N  N     . GLU A 1  484  ? 147.279 188.664 149.259 1.00 26.37  ?  484  GLU A N     1 
ATOM   3139  C  CA    . GLU A 1  484  ? 147.329 190.131 149.416 1.00 26.37  ?  484  GLU A CA    1 
ATOM   3140  C  C     . GLU A 1  484  ? 148.675 190.549 149.968 1.00 26.37  ?  484  GLU A C     1 
ATOM   3141  O  O     . GLU A 1  484  ? 149.305 191.484 149.483 1.00 26.37  ?  484  GLU A O     1 
ATOM   3142  C  CB    . GLU A 1  484  ? 146.229 190.667 150.338 1.00 26.37  ?  484  GLU A CB    1 
ATOM   3143  C  CG    . GLU A 1  484  ? 146.367 192.174 150.689 1.00 26.37  ?  484  GLU A CG    1 
ATOM   3144  C  CD    . GLU A 1  484  ? 145.372 192.658 151.742 1.00 26.37  ?  484  GLU A CD    1 
ATOM   3145  O  OE1   . GLU A 1  484  ? 144.514 191.866 152.165 1.00 26.37  ?  484  GLU A OE1   1 
ATOM   3146  O  OE2   . GLU A 1  484  ? 145.448 193.832 152.160 1.00 26.37  -1 484  GLU A OE2   1 
ATOM   3147  N  N     . HIS A 1  491  ? 141.219 202.647 162.973 1.00 29.54  ?  491  HIS A N     1 
ATOM   3148  C  CA    . HIS A 1  491  ? 139.990 202.817 163.734 1.00 29.54  ?  491  HIS A CA    1 
ATOM   3149  C  C     . HIS A 1  491  ? 139.622 204.279 163.830 1.00 29.54  ?  491  HIS A C     1 
ATOM   3150  O  O     . HIS A 1  491  ? 138.453 204.617 163.917 1.00 29.54  ?  491  HIS A O     1 
ATOM   3151  C  CB    . HIS A 1  491  ? 140.118 202.232 165.148 1.00 29.54  ?  491  HIS A CB    1 
ATOM   3152  C  CG    . HIS A 1  491  ? 139.876 200.756 165.227 1.00 29.54  ?  491  HIS A CG    1 
ATOM   3153  N  ND1   . HIS A 1  491  ? 140.236 200.000 166.321 1.00 29.54  ?  491  HIS A ND1   1 
ATOM   3154  C  CD2   . HIS A 1  491  ? 139.305 199.896 164.350 1.00 29.54  ?  491  HIS A CD2   1 
ATOM   3155  C  CE1   . HIS A 1  491  ? 139.904 198.738 166.114 1.00 29.54  ?  491  HIS A CE1   1 
ATOM   3156  N  NE2   . HIS A 1  491  ? 139.337 198.648 164.925 1.00 29.54  ?  491  HIS A NE2   1 
ATOM   3157  N  N     . SER A 1  492  ? 140.616 205.152 163.834 1.00 30.65  ?  492  SER A N     1 
ATOM   3158  C  CA    . SER A 1  492  ? 140.342 206.571 163.984 1.00 30.65  ?  492  SER A CA    1 
ATOM   3159  C  C     . SER A 1  492  ? 140.182 207.294 162.652 1.00 30.65  ?  492  SER A C     1 
ATOM   3160  O  O     . SER A 1  492  ? 139.702 208.431 162.634 1.00 30.65  ?  492  SER A O     1 
ATOM   3161  C  CB    . SER A 1  492  ? 141.447 207.223 164.814 1.00 30.65  ?  492  SER A CB    1 
ATOM   3162  O  OG    . SER A 1  492  ? 142.678 207.206 164.134 1.00 30.65  ?  492  SER A OG    1 
ATOM   3163  N  N     . ILE A 1  493  ? 140.565 206.656 161.546 1.00 40.62  ?  493  ILE A N     1 
ATOM   3164  C  CA    . ILE A 1  493  ? 140.318 207.182 160.209 1.00 40.62  ?  493  ILE A CA    1 
ATOM   3165  C  C     . ILE A 1  493  ? 138.876 206.929 159.794 1.00 40.62  ?  493  ILE A C     1 
ATOM   3166  O  O     . ILE A 1  493  ? 138.225 207.801 159.206 1.00 40.62  ?  493  ILE A O     1 
ATOM   3167  C  CB    . ILE A 1  493  ? 141.336 206.552 159.237 1.00 40.62  ?  493  ILE A CB    1 
ATOM   3168  C  CG1   . ILE A 1  493  ? 142.735 207.041 159.596 1.00 40.62  ?  493  ILE A CG1   1 
ATOM   3169  C  CG2   . ILE A 1  493  ? 141.013 206.839 157.790 1.00 40.62  ?  493  ILE A CG2   1 
ATOM   3170  C  CD1   . ILE A 1  493  ? 143.836 206.343 158.922 1.00 40.62  ?  493  ILE A CD1   1 
ATOM   3171  N  N     . ILE A 1  494  ? 138.364 205.739 160.127 1.00 28.84  ?  494  ILE A N     1 
ATOM   3172  C  CA    . ILE A 1  494  ? 136.987 205.314 159.885 1.00 28.84  ?  494  ILE A CA    1 
ATOM   3173  C  C     . ILE A 1  494  ? 135.977 206.271 160.504 1.00 28.84  ?  494  ILE A C     1 
ATOM   3174  O  O     . ILE A 1  494  ? 134.941 206.578 159.895 1.00 28.84  ?  494  ILE A O     1 
ATOM   3175  C  CB    . ILE A 1  494  ? 136.832 203.881 160.427 1.00 28.84  ?  494  ILE A CB    1 
ATOM   3176  C  CG1   . ILE A 1  494  ? 137.700 202.926 159.624 1.00 28.84  ?  494  ILE A CG1   1 
ATOM   3177  C  CG2   . ILE A 1  494  ? 135.406 203.439 160.433 1.00 28.84  ?  494  ILE A CG2   1 
ATOM   3178  C  CD1   . ILE A 1  494  ? 137.697 201.539 160.147 1.00 28.84  ?  494  ILE A CD1   1 
ATOM   3179  N  N     . THR A 1  495  ? 136.285 206.810 161.680 1.00 28.06  ?  495  THR A N     1 
ATOM   3180  C  CA    . THR A 1  495  ? 135.382 207.747 162.334 1.00 28.06  ?  495  THR A CA    1 
ATOM   3181  C  C     . THR A 1  495  ? 135.271 209.067 161.574 1.00 28.06  ?  495  THR A C     1 
ATOM   3182  O  O     . THR A 1  495  ? 134.253 209.755 161.691 1.00 28.06  ?  495  THR A O     1 
ATOM   3183  C  CB    . THR A 1  495  ? 135.846 207.964 163.774 1.00 28.06  ?  495  THR A CB    1 
ATOM   3184  O  OG1   . THR A 1  495  ? 136.114 206.687 164.358 1.00 28.06  ?  495  THR A OG1   1 
ATOM   3185  C  CG2   . THR A 1  495  ? 134.783 208.627 164.611 1.00 28.06  ?  495  THR A CG2   1 
ATOM   3186  N  N     . ASP A 1  496  ? 136.250 209.408 160.740 1.00 28.28  ?  496  ASP A N     1 
ATOM   3187  C  CA    . ASP A 1  496  ? 136.079 210.564 159.875 1.00 28.28  ?  496  ASP A CA    1 
ATOM   3188  C  C     . ASP A 1  496  ? 135.742 210.200 158.433 1.00 28.28  ?  496  ASP A C     1 
ATOM   3189  O  O     . ASP A 1  496  ? 135.378 211.093 157.669 1.00 28.28  ?  496  ASP A O     1 
ATOM   3190  C  CB    . ASP A 1  496  ? 137.322 211.461 159.922 1.00 28.28  ?  496  ASP A CB    1 
ATOM   3191  C  CG    . ASP A 1  496  ? 137.326 212.384 161.139 1.00 28.28  ?  496  ASP A CG    1 
ATOM   3192  O  OD1   . ASP A 1  496  ? 136.256 212.568 161.750 1.00 28.28  ?  496  ASP A OD1   1 
ATOM   3193  O  OD2   . ASP A 1  496  ? 138.394 212.921 161.487 1.00 28.28  -1 496  ASP A OD2   1 
ATOM   3194  N  N     . LEU A 1  497  ? 135.809 208.925 158.047 1.00 25.74  ?  497  LEU A N     1 
ATOM   3195  C  CA    . LEU A 1  497  ? 135.152 208.517 156.810 1.00 25.74  ?  497  LEU A CA    1 
ATOM   3196  C  C     . LEU A 1  497  ? 133.653 208.368 157.012 1.00 25.74  ?  497  LEU A C     1 
ATOM   3197  O  O     . LEU A 1  497  ? 132.914 208.225 156.037 1.00 25.74  ?  497  LEU A O     1 
ATOM   3198  C  CB    . LEU A 1  497  ? 135.707 207.194 156.273 1.00 25.74  ?  497  LEU A CB    1 
ATOM   3199  C  CG    . LEU A 1  497  ? 137.003 207.055 155.481 1.00 25.74  ?  497  LEU A CG    1 
ATOM   3200  C  CD1   . LEU A 1  497  ? 137.297 205.595 155.267 1.00 25.74  ?  497  LEU A CD1   1 
ATOM   3201  C  CD2   . LEU A 1  497  ? 136.915 207.731 154.162 1.00 25.74  ?  497  LEU A CD2   1 
ATOM   3202  N  N     . GLN A 1  498  ? 133.186 208.358 158.260 1.00 27.76  ?  498  GLN A N     1 
ATOM   3203  C  CA    . GLN A 1  498  ? 131.757 208.240 158.496 1.00 27.76  ?  498  GLN A CA    1 
ATOM   3204  C  C     . GLN A 1  498  ? 131.124 209.578 158.855 1.00 27.76  ?  498  GLN A C     1 
ATOM   3205  O  O     . GLN A 1  498  ? 129.933 209.775 158.616 1.00 27.76  ?  498  GLN A O     1 
ATOM   3206  C  CB    . GLN A 1  498  ? 131.503 207.210 159.591 1.00 27.76  ?  498  GLN A CB    1 
ATOM   3207  C  CG    . GLN A 1  498  ? 130.138 206.547 159.550 1.00 27.76  ?  498  GLN A CG    1 
ATOM   3208  C  CD    . GLN A 1  498  ? 129.086 207.291 160.318 1.00 27.76  ?  498  GLN A CD    1 
ATOM   3209  O  OE1   . GLN A 1  498  ? 129.390 208.069 161.219 1.00 27.76  ?  498  GLN A OE1   1 
ATOM   3210  N  NE2   . GLN A 1  498  ? 127.832 207.042 159.986 1.00 27.76  ?  498  GLN A NE2   1 
ATOM   3211  N  N     . ASN A 1  499  ? 131.891 210.515 159.400 1.00 31.55  ?  499  ASN A N     1 
ATOM   3212  C  CA    . ASN A 1  499  ? 131.382 211.851 159.673 1.00 31.55  ?  499  ASN A CA    1 
ATOM   3213  C  C     . ASN A 1  499  ? 131.572 212.807 158.502 1.00 31.55  ?  499  ASN A C     1 
ATOM   3214  O  O     . ASN A 1  499  ? 131.604 214.022 158.712 1.00 31.55  ?  499  ASN A O     1 
ATOM   3215  C  CB    . ASN A 1  499  ? 132.045 212.431 160.926 1.00 31.55  ?  499  ASN A CB    1 
ATOM   3216  C  CG    . ASN A 1  499  ? 131.398 211.951 162.206 1.00 31.55  ?  499  ASN A CG    1 
ATOM   3217  O  OD1   . ASN A 1  499  ? 130.341 212.433 162.592 1.00 31.55  ?  499  ASN A OD1   1 
ATOM   3218  N  ND2   . ASN A 1  499  ? 132.031 211.000 162.871 1.00 31.55  ?  499  ASN A ND2   1 
ATOM   3219  N  N     . GLY A 1  500  ? 131.685 212.293 157.278 1.00 34.02  ?  500  GLY A N     1 
ATOM   3220  C  CA    . GLY A 1  500  ? 131.991 213.122 156.130 1.00 34.02  ?  500  GLY A CA    1 
ATOM   3221  C  C     . GLY A 1  500  ? 130.895 213.255 155.095 1.00 34.02  ?  500  GLY A C     1 
ATOM   3222  O  O     . GLY A 1  500  ? 129.923 213.980 155.302 1.00 34.02  ?  500  GLY A O     1 
ATOM   3223  N  N     . ASN A 1  501  ? 131.057 212.583 153.966 1.00 34.27  ?  501  ASN A N     1 
ATOM   3224  C  CA    . ASN A 1  501  ? 130.088 212.591 152.883 1.00 34.27  ?  501  ASN A CA    1 
ATOM   3225  C  C     . ASN A 1  501  ? 129.663 211.160 152.582 1.00 34.27  ?  501  ASN A C     1 
ATOM   3226  O  O     . ASN A 1  501  ? 130.080 210.216 153.247 1.00 34.27  ?  501  ASN A O     1 
ATOM   3227  C  CB    . ASN A 1  501  ? 130.661 213.258 151.633 1.00 34.27  ?  501  ASN A CB    1 
ATOM   3228  C  CG    . ASN A 1  501  ? 130.860 214.721 151.812 1.00 34.27  ?  501  ASN A CG    1 
ATOM   3229  O  OD1   . ASN A 1  501  ? 130.073 215.379 152.487 1.00 34.27  ?  501  ASN A OD1   1 
ATOM   3230  N  ND2   . ASN A 1  501  ? 131.908 215.255 151.206 1.00 34.27  ?  501  ASN A ND2   1 
ATOM   3231  N  N     . ASP A 1  502  ? 128.869 211.000 151.536 1.00 34.02  ?  502  ASP A N     1 
ATOM   3232  C  CA    . ASP A 1  502  ? 128.318 209.696 151.227 1.00 34.02  ?  502  ASP A CA    1 
ATOM   3233  C  C     . ASP A 1  502  ? 129.147 208.880 150.241 1.00 34.02  ?  502  ASP A C     1 
ATOM   3234  O  O     . ASP A 1  502  ? 128.974 207.657 150.188 1.00 34.02  ?  502  ASP A O     1 
ATOM   3235  C  CB    . ASP A 1  502  ? 126.878 209.863 150.756 1.00 34.02  ?  502  ASP A CB    1 
ATOM   3236  C  CG    . ASP A 1  502  ? 126.744 210.854 149.655 1.00 34.02  ?  502  ASP A CG    1 
ATOM   3237  O  OD1   . ASP A 1  502  ? 127.756 211.476 149.286 1.00 34.02  ?  502  ASP A OD1   1 
ATOM   3238  O  OD2   . ASP A 1  502  ? 125.613 211.035 149.169 1.00 34.02  -1 502  ASP A OD2   1 
ATOM   3239  N  N     . GLN A 1  503  ? 130.094 209.485 149.519 1.00 31.40  ?  503  GLN A N     1 
ATOM   3240  C  CA    . GLN A 1  503  ? 131.034 208.653 148.773 1.00 31.40  ?  503  GLN A CA    1 
ATOM   3241  C  C     . GLN A 1  503  ? 132.121 208.078 149.672 1.00 31.40  ?  503  GLN A C     1 
ATOM   3242  O  O     . GLN A 1  503  ? 132.613 206.975 149.413 1.00 31.40  ?  503  GLN A O     1 
ATOM   3243  C  CB    . GLN A 1  503  ? 131.647 209.436 147.618 1.00 31.40  ?  503  GLN A CB    1 
ATOM   3244  C  CG    . GLN A 1  503  ? 130.953 209.193 146.297 1.00 31.40  ?  503  GLN A CG    1 
ATOM   3245  C  CD    . GLN A 1  503  ? 129.755 210.091 146.099 1.00 31.40  ?  503  GLN A CD    1 
ATOM   3246  O  OE1   . GLN A 1  503  ? 129.654 211.153 146.710 1.00 31.40  ?  503  GLN A OE1   1 
ATOM   3247  N  NE2   . GLN A 1  503  ? 128.826 209.661 145.256 1.00 31.40  ?  503  GLN A NE2   1 
ATOM   3248  N  N     . THR A 1  504  ? 132.469 208.778 150.756 1.00 35.02  ?  504  THR A N     1 
ATOM   3249  C  CA    . THR A 1  504  ? 133.334 208.194 151.780 1.00 35.02  ?  504  THR A CA    1 
ATOM   3250  C  C     . THR A 1  504  ? 132.674 206.996 152.455 1.00 35.02  ?  504  THR A C     1 
ATOM   3251  O  O     . THR A 1  504  ? 133.319 205.961 152.667 1.00 35.02  ?  504  THR A O     1 
ATOM   3252  C  CB    . THR A 1  504  ? 133.700 209.251 152.817 1.00 35.02  ?  504  THR A CB    1 
ATOM   3253  O  OG1   . THR A 1  504  ? 132.518 209.949 153.218 1.00 35.02  ?  504  THR A OG1   1 
ATOM   3254  C  CG2   . THR A 1  504  ? 134.682 210.232 152.255 1.00 35.02  ?  504  THR A CG2   1 
ATOM   3255  N  N     . ARG A 1  505  ? 131.381 207.118 152.782 1.00 40.62  ?  505  ARG A N     1 
ATOM   3256  C  CA    . ARG A 1  505  ? 130.629 205.998 153.339 1.00 40.62  ?  505  ARG A CA    1 
ATOM   3257  C  C     . ARG A 1  505  ? 130.487 204.861 152.339 1.00 40.62  ?  505  ARG A C     1 
ATOM   3258  O  O     . ARG A 1  505  ? 130.517 203.691 152.735 1.00 40.62  ?  505  ARG A O     1 
ATOM   3259  C  CB    . ARG A 1  505  ? 129.266 206.479 153.816 1.00 40.62  ?  505  ARG A CB    1 
ATOM   3260  C  CG    . ARG A 1  505  ? 129.345 207.505 154.929 1.00 40.62  ?  505  ARG A CG    1 
ATOM   3261  C  CD    . ARG A 1  505  ? 128.034 207.719 155.646 1.00 40.62  ?  505  ARG A CD    1 
ATOM   3262  N  NE    . ARG A 1  505  ? 127.229 208.747 155.014 1.00 40.62  ?  505  ARG A NE    1 
ATOM   3263  C  CZ    . ARG A 1  505  ? 127.169 210.008 155.417 1.00 40.62  ?  505  ARG A CZ    1 
ATOM   3264  N  NH1   . ARG A 1  505  ? 127.875 210.407 156.454 1.00 40.62  1  505  ARG A NH1   1 
ATOM   3265  N  NH2   . ARG A 1  505  ? 126.409 210.875 154.773 1.00 40.62  ?  505  ARG A NH2   1 
ATOM   3266  N  N     . ARG A 1  506  ? 130.380 205.172 151.048 1.00 40.62  ?  506  ARG A N     1 
ATOM   3267  C  CA    . ARG A 1  506  ? 130.366 204.117 150.043 1.00 40.62  ?  506  ARG A CA    1 
ATOM   3268  C  C     . ARG A 1  506  ? 131.709 203.388 149.967 1.00 40.62  ?  506  ARG A C     1 
ATOM   3269  O  O     . ARG A 1  506  ? 131.744 202.160 149.796 1.00 40.62  ?  506  ARG A O     1 
ATOM   3270  C  CB    . ARG A 1  506  ? 129.978 204.710 148.694 1.00 40.62  ?  506  ARG A CB    1 
ATOM   3271  C  CG    . ARG A 1  506  ? 129.695 203.701 147.635 1.00 40.62  ?  506  ARG A CG    1 
ATOM   3272  C  CD    . ARG A 1  506  ? 129.666 204.342 146.268 1.00 40.62  ?  506  ARG A CD    1 
ATOM   3273  N  NE    . ARG A 1  506  ? 129.914 203.365 145.224 1.00 40.62  ?  506  ARG A NE    1 
ATOM   3274  C  CZ    . ARG A 1  506  ? 131.122 203.008 144.823 1.00 40.62  ?  506  ARG A CZ    1 
ATOM   3275  N  NH1   . ARG A 1  506  ? 132.192 203.558 145.372 1.00 40.62  1  506  ARG A NH1   1 
ATOM   3276  N  NH2   . ARG A 1  506  ? 131.261 202.098 143.875 1.00 40.62  ?  506  ARG A NH2   1 
ATOM   3277  N  N     . ARG A 1  507  ? 132.819 204.115 150.144 1.00 40.62  ?  507  ARG A N     1 
ATOM   3278  C  CA    . ARG A 1  507  ? 134.138 203.475 150.186 1.00 40.62  ?  507  ARG A CA    1 
ATOM   3279  C  C     . ARG A 1  507  ? 134.287 202.573 151.410 1.00 40.62  ?  507  ARG A C     1 
ATOM   3280  O  O     . ARG A 1  507  ? 134.843 201.463 151.323 1.00 40.62  ?  507  ARG A O     1 
ATOM   3281  C  CB    . ARG A 1  507  ? 135.231 204.543 150.187 1.00 40.62  ?  507  ARG A CB    1 
ATOM   3282  C  CG    . ARG A 1  507  ? 136.632 203.982 150.036 1.00 40.62  ?  507  ARG A CG    1 
ATOM   3283  C  CD    . ARG A 1  507  ? 137.721 205.041 150.183 1.00 40.62  ?  507  ARG A CD    1 
ATOM   3284  N  NE    . ARG A 1  507  ? 139.033 204.462 149.900 1.00 40.62  ?  507  ARG A NE    1 
ATOM   3285  C  CZ    . ARG A 1  507  ? 140.179 205.134 149.907 1.00 40.62  ?  507  ARG A CZ    1 
ATOM   3286  N  NH1   . ARG A 1  507  ? 140.189 206.429 150.181 1.00 40.62  1  507  ARG A NH1   1 
ATOM   3287  N  NH2   . ARG A 1  507  ? 141.313 204.508 149.634 1.00 40.62  ?  507  ARG A NH2   1 
ATOM   3288  N  N     . LEU A 1  508  ? 133.762 203.041 152.548 1.00 40.62  ?  508  LEU A N     1 
ATOM   3289  C  CA    . LEU A 1  508  ? 133.738 202.267 153.786 1.00 40.62  ?  508  LEU A CA    1 
ATOM   3290  C  C     . LEU A 1  508  ? 132.925 200.977 153.639 1.00 40.62  ?  508  LEU A C     1 
ATOM   3291  O  O     . LEU A 1  508  ? 133.336 199.914 154.120 1.00 40.62  ?  508  LEU A O     1 
ATOM   3292  C  CB    . LEU A 1  508  ? 133.177 203.162 154.891 1.00 40.62  ?  508  LEU A CB    1 
ATOM   3293  C  CG    . LEU A 1  508  ? 133.053 202.764 156.358 1.00 40.62  ?  508  LEU A CG    1 
ATOM   3294  C  CD1   . LEU A 1  508  ? 134.382 202.408 156.941 1.00 40.62  ?  508  LEU A CD1   1 
ATOM   3295  C  CD2   . LEU A 1  508  ? 132.434 203.899 157.117 1.00 40.62  ?  508  LEU A CD2   1 
ATOM   3296  N  N     . ALA A 1  509  ? 131.789 201.047 152.934 1.00 29.29  ?  509  ALA A N     1 
ATOM   3297  C  CA    . ALA A 1  509  ? 130.956 199.871 152.715 1.00 29.29  ?  509  ALA A CA    1 
ATOM   3298  C  C     . ALA A 1  509  ? 131.615 198.865 151.783 1.00 29.29  ?  509  ALA A C     1 
ATOM   3299  O  O     . ALA A 1  509  ? 131.479 197.654 151.991 1.00 29.29  ?  509  ALA A O     1 
ATOM   3300  C  CB    . ALA A 1  509  ? 129.598 200.288 152.165 1.00 29.29  ?  509  ALA A CB    1 
ATOM   3301  N  N     . VAL A 1  510  ? 132.324 199.330 150.751 1.00 24.07  ?  510  VAL A N     1 
ATOM   3302  C  CA    . VAL A 1  510  ? 133.020 198.386 149.867 1.00 24.07  ?  510  VAL A CA    1 
ATOM   3303  C  C     . VAL A 1  510  ? 134.158 197.684 150.608 1.00 24.07  ?  510  VAL A C     1 
ATOM   3304  O  O     . VAL A 1  510  ? 134.386 196.471 150.429 1.00 24.07  ?  510  VAL A O     1 
ATOM   3305  C  CB    . VAL A 1  510  ? 133.510 199.107 148.597 1.00 24.07  ?  510  VAL A CB    1 
ATOM   3306  C  CG1   . VAL A 1  510  ? 134.299 198.179 147.703 1.00 24.07  ?  510  VAL A CG1   1 
ATOM   3307  C  CG2   . VAL A 1  510  ? 132.344 199.647 147.820 1.00 24.07  ?  510  VAL A CG2   1 
ATOM   3308  N  N     . TYR A 1  511  ? 134.846 198.413 151.496 1.00 22.49  ?  511  TYR A N     1 
ATOM   3309  C  CA    . TYR A 1  511  ? 135.881 197.805 152.335 1.00 22.49  ?  511  TYR A CA    1 
ATOM   3310  C  C     . TYR A 1  511  ? 135.299 196.737 153.269 1.00 22.49  ?  511  TYR A C     1 
ATOM   3311  O  O     . TYR A 1  511  ? 135.841 195.623 153.383 1.00 22.49  ?  511  TYR A O     1 
ATOM   3312  C  CB    . TYR A 1  511  ? 136.589 198.903 153.127 1.00 22.49  ?  511  TYR A CB    1 
ATOM   3313  C  CG    . TYR A 1  511  ? 137.686 198.429 154.044 1.00 22.49  ?  511  TYR A CG    1 
ATOM   3314  C  CD1   . TYR A 1  511  ? 138.846 197.862 153.538 1.00 22.49  ?  511  TYR A CD1   1 
ATOM   3315  C  CD2   . TYR A 1  511  ? 137.573 198.566 155.419 1.00 22.49  ?  511  TYR A CD2   1 
ATOM   3316  C  CE1   . TYR A 1  511  ? 139.853 197.432 154.372 1.00 22.49  ?  511  TYR A CE1   1 
ATOM   3317  C  CE2   . TYR A 1  511  ? 138.574 198.141 156.261 1.00 22.49  ?  511  TYR A CE2   1 
ATOM   3318  C  CZ    . TYR A 1  511  ? 139.711 197.574 155.730 1.00 22.49  ?  511  TYR A CZ    1 
ATOM   3319  O  OH    . TYR A 1  511  ? 140.714 197.142 156.560 1.00 22.49  ?  511  TYR A OH    1 
ATOM   3320  N  N     . CYS A 1  512  ? 134.172 197.060 153.917 1.00 27.49  ?  512  CYS A N     1 
ATOM   3321  C  CA    . CYS A 1  512  ? 133.521 196.128 154.831 1.00 27.49  ?  512  CYS A CA    1 
ATOM   3322  C  C     . CYS A 1  512  ? 133.012 194.879 154.115 1.00 27.49  ?  512  CYS A C     1 
ATOM   3323  O  O     . CYS A 1  512  ? 133.099 193.772 154.653 1.00 27.49  ?  512  CYS A O     1 
ATOM   3324  C  CB    . CYS A 1  512  ? 132.382 196.841 155.556 1.00 27.49  ?  512  CYS A CB    1 
ATOM   3325  S  SG    . CYS A 1  512  ? 131.694 195.961 156.964 1.00 27.49  ?  512  CYS A SG    1 
ATOM   3326  N  N     . LEU A 1  513  ? 132.500 195.032 152.892 1.00 40.62  ?  513  LEU A N     1 
ATOM   3327  C  CA    . LEU A 1  513  ? 132.030 193.877 152.130 1.00 40.62  ?  513  LEU A CA    1 
ATOM   3328  C  C     . LEU A 1  513  ? 133.173 192.975 151.681 1.00 40.62  ?  513  LEU A C     1 
ATOM   3329  O  O     . LEU A 1  513  ? 133.013 191.751 151.656 1.00 40.62  ?  513  LEU A O     1 
ATOM   3330  C  CB    . LEU A 1  513  ? 131.218 194.349 150.926 1.00 40.62  ?  513  LEU A CB    1 
ATOM   3331  C  CG    . LEU A 1  513  ? 129.704 194.438 151.086 1.00 40.62  ?  513  LEU A CG    1 
ATOM   3332  C  CD1   . LEU A 1  513  ? 129.098 195.296 150.016 1.00 40.62  ?  513  LEU A CD1   1 
ATOM   3333  C  CD2   . LEU A 1  513  ? 129.137 193.064 150.991 1.00 40.62  ?  513  LEU A CD2   1 
ATOM   3334  N  N     . LYS A 1  514  ? 134.337 193.544 151.349 1.00 30.01  ?  514  LYS A N     1 
ATOM   3335  C  CA    . LYS A 1  514  ? 135.501 192.704 151.044 1.00 30.01  ?  514  LYS A CA    1 
ATOM   3336  C  C     . LYS A 1  514  ? 135.970 191.920 152.275 1.00 30.01  ?  514  LYS A C     1 
ATOM   3337  O  O     . LYS A 1  514  ? 136.330 190.729 152.172 1.00 30.01  ?  514  LYS A O     1 
ATOM   3338  C  CB    . LYS A 1  514  ? 136.618 193.582 150.484 1.00 30.01  ?  514  LYS A CB    1 
ATOM   3339  C  CG    . LYS A 1  514  ? 137.935 192.887 150.224 1.00 30.01  ?  514  LYS A CG    1 
ATOM   3340  C  CD    . LYS A 1  514  ? 137.793 191.706 149.278 1.00 30.01  ?  514  LYS A CD    1 
ATOM   3341  C  CE    . LYS A 1  514  ? 139.080 190.898 149.225 1.00 30.01  ?  514  LYS A CE    1 
ATOM   3342  N  NZ    . LYS A 1  514  ? 138.823 189.462 148.926 1.00 30.01  1  514  LYS A NZ    1 
ATOM   3343  N  N     . ASP A 1  515  ? 135.947 192.578 153.447 1.00 28.08  ?  515  ASP A N     1 
ATOM   3344  C  CA    . ASP A 1  515  ? 136.245 191.901 154.713 1.00 28.08  ?  515  ASP A CA    1 
ATOM   3345  C  C     . ASP A 1  515  ? 135.283 190.747 154.977 1.00 28.08  ?  515  ASP A C     1 
ATOM   3346  O  O     . ASP A 1  515  ? 135.711 189.634 155.307 1.00 28.08  ?  515  ASP A O     1 
ATOM   3347  C  CB    . ASP A 1  515  ? 136.182 192.892 155.870 1.00 28.08  ?  515  ASP A CB    1 
ATOM   3348  C  CG    . ASP A 1  515  ? 137.511 193.539 156.158 1.00 28.08  ?  515  ASP A CG    1 
ATOM   3349  O  OD1   . ASP A 1  515  ? 138.513 193.156 155.522 1.00 28.08  ?  515  ASP A OD1   1 
ATOM   3350  O  OD2   . ASP A 1  515  ? 137.553 194.441 157.015 1.00 28.08  -1 515  ASP A OD2   1 
ATOM   3351  N  N     . ALA A 1  516  ? 133.979 190.991 154.808 1.00 25.89  ?  516  ALA A N     1 
ATOM   3352  C  CA    . ALA A 1  516  ? 132.974 189.952 155.020 1.00 25.89  ?  516  ALA A CA    1 
ATOM   3353  C  C     . ALA A 1  516  ? 132.991 188.869 153.953 1.00 25.89  ?  516  ALA A C     1 
ATOM   3354  O  O     . ALA A 1  516  ? 132.365 187.832 154.151 1.00 25.89  ?  516  ALA A O     1 
ATOM   3355  C  CB    . ALA A 1  516  ? 131.575 190.556 155.080 1.00 25.89  ?  516  ALA A CB    1 
ATOM   3356  N  N     . TYR A 1  517  ? 133.659 189.085 152.826 1.00 25.11  ?  517  TYR A N     1 
ATOM   3357  C  CA    . TYR A 1  517  ? 133.730 188.055 151.800 1.00 25.11  ?  517  TYR A CA    1 
ATOM   3358  C  C     . TYR A 1  517  ? 134.919 187.116 151.945 1.00 25.11  ?  517  TYR A C     1 
ATOM   3359  O  O     . TYR A 1  517  ? 134.812 185.953 151.548 1.00 25.11  ?  517  TYR A O     1 
ATOM   3360  C  CB    . TYR A 1  517  ? 133.766 188.702 150.415 1.00 25.11  ?  517  TYR A CB    1 
ATOM   3361  C  CG    . TYR A 1  517  ? 133.682 187.720 149.278 1.00 25.11  ?  517  TYR A CG    1 
ATOM   3362  C  CD1   . TYR A 1  517  ? 132.739 186.716 149.278 1.00 25.11  ?  517  TYR A CD1   1 
ATOM   3363  C  CD2   . TYR A 1  517  ? 134.562 187.789 148.211 1.00 25.11  ?  517  TYR A CD2   1 
ATOM   3364  C  CE1   . TYR A 1  517  ? 132.674 185.809 148.251 1.00 25.11  ?  517  TYR A CE1   1 
ATOM   3365  C  CE2   . TYR A 1  517  ? 134.495 186.893 147.174 1.00 25.11  ?  517  TYR A CE2   1 
ATOM   3366  C  CZ    . TYR A 1  517  ? 133.549 185.904 147.200 1.00 25.11  ?  517  TYR A CZ    1 
ATOM   3367  O  OH    . TYR A 1  517  ? 133.478 184.999 146.169 1.00 25.11  ?  517  TYR A OH    1 
ATOM   3368  N  N     . LEU A 1  518  ? 136.051 187.591 152.467 1.00 26.80  ?  518  LEU A N     1 
ATOM   3369  C  CA    . LEU A 1  518  ? 137.244 186.738 152.585 1.00 26.80  ?  518  LEU A CA    1 
ATOM   3370  C  C     . LEU A 1  518  ? 137.100 185.395 153.349 1.00 26.80  ?  518  LEU A C     1 
ATOM   3371  O  O     . LEU A 1  518  ? 137.664 184.388 152.865 1.00 26.80  ?  518  LEU A O     1 
ATOM   3372  C  CB    . LEU A 1  518  ? 138.375 187.585 153.183 1.00 26.80  ?  518  LEU A CB    1 
ATOM   3373  C  CG    . LEU A 1  518  ? 139.801 187.041 153.221 1.00 26.80  ?  518  LEU A CG    1 
ATOM   3374  C  CD1   . LEU A 1  518  ? 140.150 186.453 151.908 1.00 26.80  ?  518  LEU A CD1   1 
ATOM   3375  C  CD2   . LEU A 1  518  ? 140.754 188.160 153.530 1.00 26.80  ?  518  LEU A CD2   1 
ATOM   3376  N  N     . PRO A 1  519  ? 136.386 185.277 154.489 1.00 21.21  ?  519  PRO A N     1 
ATOM   3377  C  CA    . PRO A 1  519  ? 136.303 183.952 155.132 1.00 21.21  ?  519  PRO A CA    1 
ATOM   3378  C  C     . PRO A 1  519  ? 135.480 182.914 154.377 1.00 21.21  ?  519  PRO A C     1 
ATOM   3379  O  O     . PRO A 1  519  ? 135.752 181.721 154.550 1.00 21.21  ?  519  PRO A O     1 
ATOM   3380  C  CB    . PRO A 1  519  ? 135.684 184.262 156.499 1.00 21.21  ?  519  PRO A CB    1 
ATOM   3381  C  CG    . PRO A 1  519  ? 135.941 185.661 156.718 1.00 21.21  ?  519  PRO A CG    1 
ATOM   3382  C  CD    . PRO A 1  519  ? 135.823 186.294 155.399 1.00 21.21  ?  519  PRO A CD    1 
ATOM   3383  N  N     . LEU A 1  520  ? 134.504 183.314 153.549 1.00 24.36  ?  520  LEU A N     1 
ATOM   3384  C  CA    . LEU A 1  520  ? 133.822 182.359 152.672 1.00 24.36  ?  520  LEU A CA    1 
ATOM   3385  C  C     . LEU A 1  520  ? 134.782 181.701 151.695 1.00 24.36  ?  520  LEU A C     1 
ATOM   3386  O  O     . LEU A 1  520  ? 134.758 180.477 151.520 1.00 24.36  ?  520  LEU A O     1 
ATOM   3387  C  CB    . LEU A 1  520  ? 132.712 183.037 151.882 1.00 24.36  ?  520  LEU A CB    1 
ATOM   3388  C  CG    . LEU A 1  520  ? 131.338 183.254 152.481 1.00 24.36  ?  520  LEU A CG    1 
ATOM   3389  C  CD1   . LEU A 1  520  ? 130.518 184.103 151.547 1.00 24.36  ?  520  LEU A CD1   1 
ATOM   3390  C  CD2   . LEU A 1  520  ? 130.665 181.928 152.713 1.00 24.36  ?  520  LEU A CD2   1 
ATOM   3391  N  N     . ARG A 1  521  ? 135.598 182.514 151.018 1.00 28.24  ?  521  ARG A N     1 
ATOM   3392  C  CA    . ARG A 1  521  ? 136.611 182.013 150.100 1.00 28.24  ?  521  ARG A CA    1 
ATOM   3393  C  C     . ARG A 1  521  ? 137.587 181.088 150.800 1.00 28.24  ?  521  ARG A C     1 
ATOM   3394  O  O     . ARG A 1  521  ? 138.001 180.070 150.233 1.00 28.24  ?  521  ARG A O     1 
ATOM   3395  C  CB    . ARG A 1  521  ? 137.386 183.178 149.498 1.00 28.24  ?  521  ARG A CB    1 
ATOM   3396  C  CG    . ARG A 1  521  ? 136.619 184.108 148.606 1.00 28.24  ?  521  ARG A CG    1 
ATOM   3397  C  CD    . ARG A 1  521  ? 137.554 185.203 148.174 1.00 28.24  ?  521  ARG A CD    1 
ATOM   3398  N  NE    . ARG A 1  521  ? 138.649 184.631 147.401 1.00 28.24  ?  521  ARG A NE    1 
ATOM   3399  C  CZ    . ARG A 1  521  ? 139.733 185.300 147.033 1.00 28.24  ?  521  ARG A CZ    1 
ATOM   3400  N  NH1   . ARG A 1  521  ? 139.866 186.575 147.368 1.00 28.24  1  521  ARG A NH1   1 
ATOM   3401  N  NH2   . ARG A 1  521  ? 140.679 184.691 146.335 1.00 28.24  ?  521  ARG A NH2   1 
ATOM   3402  N  N     . LEU A 1  522  ? 137.958 181.422 152.040 1.00 26.05  ?  522  LEU A N     1 
ATOM   3403  C  CA    . LEU A 1  522  ? 138.861 180.547 152.782 1.00 26.05  ?  522  LEU A CA    1 
ATOM   3404  C  C     . LEU A 1  522  ? 138.184 179.238 153.183 1.00 26.05  ?  522  LEU A C     1 
ATOM   3405  O  O     . LEU A 1  522  ? 138.825 178.182 153.189 1.00 26.05  ?  522  LEU A O     1 
ATOM   3406  C  CB    . LEU A 1  522  ? 139.391 181.272 154.013 1.00 26.05  ?  522  LEU A CB    1 
ATOM   3407  C  CG    . LEU A 1  522  ? 140.784 181.887 153.929 1.00 26.05  ?  522  LEU A CG    1 
ATOM   3408  C  CD1   . LEU A 1  522  ? 141.158 182.435 155.281 1.00 26.05  ?  522  LEU A CD1   1 
ATOM   3409  C  CD2   . LEU A 1  522  ? 141.797 180.871 153.464 1.00 26.05  ?  522  LEU A CD2   1 
ATOM   3410  N  N     . LEU A 1  523  ? 136.891 179.291 153.516 1.00 26.97  ?  523  LEU A N     1 
ATOM   3411  C  CA    . LEU A 1  523  ? 136.158 178.092 153.910 1.00 26.97  ?  523  LEU A CA    1 
ATOM   3412  C  C     . LEU A 1  523  ? 135.979 177.130 152.742 1.00 26.97  ?  523  LEU A C     1 
ATOM   3413  O  O     . LEU A 1  523  ? 136.113 175.915 152.907 1.00 26.97  ?  523  LEU A O     1 
ATOM   3414  C  CB    . LEU A 1  523  ? 134.804 178.491 154.496 1.00 26.97  ?  523  LEU A CB    1 
ATOM   3415  C  CG    . LEU A 1  523  ? 133.631 177.509 154.485 1.00 26.97  ?  523  LEU A CG    1 
ATOM   3416  C  CD1   . LEU A 1  523  ? 133.852 176.366 155.450 1.00 26.97  ?  523  LEU A CD1   1 
ATOM   3417  C  CD2   . LEU A 1  523  ? 132.337 178.221 154.813 1.00 26.97  ?  523  LEU A CD2   1 
ATOM   3418  N  N     . GLU A 1  524  ? 135.684 177.652 151.554 1.00 37.00  ?  524  GLU A N     1 
ATOM   3419  C  CA    . GLU A 1  524  ? 135.494 176.753 150.420 1.00 37.00  ?  524  GLU A CA    1 
ATOM   3420  C  C     . GLU A 1  524  ? 136.814 176.337 149.786 1.00 37.00  ?  524  GLU A C     1 
ATOM   3421  O  O     . GLU A 1  524  ? 136.885 175.271 149.171 1.00 37.00  ?  524  GLU A O     1 
ATOM   3422  C  CB    . GLU A 1  524  ? 134.596 177.393 149.361 1.00 37.00  ?  524  GLU A CB    1 
ATOM   3423  C  CG    . GLU A 1  524  ? 135.089 178.729 148.862 1.00 37.00  ?  524  GLU A CG    1 
ATOM   3424  C  CD    . GLU A 1  524  ? 134.364 179.207 147.629 1.00 37.00  ?  524  GLU A CD    1 
ATOM   3425  O  OE1   . GLU A 1  524  ? 133.753 178.367 146.937 1.00 37.00  ?  524  GLU A OE1   1 
ATOM   3426  O  OE2   . GLU A 1  524  ? 134.405 180.425 147.357 1.00 37.00  -1 524  GLU A OE2   1 
ATOM   3427  N  N     . ARG A 1  525  ? 137.862 177.146 149.923 1.00 44.86  ?  525  ARG A N     1 
ATOM   3428  C  CA    . ARG A 1  525  ? 139.118 176.796 149.272 1.00 44.86  ?  525  ARG A CA    1 
ATOM   3429  C  C     . ARG A 1  525  ? 139.916 175.779 150.078 1.00 44.86  ?  525  ARG A C     1 
ATOM   3430  O  O     . ARG A 1  525  ? 140.610 174.941 149.501 1.00 44.86  ?  525  ARG A O     1 
ATOM   3431  C  CB    . ARG A 1  525  ? 139.956 178.047 149.029 1.00 44.86  ?  525  ARG A CB    1 
ATOM   3432  C  CG    . ARG A 1  525  ? 141.001 177.835 147.966 1.00 44.86  ?  525  ARG A CG    1 
ATOM   3433  C  CD    . ARG A 1  525  ? 141.932 179.008 147.839 1.00 44.86  ?  525  ARG A CD    1 
ATOM   3434  N  NE    . ARG A 1  525  ? 141.324 180.128 147.127 1.00 44.86  ?  525  ARG A NE    1 
ATOM   3435  C  CZ    . ARG A 1  525  ? 141.745 180.577 145.950 1.00 44.86  ?  525  ARG A CZ    1 
ATOM   3436  N  NH1   . ARG A 1  525  ? 142.779 180.001 145.354 1.00 44.86  1  525  ARG A NH1   1 
ATOM   3437  N  NH2   . ARG A 1  525  ? 141.135 181.605 145.374 1.00 44.86  ?  525  ARG A NH2   1 
ATOM   3438  N  N     . LEU A 1  526  ? 139.835 175.827 151.402 1.00 34.94  ?  526  LEU A N     1 
ATOM   3439  C  CA    . LEU A 1  526  ? 140.665 174.969 152.232 1.00 34.94  ?  526  LEU A CA    1 
ATOM   3440  C  C     . LEU A 1  526  ? 140.042 173.611 152.500 1.00 34.94  ?  526  LEU A C     1 
ATOM   3441  O  O     . LEU A 1  526  ? 140.654 172.821 153.227 1.00 34.94  ?  526  LEU A O     1 
ATOM   3442  C  CB    . LEU A 1  526  ? 140.972 175.656 153.559 1.00 34.94  ?  526  LEU A CB    1 
ATOM   3443  C  CG    . LEU A 1  526  ? 142.265 176.456 153.655 1.00 34.94  ?  526  LEU A CG    1 
ATOM   3444  C  CD1   . LEU A 1  526  ? 142.212 177.411 154.814 1.00 34.94  ?  526  LEU A CD1   1 
ATOM   3445  C  CD2   . LEU A 1  526  ? 143.436 175.504 153.812 1.00 34.94  ?  526  LEU A CD2   1 
ATOM   3446  N  N     . MET A 1  527  ? 138.859 173.338 151.931 1.00 34.68  ?  527  MET A N     1 
ATOM   3447  C  CA    . MET A 1  527  ? 138.094 172.099 152.127 1.00 34.68  ?  527  MET A CA    1 
ATOM   3448  C  C     . MET A 1  527  ? 137.805 171.850 153.604 1.00 34.68  ?  527  MET A C     1 
ATOM   3449  O  O     . MET A 1  527  ? 137.989 170.746 154.115 1.00 34.68  ?  527  MET A O     1 
ATOM   3450  C  CB    . MET A 1  527  ? 138.796 170.893 151.496 1.00 34.68  ?  527  MET A CB    1 
ATOM   3451  C  CG    . MET A 1  527  ? 138.669 170.823 149.994 1.00 34.68  ?  527  MET A CG    1 
ATOM   3452  S  SD    . MET A 1  527  ? 139.632 169.464 149.322 1.00 34.68  ?  527  MET A SD    1 
ATOM   3453  C  CE    . MET A 1  527  ? 138.958 168.084 150.234 1.00 34.68  ?  527  MET A CE    1 
ATOM   3454  N  N     . VAL A 1  528  ? 137.358 172.903 154.290 1.00 25.27  ?  528  VAL A N     1 
ATOM   3455  C  CA    . VAL A 1  528  ? 137.056 172.811 155.716 1.00 25.27  ?  528  VAL A CA    1 
ATOM   3456  C  C     . VAL A 1  528  ? 135.833 171.938 155.949 1.00 25.27  ?  528  VAL A C     1 
ATOM   3457  O  O     . VAL A 1  528  ? 135.895 170.919 156.647 1.00 25.27  ?  528  VAL A O     1 
ATOM   3458  C  CB    . VAL A 1  528  ? 136.848 174.217 156.312 1.00 25.27  ?  528  VAL A CB    1 
ATOM   3459  C  CG1   . VAL A 1  528  ? 136.450 174.123 157.758 1.00 25.27  ?  528  VAL A CG1   1 
ATOM   3460  C  CG2   . VAL A 1  528  ? 138.090 175.065 156.171 1.00 25.27  ?  528  VAL A CG2   1 
ATOM   3461  N  N     . LEU A 1  529  ? 134.702 172.324 155.346 1.00 27.73  ?  529  LEU A N     1 
ATOM   3462  C  CA    . LEU A 1  529  ? 133.402 171.779 155.725 1.00 27.73  ?  529  LEU A CA    1 
ATOM   3463  C  C     . LEU A 1  529  ? 133.229 170.343 155.243 1.00 27.73  ?  529  LEU A C     1 
ATOM   3464  O  O     . LEU A 1  529  ? 132.590 169.536 155.928 1.00 27.73  ?  529  LEU A O     1 
ATOM   3465  C  CB    . LEU A 1  529  ? 132.301 172.693 155.176 1.00 27.73  ?  529  LEU A CB    1 
ATOM   3466  C  CG    . LEU A 1  529  ? 130.893 172.831 155.782 1.00 27.73  ?  529  LEU A CG    1 
ATOM   3467  C  CD1   . LEU A 1  529  ? 130.197 174.007 155.118 1.00 27.73  ?  529  LEU A CD1   1 
ATOM   3468  C  CD2   . LEU A 1  529  ? 130.011 171.592 155.659 1.00 27.73  ?  529  LEU A CD2   1 
ATOM   3469  N  N     . VAL A 1  530  ? 133.815 170.008 154.096 1.00 26.27  ?  530  VAL A N     1 
ATOM   3470  C  CA    . VAL A 1  530  ? 133.778 168.643 153.588 1.00 26.27  ?  530  VAL A CA    1 
ATOM   3471  C  C     . VAL A 1  530  ? 134.545 167.704 154.514 1.00 26.27  ?  530  VAL A C     1 
ATOM   3472  O  O     . VAL A 1  530  ? 134.104 166.578 154.800 1.00 26.27  ?  530  VAL A O     1 
ATOM   3473  C  CB    . VAL A 1  530  ? 134.333 168.633 152.153 1.00 26.27  ?  530  VAL A CB    1 
ATOM   3474  C  CG1   . VAL A 1  530  ? 134.428 167.223 151.597 1.00 26.27  ?  530  VAL A CG1   1 
ATOM   3475  C  CG2   . VAL A 1  530  ? 133.483 169.518 151.268 1.00 26.27  ?  530  VAL A CG2   1 
ATOM   3476  N  N     . ASN A 1  531  ? 135.664 168.178 155.059 1.00 27.12  ?  531  ASN A N     1 
ATOM   3477  C  CA    . ASN A 1  531  ? 136.429 167.367 155.995 1.00 27.12  ?  531  ASN A CA    1 
ATOM   3478  C  C     . ASN A 1  531  ? 135.755 167.284 157.357 1.00 27.12  ?  531  ASN A C     1 
ATOM   3479  O  O     . ASN A 1  531  ? 135.860 166.255 158.026 1.00 27.12  ?  531  ASN A O     1 
ATOM   3480  C  CB    . ASN A 1  531  ? 137.846 167.916 156.126 1.00 27.12  ?  531  ASN A CB    1 
ATOM   3481  C  CG    . ASN A 1  531  ? 138.643 167.758 154.860 1.00 27.12  ?  531  ASN A CG    1 
ATOM   3482  O  OD1   . ASN A 1  531  ? 138.257 167.020 153.960 1.00 27.12  ?  531  ASN A OD1   1 
ATOM   3483  N  ND2   . ASN A 1  531  ? 139.766 168.447 154.782 1.00 27.12  ?  531  ASN A ND2   1 
ATOM   3484  N  N     . ALA A 1  532  ? 135.034 168.332 157.769 1.00 22.45  ?  532  ALA A N     1 
ATOM   3485  C  CA    . ALA A 1  532  ? 134.272 168.260 159.014 1.00 22.45  ?  532  ALA A CA    1 
ATOM   3486  C  C     . ALA A 1  532  ? 133.120 167.262 158.917 1.00 22.45  ?  532  ALA A C     1 
ATOM   3487  O  O     . ALA A 1  532  ? 132.866 166.506 159.867 1.00 22.45  ?  532  ALA A O     1 
ATOM   3488  C  CB    . ALA A 1  532  ? 133.744 169.640 159.387 1.00 22.45  ?  532  ALA A CB    1 
ATOM   3489  N  N     . VAL A 1  533  ? 132.434 167.224 157.768 1.00 22.80  ?  533  VAL A N     1 
ATOM   3490  C  CA    . VAL A 1  533  ? 131.354 166.260 157.562 1.00 22.80  ?  533  VAL A CA    1 
ATOM   3491  C  C     . VAL A 1  533  ? 131.899 164.832 157.510 1.00 22.80  ?  533  VAL A C     1 
ATOM   3492  O  O     . VAL A 1  533  ? 131.325 163.915 158.115 1.00 22.80  ?  533  VAL A O     1 
ATOM   3493  C  CB    . VAL A 1  533  ? 130.550 166.627 156.297 1.00 22.80  ?  533  VAL A CB    1 
ATOM   3494  C  CG1   . VAL A 1  533  ? 129.595 165.530 155.907 1.00 22.80  ?  533  VAL A CG1   1 
ATOM   3495  C  CG2   . VAL A 1  533  ? 129.771 167.893 156.523 1.00 22.80  ?  533  VAL A CG2   1 
ATOM   3496  N  N     . GLU A 1  534  ? 133.048 164.627 156.850 1.00 24.82  ?  534  GLU A N     1 
ATOM   3497  C  CA    . GLU A 1  534  ? 133.635 163.286 156.820 1.00 24.82  ?  534  GLU A CA    1 
ATOM   3498  C  C     . GLU A 1  534  ? 134.168 162.853 158.184 1.00 24.82  ?  534  GLU A C     1 
ATOM   3499  O  O     . GLU A 1  534  ? 134.087 161.667 158.528 1.00 24.82  ?  534  GLU A O     1 
ATOM   3500  C  CB    . GLU A 1  534  ? 134.746 163.225 155.780 1.00 24.82  ?  534  GLU A CB    1 
ATOM   3501  C  CG    . GLU A 1  534  ? 135.349 161.856 155.582 1.00 24.82  ?  534  GLU A CG    1 
ATOM   3502  C  CD    . GLU A 1  534  ? 136.750 161.918 155.039 1.00 24.82  ?  534  GLU A CD    1 
ATOM   3503  O  OE1   . GLU A 1  534  ? 137.615 161.175 155.540 1.00 24.82  ?  534  GLU A OE1   1 
ATOM   3504  O  OE2   . GLU A 1  534  ? 136.986 162.714 154.109 1.00 24.82  -1 534  GLU A OE2   1 
ATOM   3505  N  N     . MET A 1  535  ? 134.684 163.790 158.983 1.00 24.10  ?  535  MET A N     1 
ATOM   3506  C  CA    . MET A 1  535  ? 135.118 163.449 160.335 1.00 24.10  ?  535  MET A CA    1 
ATOM   3507  C  C     . MET A 1  535  ? 133.939 163.040 161.208 1.00 24.10  ?  535  MET A C     1 
ATOM   3508  O  O     . MET A 1  535  ? 134.019 162.051 161.948 1.00 24.10  ?  535  MET A O     1 
ATOM   3509  C  CB    . MET A 1  535  ? 135.855 164.629 160.960 1.00 24.10  ?  535  MET A CB    1 
ATOM   3510  C  CG    . MET A 1  535  ? 136.900 164.225 161.976 1.00 24.10  ?  535  MET A CG    1 
ATOM   3511  S  SD    . MET A 1  535  ? 138.313 163.434 161.196 1.00 24.10  ?  535  MET A SD    1 
ATOM   3512  C  CE    . MET A 1  535  ? 138.500 162.002 162.233 1.00 24.10  ?  535  MET A CE    1 
ATOM   3513  N  N     . ALA A 1  536  ? 132.825 163.772 161.106 1.00 19.78  ?  536  ALA A N     1 
ATOM   3514  C  CA    . ALA A 1  536  ? 131.638 163.418 161.872 1.00 19.78  ?  536  ALA A CA    1 
ATOM   3515  C  C     . ALA A 1  536  ? 131.011 162.114 161.397 1.00 19.78  ?  536  ALA A C     1 
ATOM   3516  O  O     . ALA A 1  536  ? 130.346 161.434 162.181 1.00 19.78  ?  536  ALA A O     1 
ATOM   3517  C  CB    . ALA A 1  536  ? 130.621 164.547 161.804 1.00 19.78  ?  536  ALA A CB    1 
ATOM   3518  N  N     . ARG A 1  537  ? 131.207 161.737 160.136 1.00 13.49  ?  537  ARG A N     1 
ATOM   3519  C  CA    . ARG A 1  537  ? 130.660 160.456 159.703 1.00 13.49  ?  537  ARG A CA    1 
ATOM   3520  C  C     . ARG A 1  537  ? 131.560 159.282 160.064 1.00 13.49  ?  537  ARG A C     1 
ATOM   3521  O  O     . ARG A 1  537  ? 131.057 158.182 160.297 1.00 13.49  ?  537  ARG A O     1 
ATOM   3522  C  CB    . ARG A 1  537  ? 130.387 160.470 158.200 1.00 13.49  ?  537  ARG A CB    1 
ATOM   3523  C  CG    . ARG A 1  537  ? 129.212 161.341 157.827 1.00 13.49  ?  537  ARG A CG    1 
ATOM   3524  C  CD    . ARG A 1  537  ? 128.879 161.238 156.368 1.00 13.49  ?  537  ARG A CD    1 
ATOM   3525  N  NE    . ARG A 1  537  ? 127.880 162.223 155.975 1.00 13.49  ?  537  ARG A NE    1 
ATOM   3526  C  CZ    . ARG A 1  537  ? 127.414 162.356 154.742 1.00 13.49  ?  537  ARG A CZ    1 
ATOM   3527  N  NH1   . ARG A 1  537  ? 127.849 161.565 153.779 1.00 13.49  1  537  ARG A NH1   1 
ATOM   3528  N  NH2   . ARG A 1  537  ? 126.513 163.279 154.474 1.00 13.49  ?  537  ARG A NH2   1 
ATOM   3529  N  N     . VAL A 1  538  ? 132.874 159.478 160.121 1.00 23.52  ?  538  VAL A N     1 
ATOM   3530  C  CA    . VAL A 1  538  ? 133.755 158.364 160.461 1.00 23.52  ?  538  VAL A CA    1 
ATOM   3531  C  C     . VAL A 1  538  ? 133.798 158.147 161.972 1.00 23.52  ?  538  VAL A C     1 
ATOM   3532  O  O     . VAL A 1  538  ? 133.836 157.007 162.445 1.00 23.52  ?  538  VAL A O     1 
ATOM   3533  C  CB    . VAL A 1  538  ? 135.153 158.601 159.851 1.00 23.52  ?  538  VAL A CB    1 
ATOM   3534  C  CG1   . VAL A 1  538  ? 136.165 157.582 160.324 1.00 23.52  ?  538  VAL A CG1   1 
ATOM   3535  C  CG2   . VAL A 1  538  ? 135.069 158.530 158.348 1.00 23.52  ?  538  VAL A CG2   1 
ATOM   3536  N  N     . THR A 1  539  ? 133.726 159.217 162.763 1.00 18.47  ?  539  THR A N     1 
ATOM   3537  C  CA    . THR A 1  539  ? 133.811 159.029 164.208 1.00 18.47  ?  539  THR A CA    1 
ATOM   3538  C  C     . THR A 1  539  ? 132.456 158.813 164.880 1.00 18.47  ?  539  THR A C     1 
ATOM   3539  O  O     . THR A 1  539  ? 132.366 158.051 165.841 1.00 18.47  ?  539  THR A O     1 
ATOM   3540  C  CB    . THR A 1  539  ? 134.536 160.209 164.852 1.00 18.47  ?  539  THR A CB    1 
ATOM   3541  O  OG1   . THR A 1  539  ? 133.879 161.436 164.513 1.00 18.47  ?  539  THR A OG1   1 
ATOM   3542  C  CG2   . THR A 1  539  ? 135.966 160.247 164.370 1.00 18.47  ?  539  THR A CG2   1 
ATOM   3543  N  N     . GLY A 1  540  ? 131.396 159.444 164.406 1.00 17.79  ?  540  GLY A N     1 
ATOM   3544  C  CA    . GLY A 1  540  ? 130.100 159.278 165.014 1.00 17.79  ?  540  GLY A CA    1 
ATOM   3545  C  C     . GLY A 1  540  ? 129.747 160.291 166.073 1.00 17.79  ?  540  GLY A C     1 
ATOM   3546  O  O     . GLY A 1  540  ? 128.848 160.027 166.879 1.00 17.79  ?  540  GLY A O     1 
ATOM   3547  N  N     . VAL A 1  541  ? 130.416 161.436 166.101 1.00 20.90  ?  541  VAL A N     1 
ATOM   3548  C  CA    . VAL A 1  541  ? 130.101 162.504 167.040 1.00 20.90  ?  541  VAL A CA    1 
ATOM   3549  C  C     . VAL A 1  541  ? 129.381 163.606 166.270 1.00 20.90  ?  541  VAL A C     1 
ATOM   3550  O  O     . VAL A 1  541  ? 129.522 163.686 165.045 1.00 20.90  ?  541  VAL A O     1 
ATOM   3551  C  CB    . VAL A 1  541  ? 131.373 163.011 167.742 1.00 20.90  ?  541  VAL A CB    1 
ATOM   3552  C  CG1   . VAL A 1  541  ? 132.026 161.890 168.514 1.00 20.90  ?  541  VAL A CG1   1 
ATOM   3553  C  CG2   . VAL A 1  541  ? 132.345 163.608 166.745 1.00 20.90  ?  541  VAL A CG2   1 
ATOM   3554  N  N     . PRO A 1  542  ? 128.589 164.460 166.931 1.00 22.46  ?  542  PRO A N     1 
ATOM   3555  C  CA    . PRO A 1  542  ? 127.933 165.569 166.216 1.00 22.46  ?  542  PRO A CA    1 
ATOM   3556  C  C     . PRO A 1  542  ? 128.874 166.606 165.617 1.00 22.46  ?  542  PRO A C     1 
ATOM   3557  O  O     . PRO A 1  542  ? 130.094 166.546 165.785 1.00 22.46  ?  542  PRO A O     1 
ATOM   3558  C  CB    . PRO A 1  542  ? 127.056 166.208 167.300 1.00 22.46  ?  542  PRO A CB    1 
ATOM   3559  C  CG    . PRO A 1  542  ? 126.785 165.116 168.253 1.00 22.46  ?  542  PRO A CG    1 
ATOM   3560  C  CD    . PRO A 1  542  ? 128.011 164.260 168.273 1.00 22.46  ?  542  PRO A CD    1 
ATOM   3561  N  N     . LEU A 1  543  ? 128.296 167.575 164.912 1.00 24.80  ?  543  LEU A N     1 
ATOM   3562  C  CA    . LEU A 1  543  ? 129.064 168.588 164.206 1.00 24.80  ?  543  LEU A CA    1 
ATOM   3563  C  C     . LEU A 1  543  ? 129.430 169.777 165.078 1.00 24.80  ?  543  LEU A C     1 
ATOM   3564  O  O     . LEU A 1  543  ? 130.253 170.596 164.673 1.00 24.80  ?  543  LEU A O     1 
ATOM   3565  C  CB    . LEU A 1  543  ? 128.282 169.066 162.981 1.00 24.80  ?  543  LEU A CB    1 
ATOM   3566  C  CG    . LEU A 1  543  ? 129.066 169.617 161.797 1.00 24.80  ?  543  LEU A CG    1 
ATOM   3567  C  CD1   . LEU A 1  543  ? 130.039 168.595 161.237 1.00 24.80  ?  543  LEU A CD1   1 
ATOM   3568  C  CD2   . LEU A 1  543  ? 128.113 170.108 160.737 1.00 24.80  ?  543  LEU A CD2   1 
ATOM   3569  N  N     . SER A 1  544  ? 128.857 169.895 166.262 1.00 26.14  ?  544  SER A N     1 
ATOM   3570  C  CA    . SER A 1  544  ? 129.277 170.947 167.168 1.00 26.14  ?  544  SER A CA    1 
ATOM   3571  C  C     . SER A 1  544  ? 130.419 170.519 168.080 1.00 26.14  ?  544  SER A C     1 
ATOM   3572  O  O     . SER A 1  544  ? 131.049 171.377 168.706 1.00 26.14  ?  544  SER A O     1 
ATOM   3573  C  CB    . SER A 1  544  ? 128.094 171.418 168.009 1.00 26.14  ?  544  SER A CB    1 
ATOM   3574  O  OG    . SER A 1  544  ? 127.338 170.313 168.456 1.00 26.14  ?  544  SER A OG    1 
ATOM   3575  N  N     . TYR A 1  545  ? 130.704 169.225 168.165 1.00 26.81  ?  545  TYR A N     1 
ATOM   3576  C  CA    . TYR A 1  545  ? 131.759 168.751 169.047 1.00 26.81  ?  545  TYR A CA    1 
ATOM   3577  C  C     . TYR A 1  545  ? 133.138 168.891 168.436 1.00 26.81  ?  545  TYR A C     1 
ATOM   3578  O  O     . TYR A 1  545  ? 134.128 168.823 169.166 1.00 26.81  ?  545  TYR A O     1 
ATOM   3579  C  CB    . TYR A 1  545  ? 131.549 167.282 169.412 1.00 26.81  ?  545  TYR A CB    1 
ATOM   3580  C  CG    . TYR A 1  545  ? 130.519 167.014 170.485 1.00 26.81  ?  545  TYR A CG    1 
ATOM   3581  C  CD1   . TYR A 1  545  ? 129.701 168.025 170.974 1.00 26.81  ?  545  TYR A CD1   1 
ATOM   3582  C  CD2   . TYR A 1  545  ? 130.368 165.742 171.005 1.00 26.81  ?  545  TYR A CD2   1 
ATOM   3583  C  CE1   . TYR A 1  545  ? 128.765 167.769 171.945 1.00 26.81  ?  545  TYR A CE1   1 
ATOM   3584  C  CE2   . TYR A 1  545  ? 129.435 165.482 171.978 1.00 26.81  ?  545  TYR A CE2   1 
ATOM   3585  C  CZ    . TYR A 1  545  ? 128.638 166.496 172.442 1.00 26.81  ?  545  TYR A CZ    1 
ATOM   3586  O  OH    . TYR A 1  545  ? 127.711 166.229 173.413 1.00 26.81  ?  545  TYR A OH    1 
ATOM   3587  N  N     . LEU A 1  546  ? 133.233 169.072 167.123 1.00 26.10  ?  546  LEU A N     1 
ATOM   3588  C  CA    . LEU A 1  546  ? 134.525 169.233 166.470 1.00 26.10  ?  546  LEU A CA    1 
ATOM   3589  C  C     . LEU A 1  546  ? 135.048 170.658 166.539 1.00 26.10  ?  546  LEU A C     1 
ATOM   3590  O  O     . LEU A 1  546  ? 136.043 170.966 165.884 1.00 26.10  ?  546  LEU A O     1 
ATOM   3591  C  CB    . LEU A 1  546  ? 134.445 168.779 165.009 1.00 26.10  ?  546  LEU A CB    1 
ATOM   3592  C  CG    . LEU A 1  546  ? 134.013 167.331 164.792 1.00 26.10  ?  546  LEU A CG    1 
ATOM   3593  C  CD1   . LEU A 1  546  ? 134.087 166.986 163.341 1.00 26.10  ?  546  LEU A CD1   1 
ATOM   3594  C  CD2   . LEU A 1  546  ? 134.875 166.399 165.579 1.00 26.10  ?  546  LEU A CD2   1 
ATOM   3595  N  N     . LEU A 1  547  ? 134.410 171.523 167.315 1.00 31.05  ?  547  LEU A N     1 
ATOM   3596  C  CA    . LEU A 1  547  ? 134.869 172.881 167.530 1.00 31.05  ?  547  LEU A CA    1 
ATOM   3597  C  C     . LEU A 1  547  ? 134.996 173.226 168.998 1.00 31.05  ?  547  LEU A C     1 
ATOM   3598  O  O     . LEU A 1  547  ? 135.374 174.354 169.325 1.00 31.05  ?  547  LEU A O     1 
ATOM   3599  C  CB    . LEU A 1  547  ? 133.912 173.873 166.867 1.00 31.05  ?  547  LEU A CB    1 
ATOM   3600  C  CG    . LEU A 1  547  ? 134.160 174.061 165.384 1.00 31.05  ?  547  LEU A CG    1 
ATOM   3601  C  CD1   . LEU A 1  547  ? 132.855 174.393 164.698 1.00 31.05  ?  547  LEU A CD1   1 
ATOM   3602  C  CD2   . LEU A 1  547  ? 135.197 175.154 165.201 1.00 31.05  ?  547  LEU A CD2   1 
ATOM   3603  N  N     . SER A 1  548  ? 134.682 172.301 169.883 1.00 34.95  ?  548  SER A N     1 
ATOM   3604  C  CA    . SER A 1  548  ? 134.631 172.555 171.308 1.00 34.95  ?  548  SER A CA    1 
ATOM   3605  C  C     . SER A 1  548  ? 135.428 171.561 172.128 1.00 34.95  ?  548  SER A C     1 
ATOM   3606  O  O     . SER A 1  548  ? 135.840 171.895 173.233 1.00 34.95  ?  548  SER A O     1 
ATOM   3607  C  CB    . SER A 1  548  ? 133.174 172.530 171.788 1.00 34.95  ?  548  SER A CB    1 
ATOM   3608  O  OG    . SER A 1  548  ? 132.418 173.554 171.178 1.00 34.95  ?  548  SER A OG    1 
ATOM   3609  N  N     . ARG A 1  549  ? 135.657 170.363 171.619 1.00 32.67  ?  549  ARG A N     1 
ATOM   3610  C  CA    . ARG A 1  549  ? 136.155 169.251 172.413 1.00 32.67  ?  549  ARG A CA    1 
ATOM   3611  C  C     . ARG A 1  549  ? 137.494 168.764 171.869 1.00 32.67  ?  549  ARG A C     1 
ATOM   3612  O  O     . ARG A 1  549  ? 138.082 169.362 170.968 1.00 32.67  ?  549  ARG A O     1 
ATOM   3613  C  CB    . ARG A 1  549  ? 135.120 168.133 172.443 1.00 32.67  ?  549  ARG A CB    1 
ATOM   3614  C  CG    . ARG A 1  549  ? 133.816 168.582 173.015 1.00 32.67  ?  549  ARG A CG    1 
ATOM   3615  C  CD    . ARG A 1  549  ? 133.720 168.179 174.450 1.00 32.67  ?  549  ARG A CD    1 
ATOM   3616  N  NE    . ARG A 1  549  ? 132.384 168.391 174.982 1.00 32.67  ?  549  ARG A NE    1 
ATOM   3617  C  CZ    . ARG A 1  549  ? 131.878 167.695 175.987 1.00 32.67  ?  549  ARG A CZ    1 
ATOM   3618  N  NH1   . ARG A 1  549  ? 130.650 167.943 176.413 1.00 32.67  1  549  ARG A NH1   1 
ATOM   3619  N  NH2   . ARG A 1  549  ? 132.599 166.741 176.558 1.00 32.67  ?  549  ARG A NH2   1 
ATOM   3620  N  N     . GLY A 1  550  ? 137.977 167.668 172.434 1.00 29.49  ?  550  GLY A N     1 
ATOM   3621  C  CA    . GLY A 1  550  ? 139.271 167.155 172.046 1.00 29.49  ?  550  GLY A CA    1 
ATOM   3622  C  C     . GLY A 1  550  ? 139.173 165.820 171.359 1.00 29.49  ?  550  GLY A C     1 
ATOM   3623  O  O     . GLY A 1  550  ? 138.232 165.569 170.609 1.00 29.49  ?  550  GLY A O     1 
ATOM   3624  N  N     . GLN A 1  551  ? 140.126 164.944 171.627 1.00 31.57  ?  551  GLN A N     1 
ATOM   3625  C  CA    . GLN A 1  551  ? 140.177 163.651 170.977 1.00 31.57  ?  551  GLN A CA    1 
ATOM   3626  C  C     . GLN A 1  551  ? 139.730 162.506 171.875 1.00 31.57  ?  551  GLN A C     1 
ATOM   3627  O  O     . GLN A 1  551  ? 140.023 161.350 171.555 1.00 31.57  ?  551  GLN A O     1 
ATOM   3628  C  CB    . GLN A 1  551  ? 141.596 163.386 170.486 1.00 31.57  ?  551  GLN A CB    1 
ATOM   3629  C  CG    . GLN A 1  551  ? 142.335 164.617 169.987 1.00 31.57  ?  551  GLN A CG    1 
ATOM   3630  C  CD    . GLN A 1  551  ? 142.054 164.945 168.530 1.00 31.57  ?  551  GLN A CD    1 
ATOM   3631  O  OE1   . GLN A 1  551  ? 142.024 164.061 167.679 1.00 31.57  ?  551  GLN A OE1   1 
ATOM   3632  N  NE2   . GLN A 1  551  ? 141.853 166.221 168.240 1.00 31.57  ?  551  GLN A NE2   1 
ATOM   3633  N  N     . GLN A 1  552  ? 139.045 162.786 172.990 1.00 31.13  ?  552  GLN A N     1 
ATOM   3634  C  CA    . GLN A 1  552  ? 138.597 161.714 173.879 1.00 31.13  ?  552  GLN A CA    1 
ATOM   3635  C  C     . GLN A 1  552  ? 137.170 161.280 173.582 1.00 31.13  ?  552  GLN A C     1 
ATOM   3636  O  O     . GLN A 1  552  ? 136.872 160.083 173.614 1.00 31.13  ?  552  GLN A O     1 
ATOM   3637  C  CB    . GLN A 1  552  ? 138.705 162.131 175.343 1.00 31.13  ?  552  GLN A CB    1 
ATOM   3638  C  CG    . GLN A 1  552  ? 140.053 161.879 175.976 1.00 31.13  ?  552  GLN A CG    1 
ATOM   3639  C  CD    . GLN A 1  552  ? 140.122 162.402 177.391 1.00 31.13  ?  552  GLN A CD    1 
ATOM   3640  O  OE1   . GLN A 1  552  ? 139.142 162.919 177.917 1.00 31.13  ?  552  GLN A OE1   1 
ATOM   3641  N  NE2   . GLN A 1  552  ? 141.289 162.291 178.006 1.00 31.13  ?  552  GLN A NE2   1 
ATOM   3642  N  N     . VAL A 1  553  ? 136.270 162.238 173.324 1.00 29.10  ?  553  VAL A N     1 
ATOM   3643  C  CA    . VAL A 1  553  ? 134.861 161.928 173.085 1.00 29.10  ?  553  VAL A CA    1 
ATOM   3644  C  C     . VAL A 1  553  ? 134.690 161.044 171.860 1.00 29.10  ?  553  VAL A C     1 
ATOM   3645  O  O     . VAL A 1  553  ? 133.815 160.171 171.829 1.00 29.10  ?  553  VAL A O     1 
ATOM   3646  C  CB    . VAL A 1  553  ? 134.044 163.227 172.954 1.00 29.10  ?  553  VAL A CB    1 
ATOM   3647  C  CG1   . VAL A 1  553  ? 133.791 163.831 174.318 1.00 29.10  ?  553  VAL A CG1   1 
ATOM   3648  C  CG2   . VAL A 1  553  ? 134.778 164.231 172.080 1.00 29.10  ?  553  VAL A CG2   1 
ATOM   3649  N  N     . LYS A 1  554  ? 135.588 161.179 170.887 1.00 13.16  ?  554  LYS A N     1 
ATOM   3650  C  CA    . LYS A 1  554  ? 135.500 160.403 169.664 1.00 13.16  ?  554  LYS A CA    1 
ATOM   3651  C  C     . LYS A 1  554  ? 135.920 158.954 169.884 1.00 13.16  ?  554  LYS A C     1 
ATOM   3652  O  O     . LYS A 1  554  ? 135.280 158.031 169.360 1.00 13.16  ?  554  LYS A O     1 
ATOM   3653  C  CB    . LYS A 1  554  ? 136.344 161.088 168.602 1.00 13.16  ?  554  LYS A CB    1 
ATOM   3654  C  CG    . LYS A 1  554  ? 136.017 162.571 168.510 1.00 13.16  ?  554  LYS A CG    1 
ATOM   3655  C  CD    . LYS A 1  554  ? 137.138 163.386 167.909 1.00 13.16  ?  554  LYS A CD    1 
ATOM   3656  C  CE    . LYS A 1  554  ? 137.558 162.844 166.573 1.00 13.16  ?  554  LYS A CE    1 
ATOM   3657  N  NZ    . LYS A 1  554  ? 138.851 163.414 166.158 1.00 13.16  1  554  LYS A NZ    1 
ATOM   3658  N  N     . VAL A 1  555  ? 136.958 158.724 170.691 1.00 27.11  ?  555  VAL A N     1 
ATOM   3659  C  CA    . VAL A 1  555  ? 137.398 157.349 170.921 1.00 27.11  ?  555  VAL A CA    1 
ATOM   3660  C  C     . VAL A 1  555  ? 136.489 156.648 171.937 1.00 27.11  ?  555  VAL A C     1 
ATOM   3661  O  O     . VAL A 1  555  ? 136.239 155.440 171.819 1.00 27.11  ?  555  VAL A O     1 
ATOM   3662  C  CB    . VAL A 1  555  ? 138.900 157.324 171.300 1.00 27.11  ?  555  VAL A CB    1 
ATOM   3663  C  CG1   . VAL A 1  555  ? 139.182 158.052 172.583 1.00 27.11  ?  555  VAL A CG1   1 
ATOM   3664  C  CG2   . VAL A 1  555  ? 139.436 155.899 171.362 1.00 27.11  ?  555  VAL A CG2   1 
ATOM   3665  N  N     . VAL A 1  556  ? 135.910 157.401 172.881 1.00 24.92  ?  556  VAL A N     1 
ATOM   3666  C  CA    . VAL A 1  556  ? 134.841 156.875 173.733 1.00 24.92  ?  556  VAL A CA    1 
ATOM   3667  C  C     . VAL A 1  556  ? 133.638 156.456 172.893 1.00 24.92  ?  556  VAL A C     1 
ATOM   3668  O  O     . VAL A 1  556  ? 133.072 155.371 173.087 1.00 24.92  ?  556  VAL A O     1 
ATOM   3669  C  CB    . VAL A 1  556  ? 134.453 157.915 174.804 1.00 24.92  ?  556  VAL A CB    1 
ATOM   3670  C  CG1   . VAL A 1  556  ? 133.188 157.526 175.529 1.00 24.92  ?  556  VAL A CG1   1 
ATOM   3671  C  CG2   . VAL A 1  556  ? 135.554 158.045 175.822 1.00 24.92  ?  556  VAL A CG2   1 
ATOM   3672  N  N     . SER A 1  557  ? 133.257 157.300 171.924 1.00 20.00  ?  557  SER A N     1 
ATOM   3673  C  CA    . SER A 1  557  ? 132.113 157.017 171.065 1.00 20.00  ?  557  SER A CA    1 
ATOM   3674  C  C     . SER A 1  557  ? 132.327 155.763 170.226 1.00 20.00  ?  557  SER A C     1 
ATOM   3675  O  O     . SER A 1  557  ? 131.456 154.886 170.181 1.00 20.00  ?  557  SER A O     1 
ATOM   3676  C  CB    . SER A 1  557  ? 131.841 158.222 170.171 1.00 20.00  ?  557  SER A CB    1 
ATOM   3677  O  OG    . SER A 1  557  ? 130.756 157.976 169.310 1.00 20.00  ?  557  SER A OG    1 
ATOM   3678  N  N     . GLN A 1  558  ? 133.493 155.646 169.579 1.00 21.38  ?  558  GLN A N     1 
ATOM   3679  C  CA    . GLN A 1  558  ? 133.765 154.468 168.757 1.00 21.38  ?  558  GLN A CA    1 
ATOM   3680  C  C     . GLN A 1  558  ? 133.885 153.195 169.591 1.00 21.38  ?  558  GLN A C     1 
ATOM   3681  O  O     . GLN A 1  558  ? 133.448 152.122 169.148 1.00 21.38  ?  558  GLN A O     1 
ATOM   3682  C  CB    . GLN A 1  558  ? 135.033 154.678 167.937 1.00 21.38  ?  558  GLN A CB    1 
ATOM   3683  C  CG    . GLN A 1  558  ? 134.973 155.828 166.954 1.00 21.38  ?  558  GLN A CG    1 
ATOM   3684  C  CD    . GLN A 1  558  ? 136.338 156.212 166.388 1.00 21.38  ?  558  GLN A CD    1 
ATOM   3685  O  OE1   . GLN A 1  558  ? 137.381 155.782 166.873 1.00 21.38  ?  558  GLN A OE1   1 
ATOM   3686  N  NE2   . GLN A 1  558  ? 136.326 157.036 165.355 1.00 21.38  ?  558  GLN A NE2   1 
ATOM   3687  N  N     . LEU A 1  559  ? 134.417 153.293 170.815 1.00 24.72  ?  559  LEU A N     1 
ATOM   3688  C  CA    . LEU A 1  559  ? 134.539 152.101 171.649 1.00 24.72  ?  559  LEU A CA    1 
ATOM   3689  C  C     . LEU A 1  559  ? 133.179 151.626 172.159 1.00 24.72  ?  559  LEU A C     1 
ATOM   3690  O  O     . LEU A 1  559  ? 132.921 150.418 172.207 1.00 24.72  ?  559  LEU A O     1 
ATOM   3691  C  CB    . LEU A 1  559  ? 135.492 152.379 172.806 1.00 24.72  ?  559  LEU A CB    1 
ATOM   3692  C  CG    . LEU A 1  559  ? 135.757 151.278 173.823 1.00 24.72  ?  559  LEU A CG    1 
ATOM   3693  C  CD1   . LEU A 1  559  ? 136.755 150.282 173.291 1.00 24.72  ?  559  LEU A CD1   1 
ATOM   3694  C  CD2   . LEU A 1  559  ? 136.261 151.914 175.096 1.00 24.72  ?  559  LEU A CD2   1 
ATOM   3695  N  N     . LEU A 1  560  ? 132.291 152.557 172.519 1.00 21.40  ?  560  LEU A N     1 
ATOM   3696  C  CA    . LEU A 1  560  ? 130.931 152.178 172.892 1.00 21.40  ?  560  LEU A CA    1 
ATOM   3697  C  C     . LEU A 1  560  ? 130.169 151.574 171.720 1.00 21.40  ?  560  LEU A C     1 
ATOM   3698  O  O     . LEU A 1  560  ? 129.431 150.599 171.892 1.00 21.40  ?  560  LEU A O     1 
ATOM   3699  C  CB    . LEU A 1  560  ? 130.172 153.383 173.432 1.00 21.40  ?  560  LEU A CB    1 
ATOM   3700  C  CG    . LEU A 1  560  ? 130.399 153.707 174.901 1.00 21.40  ?  560  LEU A CG    1 
ATOM   3701  C  CD1   . LEU A 1  560  ? 129.485 154.822 175.334 1.00 21.40  ?  560  LEU A CD1   1 
ATOM   3702  C  CD2   . LEU A 1  560  ? 130.178 152.479 175.748 1.00 21.40  ?  560  LEU A CD2   1 
ATOM   3703  N  N     . ARG A 1  561  ? 130.331 152.140 170.519 1.00 20.74  ?  561  ARG A N     1 
ATOM   3704  C  CA    . ARG A 1  561  ? 129.655 151.598 169.343 1.00 20.74  ?  561  ARG A CA    1 
ATOM   3705  C  C     . ARG A 1  561  ? 130.176 150.221 168.962 1.00 20.74  ?  561  ARG A C     1 
ATOM   3706  O  O     . ARG A 1  561  ? 129.447 149.440 168.348 1.00 20.74  ?  561  ARG A O     1 
ATOM   3707  C  CB    . ARG A 1  561  ? 129.806 152.543 168.160 1.00 20.74  ?  561  ARG A CB    1 
ATOM   3708  C  CG    . ARG A 1  561  ? 129.047 153.827 168.298 1.00 20.74  ?  561  ARG A CG    1 
ATOM   3709  C  CD    . ARG A 1  561  ? 129.415 154.760 167.188 1.00 20.74  ?  561  ARG A CD    1 
ATOM   3710  N  NE    . ARG A 1  561  ? 128.803 156.065 167.339 1.00 20.74  ?  561  ARG A NE    1 
ATOM   3711  C  CZ    . ARG A 1  561  ? 127.605 156.367 166.871 1.00 20.74  ?  561  ARG A CZ    1 
ATOM   3712  N  NH1   . ARG A 1  561  ? 127.112 157.579 167.037 1.00 20.74  1  561  ARG A NH1   1 
ATOM   3713  N  NH2   . ARG A 1  561  ? 126.906 155.451 166.231 1.00 20.74  ?  561  ARG A NH2   1 
ATOM   3714  N  N     . GLN A 1  562  ? 131.423 149.902 169.294 1.00 30.10  ?  562  GLN A N     1 
ATOM   3715  C  CA    . GLN A 1  562  ? 131.890 148.535 169.093 1.00 30.10  ?  562  GLN A CA    1 
ATOM   3716  C  C     . GLN A 1  562  ? 131.583 147.619 170.267 1.00 30.10  ?  562  GLN A C     1 
ATOM   3717  O  O     . GLN A 1  562  ? 131.700 146.397 170.121 1.00 30.10  ?  562  GLN A O     1 
ATOM   3718  C  CB    . GLN A 1  562  ? 133.397 148.509 168.838 1.00 30.10  ?  562  GLN A CB    1 
ATOM   3719  C  CG    . GLN A 1  562  ? 133.829 149.179 167.563 1.00 30.10  ?  562  GLN A CG    1 
ATOM   3720  C  CD    . GLN A 1  562  ? 133.614 148.306 166.354 1.00 30.10  ?  562  GLN A CD    1 
ATOM   3721  O  OE1   . GLN A 1  562  ? 133.417 147.101 166.477 1.00 30.10  ?  562  GLN A OE1   1 
ATOM   3722  N  NE2   . GLN A 1  562  ? 133.664 148.907 165.176 1.00 30.10  ?  562  GLN A NE2   1 
ATOM   3723  N  N     . ALA A 1  563  ? 131.204 148.171 171.421 1.00 34.53  ?  563  ALA A N     1 
ATOM   3724  C  CA    . ALA A 1  563  ? 130.959 147.366 172.613 1.00 34.53  ?  563  ALA A CA    1 
ATOM   3725  C  C     . ALA A 1  563  ? 129.546 146.812 172.701 1.00 34.53  ?  563  ALA A C     1 
ATOM   3726  O  O     . ALA A 1  563  ? 129.330 145.834 173.421 1.00 34.53  ?  563  ALA A O     1 
ATOM   3727  C  CB    . ALA A 1  563  ? 131.243 148.181 173.875 1.00 34.53  ?  563  ALA A CB    1 
ATOM   3728  N  N     . MET A 1  564  ? 128.582 147.402 172.004 1.00 49.71  ?  564  MET A N     1 
ATOM   3729  C  CA    . MET A 1  564  ? 127.215 146.905 172.049 1.00 49.71  ?  564  MET A CA    1 
ATOM   3730  C  C     . MET A 1  564  ? 127.040 145.619 171.245 1.00 49.71  ?  564  MET A C     1 
ATOM   3731  O  O     . MET A 1  564  ? 126.048 144.908 171.430 1.00 49.71  ?  564  MET A O     1 
ATOM   3732  C  CB    . MET A 1  564  ? 126.273 148.019 171.565 1.00 49.71  ?  564  MET A CB    1 
ATOM   3733  C  CG    . MET A 1  564  ? 124.789 147.808 171.821 1.00 49.71  ?  564  MET A CG    1 
ATOM   3734  S  SD    . MET A 1  564  ? 123.787 149.307 171.759 1.00 49.71  ?  564  MET A SD    1 
ATOM   3735  C  CE    . MET A 1  564  ? 123.865 149.830 173.465 1.00 49.71  ?  564  MET A CE    1 
ATOM   3736  N  N     . HIS A 1  565  ? 128.007 145.264 170.413 1.00 53.92  ?  565  HIS A N     1 
ATOM   3737  C  CA    . HIS A 1  565  ? 127.841 144.140 169.508 1.00 53.92  ?  565  HIS A CA    1 
ATOM   3738  C  C     . HIS A 1  565  ? 128.318 142.815 170.081 1.00 53.92  ?  565  HIS A C     1 
ATOM   3739  O  O     . HIS A 1  565  ? 128.121 141.777 169.441 1.00 53.92  ?  565  HIS A O     1 
ATOM   3740  C  CB    . HIS A 1  565  ? 128.570 144.422 168.192 1.00 53.92  ?  565  HIS A CB    1 
ATOM   3741  C  CG    . HIS A 1  565  ? 128.121 145.683 167.518 1.00 53.92  ?  565  HIS A CG    1 
ATOM   3742  N  ND1   . HIS A 1  565  ? 128.887 146.341 166.582 1.00 53.92  ?  565  HIS A ND1   1 
ATOM   3743  C  CD2   . HIS A 1  565  ? 126.980 146.401 167.640 1.00 53.92  ?  565  HIS A CD2   1 
ATOM   3744  C  CE1   . HIS A 1  565  ? 128.242 147.414 166.162 1.00 53.92  ?  565  HIS A CE1   1 
ATOM   3745  N  NE2   . HIS A 1  565  ? 127.082 147.474 166.789 1.00 53.92  ?  565  HIS A NE2   1 
ATOM   3746  N  N     . GLU A 1  566  ? 128.944 142.811 171.257 1.00 49.04  ?  566  GLU A N     1 
ATOM   3747  C  CA    . GLU A 1  566  ? 129.310 141.576 171.942 1.00 49.04  ?  566  GLU A CA    1 
ATOM   3748  C  C     . GLU A 1  566  ? 128.819 141.533 173.382 1.00 49.04  ?  566  GLU A C     1 
ATOM   3749  O  O     . GLU A 1  566  ? 129.011 140.516 174.056 1.00 49.04  ?  566  GLU A O     1 
ATOM   3750  C  CB    . GLU A 1  566  ? 130.830 141.363 171.915 1.00 49.04  ?  566  GLU A CB    1 
ATOM   3751  C  CG    . GLU A 1  566  ? 131.458 141.351 170.527 1.00 49.04  ?  566  GLU A CG    1 
ATOM   3752  C  CD    . GLU A 1  566  ? 132.814 140.665 170.494 1.00 49.04  ?  566  GLU A CD    1 
ATOM   3753  O  OE1   . GLU A 1  566  ? 133.037 139.759 171.324 1.00 49.04  ?  566  GLU A OE1   1 
ATOM   3754  O  OE2   . GLU A 1  566  ? 133.655 141.034 169.645 1.00 49.04  -1 566  GLU A OE2   1 
ATOM   3755  N  N     . GLY A 1  567  ? 128.195 142.604 173.869 1.00 39.87  ?  567  GLY A N     1 
ATOM   3756  C  CA    . GLY A 1  567  ? 127.648 142.635 175.210 1.00 39.87  ?  567  GLY A CA    1 
ATOM   3757  C  C     . GLY A 1  567  ? 128.669 142.788 176.318 1.00 39.87  ?  567  GLY A C     1 
ATOM   3758  O  O     . GLY A 1  567  ? 128.836 141.879 177.135 1.00 39.87  ?  567  GLY A O     1 
ATOM   3759  N  N     . LEU A 1  568  ? 129.363 143.920 176.356 1.00 36.07  ?  568  LEU A N     1 
ATOM   3760  C  CA    . LEU A 1  568  ? 130.258 144.257 177.450 1.00 36.07  ?  568  LEU A CA    1 
ATOM   3761  C  C     . LEU A 1  568  ? 129.863 145.607 178.024 1.00 36.07  ?  568  LEU A C     1 
ATOM   3762  O  O     . LEU A 1  568  ? 129.230 146.424 177.356 1.00 36.07  ?  568  LEU A O     1 
ATOM   3763  C  CB    . LEU A 1  568  ? 131.722 144.313 177.004 1.00 36.07  ?  568  LEU A CB    1 
ATOM   3764  C  CG    . LEU A 1  568  ? 132.239 143.249 176.055 1.00 36.07  ?  568  LEU A CG    1 
ATOM   3765  C  CD1   . LEU A 1  568  ? 133.520 143.733 175.444 1.00 36.07  ?  568  LEU A CD1   1 
ATOM   3766  C  CD2   . LEU A 1  568  ? 132.466 141.945 176.765 1.00 36.07  ?  568  LEU A CD2   1 
ATOM   3767  N  N     . LEU A 1  569  ? 130.252 145.839 179.268 1.00 36.88  ?  569  LEU A N     1 
ATOM   3768  C  CA    . LEU A 1  569  ? 130.051 147.122 179.913 1.00 36.88  ?  569  LEU A CA    1 
ATOM   3769  C  C     . LEU A 1  569  ? 131.400 147.703 180.301 1.00 36.88  ?  569  LEU A C     1 
ATOM   3770  O  O     . LEU A 1  569  ? 132.340 146.965 180.609 1.00 36.88  ?  569  LEU A O     1 
ATOM   3771  C  CB    . LEU A 1  569  ? 129.151 146.991 181.145 1.00 36.88  ?  569  LEU A CB    1 
ATOM   3772  C  CG    . LEU A 1  569  ? 127.642 147.059 180.907 1.00 36.88  ?  569  LEU A CG    1 
ATOM   3773  C  CD1   . LEU A 1  569  ? 126.908 146.400 182.034 1.00 36.88  ?  569  LEU A CD1   1 
ATOM   3774  C  CD2   . LEU A 1  569  ? 127.207 148.493 180.794 1.00 36.88  ?  569  LEU A CD2   1 
ATOM   3775  N  N     . MET A 1  570  ? 131.492 149.036 180.287 1.00 45.79  ?  570  MET A N     1 
ATOM   3776  C  CA    . MET A 1  570  ? 132.750 149.692 180.599 1.00 45.79  ?  570  MET A CA    1 
ATOM   3777  C  C     . MET A 1  570  ? 132.829 150.013 182.082 1.00 45.79  ?  570  MET A C     1 
ATOM   3778  O  O     . MET A 1  570  ? 131.801 150.306 182.705 1.00 45.79  ?  570  MET A O     1 
ATOM   3779  C  CB    . MET A 1  570  ? 132.932 150.975 179.768 1.00 45.79  ?  570  MET A CB    1 
ATOM   3780  C  CG    . MET A 1  570  ? 132.158 152.215 180.208 1.00 45.79  ?  570  MET A CG    1 
ATOM   3781  S  SD    . MET A 1  570  ? 132.726 153.707 179.372 1.00 45.79  ?  570  MET A SD    1 
ATOM   3782  C  CE    . MET A 1  570  ? 131.867 154.976 180.299 1.00 45.79  ?  570  MET A CE    1 
ATOM   3783  N  N     . PRO A 1  571  ? 133.996 149.897 182.703 1.00 44.29  ?  571  PRO A N     1 
ATOM   3784  C  CA    . PRO A 1  571  ? 134.133 150.284 184.108 1.00 44.29  ?  571  PRO A CA    1 
ATOM   3785  C  C     . PRO A 1  571  ? 134.605 151.720 184.259 1.00 44.29  ?  571  PRO A C     1 
ATOM   3786  O  O     . PRO A 1  571  ? 134.917 152.410 183.291 1.00 44.29  ?  571  PRO A O     1 
ATOM   3787  C  CB    . PRO A 1  571  ? 135.191 149.308 184.636 1.00 44.29  ?  571  PRO A CB    1 
ATOM   3788  C  CG    . PRO A 1  571  ? 136.001 148.984 183.457 1.00 44.29  ?  571  PRO A CG    1 
ATOM   3789  C  CD    . PRO A 1  571  ? 135.111 149.051 182.256 1.00 44.29  ?  571  PRO A CD    1 
ATOM   3790  N  N     . VAL A 1  572  ? 134.643 152.164 185.507 1.00 52.25  ?  572  VAL A N     1 
ATOM   3791  C  CA    . VAL A 1  572  ? 135.123 153.496 185.851 1.00 52.25  ?  572  VAL A CA    1 
ATOM   3792  C  C     . VAL A 1  572  ? 136.346 153.336 186.742 1.00 52.25  ?  572  VAL A C     1 
ATOM   3793  O  O     . VAL A 1  572  ? 136.214 153.116 187.952 1.00 52.25  ?  572  VAL A O     1 
ATOM   3794  C  CB    . VAL A 1  572  ? 134.043 154.337 186.548 1.00 52.25  ?  572  VAL A CB    1 
ATOM   3795  C  CG1   . VAL A 1  572  ? 134.516 155.764 186.718 1.00 52.25  ?  572  VAL A CG1   1 
ATOM   3796  C  CG2   . VAL A 1  572  ? 132.748 154.303 185.770 1.00 52.25  ?  572  VAL A CG2   1 
ATOM   3797  N  N     . VAL A 1  573  ? 137.542 153.449 186.162 1.00 59.94  ?  573  VAL A N     1 
ATOM   3798  C  CA    . VAL A 1  573  ? 138.767 153.521 186.948 1.00 59.94  ?  573  VAL A CA    1 
ATOM   3799  C  C     . VAL A 1  573  ? 139.296 154.949 186.867 1.00 59.94  ?  573  VAL A C     1 
ATOM   3800  O  O     . VAL A 1  573  ? 139.272 155.582 185.805 1.00 59.94  ?  573  VAL A O     1 
ATOM   3801  C  CB    . VAL A 1  573  ? 139.832 152.474 186.515 1.00 59.94  ?  573  VAL A CB    1 
ATOM   3802  C  CG1   . VAL A 1  573  ? 139.286 151.059 186.671 1.00 59.94  ?  573  VAL A CG1   1 
ATOM   3803  C  CG2   . VAL A 1  573  ? 140.353 152.667 185.108 1.00 59.94  ?  573  VAL A CG2   1 
ATOM   3804  N  N     . LYS A 1  574  ? 139.689 155.486 188.017 1.00 84.71  ?  574  LYS A N     1 
ATOM   3805  C  CA    . LYS A 1  574  ? 140.224 156.836 188.114 1.00 84.71  ?  574  LYS A CA    1 
ATOM   3806  C  C     . LYS A 1  574  ? 141.306 156.835 189.177 1.00 84.71  ?  574  LYS A C     1 
ATOM   3807  O  O     . LYS A 1  574  ? 141.080 156.360 190.293 1.00 84.71  ?  574  LYS A O     1 
ATOM   3808  C  CB    . LYS A 1  574  ? 139.135 157.860 188.458 1.00 84.71  ?  574  LYS A CB    1 
ATOM   3809  C  CG    . LYS A 1  574  ? 139.604 159.310 188.399 1.00 84.71  ?  574  LYS A CG    1 
ATOM   3810  C  CD    . LYS A 1  574  ? 139.882 159.749 186.967 1.00 84.71  ?  574  LYS A CD    1 
ATOM   3811  C  CE    . LYS A 1  574  ? 140.787 160.967 186.912 1.00 84.71  ?  574  LYS A CE    1 
ATOM   3812  N  NZ    . LYS A 1  574  ? 142.136 160.699 187.474 1.00 84.71  1  574  LYS A NZ    1 
ATOM   3813  N  N     . SER A 1  575  ? 142.477 157.357 188.827 1.00 99.46  ?  575  SER A N     1 
ATOM   3814  C  CA    . SER A 1  575  ? 143.638 157.289 189.700 1.00 99.46  ?  575  SER A CA    1 
ATOM   3815  C  C     . SER A 1  575  ? 144.452 158.566 189.565 1.00 99.46  ?  575  SER A C     1 
ATOM   3816  O  O     . SER A 1  575  ? 144.652 159.064 188.453 1.00 99.46  ?  575  SER A O     1 
ATOM   3817  C  CB    . SER A 1  575  ? 144.501 156.061 189.377 1.00 99.46  ?  575  SER A CB    1 
ATOM   3818  O  OG    . SER A 1  575  ? 144.661 155.881 187.979 1.00 99.46  ?  575  SER A OG    1 
ATOM   3819  N  N     . GLU A 1  576  ? 144.890 159.106 190.700 1.00 109.39 ?  576  GLU A N     1 
ATOM   3820  C  CA    . GLU A 1  576  ? 145.775 160.266 190.745 1.00 109.39 ?  576  GLU A CA    1 
ATOM   3821  C  C     . GLU A 1  576  ? 146.861 159.984 191.775 1.00 109.39 ?  576  GLU A C     1 
ATOM   3822  O  O     . GLU A 1  576  ? 146.617 160.109 192.980 1.00 109.39 ?  576  GLU A O     1 
ATOM   3823  C  CB    . GLU A 1  576  ? 145.018 161.549 191.097 1.00 109.39 ?  576  GLU A CB    1 
ATOM   3824  C  CG    . GLU A 1  576  ? 143.963 161.970 190.091 1.00 109.39 ?  576  GLU A CG    1 
ATOM   3825  C  CD    . GLU A 1  576  ? 143.965 163.463 189.835 1.00 109.39 ?  576  GLU A CD    1 
ATOM   3826  O  OE1   . GLU A 1  576  ? 144.471 164.216 190.691 1.00 109.39 ?  576  GLU A OE1   1 
ATOM   3827  O  OE2   . GLU A 1  576  ? 143.465 163.882 188.772 1.00 109.39 -1 576  GLU A OE2   1 
ATOM   3828  N  N     . GLY A 1  577  ? 148.055 159.604 191.319 1.00 99.11  ?  577  GLY A N     1 
ATOM   3829  C  CA    . GLY A 1  577  ? 148.355 159.379 189.915 1.00 99.11  ?  577  GLY A CA    1 
ATOM   3830  C  C     . GLY A 1  577  ? 149.503 158.405 189.762 1.00 99.11  ?  577  GLY A C     1 
ATOM   3831  O  O     . GLY A 1  577  ? 150.333 158.275 190.662 1.00 99.11  ?  577  GLY A O     1 
ATOM   3832  N  N     . GLY A 1  578  ? 149.557 157.717 188.621 1.00 83.22  ?  578  GLY A N     1 
ATOM   3833  C  CA    . GLY A 1  578  ? 150.620 156.780 188.338 1.00 83.22  ?  578  GLY A CA    1 
ATOM   3834  C  C     . GLY A 1  578  ? 151.935 157.474 188.003 1.00 83.22  ?  578  GLY A C     1 
ATOM   3835  O  O     . GLY A 1  578  ? 152.102 158.684 188.134 1.00 83.22  ?  578  GLY A O     1 
ATOM   3836  N  N     . GLU A 1  579  ? 152.886 156.670 187.555 1.00 68.41  ?  579  GLU A N     1 
ATOM   3837  C  CA    . GLU A 1  579  ? 154.179 157.195 187.161 1.00 68.41  ?  579  GLU A CA    1 
ATOM   3838  C  C     . GLU A 1  579  ? 154.328 157.169 185.645 1.00 68.41  ?  579  GLU A C     1 
ATOM   3839  O  O     . GLU A 1  579  ? 153.479 156.657 184.912 1.00 68.41  ?  579  GLU A O     1 
ATOM   3840  C  CB    . GLU A 1  579  ? 155.309 156.404 187.825 1.00 68.41  ?  579  GLU A CB    1 
ATOM   3841  C  CG    . GLU A 1  579  ? 155.363 154.937 187.445 1.00 68.41  ?  579  GLU A CG    1 
ATOM   3842  C  CD    . GLU A 1  579  ? 156.681 154.294 187.832 1.00 68.41  ?  579  GLU A CD    1 
ATOM   3843  O  OE1   . GLU A 1  579  ? 157.731 154.951 187.660 1.00 68.41  ?  579  GLU A OE1   1 
ATOM   3844  O  OE2   . GLU A 1  579  ? 156.667 153.141 188.308 1.00 68.41  -1 579  GLU A OE2   1 
ATOM   3845  N  N     . ASP A 1  580  ? 155.421 157.752 185.178 1.00 50.34  ?  580  ASP A N     1 
ATOM   3846  C  CA    . ASP A 1  580  ? 155.746 157.685 183.768 1.00 50.34  ?  580  ASP A CA    1 
ATOM   3847  C  C     . ASP A 1  580  ? 156.342 156.320 183.441 1.00 50.34  ?  580  ASP A C     1 
ATOM   3848  O  O     . ASP A 1  580  ? 156.699 155.538 184.325 1.00 50.34  ?  580  ASP A O     1 
ATOM   3849  C  CB    . ASP A 1  580  ? 156.713 158.809 183.390 1.00 50.34  ?  580  ASP A CB    1 
ATOM   3850  C  CG    . ASP A 1  580  ? 156.705 159.116 181.907 1.00 50.34  ?  580  ASP A CG    1 
ATOM   3851  O  OD1   . ASP A 1  580  ? 155.931 158.457 181.184 1.00 50.34  ?  580  ASP A OD1   1 
ATOM   3852  O  OD2   . ASP A 1  580  ? 157.471 159.996 181.467 1.00 50.34  -1 580  ASP A OD2   1 
ATOM   3853  N  N     . TYR A 1  581  ? 156.412 156.030 182.153 1.00 38.20  ?  581  TYR A N     1 
ATOM   3854  C  CA    . TYR A 1  581  ? 157.071 154.853 181.621 1.00 38.20  ?  581  TYR A CA    1 
ATOM   3855  C  C     . TYR A 1  581  ? 158.103 155.307 180.595 1.00 38.20  ?  581  TYR A C     1 
ATOM   3856  O  O     . TYR A 1  581  ? 158.234 156.494 180.302 1.00 38.20  ?  581  TYR A O     1 
ATOM   3857  C  CB    . TYR A 1  581  ? 156.047 153.864 181.037 1.00 38.20  ?  581  TYR A CB    1 
ATOM   3858  C  CG    . TYR A 1  581  ? 155.264 154.326 179.820 1.00 38.20  ?  581  TYR A CG    1 
ATOM   3859  C  CD1   . TYR A 1  581  ? 154.285 155.309 179.918 1.00 38.20  ?  581  TYR A CD1   1 
ATOM   3860  C  CD2   . TYR A 1  581  ? 155.481 153.744 178.581 1.00 38.20  ?  581  TYR A CD2   1 
ATOM   3861  C  CE1   . TYR A 1  581  ? 153.586 155.717 178.824 1.00 38.20  ?  581  TYR A CE1   1 
ATOM   3862  C  CE2   . TYR A 1  581  ? 154.775 154.144 177.476 1.00 38.20  ?  581  TYR A CE2   1 
ATOM   3863  C  CZ    . TYR A 1  581  ? 153.834 155.132 177.607 1.00 38.20  ?  581  TYR A CZ    1 
ATOM   3864  O  OH    . TYR A 1  581  ? 153.115 155.541 176.515 1.00 38.20  ?  581  TYR A OH    1 
ATOM   3865  N  N     . THR A 1  582  ? 158.847 154.354 180.051 1.00 35.69  ?  582  THR A N     1 
ATOM   3866  C  CA    . THR A 1  582  ? 159.959 154.674 179.173 1.00 35.69  ?  582  THR A CA    1 
ATOM   3867  C  C     . THR A 1  582  ? 159.482 154.772 177.727 1.00 35.69  ?  582  THR A C     1 
ATOM   3868  O  O     . THR A 1  582  ? 158.840 153.849 177.218 1.00 35.69  ?  582  THR A O     1 
ATOM   3869  C  CB    . THR A 1  582  ? 161.050 153.615 179.306 1.00 35.69  ?  582  THR A CB    1 
ATOM   3870  O  OG1   . THR A 1  582  ? 161.478 153.555 180.669 1.00 35.69  ?  582  THR A OG1   1 
ATOM   3871  C  CG2   . THR A 1  582  ? 162.243 153.976 178.451 1.00 35.69  ?  582  THR A CG2   1 
ATOM   3872  N  N     . GLY A 1  583  ? 159.804 155.884 177.070 1.00 33.00  ?  583  GLY A N     1 
ATOM   3873  C  CA    . GLY A 1  583  ? 159.408 156.100 175.692 1.00 33.00  ?  583  GLY A CA    1 
ATOM   3874  C  C     . GLY A 1  583  ? 160.320 155.468 174.663 1.00 33.00  ?  583  GLY A C     1 
ATOM   3875  O  O     . GLY A 1  583  ? 160.745 154.322 174.819 1.00 33.00  ?  583  GLY A O     1 
ATOM   3876  N  N     . ALA A 1  584  ? 160.642 156.214 173.617 1.00 32.51  ?  584  ALA A N     1 
ATOM   3877  C  CA    . ALA A 1  584  ? 161.245 155.679 172.405 1.00 32.51  ?  584  ALA A CA    1 
ATOM   3878  C  C     . ALA A 1  584  ? 162.766 155.799 172.415 1.00 32.51  ?  584  ALA A C     1 
ATOM   3879  O  O     . ALA A 1  584  ? 163.340 156.679 173.056 1.00 32.51  ?  584  ALA A O     1 
ATOM   3880  C  CB    . ALA A 1  584  ? 160.683 156.407 171.186 1.00 32.51  ?  584  ALA A CB    1 
ATOM   3881  N  N     . THR A 1  585  ? 163.413 154.905 171.668 1.00 34.98  ?  585  THR A N     1 
ATOM   3882  C  CA    . THR A 1  585  ? 164.865 154.926 171.527 1.00 34.98  ?  585  THR A CA    1 
ATOM   3883  C  C     . THR A 1  585  ? 165.284 155.805 170.347 1.00 34.98  ?  585  THR A C     1 
ATOM   3884  O  O     . THR A 1  585  ? 164.537 155.972 169.378 1.00 34.98  ?  585  THR A O     1 
ATOM   3885  C  CB    . THR A 1  585  ? 165.427 153.501 171.383 1.00 34.98  ?  585  THR A CB    1 
ATOM   3886  O  OG1   . THR A 1  585  ? 166.848 153.517 171.551 1.00 34.98  ?  585  THR A OG1   1 
ATOM   3887  C  CG2   . THR A 1  585  ? 165.113 152.889 170.043 1.00 34.98  ?  585  THR A CG2   1 
ATOM   3888  N  N     . VAL A 1  586  ? 166.450 156.437 170.478 1.00 29.07  ?  586  VAL A N     1 
ATOM   3889  C  CA    . VAL A 1  586  ? 167.131 157.117 169.385 1.00 29.07  ?  586  VAL A CA    1 
ATOM   3890  C  C     . VAL A 1  586  ? 168.519 156.500 169.272 1.00 29.07  ?  586  VAL A C     1 
ATOM   3891  O  O     . VAL A 1  586  ? 169.164 156.231 170.291 1.00 29.07  ?  586  VAL A O     1 
ATOM   3892  C  CB    . VAL A 1  586  ? 167.210 158.641 169.614 1.00 29.07  ?  586  VAL A CB    1 
ATOM   3893  C  CG1   . VAL A 1  586  ? 167.698 159.349 168.372 1.00 29.07  ?  586  VAL A CG1   1 
ATOM   3894  C  CG2   . VAL A 1  586  ? 165.867 159.215 170.018 1.00 29.07  ?  586  VAL A CG2   1 
ATOM   3895  N  N     . ILE A 1  587  ? 168.967 156.240 168.041 1.00 30.04  ?  587  ILE A N     1 
ATOM   3896  C  CA    . ILE A 1  587  ? 170.286 155.652 167.828 1.00 30.04  ?  587  ILE A CA    1 
ATOM   3897  C  C     . ILE A 1  587  ? 171.337 156.761 167.764 1.00 30.04  ?  587  ILE A C     1 
ATOM   3898  O  O     . ILE A 1  587  ? 171.091 157.861 167.260 1.00 30.04  ?  587  ILE A O     1 
ATOM   3899  C  CB    . ILE A 1  587  ? 170.294 154.779 166.556 1.00 30.04  ?  587  ILE A CB    1 
ATOM   3900  C  CG1   . ILE A 1  587  ? 169.174 153.753 166.608 1.00 30.04  ?  587  ILE A CG1   1 
ATOM   3901  C  CG2   . ILE A 1  587  ? 171.597 153.999 166.381 1.00 30.04  ?  587  ILE A CG2   1 
ATOM   3902  C  CD1   . ILE A 1  587  ? 169.047 152.952 165.339 1.00 30.04  ?  587  ILE A CD1   1 
ATOM   3903  N  N     . GLU A 1  588  ? 172.517 156.471 168.315 1.00 36.69  ?  588  GLU A N     1 
ATOM   3904  C  CA    . GLU A 1  588  ? 173.601 157.448 168.363 1.00 36.69  ?  588  GLU A CA    1 
ATOM   3905  C  C     . GLU A 1  588  ? 174.154 157.727 166.970 1.00 36.69  ?  588  GLU A C     1 
ATOM   3906  O  O     . GLU A 1  588  ? 174.515 156.786 166.250 1.00 36.69  ?  588  GLU A O     1 
ATOM   3907  C  CB    . GLU A 1  588  ? 174.714 156.956 169.268 1.00 36.69  ?  588  GLU A CB    1 
ATOM   3908  C  CG    . GLU A 1  588  ? 174.504 157.277 170.726 1.00 36.69  ?  588  GLU A CG    1 
ATOM   3909  C  CD    . GLU A 1  588  ? 174.540 158.767 170.996 1.00 36.69  ?  588  GLU A CD    1 
ATOM   3910  O  OE1   . GLU A 1  588  ? 173.673 159.256 171.744 1.00 36.69  ?  588  GLU A OE1   1 
ATOM   3911  O  OE2   . GLU A 1  588  ? 175.431 159.450 170.450 1.00 36.69  -1 588  GLU A OE2   1 
ATOM   3912  N  N     . PRO A 1  589  ? 174.236 158.991 166.560 1.00 26.57  ?  589  PRO A N     1 
ATOM   3913  C  CA    . PRO A 1  589  ? 174.673 159.303 165.200 1.00 26.57  ?  589  PRO A CA    1 
ATOM   3914  C  C     . PRO A 1  589  ? 176.164 159.100 164.985 1.00 26.57  ?  589  PRO A C     1 
ATOM   3915  O  O     . PRO A 1  589  ? 176.933 158.831 165.907 1.00 26.57  ?  589  PRO A O     1 
ATOM   3916  C  CB    . PRO A 1  589  ? 174.302 160.777 165.043 1.00 26.57  ?  589  PRO A CB    1 
ATOM   3917  C  CG    . PRO A 1  589  ? 174.158 161.291 166.410 1.00 26.57  ?  589  PRO A CG    1 
ATOM   3918  C  CD    . PRO A 1  589  ? 173.665 160.165 167.234 1.00 26.57  ?  589  PRO A CD    1 
ATOM   3919  N  N     . LEU A 1  590  ? 176.546 159.201 163.720 1.00 25.23  ?  590  LEU A N     1 
ATOM   3920  C  CA    . LEU A 1  590  ? 177.913 159.470 163.294 1.00 25.23  ?  590  LEU A CA    1 
ATOM   3921  C  C     . LEU A 1  590  ? 177.845 160.837 162.626 1.00 25.23  ?  590  LEU A C     1 
ATOM   3922  O  O     . LEU A 1  590  ? 177.567 160.929 161.428 1.00 25.23  ?  590  LEU A O     1 
ATOM   3923  C  CB    . LEU A 1  590  ? 178.437 158.403 162.341 1.00 25.23  ?  590  LEU A CB    1 
ATOM   3924  C  CG    . LEU A 1  590  ? 178.294 156.918 162.688 1.00 25.23  ?  590  LEU A CG    1 
ATOM   3925  C  CD1   . LEU A 1  590  ? 179.119 156.077 161.724 1.00 25.23  ?  590  LEU A CD1   1 
ATOM   3926  C  CD2   . LEU A 1  590  ? 178.700 156.625 164.116 1.00 25.23  ?  590  LEU A CD2   1 
ATOM   3927  N  N     . LYS A 1  591  ? 178.079 161.883 163.414 1.00 28.42  ?  591  LYS A N     1 
ATOM   3928  C  CA    . LYS A 1  591  ? 177.789 163.262 163.035 1.00 28.42  ?  591  LYS A CA    1 
ATOM   3929  C  C     . LYS A 1  591  ? 178.649 163.708 161.854 1.00 28.42  ?  591  LYS A C     1 
ATOM   3930  O  O     . LYS A 1  591  ? 179.768 163.225 161.665 1.00 28.42  ?  591  LYS A O     1 
ATOM   3931  C  CB    . LYS A 1  591  ? 178.022 164.168 164.247 1.00 28.42  ?  591  LYS A CB    1 
ATOM   3932  C  CG    . LYS A 1  591  ? 177.691 165.632 164.049 1.00 28.42  ?  591  LYS A CG    1 
ATOM   3933  C  CD    . LYS A 1  591  ? 178.270 166.515 165.116 1.00 28.42  ?  591  LYS A CD    1 
ATOM   3934  C  CE    . LYS A 1  591  ? 178.186 167.963 164.682 1.00 28.42  ?  591  LYS A CE    1 
ATOM   3935  N  NZ    . LYS A 1  591  ? 178.886 168.165 163.394 1.00 28.42  1  591  LYS A NZ    1 
ATOM   3936  N  N     . GLY A 1  592  ? 178.103 164.599 161.018 1.00 32.25  ?  592  GLY A N     1 
ATOM   3937  C  CA    . GLY A 1  592  ? 178.964 165.282 160.070 1.00 32.25  ?  592  GLY A CA    1 
ATOM   3938  C  C     . GLY A 1  592  ? 178.379 165.752 158.754 1.00 32.25  ?  592  GLY A C     1 
ATOM   3939  O  O     . GLY A 1  592  ? 177.251 166.251 158.688 1.00 32.25  ?  592  GLY A O     1 
ATOM   3940  N  N     . TYR A 1  593  ? 179.181 165.625 157.702 1.00 38.67  ?  593  TYR A N     1 
ATOM   3941  C  CA    . TYR A 1  593  ? 178.802 165.936 156.333 1.00 38.67  ?  593  TYR A CA    1 
ATOM   3942  C  C     . TYR A 1  593  ? 179.084 164.700 155.510 1.00 38.67  ?  593  TYR A C     1 
ATOM   3943  O  O     . TYR A 1  593  ? 180.205 164.181 155.531 1.00 38.67  ?  593  TYR A O     1 
ATOM   3944  C  CB    . TYR A 1  593  ? 179.591 167.136 155.791 1.00 38.67  ?  593  TYR A CB    1 
ATOM   3945  C  CG    . TYR A 1  593  ? 179.452 167.427 154.306 1.00 38.67  ?  593  TYR A CG    1 
ATOM   3946  C  CD1   . TYR A 1  593  ? 178.478 168.295 153.839 1.00 38.67  ?  593  TYR A CD1   1 
ATOM   3947  C  CD2   . TYR A 1  593  ? 180.345 166.890 153.380 1.00 38.67  ?  593  TYR A CD2   1 
ATOM   3948  C  CE1   . TYR A 1  593  ? 178.363 168.582 152.492 1.00 38.67  ?  593  TYR A CE1   1 
ATOM   3949  C  CE2   . TYR A 1  593  ? 180.235 167.165 152.033 1.00 38.67  ?  593  TYR A CE2   1 
ATOM   3950  C  CZ    . TYR A 1  593  ? 179.246 168.015 151.595 1.00 38.67  ?  593  TYR A CZ    1 
ATOM   3951  O  OH    . TYR A 1  593  ? 179.152 168.289 150.253 1.00 38.67  ?  593  TYR A OH    1 
ATOM   3952  N  N     . TYR A 1  594  ? 178.077 164.225 154.792 1.00 34.76  ?  594  TYR A N     1 
ATOM   3953  C  CA    . TYR A 1  594  ? 178.204 163.049 153.957 1.00 34.76  ?  594  TYR A CA    1 
ATOM   3954  C  C     . TYR A 1  594  ? 178.016 163.457 152.509 1.00 34.76  ?  594  TYR A C     1 
ATOM   3955  O  O     . TYR A 1  594  ? 177.254 164.381 152.213 1.00 34.76  ?  594  TYR A O     1 
ATOM   3956  C  CB    . TYR A 1  594  ? 177.185 162.004 154.349 1.00 34.76  ?  594  TYR A CB    1 
ATOM   3957  C  CG    . TYR A 1  594  ? 177.590 161.211 155.559 1.00 34.76  ?  594  TYR A CG    1 
ATOM   3958  C  CD1   . TYR A 1  594  ? 177.399 161.717 156.838 1.00 34.76  ?  594  TYR A CD1   1 
ATOM   3959  C  CD2   . TYR A 1  594  ? 178.159 159.958 155.426 1.00 34.76  ?  594  TYR A CD2   1 
ATOM   3960  C  CE1   . TYR A 1  594  ? 177.757 160.994 157.946 1.00 34.76  ?  594  TYR A CE1   1 
ATOM   3961  C  CE2   . TYR A 1  594  ? 178.526 159.230 156.529 1.00 34.76  ?  594  TYR A CE2   1 
ATOM   3962  C  CZ    . TYR A 1  594  ? 178.320 159.750 157.783 1.00 34.76  ?  594  TYR A CZ    1 
ATOM   3963  O  OH    . TYR A 1  594  ? 178.692 159.011 158.876 1.00 34.76  ?  594  TYR A OH    1 
ATOM   3964  N  N     . ASP A 1  595  ? 178.712 162.762 151.607 1.00 43.73  ?  595  ASP A N     1 
ATOM   3965  C  CA    . ASP A 1  595  ? 178.626 163.055 150.184 1.00 43.73  ?  595  ASP A CA    1 
ATOM   3966  C  C     . ASP A 1  595  ? 178.544 161.769 149.383 1.00 43.73  ?  595  ASP A C     1 
ATOM   3967  O  O     . ASP A 1  595  ? 178.797 161.754 148.179 1.00 43.73  ?  595  ASP A O     1 
ATOM   3968  C  CB    . ASP A 1  595  ? 179.802 163.914 149.729 1.00 43.73  ?  595  ASP A CB    1 
ATOM   3969  C  CG    . ASP A 1  595  ? 179.423 164.848 148.613 1.00 43.73  ?  595  ASP A CG    1 
ATOM   3970  O  OD1   . ASP A 1  595  ? 178.297 164.713 148.099 1.00 43.73  ?  595  ASP A OD1   1 
ATOM   3971  O  OD2   . ASP A 1  595  ? 180.236 165.727 148.260 1.00 43.73  -1 595  ASP A OD2   1 
ATOM   3972  N  N     . VAL A 1  596  ? 178.202 160.687 150.058 1.00 46.84  ?  596  VAL A N     1 
ATOM   3973  C  CA    . VAL A 1  596  ? 177.859 159.413 149.437 1.00 46.84  ?  596  VAL A CA    1 
ATOM   3974  C  C     . VAL A 1  596  ? 176.433 159.100 149.872 1.00 46.84  ?  596  VAL A C     1 
ATOM   3975  O  O     . VAL A 1  596  ? 176.067 159.364 151.029 1.00 46.84  ?  596  VAL A O     1 
ATOM   3976  C  CB    . VAL A 1  596  ? 178.882 158.314 149.812 1.00 46.84  ?  596  VAL A CB    1 
ATOM   3977  C  CG1   . VAL A 1  596  ? 179.099 158.273 151.318 1.00 46.84  ?  596  VAL A CG1   1 
ATOM   3978  C  CG2   . VAL A 1  596  ? 178.480 156.950 149.300 1.00 46.84  ?  596  VAL A CG2   1 
ATOM   3979  N  N     . PRO A 1  597  ? 175.577 158.624 148.954 1.00 43.77  ?  597  PRO A N     1 
ATOM   3980  C  CA    . PRO A 1  597  ? 174.133 158.508 149.247 1.00 43.77  ?  597  PRO A CA    1 
ATOM   3981  C  C     . PRO A 1  597  ? 173.758 157.594 150.411 1.00 43.77  ?  597  PRO A C     1 
ATOM   3982  O  O     . PRO A 1  597  ? 174.291 156.493 150.568 1.00 43.77  ?  597  PRO A O     1 
ATOM   3983  C  CB    . PRO A 1  597  ? 173.568 157.959 147.936 1.00 43.77  ?  597  PRO A CB    1 
ATOM   3984  C  CG    . PRO A 1  597  ? 174.445 158.525 146.911 1.00 43.77  ?  597  PRO A CG    1 
ATOM   3985  C  CD    . PRO A 1  597  ? 175.818 158.639 147.501 1.00 43.77  ?  597  PRO A CD    1 
ATOM   3986  N  N     . ILE A 1  598  ? 172.810 158.079 151.219 1.00 39.71  ?  598  ILE A N     1 
ATOM   3987  C  CA    . ILE A 1  598  ? 172.214 157.351 152.336 1.00 39.71  ?  598  ILE A CA    1 
ATOM   3988  C  C     . ILE A 1  598  ? 170.749 157.096 151.999 1.00 39.71  ?  598  ILE A C     1 
ATOM   3989  O  O     . ILE A 1  598  ? 170.040 158.021 151.581 1.00 39.71  ?  598  ILE A O     1 
ATOM   3990  C  CB    . ILE A 1  598  ? 172.337 158.135 153.660 1.00 39.71  ?  598  ILE A CB    1 
ATOM   3991  C  CG1   . ILE A 1  598  ? 173.792 158.292 154.093 1.00 39.71  ?  598  ILE A CG1   1 
ATOM   3992  C  CG2   . ILE A 1  598  ? 171.575 157.485 154.773 1.00 39.71  ?  598  ILE A CG2   1 
ATOM   3993  C  CD1   . ILE A 1  598  ? 174.359 159.625 153.782 1.00 39.71  ?  598  ILE A CD1   1 
ATOM   3994  N  N     . ALA A 1  599  ? 170.298 155.851 152.184 1.00 36.20  ?  599  ALA A N     1 
ATOM   3995  C  CA    . ALA A 1  599  ? 168.928 155.445 151.897 1.00 36.20  ?  599  ALA A CA    1 
ATOM   3996  C  C     . ALA A 1  599  ? 168.121 155.268 153.178 1.00 36.20  ?  599  ALA A C     1 
ATOM   3997  O  O     . ALA A 1  599  ? 168.606 154.689 154.153 1.00 36.20  ?  599  ALA A O     1 
ATOM   3998  C  CB    . ALA A 1  599  ? 168.905 154.146 151.100 1.00 36.20  ?  599  ALA A CB    1 
ATOM   3999  N  N     . THR A 1  600  ? 166.874 155.749 153.152 1.00 31.37  ?  600  THR A N     1 
ATOM   4000  C  CA    . THR A 1  600  ? 165.981 155.772 154.308 1.00 31.37  ?  600  THR A CA    1 
ATOM   4001  C  C     . THR A 1  600  ? 164.934 154.675 154.184 1.00 31.37  ?  600  THR A C     1 
ATOM   4002  O  O     . THR A 1  600  ? 164.207 154.607 153.186 1.00 31.37  ?  600  THR A O     1 
ATOM   4003  C  CB    . THR A 1  600  ? 165.277 157.122 154.436 1.00 31.37  ?  600  THR A CB    1 
ATOM   4004  O  OG1   . THR A 1  600  ? 166.239 158.178 154.506 1.00 31.37  ?  600  THR A OG1   1 
ATOM   4005  C  CG2   . THR A 1  600  ? 164.430 157.156 155.681 1.00 31.37  ?  600  THR A CG2   1 
ATOM   4006  N  N     . LEU A 1  601  ? 164.844 153.836 155.208 1.00 32.43  ?  601  LEU A N     1 
ATOM   4007  C  CA    . LEU A 1  601  ? 163.866 152.762 155.268 1.00 32.43  ?  601  LEU A CA    1 
ATOM   4008  C  C     . LEU A 1  601  ? 163.042 152.939 156.531 1.00 32.43  ?  601  LEU A C     1 
ATOM   4009  O  O     . LEU A 1  601  ? 163.607 153.080 157.616 1.00 32.43  ?  601  LEU A O     1 
ATOM   4010  C  CB    . LEU A 1  601  ? 164.556 151.401 155.295 1.00 32.43  ?  601  LEU A CB    1 
ATOM   4011  C  CG    . LEU A 1  601  ? 165.767 151.196 154.394 1.00 32.43  ?  601  LEU A CG    1 
ATOM   4012  C  CD1   . LEU A 1  601  ? 166.328 149.826 154.650 1.00 32.43  ?  601  LEU A CD1   1 
ATOM   4013  C  CD2   . LEU A 1  601  ? 165.394 151.363 152.943 1.00 32.43  ?  601  LEU A CD2   1 
ATOM   4014  N  N     . ASP A 1  602  ? 161.718 152.932 156.411 1.00 32.94  ?  602  ASP A N     1 
ATOM   4015  C  CA    . ASP A 1  602  ? 160.943 153.117 157.627 1.00 32.94  ?  602  ASP A CA    1 
ATOM   4016  C  C     . ASP A 1  602  ? 159.698 152.247 157.624 1.00 32.94  ?  602  ASP A C     1 
ATOM   4017  O  O     . ASP A 1  602  ? 159.280 151.721 156.591 1.00 32.94  ?  602  ASP A O     1 
ATOM   4018  C  CB    . ASP A 1  602  ? 160.577 154.592 157.876 1.00 32.94  ?  602  ASP A CB    1 
ATOM   4019  C  CG    . ASP A 1  602  ? 159.706 155.196 156.811 1.00 32.94  ?  602  ASP A CG    1 
ATOM   4020  O  OD1   . ASP A 1  602  ? 159.467 154.588 155.750 1.00 32.94  ?  602  ASP A OD1   1 
ATOM   4021  O  OD2   . ASP A 1  602  ? 159.248 156.323 157.056 1.00 32.94  -1 602  ASP A OD2   1 
ATOM   4022  N  N     . PHE A 1  603  ? 159.118 152.105 158.813 1.00 30.91  ?  603  PHE A N     1 
ATOM   4023  C  CA    . PHE A 1  603  ? 157.867 151.397 158.996 1.00 30.91  ?  603  PHE A CA    1 
ATOM   4024  C  C     . PHE A 1  603  ? 156.712 152.379 158.905 1.00 30.91  ?  603  PHE A C     1 
ATOM   4025  O  O     . PHE A 1  603  ? 156.798 153.504 159.405 1.00 30.91  ?  603  PHE A O     1 
ATOM   4026  C  CB    . PHE A 1  603  ? 157.832 150.700 160.348 1.00 30.91  ?  603  PHE A CB    1 
ATOM   4027  C  CG    . PHE A 1  603  ? 158.888 149.662 160.538 1.00 30.91  ?  603  PHE A CG    1 
ATOM   4028  C  CD1   . PHE A 1  603  ? 158.723 148.391 160.030 1.00 30.91  ?  603  PHE A CD1   1 
ATOM   4029  C  CD2   . PHE A 1  603  ? 160.028 149.943 161.257 1.00 30.91  ?  603  PHE A CD2   1 
ATOM   4030  C  CE1   . PHE A 1  603  ? 159.688 147.424 160.219 1.00 30.91  ?  603  PHE A CE1   1 
ATOM   4031  C  CE2   . PHE A 1  603  ? 160.989 148.984 161.451 1.00 30.91  ?  603  PHE A CE2   1 
ATOM   4032  C  CZ    . PHE A 1  603  ? 160.816 147.719 160.926 1.00 30.91  ?  603  PHE A CZ    1 
ATOM   4033  N  N     . SER A 1  604  ? 155.629 151.941 158.272 1.00 29.06  ?  604  SER A N     1 
ATOM   4034  C  CA    . SER A 1  604  ? 154.436 152.754 158.078 1.00 29.06  ?  604  SER A CA    1 
ATOM   4035  C  C     . SER A 1  604  ? 153.330 152.295 159.017 1.00 29.06  ?  604  SER A C     1 
ATOM   4036  O  O     . SER A 1  604  ? 153.042 151.096 159.093 1.00 29.06  ?  604  SER A O     1 
ATOM   4037  C  CB    . SER A 1  604  ? 153.977 152.678 156.623 1.00 29.06  ?  604  SER A CB    1 
ATOM   4038  O  OG    . SER A 1  604  ? 153.632 151.349 156.278 1.00 29.06  ?  604  SER A OG    1 
ATOM   4039  N  N     . SER A 1  605  ? 152.707 153.259 159.709 1.00 21.72  ?  605  SER A N     1 
ATOM   4040  C  CA    . SER A 1  605  ? 151.706 153.042 160.762 1.00 21.72  ?  605  SER A CA    1 
ATOM   4041  C  C     . SER A 1  605  ? 152.205 152.040 161.806 1.00 21.72  ?  605  SER A C     1 
ATOM   4042  O  O     . SER A 1  605  ? 151.727 150.918 161.901 1.00 21.72  ?  605  SER A O     1 
ATOM   4043  C  CB    . SER A 1  605  ? 150.365 152.604 160.175 1.00 21.72  ?  605  SER A CB    1 
ATOM   4044  O  OG    . SER A 1  605  ? 149.955 153.461 159.130 1.00 21.72  ?  605  SER A OG    1 
ATOM   4045  N  N     . LEU A 1  606  ? 153.222 152.471 162.556 1.00 18.86  ?  606  LEU A N     1 
ATOM   4046  C  CA    . LEU A 1  606  ? 153.975 151.552 163.406 1.00 18.86  ?  606  LEU A CA    1 
ATOM   4047  C  C     . LEU A 1  606  ? 153.174 151.109 164.629 1.00 18.86  ?  606  LEU A C     1 
ATOM   4048  O  O     . LEU A 1  606  ? 152.950 149.910 164.838 1.00 18.86  ?  606  LEU A O     1 
ATOM   4049  C  CB    . LEU A 1  606  ? 155.294 152.199 163.829 1.00 18.86  ?  606  LEU A CB    1 
ATOM   4050  C  CG    . LEU A 1  606  ? 156.283 151.313 164.576 1.00 18.86  ?  606  LEU A CG    1 
ATOM   4051  C  CD1   . LEU A 1  606  ? 156.641 150.104 163.763 1.00 18.86  ?  606  LEU A CD1   1 
ATOM   4052  C  CD2   . LEU A 1  606  ? 157.513 152.098 164.915 1.00 18.86  ?  606  LEU A CD2   1 
ATOM   4053  N  N     . TYR A 1  607  ? 152.735 152.053 165.447 1.00 19.56  ?  607  TYR A N     1 
ATOM   4054  C  CA    . TYR A 1  607  ? 152.044 151.677 166.676 1.00 19.56  ?  607  TYR A CA    1 
ATOM   4055  C  C     . TYR A 1  607  ? 150.651 151.078 166.471 1.00 19.56  ?  607  TYR A C     1 
ATOM   4056  O  O     . TYR A 1  607  ? 150.331 150.114 167.187 1.00 19.56  ?  607  TYR A O     1 
ATOM   4057  C  CB    . TYR A 1  607  ? 151.967 152.858 167.648 1.00 19.56  ?  607  TYR A CB    1 
ATOM   4058  C  CG    . TYR A 1  607  ? 153.276 153.177 168.343 1.00 19.56  ?  607  TYR A CG    1 
ATOM   4059  C  CD1   . TYR A 1  607  ? 154.401 152.379 168.165 1.00 19.56  ?  607  TYR A CD1   1 
ATOM   4060  C  CD2   . TYR A 1  607  ? 153.376 154.266 169.191 1.00 19.56  ?  607  TYR A CD2   1 
ATOM   4061  C  CE1   . TYR A 1  607  ? 155.581 152.677 168.784 1.00 19.56  ?  607  TYR A CE1   1 
ATOM   4062  C  CE2   . TYR A 1  607  ? 154.560 154.573 169.814 1.00 19.56  ?  607  TYR A CE2   1 
ATOM   4063  C  CZ    . TYR A 1  607  ? 155.653 153.774 169.608 1.00 19.56  ?  607  TYR A CZ    1 
ATOM   4064  O  OH    . TYR A 1  607  ? 156.827 154.073 170.235 1.00 19.56  ?  607  TYR A OH    1 
ATOM   4065  N  N     . PRO A 1  608  ? 149.793 151.566 165.545 1.00 18.91  ?  608  PRO A N     1 
ATOM   4066  C  CA    . PRO A 1  608  ? 148.541 150.833 165.300 1.00 18.91  ?  608  PRO A CA    1 
ATOM   4067  C  C     . PRO A 1  608  ? 148.737 149.424 164.765 1.00 18.91  ?  608  PRO A C     1 
ATOM   4068  O  O     . PRO A 1  608  ? 147.932 148.545 165.083 1.00 18.91  ?  608  PRO A O     1 
ATOM   4069  C  CB    . PRO A 1  608  ? 147.812 151.728 164.296 1.00 18.91  ?  608  PRO A CB    1 
ATOM   4070  C  CG    . PRO A 1  608  ? 148.273 153.048 164.606 1.00 18.91  ?  608  PRO A CG    1 
ATOM   4071  C  CD    . PRO A 1  608  ? 149.714 152.881 164.869 1.00 18.91  ?  608  PRO A CD    1 
ATOM   4072  N  N     . SER A 1  609  ? 149.824 149.149 164.049 1.00 18.50  ?  609  SER A N     1 
ATOM   4073  C  CA    . SER A 1  609  ? 150.031 147.792 163.568 1.00 18.50  ?  609  SER A CA    1 
ATOM   4074  C  C     . SER A 1  609  ? 150.660 146.890 164.615 1.00 18.50  ?  609  SER A C     1 
ATOM   4075  O  O     . SER A 1  609  ? 150.470 145.670 164.558 1.00 18.50  ?  609  SER A O     1 
ATOM   4076  C  CB    . SER A 1  609  ? 150.887 147.799 162.316 1.00 18.50  ?  609  SER A CB    1 
ATOM   4077  O  OG    . SER A 1  609  ? 150.321 148.652 161.346 1.00 18.50  ?  609  SER A OG    1 
ATOM   4078  N  N     . ILE A 1  610  ? 151.416 147.457 165.560 1.00 20.67  ?  610  ILE A N     1 
ATOM   4079  C  CA    . ILE A 1  610  ? 151.817 146.697 166.747 1.00 20.67  ?  610  ILE A CA    1 
ATOM   4080  C  C     . ILE A 1  610  ? 150.583 146.278 167.541 1.00 20.67  ?  610  ILE A C     1 
ATOM   4081  O  O     . ILE A 1  610  ? 150.431 145.107 167.911 1.00 20.67  ?  610  ILE A O     1 
ATOM   4082  C  CB    . ILE A 1  610  ? 152.785 147.520 167.619 1.00 20.67  ?  610  ILE A CB    1 
ATOM   4083  C  CG1   . ILE A 1  610  ? 154.141 147.690 166.950 1.00 20.67  ?  610  ILE A CG1   1 
ATOM   4084  C  CG2   . ILE A 1  610  ? 153.002 146.870 168.971 1.00 20.67  ?  610  ILE A CG2   1 
ATOM   4085  C  CD1   . ILE A 1  610  ? 155.002 148.701 167.656 1.00 20.67  ?  610  ILE A CD1   1 
ATOM   4086  N  N     . MET A 1  611  ? 149.676 147.231 167.791 1.00 21.69  ?  611  MET A N     1 
ATOM   4087  C  CA    . MET A 1  611  ? 148.440 146.931 168.509 1.00 21.69  ?  611  MET A CA    1 
ATOM   4088  C  C     . MET A 1  611  ? 147.541 145.972 167.744 1.00 21.69  ?  611  MET A C     1 
ATOM   4089  O  O     . MET A 1  611  ? 146.755 145.246 168.354 1.00 21.69  ?  611  MET A O     1 
ATOM   4090  C  CB    . MET A 1  611  ? 147.668 148.215 168.800 1.00 21.69  ?  611  MET A CB    1 
ATOM   4091  C  CG    . MET A 1  611  ? 148.328 149.156 169.761 1.00 21.69  ?  611  MET A CG    1 
ATOM   4092  S  SD    . MET A 1  611  ? 147.096 150.085 170.670 1.00 21.69  ?  611  MET A SD    1 
ATOM   4093  C  CE    . MET A 1  611  ? 146.171 148.736 171.407 1.00 21.69  ?  611  MET A CE    1 
ATOM   4094  N  N     . MET A 1  612  ? 147.619 145.968 166.413 1.00 26.85  ?  612  MET A N     1 
ATOM   4095  C  CA    . MET A 1  612  ? 146.816 145.035 165.629 1.00 26.85  ?  612  MET A CA    1 
ATOM   4096  C  C     . MET A 1  612  ? 147.381 143.620 165.640 1.00 26.85  ?  612  MET A C     1 
ATOM   4097  O  O     . MET A 1  612  ? 146.649 142.673 165.928 1.00 26.85  ?  612  MET A O     1 
ATOM   4098  C  CB    . MET A 1  612  ? 146.699 145.521 164.191 1.00 26.85  ?  612  MET A CB    1 
ATOM   4099  C  CG    . MET A 1  612  ? 145.607 146.508 163.961 1.00 26.85  ?  612  MET A CG    1 
ATOM   4100  S  SD    . MET A 1  612  ? 145.228 146.634 162.217 1.00 26.85  ?  612  MET A SD    1 
ATOM   4101  C  CE    . MET A 1  612  ? 145.058 148.408 162.065 1.00 26.85  ?  612  MET A CE    1 
ATOM   4102  N  N     . ALA A 1  613  ? 148.665 143.448 165.328 1.00 26.11  ?  613  ALA A N     1 
ATOM   4103  C  CA    . ALA A 1  613  ? 149.171 142.133 164.961 1.00 26.11  ?  613  ALA A CA    1 
ATOM   4104  C  C     . ALA A 1  613  ? 149.733 141.322 166.116 1.00 26.11  ?  613  ALA A C     1 
ATOM   4105  O  O     . ALA A 1  613  ? 150.313 140.262 165.869 1.00 26.11  ?  613  ALA A O     1 
ATOM   4106  C  CB    . ALA A 1  613  ? 150.251 142.265 163.897 1.00 26.11  ?  613  ALA A CB    1 
ATOM   4107  N  N     . HIS A 1  614  ? 149.596 141.786 167.355 1.00 31.83  ?  614  HIS A N     1 
ATOM   4108  C  CA    . HIS A 1  614  ? 149.922 140.977 168.526 1.00 31.83  ?  614  HIS A CA    1 
ATOM   4109  C  C     . HIS A 1  614  ? 148.737 140.854 169.472 1.00 31.83  ?  614  HIS A C     1 
ATOM   4110  O  O     . HIS A 1  614  ? 148.911 140.370 170.598 1.00 31.83  ?  614  HIS A O     1 
ATOM   4111  C  CB    . HIS A 1  614  ? 151.135 141.551 169.265 1.00 31.83  ?  614  HIS A CB    1 
ATOM   4112  C  CG    . HIS A 1  614  ? 152.453 141.108 168.712 1.00 31.83  ?  614  HIS A CG    1 
ATOM   4113  N  ND1   . HIS A 1  614  ? 152.943 139.833 168.891 1.00 31.83  ?  614  HIS A ND1   1 
ATOM   4114  C  CD2   . HIS A 1  614  ? 153.394 141.776 168.005 1.00 31.83  ?  614  HIS A CD2   1 
ATOM   4115  C  CE1   . HIS A 1  614  ? 154.123 139.732 168.307 1.00 31.83  ?  614  HIS A CE1   1 
ATOM   4116  N  NE2   . HIS A 1  614  ? 154.419 140.896 167.761 1.00 31.83  ?  614  HIS A NE2   1 
ATOM   4117  N  N     . ASN A 1  615  ? 147.555 141.310 169.042 1.00 33.40  ?  615  ASN A N     1 
ATOM   4118  C  CA    . ASN A 1  615  ? 146.261 141.107 169.703 1.00 33.40  ?  615  ASN A CA    1 
ATOM   4119  C  C     . ASN A 1  615  ? 146.245 141.699 171.112 1.00 33.40  ?  615  ASN A C     1 
ATOM   4120  O  O     . ASN A 1  615  ? 146.065 141.005 172.110 1.00 33.40  ?  615  ASN A O     1 
ATOM   4121  C  CB    . ASN A 1  615  ? 145.884 139.624 169.712 1.00 33.40  ?  615  ASN A CB    1 
ATOM   4122  C  CG    . ASN A 1  615  ? 144.427 139.395 170.005 1.00 33.40  ?  615  ASN A CG    1 
ATOM   4123  O  OD1   . ASN A 1  615  ? 143.604 140.277 169.815 1.00 33.40  ?  615  ASN A OD1   1 
ATOM   4124  N  ND2   . ASN A 1  615  ? 144.105 138.214 170.497 1.00 33.40  ?  615  ASN A ND2   1 
ATOM   4125  N  N     . LEU A 1  616  ? 146.452 143.006 171.171 1.00 27.62  ?  616  LEU A N     1 
ATOM   4126  C  CA    . LEU A 1  616  ? 146.510 143.754 172.415 1.00 27.62  ?  616  LEU A CA    1 
ATOM   4127  C  C     . LEU A 1  616  ? 145.221 144.532 172.565 1.00 27.62  ?  616  LEU A C     1 
ATOM   4128  O  O     . LEU A 1  616  ? 144.831 145.247 171.637 1.00 27.62  ?  616  LEU A O     1 
ATOM   4129  C  CB    . LEU A 1  616  ? 147.689 144.730 172.408 1.00 27.62  ?  616  LEU A CB    1 
ATOM   4130  C  CG    . LEU A 1  616  ? 149.083 144.378 172.925 1.00 27.62  ?  616  LEU A CG    1 
ATOM   4131  C  CD1   . LEU A 1  616  ? 149.686 143.233 172.178 1.00 27.62  ?  616  LEU A CD1   1 
ATOM   4132  C  CD2   . LEU A 1  616  ? 149.959 145.594 172.801 1.00 27.62  ?  616  LEU A CD2   1 
ATOM   4133  N  N     . CYS A 1  617  ? 144.578 144.420 173.729 1.00 33.29  ?  617  CYS A N     1 
ATOM   4134  C  CA    . CYS A 1  617  ? 143.348 145.153 174.014 1.00 33.29  ?  617  CYS A CA    1 
ATOM   4135  C  C     . CYS A 1  617  ? 143.113 145.159 175.515 1.00 33.29  ?  617  CYS A C     1 
ATOM   4136  O  O     . CYS A 1  617  ? 143.751 144.413 176.259 1.00 33.29  ?  617  CYS A O     1 
ATOM   4137  C  CB    . CYS A 1  617  ? 142.144 144.547 173.285 1.00 33.29  ?  617  CYS A CB    1 
ATOM   4138  S  SG    . CYS A 1  617  ? 140.551 145.279 173.666 1.00 33.29  ?  617  CYS A SG    1 
ATOM   4139  N  N     . TYR A 1  618  ? 142.202 146.042 175.948 1.00 40.62  ?  618  TYR A N     1 
ATOM   4140  C  CA    . TYR A 1  618  ? 141.633 145.973 177.291 1.00 40.62  ?  618  TYR A CA    1 
ATOM   4141  C  C     . TYR A 1  618  ? 141.036 144.606 177.550 1.00 40.62  ?  618  TYR A C     1 
ATOM   4142  O  O     . TYR A 1  618  ? 141.232 144.011 178.611 1.00 40.62  ?  618  TYR A O     1 
ATOM   4143  C  CB    . TYR A 1  618  ? 140.517 146.994 177.465 1.00 40.62  ?  618  TYR A CB    1 
ATOM   4144  C  CG    . TYR A 1  618  ? 140.882 148.443 177.586 1.00 40.62  ?  618  TYR A CG    1 
ATOM   4145  C  CD1   . TYR A 1  618  ? 141.528 148.929 178.702 1.00 40.62  ?  618  TYR A CD1   1 
ATOM   4146  C  CD2   . TYR A 1  618  ? 140.497 149.345 176.610 1.00 40.62  ?  618  TYR A CD2   1 
ATOM   4147  C  CE1   . TYR A 1  618  ? 141.818 150.267 178.820 1.00 40.62  ?  618  TYR A CE1   1 
ATOM   4148  C  CE2   . TYR A 1  618  ? 140.789 150.671 176.717 1.00 40.62  ?  618  TYR A CE2   1 
ATOM   4149  C  CZ    . TYR A 1  618  ? 141.450 151.130 177.819 1.00 40.62  ?  618  TYR A CZ    1 
ATOM   4150  O  OH    . TYR A 1  618  ? 141.741 152.466 177.922 1.00 40.62  ?  618  TYR A OH    1 
ATOM   4151  N  N     . THR A 1  619  ? 140.296 144.100 176.580 1.00 34.19  ?  619  THR A N     1 
ATOM   4152  C  CA    . THR A 1  619  ? 139.393 142.980 176.772 1.00 34.19  ?  619  THR A CA    1 
ATOM   4153  C  C     . THR A 1  619  ? 140.124 141.646 176.634 1.00 34.19  ?  619  THR A C     1 
ATOM   4154  O  O     . THR A 1  619  ? 139.515 140.587 176.798 1.00 34.19  ?  619  THR A O     1 
ATOM   4155  C  CB    . THR A 1  619  ? 138.250 143.135 175.756 1.00 34.19  ?  619  THR A CB    1 
ATOM   4156  O  OG1   . THR A 1  619  ? 137.863 144.511 175.739 1.00 34.19  ?  619  THR A OG1   1 
ATOM   4157  C  CG2   . THR A 1  619  ? 137.004 142.430 176.213 1.00 34.19  ?  619  THR A CG2   1 
ATOM   4158  N  N     . THR A 1  620  ? 141.432 141.668 176.388 1.00 26.58  ?  620  THR A N     1 
ATOM   4159  C  CA    . THR A 1  620  ? 142.225 140.447 176.344 1.00 26.58  ?  620  THR A CA    1 
ATOM   4160  C  C     . THR A 1  620  ? 143.518 140.553 177.144 1.00 26.58  ?  620  THR A C     1 
ATOM   4161  O  O     . THR A 1  620  ? 144.402 139.704 176.987 1.00 26.58  ?  620  THR A O     1 
ATOM   4162  C  CB    . THR A 1  620  ? 142.531 140.053 174.900 1.00 26.58  ?  620  THR A CB    1 
ATOM   4163  O  OG1   . THR A 1  620  ? 143.297 138.848 174.889 1.00 26.58  ?  620  THR A OG1   1 
ATOM   4164  C  CG2   . THR A 1  620  ? 143.306 141.144 174.207 1.00 26.58  ?  620  THR A CG2   1 
ATOM   4165  N  N     . LEU A 1  621  ? 143.639 141.556 178.010 1.00 29.78  ?  621  LEU A N     1 
ATOM   4166  C  CA    . LEU A 1  621  ? 144.750 141.647 178.950 1.00 29.78  ?  621  LEU A CA    1 
ATOM   4167  C  C     . LEU A 1  621  ? 144.624 140.566 180.016 1.00 29.78  ?  621  LEU A C     1 
ATOM   4168  O  O     . LEU A 1  621  ? 143.639 140.529 180.758 1.00 29.78  ?  621  LEU A O     1 
ATOM   4169  C  CB    . LEU A 1  621  ? 144.775 143.029 179.596 1.00 29.78  ?  621  LEU A CB    1 
ATOM   4170  C  CG    . LEU A 1  621  ? 145.635 143.229 180.840 1.00 29.78  ?  621  LEU A CG    1 
ATOM   4171  C  CD1   . LEU A 1  621  ? 147.095 142.980 180.557 1.00 29.78  ?  621  LEU A CD1   1 
ATOM   4172  C  CD2   . LEU A 1  621  ? 145.453 144.622 181.354 1.00 29.78  ?  621  LEU A CD2   1 
ATOM   4173  N  N     . LEU A 1  622  ? 145.623 139.698 180.104 1.00 37.93  ?  622  LEU A N     1 
ATOM   4174  C  CA    . LEU A 1  622  ? 145.605 138.588 181.045 1.00 37.93  ?  622  LEU A CA    1 
ATOM   4175  C  C     . LEU A 1  622  ? 146.255 139.028 182.352 1.00 37.93  ?  622  LEU A C     1 
ATOM   4176  O  O     . LEU A 1  622  ? 147.407 139.469 182.354 1.00 37.93  ?  622  LEU A O     1 
ATOM   4177  C  CB    . LEU A 1  622  ? 146.335 137.390 180.444 1.00 37.93  ?  622  LEU A CB    1 
ATOM   4178  C  CG    . LEU A 1  622  ? 146.151 135.963 180.944 1.00 37.93  ?  622  LEU A CG    1 
ATOM   4179  C  CD1   . LEU A 1  622  ? 144.845 135.406 180.478 1.00 37.93  ?  622  LEU A CD1   1 
ATOM   4180  C  CD2   . LEU A 1  622  ? 147.273 135.113 180.419 1.00 37.93  ?  622  LEU A CD2   1 
ATOM   4181  N  N     . ARG A 1  623  ? 145.508 138.913 183.471 1.00 57.74  ?  623  ARG A N     1 
ATOM   4182  C  CA    . ARG A 1  623  ? 146.033 139.229 184.793 1.00 57.74  ?  623  ARG A CA    1 
ATOM   4183  C  C     . ARG A 1  623  ? 147.085 138.184 185.181 1.00 57.74  ?  623  ARG A C     1 
ATOM   4184  O  O     . ARG A 1  623  ? 147.093 137.083 184.620 1.00 57.74  ?  623  ARG A O     1 
ATOM   4185  C  CB    . ARG A 1  623  ? 144.895 139.274 185.820 1.00 57.74  ?  623  ARG A CB    1 
ATOM   4186  C  CG    . ARG A 1  623  ? 144.598 137.962 186.512 1.00 57.74  ?  623  ARG A CG    1 
ATOM   4187  C  CD    . ARG A 1  623  ? 143.586 138.116 187.640 1.00 57.74  ?  623  ARG A CD    1 
ATOM   4188  N  NE    . ARG A 1  623  ? 143.225 136.827 188.230 1.00 57.74  ?  623  ARG A NE    1 
ATOM   4189  C  CZ    . ARG A 1  623  ? 143.845 136.270 189.263 1.00 57.74  ?  623  ARG A CZ    1 
ATOM   4190  N  NH1   . ARG A 1  623  ? 144.862 136.889 189.839 1.00 57.74  1  623  ARG A NH1   1 
ATOM   4191  N  NH2   . ARG A 1  623  ? 143.445 135.094 189.723 1.00 57.74  ?  623  ARG A NH2   1 
ATOM   4192  N  N     . PRO A 1  624  ? 148.018 138.511 186.093 1.00 55.91  ?  624  PRO A N     1 
ATOM   4193  C  CA    . PRO A 1  624  ? 149.124 137.573 186.377 1.00 55.91  ?  624  PRO A CA    1 
ATOM   4194  C  C     . PRO A 1  624  ? 148.708 136.239 186.983 1.00 55.91  ?  624  PRO A C     1 
ATOM   4195  O  O     . PRO A 1  624  ? 149.476 135.272 186.891 1.00 55.91  ?  624  PRO A O     1 
ATOM   4196  C  CB    . PRO A 1  624  ? 150.011 138.358 187.352 1.00 55.91  ?  624  PRO A CB    1 
ATOM   4197  C  CG    . PRO A 1  624  ? 149.708 139.760 187.091 1.00 55.91  ?  624  PRO A CG    1 
ATOM   4198  C  CD    . PRO A 1  624  ? 148.266 139.817 186.739 1.00 55.91  ?  624  PRO A CD    1 
ATOM   4199  N  N     . GLY A 1  625  ? 147.528 136.146 187.583 1.00 67.26  ?  625  GLY A N     1 
ATOM   4200  C  CA    . GLY A 1  625  ? 147.121 134.918 188.227 1.00 67.26  ?  625  GLY A CA    1 
ATOM   4201  C  C     . GLY A 1  625  ? 146.192 134.041 187.415 1.00 67.26  ?  625  GLY A C     1 
ATOM   4202  O  O     . GLY A 1  625  ? 146.194 132.822 187.595 1.00 67.26  ?  625  GLY A O     1 
ATOM   4203  N  N     . THR A 1  626  ? 145.399 134.627 186.512 1.00 67.38  ?  626  THR A N     1 
ATOM   4204  C  CA    . THR A 1  626  ? 144.345 133.847 185.871 1.00 67.38  ?  626  THR A CA    1 
ATOM   4205  C  C     . THR A 1  626  ? 144.862 132.918 184.787 1.00 67.38  ?  626  THR A C     1 
ATOM   4206  O  O     . THR A 1  626  ? 144.080 132.109 184.276 1.00 67.38  ?  626  THR A O     1 
ATOM   4207  C  CB    . THR A 1  626  ? 143.267 134.746 185.270 1.00 67.38  ?  626  THR A CB    1 
ATOM   4208  O  OG1   . THR A 1  626  ? 142.128 133.946 184.926 1.00 67.38  ?  626  THR A OG1   1 
ATOM   4209  C  CG2   . THR A 1  626  ? 143.775 135.421 184.007 1.00 67.38  ?  626  THR A CG2   1 
ATOM   4210  N  N     . ALA A 1  627  ? 146.137 133.022 184.411 1.00 78.03  ?  627  ALA A N     1 
ATOM   4211  C  CA    . ALA A 1  627  ? 146.733 131.962 183.612 1.00 78.03  ?  627  ALA A CA    1 
ATOM   4212  C  C     . ALA A 1  627  ? 146.842 130.692 184.434 1.00 78.03  ?  627  ALA A C     1 
ATOM   4213  O  O     . ALA A 1  627  ? 146.545 129.599 183.946 1.00 78.03  ?  627  ALA A O     1 
ATOM   4214  C  CB    . ALA A 1  627  ? 148.103 132.393 183.091 1.00 78.03  ?  627  ALA A CB    1 
ATOM   4215  N  N     . GLN A 1  628  ? 147.209 130.834 185.702 1.00 84.91  ?  628  GLN A N     1 
ATOM   4216  C  CA    . GLN A 1  628  ? 147.339 129.714 186.622 1.00 84.91  ?  628  GLN A CA    1 
ATOM   4217  C  C     . GLN A 1  628  ? 145.962 129.304 187.155 1.00 84.91  ?  628  GLN A C     1 
ATOM   4218  O  O     . GLN A 1  628  ? 145.103 130.159 187.388 1.00 84.91  ?  628  GLN A O     1 
ATOM   4219  C  CB    . GLN A 1  628  ? 148.269 130.125 187.770 1.00 84.91  ?  628  GLN A CB    1 
ATOM   4220  C  CG    . GLN A 1  628  ? 149.753 130.068 187.439 1.00 84.91  ?  628  GLN A CG    1 
ATOM   4221  C  CD    . GLN A 1  628  ? 150.245 131.276 186.650 1.00 84.91  ?  628  GLN A CD    1 
ATOM   4222  O  OE1   . GLN A 1  628  ? 150.036 132.426 187.049 1.00 84.91  ?  628  GLN A OE1   1 
ATOM   4223  N  NE2   . GLN A 1  628  ? 150.911 131.017 185.528 1.00 84.91  ?  628  GLN A NE2   1 
ATOM   4224  N  N     . LYS A 1  629  ? 145.735 127.998 187.347 1.00 100.65 ?  629  LYS A N     1 
ATOM   4225  C  CA    . LYS A 1  629  ? 146.701 126.909 187.172 1.00 100.65 ?  629  LYS A CA    1 
ATOM   4226  C  C     . LYS A 1  629  ? 146.563 126.185 185.843 1.00 100.65 ?  629  LYS A C     1 
ATOM   4227  O  O     . LYS A 1  629  ? 146.919 125.008 185.741 1.00 100.65 ?  629  LYS A O     1 
ATOM   4228  C  CB    . LYS A 1  629  ? 146.557 125.874 188.301 1.00 100.65 ?  629  LYS A CB    1 
ATOM   4229  C  CG    . LYS A 1  629  ? 147.169 126.248 189.649 1.00 100.65 ?  629  LYS A CG    1 
ATOM   4230  C  CD    . LYS A 1  629  ? 148.517 126.929 189.514 1.00 100.65 ?  629  LYS A CD    1 
ATOM   4231  C  CE    . LYS A 1  629  ? 149.197 127.061 190.860 1.00 100.65 ?  629  LYS A CE    1 
ATOM   4232  N  NZ    . LYS A 1  629  ? 148.212 127.355 191.935 1.00 100.65 1  629  LYS A NZ    1 
ATOM   4233  N  N     . LEU A 1  630  ? 146.031 126.858 184.828 1.00 94.72  ?  630  LEU A N     1 
ATOM   4234  C  CA    . LEU A 1  630  ? 146.137 126.311 183.487 1.00 94.72  ?  630  LEU A CA    1 
ATOM   4235  C  C     . LEU A 1  630  ? 147.572 126.493 182.993 1.00 94.72  ?  630  LEU A C     1 
ATOM   4236  O  O     . LEU A 1  630  ? 148.250 127.467 183.328 1.00 94.72  ?  630  LEU A O     1 
ATOM   4237  C  CB    . LEU A 1  630  ? 145.135 126.980 182.546 1.00 94.72  ?  630  LEU A CB    1 
ATOM   4238  C  CG    . LEU A 1  630  ? 144.934 126.329 181.174 1.00 94.72  ?  630  LEU A CG    1 
ATOM   4239  C  CD1   . LEU A 1  630  ? 144.353 124.935 181.325 1.00 94.72  ?  630  LEU A CD1   1 
ATOM   4240  C  CD2   . LEU A 1  630  ? 144.065 127.184 180.280 1.00 94.72  ?  630  LEU A CD2   1 
ATOM   4241  N  N     . GLY A 1  631  ? 148.055 125.520 182.226 1.00 96.74  ?  631  GLY A N     1 
ATOM   4242  C  CA    . GLY A 1  631  ? 149.448 125.557 181.825 1.00 96.74  ?  631  GLY A CA    1 
ATOM   4243  C  C     . GLY A 1  631  ? 149.677 125.764 180.341 1.00 96.74  ?  631  GLY A C     1 
ATOM   4244  O  O     . GLY A 1  631  ? 150.808 125.637 179.864 1.00 96.74  ?  631  GLY A O     1 
ATOM   4245  N  N     . LEU A 1  632  ? 148.622 126.086 179.600 1.00 91.30  ?  632  LEU A N     1 
ATOM   4246  C  CA    . LEU A 1  632  ? 148.734 126.150 178.148 1.00 91.30  ?  632  LEU A CA    1 
ATOM   4247  C  C     . LEU A 1  632  ? 149.295 127.505 177.740 1.00 91.30  ?  632  LEU A C     1 
ATOM   4248  O  O     . LEU A 1  632  ? 148.558 128.492 177.658 1.00 91.30  ?  632  LEU A O     1 
ATOM   4249  C  CB    . LEU A 1  632  ? 147.380 125.887 177.504 1.00 91.30  ?  632  LEU A CB    1 
ATOM   4250  C  CG    . LEU A 1  632  ? 146.978 124.411 177.440 1.00 91.30  ?  632  LEU A CG    1 
ATOM   4251  C  CD1   . LEU A 1  632  ? 145.697 124.239 176.640 1.00 91.30  ?  632  LEU A CD1   1 
ATOM   4252  C  CD2   . LEU A 1  632  ? 148.086 123.533 176.878 1.00 91.30  ?  632  LEU A CD2   1 
ATOM   4253  N  N     . THR A 1  633  ? 150.602 127.547 177.484 1.00 89.68  ?  633  THR A N     1 
ATOM   4254  C  CA    . THR A 1  633  ? 151.307 128.754 177.074 1.00 89.68  ?  633  THR A CA    1 
ATOM   4255  C  C     . THR A 1  633  ? 151.346 128.891 175.561 1.00 89.68  ?  633  THR A C     1 
ATOM   4256  O  O     . THR A 1  633  ? 151.020 129.957 175.025 1.00 89.68  ?  633  THR A O     1 
ATOM   4257  C  CB    . THR A 1  633  ? 152.745 128.736 177.596 1.00 89.68  ?  633  THR A CB    1 
ATOM   4258  O  OG1   . THR A 1  633  ? 153.420 127.589 177.070 1.00 89.68  ?  633  THR A OG1   1 
ATOM   4259  C  CG2   . THR A 1  633  ? 152.769 128.646 179.103 1.00 89.68  ?  633  THR A CG2   1 
ATOM   4260  N  N     . GLU A 1  634  ? 151.756 127.815 174.886 1.00 101.39 ?  634  GLU A N     1 
ATOM   4261  C  CA    . GLU A 1  634  ? 151.949 127.800 173.440 1.00 101.39 ?  634  GLU A CA    1 
ATOM   4262  C  C     . GLU A 1  634  ? 150.634 128.034 172.708 1.00 101.39 ?  634  GLU A C     1 
ATOM   4263  O  O     . GLU A 1  634  ? 149.603 127.454 173.057 1.00 101.39 ?  634  GLU A O     1 
ATOM   4264  C  CB    . GLU A 1  634  ? 152.578 126.471 173.004 1.00 101.39 ?  634  GLU A CB    1 
ATOM   4265  C  CG    . GLU A 1  634  ? 151.857 125.190 173.460 1.00 101.39 ?  634  GLU A CG    1 
ATOM   4266  C  CD    . GLU A 1  634  ? 152.226 124.745 174.863 1.00 101.39 ?  634  GLU A CD    1 
ATOM   4267  O  OE1   . GLU A 1  634  ? 151.683 123.716 175.321 1.00 101.39 ?  634  GLU A OE1   1 
ATOM   4268  O  OE2   . GLU A 1  634  ? 153.045 125.435 175.508 1.00 101.39 -1 634  GLU A OE2   1 
ATOM   4269  N  N     . ASP A 1  635  ? 150.664 128.994 171.778 1.00 102.48 ?  635  ASP A N     1 
ATOM   4270  C  CA    . ASP A 1  635  ? 149.592 129.473 170.897 1.00 102.48 ?  635  ASP A CA    1 
ATOM   4271  C  C     . ASP A 1  635  ? 148.268 129.786 171.599 1.00 102.48 ?  635  ASP A C     1 
ATOM   4272  O  O     . ASP A 1  635  ? 147.228 129.900 170.946 1.00 102.48 ?  635  ASP A O     1 
ATOM   4273  C  CB    . ASP A 1  635  ? 149.346 128.521 169.708 1.00 102.48 ?  635  ASP A CB    1 
ATOM   4274  C  CG    . ASP A 1  635  ? 148.621 127.238 170.080 1.00 102.48 ?  635  ASP A CG    1 
ATOM   4275  O  OD1   . ASP A 1  635  ? 149.259 126.282 170.570 1.00 102.48 ?  635  ASP A OD1   1 
ATOM   4276  O  OD2   . ASP A 1  635  ? 147.387 127.197 169.884 1.00 102.48 -1 635  ASP A OD2   1 
ATOM   4277  N  N     . GLN A 1  636  ? 148.296 129.973 172.914 1.00 83.89  ?  636  GLN A N     1 
ATOM   4278  C  CA    . GLN A 1  636  ? 147.169 130.545 173.625 1.00 83.89  ?  636  GLN A CA    1 
ATOM   4279  C  C     . GLN A 1  636  ? 147.498 131.920 174.192 1.00 83.89  ?  636  GLN A C     1 
ATOM   4280  O  O     . GLN A 1  636  ? 146.635 132.797 174.192 1.00 83.89  ?  636  GLN A O     1 
ATOM   4281  C  CB    . GLN A 1  636  ? 146.678 129.595 174.720 1.00 83.89  ?  636  GLN A CB    1 
ATOM   4282  C  CG    . GLN A 1  636  ? 145.598 128.629 174.234 1.00 83.89  ?  636  GLN A CG    1 
ATOM   4283  C  CD    . GLN A 1  636  ? 146.131 127.260 173.864 1.00 83.89  ?  636  GLN A CD    1 
ATOM   4284  O  OE1   . GLN A 1  636  ? 147.156 126.822 174.377 1.00 83.89  ?  636  GLN A OE1   1 
ATOM   4285  N  NE2   . GLN A 1  636  ? 145.429 126.573 172.972 1.00 83.89  ?  636  GLN A NE2   1 
ATOM   4286  N  N     . PHE A 1  637  ? 148.731 132.147 174.645 1.00 62.54  ?  637  PHE A N     1 
ATOM   4287  C  CA    . PHE A 1  637  ? 149.143 133.507 174.951 1.00 62.54  ?  637  PHE A CA    1 
ATOM   4288  C  C     . PHE A 1  637  ? 150.603 133.747 174.594 1.00 62.54  ?  637  PHE A C     1 
ATOM   4289  O  O     . PHE A 1  637  ? 151.365 132.830 174.279 1.00 62.54  ?  637  PHE A O     1 
ATOM   4290  C  CB    . PHE A 1  637  ? 148.870 133.888 176.418 1.00 62.54  ?  637  PHE A CB    1 
ATOM   4291  C  CG    . PHE A 1  637  ? 149.515 133.017 177.448 1.00 62.54  ?  637  PHE A CG    1 
ATOM   4292  C  CD1   . PHE A 1  637  ? 150.807 133.256 177.876 1.00 62.54  ?  637  PHE A CD1   1 
ATOM   4293  C  CD2   . PHE A 1  637  ? 148.786 132.030 178.071 1.00 62.54  ?  637  PHE A CD2   1 
ATOM   4294  C  CE1   . PHE A 1  637  ? 151.380 132.483 178.842 1.00 62.54  ?  637  PHE A CE1   1 
ATOM   4295  C  CE2   . PHE A 1  637  ? 149.351 131.257 179.055 1.00 62.54  ?  637  PHE A CE2   1 
ATOM   4296  C  CZ    . PHE A 1  637  ? 150.650 131.485 179.439 1.00 62.54  ?  637  PHE A CZ    1 
ATOM   4297  N  N     . ILE A 1  638  ? 150.963 135.028 174.644 1.00 44.49  ?  638  ILE A N     1 
ATOM   4298  C  CA    . ILE A 1  638  ? 152.279 135.541 174.304 1.00 44.49  ?  638  ILE A CA    1 
ATOM   4299  C  C     . ILE A 1  638  ? 152.785 136.369 175.479 1.00 44.49  ?  638  ILE A C     1 
ATOM   4300  O  O     . ILE A 1  638  ? 152.043 136.678 176.412 1.00 44.49  ?  638  ILE A O     1 
ATOM   4301  C  CB    . ILE A 1  638  ? 152.261 136.396 173.023 1.00 44.49  ?  638  ILE A CB    1 
ATOM   4302  C  CG1   . ILE A 1  638  ? 151.459 137.674 173.262 1.00 44.49  ?  638  ILE A CG1   1 
ATOM   4303  C  CG2   . ILE A 1  638  ? 151.723 135.608 171.832 1.00 44.49  ?  638  ILE A CG2   1 
ATOM   4304  C  CD1   . ILE A 1  638  ? 151.929 138.850 172.453 1.00 44.49  ?  638  ILE A CD1   1 
ATOM   4305  N  N     . ARG A 1  639  ? 154.059 136.765 175.393 1.00 49.65  ?  639  ARG A N     1 
ATOM   4306  C  CA    . ARG A 1  639  ? 154.729 137.534 176.431 1.00 49.65  ?  639  ARG A CA    1 
ATOM   4307  C  C     . ARG A 1  639  ? 155.477 138.714 175.823 1.00 49.65  ?  639  ARG A C     1 
ATOM   4308  O  O     . ARG A 1  639  ? 156.110 138.593 174.772 1.00 49.65  ?  639  ARG A O     1 
ATOM   4309  C  CB    . ARG A 1  639  ? 155.696 136.654 177.227 1.00 49.65  ?  639  ARG A CB    1 
ATOM   4310  C  CG    . ARG A 1  639  ? 154.988 135.747 178.213 1.00 49.65  ?  639  ARG A CG    1 
ATOM   4311  C  CD    . ARG A 1  639  ? 155.938 134.850 178.964 1.00 49.65  ?  639  ARG A CD    1 
ATOM   4312  N  NE    . ARG A 1  639  ? 155.242 134.104 180.004 1.00 49.65  ?  639  ARG A NE    1 
ATOM   4313  C  CZ    . ARG A 1  639  ? 154.649 132.932 179.807 1.00 49.65  ?  639  ARG A CZ    1 
ATOM   4314  N  NH1   . ARG A 1  639  ? 154.665 132.374 178.605 1.00 49.65  1  639  ARG A NH1   1 
ATOM   4315  N  NH2   . ARG A 1  639  ? 154.035 132.318 180.811 1.00 49.65  ?  639  ARG A NH2   1 
ATOM   4316  N  N     . THR A 1  640  ? 155.415 139.848 176.508 1.00 43.54  ?  640  THR A N     1 
ATOM   4317  C  CA    . THR A 1  640  ? 155.920 141.123 176.028 1.00 43.54  ?  640  THR A CA    1 
ATOM   4318  C  C     . THR A 1  640  ? 157.208 141.500 176.754 1.00 43.54  ?  640  THR A C     1 
ATOM   4319  O  O     . THR A 1  640  ? 157.489 140.976 177.838 1.00 43.54  ?  640  THR A O     1 
ATOM   4320  C  CB    . THR A 1  640  ? 154.872 142.222 176.233 1.00 43.54  ?  640  THR A CB    1 
ATOM   4321  O  OG1   . THR A 1  640  ? 154.747 142.494 177.629 1.00 43.54  ?  640  THR A OG1   1 
ATOM   4322  C  CG2   . THR A 1  640  ? 153.541 141.786 175.680 1.00 43.54  ?  640  THR A CG2   1 
ATOM   4323  N  N     . PRO A 1  641  ? 158.035 142.380 176.164 1.00 45.02  ?  641  PRO A N     1 
ATOM   4324  C  CA    . PRO A 1  641  ? 159.287 142.779 176.835 1.00 45.02  ?  641  PRO A CA    1 
ATOM   4325  C  C     . PRO A 1  641  ? 159.121 143.490 178.169 1.00 45.02  ?  641  PRO A C     1 
ATOM   4326  O  O     . PRO A 1  641  ? 160.036 143.418 178.998 1.00 45.02  ?  641  PRO A O     1 
ATOM   4327  C  CB    . PRO A 1  641  ? 159.940 143.702 175.801 1.00 45.02  ?  641  PRO A CB    1 
ATOM   4328  C  CG    . PRO A 1  641  ? 159.494 143.172 174.522 1.00 45.02  ?  641  PRO A CG    1 
ATOM   4329  C  CD    . PRO A 1  641  ? 158.097 142.681 174.721 1.00 45.02  ?  641  PRO A CD    1 
ATOM   4330  N  N     . THR A 1  642  ? 158.009 144.187 178.410 1.00 45.06  ?  642  THR A N     1 
ATOM   4331  C  CA    . THR A 1  642  ? 157.806 144.734 179.746 1.00 45.06  ?  642  THR A CA    1 
ATOM   4332  C  C     . THR A 1  642  ? 157.385 143.639 180.719 1.00 45.06  ?  642  THR A C     1 
ATOM   4333  O  O     . THR A 1  642  ? 157.798 143.659 181.885 1.00 45.06  ?  642  THR A O     1 
ATOM   4334  C  CB    . THR A 1  642  ? 156.790 145.889 179.707 1.00 45.06  ?  642  THR A CB    1 
ATOM   4335  O  OG1   . THR A 1  642  ? 157.237 146.882 178.777 1.00 45.06  ?  642  THR A OG1   1 
ATOM   4336  C  CG2   . THR A 1  642  ? 156.639 146.556 181.070 1.00 45.06  ?  642  THR A CG2   1 
ATOM   4337  N  N     . GLY A 1  643  ? 156.622 142.656 180.264 1.00 46.78  ?  643  GLY A N     1 
ATOM   4338  C  CA    . GLY A 1  643  ? 156.457 141.463 181.072 1.00 46.78  ?  643  GLY A CA    1 
ATOM   4339  C  C     . GLY A 1  643  ? 155.099 140.797 181.069 1.00 46.78  ?  643  GLY A C     1 
ATOM   4340  O  O     . GLY A 1  643  ? 154.990 139.654 181.517 1.00 46.78  ?  643  GLY A O     1 
ATOM   4341  N  N     . ASP A 1  644  ? 154.071 141.478 180.552 1.00 40.14  ?  644  ASP A N     1 
ATOM   4342  C  CA    . ASP A 1  644  ? 152.691 141.013 180.565 1.00 40.14  ?  644  ASP A CA    1 
ATOM   4343  C  C     . ASP A 1  644  ? 152.518 139.741 179.731 1.00 40.14  ?  644  ASP A C     1 
ATOM   4344  O  O     . ASP A 1  644  ? 153.399 139.329 178.975 1.00 40.14  ?  644  ASP A O     1 
ATOM   4345  C  CB    . ASP A 1  644  ? 151.758 142.098 180.031 1.00 40.14  ?  644  ASP A CB    1 
ATOM   4346  C  CG    . ASP A 1  644  ? 151.874 143.398 180.796 1.00 40.14  ?  644  ASP A CG    1 
ATOM   4347  O  OD1   . ASP A 1  644  ? 151.789 143.361 182.037 1.00 40.14  ?  644  ASP A OD1   1 
ATOM   4348  O  OD2   . ASP A 1  644  ? 152.055 144.457 180.163 1.00 40.14  -1 644  ASP A OD2   1 
ATOM   4349  N  N     . GLU A 1  645  ? 151.360 139.111 179.885 1.00 37.10  ?  645  GLU A N     1 
ATOM   4350  C  CA    . GLU A 1  645  ? 150.942 138.006 179.034 1.00 37.10  ?  645  GLU A CA    1 
ATOM   4351  C  C     . GLU A 1  645  ? 149.632 138.383 178.363 1.00 37.10  ?  645  GLU A C     1 
ATOM   4352  O  O     . GLU A 1  645  ? 148.757 138.978 178.995 1.00 37.10  ?  645  GLU A O     1 
ATOM   4353  C  CB    . GLU A 1  645  ? 150.773 136.718 179.822 1.00 37.10  ?  645  GLU A CB    1 
ATOM   4354  C  CG    . GLU A 1  645  ? 151.836 136.483 180.877 1.00 37.10  ?  645  GLU A CG    1 
ATOM   4355  C  CD    . GLU A 1  645  ? 151.419 136.939 182.270 1.00 37.10  ?  645  GLU A CD    1 
ATOM   4356  O  OE1   . GLU A 1  645  ? 150.781 138.008 182.390 1.00 37.10  ?  645  GLU A OE1   1 
ATOM   4357  O  OE2   . GLU A 1  645  ? 151.742 136.230 183.248 1.00 37.10  -1 645  GLU A OE2   1 
ATOM   4358  N  N     . PHE A 1  646  ? 149.512 138.069 177.074 1.00 38.25  ?  646  PHE A N     1 
ATOM   4359  C  CA    . PHE A 1  646  ? 148.348 138.472 176.289 1.00 38.25  ?  646  PHE A CA    1 
ATOM   4360  C  C     . PHE A 1  646  ? 147.862 137.298 175.458 1.00 38.25  ?  646  PHE A C     1 
ATOM   4361  O  O     . PHE A 1  646  ? 148.660 136.635 174.805 1.00 38.25  ?  646  PHE A O     1 
ATOM   4362  C  CB    . PHE A 1  646  ? 148.662 139.630 175.347 1.00 38.25  ?  646  PHE A CB    1 
ATOM   4363  C  CG    . PHE A 1  646  ? 148.472 140.996 175.939 1.00 38.25  ?  646  PHE A CG    1 
ATOM   4364  C  CD1   . PHE A 1  646  ? 149.391 141.521 176.816 1.00 38.25  ?  646  PHE A CD1   1 
ATOM   4365  C  CD2   . PHE A 1  646  ? 147.417 141.784 175.552 1.00 38.25  ?  646  PHE A CD2   1 
ATOM   4366  C  CE1   . PHE A 1  646  ? 149.236 142.792 177.327 1.00 38.25  ?  646  PHE A CE1   1 
ATOM   4367  C  CE2   . PHE A 1  646  ? 147.259 143.056 176.067 1.00 38.25  ?  646  PHE A CE2   1 
ATOM   4368  C  CZ    . PHE A 1  646  ? 148.175 143.557 176.947 1.00 38.25  ?  646  PHE A CZ    1 
ATOM   4369  N  N     . VAL A 1  647  ? 146.549 137.100 175.425 1.00 40.47  ?  647  VAL A N     1 
ATOM   4370  C  CA    . VAL A 1  647  ? 145.945 135.909 174.831 1.00 40.47  ?  647  VAL A CA    1 
ATOM   4371  C  C     . VAL A 1  647  ? 146.041 135.967 173.310 1.00 40.47  ?  647  VAL A C     1 
ATOM   4372  O  O     . VAL A 1  647  ? 145.875 137.028 172.698 1.00 40.47  ?  647  VAL A O     1 
ATOM   4373  C  CB    . VAL A 1  647  ? 144.483 135.784 175.312 1.00 40.47  ?  647  VAL A CB    1 
ATOM   4374  C  CG1   . VAL A 1  647  ? 143.802 134.590 174.727 1.00 40.47  ?  647  VAL A CG1   1 
ATOM   4375  C  CG2   . VAL A 1  647  ? 144.432 135.698 176.810 1.00 40.47  ?  647  VAL A CG2   1 
ATOM   4376  N  N     . LYS A 1  648  ? 146.330 134.817 172.688 1.00 54.63  ?  648  LYS A N     1 
ATOM   4377  C  CA    . LYS A 1  648  ? 146.347 134.696 171.235 1.00 54.63  ?  648  LYS A CA    1 
ATOM   4378  C  C     . LYS A 1  648  ? 144.953 134.920 170.643 1.00 54.63  ?  648  LYS A C     1 
ATOM   4379  O  O     . LYS A 1  648  ? 143.937 134.902 171.340 1.00 54.63  ?  648  LYS A O     1 
ATOM   4380  C  CB    . LYS A 1  648  ? 146.868 133.324 170.816 1.00 54.63  ?  648  LYS A CB    1 
ATOM   4381  C  CG    . LYS A 1  648  ? 148.366 133.207 170.853 1.00 54.63  ?  648  LYS A CG    1 
ATOM   4382  C  CD    . LYS A 1  648  ? 148.993 133.765 169.597 1.00 54.63  ?  648  LYS A CD    1 
ATOM   4383  C  CE    . LYS A 1  648  ? 150.317 133.104 169.326 1.00 54.63  ?  648  LYS A CE    1 
ATOM   4384  N  NZ    . LYS A 1  648  ? 150.808 133.424 167.965 1.00 54.63  1  648  LYS A NZ    1 
ATOM   4385  N  N     . THR A 1  649  ? 144.912 135.112 169.320 1.00 50.04  ?  649  THR A N     1 
ATOM   4386  C  CA    . THR A 1  649  ? 143.679 135.460 168.620 1.00 50.04  ?  649  THR A CA    1 
ATOM   4387  C  C     . THR A 1  649  ? 142.777 134.269 168.350 1.00 50.04  ?  649  THR A C     1 
ATOM   4388  O  O     . THR A 1  649  ? 141.673 134.460 167.833 1.00 50.04  ?  649  THR A O     1 
ATOM   4389  C  CB    . THR A 1  649  ? 143.983 136.147 167.288 1.00 50.04  ?  649  THR A CB    1 
ATOM   4390  O  OG1   . THR A 1  649  ? 142.770 136.668 166.729 1.00 50.04  ?  649  THR A OG1   1 
ATOM   4391  C  CG2   . THR A 1  649  ? 144.608 135.159 166.307 1.00 50.04  ?  649  THR A CG2   1 
ATOM   4392  N  N     . SER A 1  650  ? 143.218 133.058 168.672 1.00 53.08  ?  650  SER A N     1 
ATOM   4393  C  CA    . SER A 1  650  ? 142.391 131.864 168.573 1.00 53.08  ?  650  SER A CA    1 
ATOM   4394  C  C     . SER A 1  650  ? 141.441 131.706 169.748 1.00 53.08  ?  650  SER A C     1 
ATOM   4395  O  O     . SER A 1  650  ? 140.713 130.714 169.806 1.00 53.08  ?  650  SER A O     1 
ATOM   4396  C  CB    . SER A 1  650  ? 143.280 130.625 168.448 1.00 53.08  ?  650  SER A CB    1 
ATOM   4397  O  OG    . SER A 1  650  ? 142.588 129.459 168.850 1.00 53.08  ?  650  SER A OG    1 
ATOM   4398  N  N     . VAL A 1  651  ? 141.428 132.650 170.686 1.00 49.04  ?  651  VAL A N     1 
ATOM   4399  C  CA    . VAL A 1  651  ? 140.481 132.664 171.792 1.00 49.04  ?  651  VAL A CA    1 
ATOM   4400  C  C     . VAL A 1  651  ? 139.606 133.916 171.760 1.00 49.04  ?  651  VAL A C     1 
ATOM   4401  O  O     . VAL A 1  651  ? 138.378 133.829 171.859 1.00 49.04  ?  651  VAL A O     1 
ATOM   4402  C  CB    . VAL A 1  651  ? 141.204 132.532 173.148 1.00 49.04  ?  651  VAL A CB    1 
ATOM   4403  C  CG1   . VAL A 1  651  ? 140.231 132.695 174.305 1.00 49.04  ?  651  VAL A CG1   1 
ATOM   4404  C  CG2   . VAL A 1  651  ? 141.920 131.200 173.229 1.00 49.04  ?  651  VAL A CG2   1 
ATOM   4405  N  N     . ARG A 1  652  ? 140.217 135.088 171.598 1.00 41.56  ?  652  ARG A N     1 
ATOM   4406  C  CA    . ARG A 1  652  ? 139.468 136.339 171.568 1.00 41.56  ?  652  ARG A CA    1 
ATOM   4407  C  C     . ARG A 1  652  ? 139.959 137.226 170.431 1.00 41.56  ?  652  ARG A C     1 
ATOM   4408  O  O     . ARG A 1  652  ? 141.055 137.045 169.896 1.00 41.56  ?  652  ARG A O     1 
ATOM   4409  C  CB    . ARG A 1  652  ? 139.580 137.125 172.884 1.00 41.56  ?  652  ARG A CB    1 
ATOM   4410  C  CG    . ARG A 1  652  ? 138.974 136.445 174.077 1.00 41.56  ?  652  ARG A CG    1 
ATOM   4411  C  CD    . ARG A 1  652  ? 137.472 136.405 173.979 1.00 41.56  ?  652  ARG A CD    1 
ATOM   4412  N  NE    . ARG A 1  652  ? 136.807 137.696 174.113 1.00 41.56  ?  652  ARG A NE    1 
ATOM   4413  C  CZ    . ARG A 1  652  ? 136.399 138.191 175.278 1.00 41.56  ?  652  ARG A CZ    1 
ATOM   4414  N  NH1   . ARG A 1  652  ? 136.578 137.501 176.394 1.00 41.56  1  652  ARG A NH1   1 
ATOM   4415  N  NH2   . ARG A 1  652  ? 135.792 139.366 175.327 1.00 41.56  ?  652  ARG A NH2   1 
ATOM   4416  N  N     . LYS A 1  653  ? 139.115 138.185 170.064 1.00 32.31  ?  653  LYS A N     1 
ATOM   4417  C  CA    . LYS A 1  653  ? 139.479 139.304 169.208 1.00 32.31  ?  653  LYS A CA    1 
ATOM   4418  C  C     . LYS A 1  653  ? 139.248 140.581 169.993 1.00 32.31  ?  653  LYS A C     1 
ATOM   4419  O  O     . LYS A 1  653  ? 138.194 140.742 170.610 1.00 32.31  ?  653  LYS A O     1 
ATOM   4420  C  CB    . LYS A 1  653  ? 138.644 139.325 167.930 1.00 32.31  ?  653  LYS A CB    1 
ATOM   4421  C  CG    . LYS A 1  653  ? 138.872 140.543 167.049 1.00 32.31  ?  653  LYS A CG    1 
ATOM   4422  C  CD    . LYS A 1  653  ? 140.136 140.426 166.226 1.00 32.31  ?  653  LYS A CD    1 
ATOM   4423  C  CE    . LYS A 1  653  ? 139.960 139.440 165.083 1.00 32.31  ?  653  LYS A CE    1 
ATOM   4424  N  NZ    . LYS A 1  653  ? 139.042 139.983 164.055 1.00 32.31  1  653  LYS A NZ    1 
ATOM   4425  N  N     . GLY A 1  654  ? 140.217 141.469 169.982 1.00 23.48  ?  654  GLY A N     1 
ATOM   4426  C  CA    . GLY A 1  654  ? 140.086 142.682 170.749 1.00 23.48  ?  654  GLY A CA    1 
ATOM   4427  C  C     . GLY A 1  654  ? 139.222 143.708 170.060 1.00 23.48  ?  654  GLY A C     1 
ATOM   4428  O  O     . GLY A 1  654  ? 138.815 143.550 168.919 1.00 23.48  ?  654  GLY A O     1 
ATOM   4429  N  N     . LEU A 1  655  ? 138.951 144.789 170.779 1.00 28.99  ?  655  LEU A N     1 
ATOM   4430  C  CA    . LEU A 1  655  ? 138.116 145.862 170.256 1.00 28.99  ?  655  LEU A CA    1 
ATOM   4431  C  C     . LEU A 1  655  ? 138.921 146.975 169.616 1.00 28.99  ?  655  LEU A C     1 
ATOM   4432  O  O     . LEU A 1  655  ? 138.452 147.596 168.666 1.00 28.99  ?  655  LEU A O     1 
ATOM   4433  C  CB    . LEU A 1  655  ? 137.243 146.466 171.362 1.00 28.99  ?  655  LEU A CB    1 
ATOM   4434  C  CG    . LEU A 1  655  ? 136.386 145.592 172.275 1.00 28.99  ?  655  LEU A CG    1 
ATOM   4435  C  CD1   . LEU A 1  655  ? 135.436 146.495 173.018 1.00 28.99  ?  655  LEU A CD1   1 
ATOM   4436  C  CD2   . LEU A 1  655  ? 135.620 144.528 171.521 1.00 28.99  ?  655  LEU A CD2   1 
ATOM   4437  N  N     . LEU A 1  656  ? 140.101 147.255 170.122 1.00 22.88  ?  656  LEU A N     1 
ATOM   4438  C  CA    . LEU A 1  656  ? 140.979 148.266 169.548 1.00 22.88  ?  656  LEU A CA    1 
ATOM   4439  C  C     . LEU A 1  656  ? 141.613 147.872 168.203 1.00 22.88  ?  656  LEU A C     1 
ATOM   4440  O  O     . LEU A 1  656  ? 141.826 148.771 167.371 1.00 22.88  ?  656  LEU A O     1 
ATOM   4441  C  CB    . LEU A 1  656  ? 142.047 148.647 170.575 1.00 22.88  ?  656  LEU A CB    1 
ATOM   4442  C  CG    . LEU A 1  656  ? 141.503 148.962 171.964 1.00 22.88  ?  656  LEU A CG    1 
ATOM   4443  C  CD1   . LEU A 1  656  ? 142.635 149.268 172.919 1.00 22.88  ?  656  LEU A CD1   1 
ATOM   4444  C  CD2   . LEU A 1  656  ? 140.559 150.126 171.883 1.00 22.88  ?  656  LEU A CD2   1 
ATOM   4445  N  N     . PRO A 1  657  ? 141.935 146.586 167.927 1.00 26.89  ?  657  PRO A N     1 
ATOM   4446  C  CA    . PRO A 1  657  ? 142.210 146.201 166.529 1.00 26.89  ?  657  PRO A CA    1 
ATOM   4447  C  C     . PRO A 1  657  ? 141.140 146.565 165.502 1.00 26.89  ?  657  PRO A C     1 
ATOM   4448  O  O     . PRO A 1  657  ? 141.491 147.033 164.415 1.00 26.89  ?  657  PRO A O     1 
ATOM   4449  C  CB    . PRO A 1  657  ? 142.385 144.686 166.641 1.00 26.89  ?  657  PRO A CB    1 
ATOM   4450  C  CG    . PRO A 1  657  ? 143.073 144.528 167.908 1.00 26.89  ?  657  PRO A CG    1 
ATOM   4451  C  CD    . PRO A 1  657  ? 142.489 145.554 168.832 1.00 26.89  ?  657  PRO A CD    1 
ATOM   4452  N  N     . GLN A 1  658  ? 139.855 146.431 165.827 1.00 28.67  ?  658  GLN A N     1 
ATOM   4453  C  CA    . GLN A 1  658  ? 138.816 146.681 164.829 1.00 28.67  ?  658  GLN A CA    1 
ATOM   4454  C  C     . GLN A 1  658  ? 138.602 148.173 164.582 1.00 28.67  ?  658  GLN A C     1 
ATOM   4455  O  O     . GLN A 1  658  ? 138.429 148.596 163.427 1.00 28.67  ?  658  GLN A O     1 
ATOM   4456  C  CB    . GLN A 1  658  ? 137.524 146.009 165.270 1.00 28.67  ?  658  GLN A CB    1 
ATOM   4457  C  CG    . GLN A 1  658  ? 137.721 144.572 165.708 1.00 28.67  ?  658  GLN A CG    1 
ATOM   4458  C  CD    . GLN A 1  658  ? 136.457 143.765 165.609 1.00 28.67  ?  658  GLN A CD    1 
ATOM   4459  O  OE1   . GLN A 1  658  ? 136.010 143.439 164.515 1.00 28.67  ?  658  GLN A OE1   1 
ATOM   4460  N  NE2   . GLN A 1  658  ? 135.867 143.436 166.751 1.00 28.67  ?  658  GLN A NE2   1 
ATOM   4461  N  N     . ILE A 1  659  ? 138.608 148.981 165.646 1.00 17.33  ?  659  ILE A N     1 
ATOM   4462  C  CA    . ILE A 1  659  ? 138.523 150.433 165.501 1.00 17.33  ?  659  ILE A CA    1 
ATOM   4463  C  C     . ILE A 1  659  ? 139.708 150.956 164.708 1.00 17.33  ?  659  ILE A C     1 
ATOM   4464  O  O     . ILE A 1  659  ? 139.558 151.806 163.811 1.00 17.33  ?  659  ILE A O     1 
ATOM   4465  C  CB    . ILE A 1  659  ? 138.449 151.107 166.881 1.00 17.33  ?  659  ILE A CB    1 
ATOM   4466  C  CG1   . ILE A 1  659  ? 137.348 150.498 167.730 1.00 17.33  ?  659  ILE A CG1   1 
ATOM   4467  C  CG2   . ILE A 1  659  ? 138.209 152.580 166.737 1.00 17.33  ?  659  ILE A CG2   1 
ATOM   4468  C  CD1   . ILE A 1  659  ? 137.365 150.987 169.161 1.00 17.33  ?  659  ILE A CD1   1 
ATOM   4469  N  N     . LEU A 1  660  ? 140.900 150.418 164.997 1.00 30.93  ?  660  LEU A N     1 
ATOM   4470  C  CA    . LEU A 1  660  ? 142.089 150.855 164.283 1.00 30.93  ?  660  LEU A CA    1 
ATOM   4471  C  C     . LEU A 1  660  ? 142.050 150.433 162.816 1.00 30.93  ?  660  LEU A C     1 
ATOM   4472  O  O     . LEU A 1  660  ? 142.479 151.196 161.943 1.00 30.93  ?  660  LEU A O     1 
ATOM   4473  C  CB    . LEU A 1  660  ? 143.336 150.317 164.980 1.00 30.93  ?  660  LEU A CB    1 
ATOM   4474  C  CG    . LEU A 1  660  ? 143.782 151.138 166.187 1.00 30.93  ?  660  LEU A CG    1 
ATOM   4475  C  CD1   . LEU A 1  660  ? 144.987 150.499 166.836 1.00 30.93  ?  660  LEU A CD1   1 
ATOM   4476  C  CD2   . LEU A 1  660  ? 144.062 152.580 165.803 1.00 30.93  ?  660  LEU A CD2   1 
ATOM   4477  N  N     . GLU A 1  661  ? 141.504 149.245 162.525 1.00 25.28  ?  661  GLU A N     1 
ATOM   4478  C  CA    . GLU A 1  661  ? 141.419 148.766 161.146 1.00 25.28  ?  661  GLU A CA    1 
ATOM   4479  C  C     . GLU A 1  661  ? 140.462 149.608 160.301 1.00 25.28  ?  661  GLU A C     1 
ATOM   4480  O  O     . GLU A 1  661  ? 140.753 149.891 159.128 1.00 25.28  ?  661  GLU A O     1 
ATOM   4481  C  CB    . GLU A 1  661  ? 141.001 147.298 161.161 1.00 25.28  ?  661  GLU A CB    1 
ATOM   4482  C  CG    . GLU A 1  661  ? 141.374 146.500 159.936 1.00 25.28  ?  661  GLU A CG    1 
ATOM   4483  C  CD    . GLU A 1  661  ? 141.578 145.026 160.257 1.00 25.28  ?  661  GLU A CD    1 
ATOM   4484  O  OE1   . GLU A 1  661  ? 142.134 144.721 161.327 1.00 25.28  ?  661  GLU A OE1   1 
ATOM   4485  O  OE2   . GLU A 1  661  ? 141.181 144.170 159.444 1.00 25.28  -1 661  GLU A OE2   1 
ATOM   4486  N  N     . ASN A 1  662  ? 139.346 150.044 160.892 1.00 31.07  ?  662  ASN A N     1 
ATOM   4487  C  CA    . ASN A 1  662  ? 138.446 150.972 160.203 1.00 31.07  ?  662  ASN A CA    1 
ATOM   4488  C  C     . ASN A 1  662  ? 139.122 152.313 159.911 1.00 31.07  ?  662  ASN A C     1 
ATOM   4489  O  O     . ASN A 1  662  ? 139.003 152.846 158.793 1.00 31.07  ?  662  ASN A O     1 
ATOM   4490  C  CB    . ASN A 1  662  ? 137.183 151.175 161.041 1.00 31.07  ?  662  ASN A CB    1 
ATOM   4491  C  CG    . ASN A 1  662  ? 136.373 152.375 160.603 1.00 31.07  ?  662  ASN A CG    1 
ATOM   4492  O  OD1   . ASN A 1  662  ? 136.087 152.557 159.418 1.00 31.07  ?  662  ASN A OD1   1 
ATOM   4493  N  ND2   . ASN A 1  662  ? 135.988 153.205 161.566 1.00 31.07  ?  662  ASN A ND2   1 
ATOM   4494  N  N     . LEU A 1  663  ? 139.844 152.869 160.895 1.00 27.56  ?  663  LEU A N     1 
ATOM   4495  C  CA    . LEU A 1  663  ? 140.519 154.148 160.663 1.00 27.56  ?  663  LEU A CA    1 
ATOM   4496  C  C     . LEU A 1  663  ? 141.634 154.030 159.625 1.00 27.56  ?  663  LEU A C     1 
ATOM   4497  O  O     . LEU A 1  663  ? 141.852 154.956 158.821 1.00 27.56  ?  663  LEU A O     1 
ATOM   4498  C  CB    . LEU A 1  663  ? 141.080 154.689 161.974 1.00 27.56  ?  663  LEU A CB    1 
ATOM   4499  C  CG    . LEU A 1  663  ? 140.146 155.538 162.827 1.00 27.56  ?  663  LEU A CG    1 
ATOM   4500  C  CD1   . LEU A 1  663  ? 140.695 155.640 164.214 1.00 27.56  ?  663  LEU A CD1   1 
ATOM   4501  C  CD2   . LEU A 1  663  ? 140.020 156.901 162.223 1.00 27.56  ?  663  LEU A CD2   1 
ATOM   4502  N  N     . LEU A 1  664  ? 142.302 152.879 159.595 1.00 31.54  ?  664  LEU A N     1 
ATOM   4503  C  CA    . LEU A 1  664  ? 143.393 152.665 158.655 1.00 31.54  ?  664  LEU A CA    1 
ATOM   4504  C  C     . LEU A 1  664  ? 142.877 152.540 157.226 1.00 31.54  ?  664  LEU A C     1 
ATOM   4505  O  O     . LEU A 1  664  ? 143.484 153.072 156.287 1.00 31.54  ?  664  LEU A O     1 
ATOM   4506  C  CB    . LEU A 1  664  ? 144.174 151.425 159.086 1.00 31.54  ?  664  LEU A CB    1 
ATOM   4507  C  CG    . LEU A 1  664  ? 145.376 150.905 158.327 1.00 31.54  ?  664  LEU A CG    1 
ATOM   4508  C  CD1   . LEU A 1  664  ? 146.452 150.578 159.324 1.00 31.54  ?  664  LEU A CD1   1 
ATOM   4509  C  CD2   . LEU A 1  664  ? 144.970 149.660 157.579 1.00 31.54  ?  664  LEU A CD2   1 
ATOM   4510  N  N     . SER A 1  665  ? 141.732 151.870 157.042 1.00 34.11  ?  665  SER A N     1 
ATOM   4511  C  CA    . SER A 1  665  ? 141.138 151.820 155.706 1.00 34.11  ?  665  SER A CA    1 
ATOM   4512  C  C     . SER A 1  665  ? 140.637 153.185 155.239 1.00 34.11  ?  665  SER A C     1 
ATOM   4513  O  O     . SER A 1  665  ? 140.746 153.496 154.046 1.00 34.11  ?  665  SER A O     1 
ATOM   4514  C  CB    . SER A 1  665  ? 140.004 150.800 155.664 1.00 34.11  ?  665  SER A CB    1 
ATOM   4515  O  OG    . SER A 1  665  ? 139.465 150.724 154.361 1.00 34.11  ?  665  SER A OG    1 
ATOM   4516  N  N     . ALA A 1  666  ? 140.099 154.008 156.147 1.00 32.84  ?  666  ALA A N     1 
ATOM   4517  C  CA    . ALA A 1  666  ? 139.672 155.356 155.754 1.00 32.84  ?  666  ALA A CA    1 
ATOM   4518  C  C     . ALA A 1  666  ? 140.847 156.217 155.294 1.00 32.84  ?  666  ALA A C     1 
ATOM   4519  O  O     . ALA A 1  666  ? 140.750 156.933 154.286 1.00 32.84  ?  666  ALA A O     1 
ATOM   4520  C  CB    . ALA A 1  666  ? 138.942 156.040 156.905 1.00 32.84  ?  666  ALA A CB    1 
ATOM   4521  N  N     . ARG A 1  667  ? 141.980 156.136 156.001 1.00 38.65  ?  667  ARG A N     1 
ATOM   4522  C  CA    . ARG A 1  667  ? 143.158 156.898 155.576 1.00 38.65  ?  667  ARG A CA    1 
ATOM   4523  C  C     . ARG A 1  667  ? 143.748 156.356 154.272 1.00 38.65  ?  667  ARG A C     1 
ATOM   4524  O  O     . ARG A 1  667  ? 144.252 157.131 153.445 1.00 38.65  ?  667  ARG A O     1 
ATOM   4525  C  CB    . ARG A 1  667  ? 144.214 156.900 156.674 1.00 38.65  ?  667  ARG A CB    1 
ATOM   4526  C  CG    . ARG A 1  667  ? 145.310 157.948 156.497 1.00 38.65  ?  667  ARG A CG    1 
ATOM   4527  C  CD    . ARG A 1  667  ? 146.654 157.381 156.908 1.00 38.65  ?  667  ARG A CD    1 
ATOM   4528  N  NE    . ARG A 1  667  ? 147.739 158.353 156.839 1.00 38.65  ?  667  ARG A NE    1 
ATOM   4529  C  CZ    . ARG A 1  667  ? 149.023 158.036 156.969 1.00 38.65  ?  667  ARG A CZ    1 
ATOM   4530  N  NH1   . ARG A 1  667  ? 149.379 156.776 157.169 1.00 38.65  1  667  ARG A NH1   1 
ATOM   4531  N  NH2   . ARG A 1  667  ? 149.947 158.981 156.897 1.00 38.65  ?  667  ARG A NH2   1 
ATOM   4532  N  N     . LYS A 1  668  ? 143.685 155.032 154.068 1.00 43.64  ?  668  LYS A N     1 
ATOM   4533  C  CA    . LYS A 1  668  ? 144.156 154.442 152.815 1.00 43.64  ?  668  LYS A CA    1 
ATOM   4534  C  C     . LYS A 1  668  ? 143.315 154.896 151.625 1.00 43.64  ?  668  LYS A C     1 
ATOM   4535  O  O     . LYS A 1  668  ? 143.853 155.156 150.540 1.00 43.64  ?  668  LYS A O     1 
ATOM   4536  C  CB    . LYS A 1  668  ? 144.142 152.922 152.929 1.00 43.64  ?  668  LYS A CB    1 
ATOM   4537  C  CG    . LYS A 1  668  ? 144.949 152.195 151.887 1.00 43.64  ?  668  LYS A CG    1 
ATOM   4538  C  CD    . LYS A 1  668  ? 145.273 150.797 152.377 1.00 43.64  ?  668  LYS A CD    1 
ATOM   4539  C  CE    . LYS A 1  668  ? 146.226 150.067 151.441 1.00 43.64  ?  668  LYS A CE    1 
ATOM   4540  N  NZ    . LYS A 1  668  ? 146.599 148.727 151.972 1.00 43.64  1  668  LYS A NZ    1 
ATOM   4541  N  N     . ARG A 1  669  ? 141.995 155.015 151.814 1.00 43.40  ?  669  ARG A N     1 
ATOM   4542  C  CA    . ARG A 1  669  ? 141.141 155.551 150.752 1.00 43.40  ?  669  ARG A CA    1 
ATOM   4543  C  C     . ARG A 1  669  ? 141.437 157.018 150.480 1.00 43.40  ?  669  ARG A C     1 
ATOM   4544  O  O     . ARG A 1  669  ? 141.395 157.456 149.323 1.00 43.40  ?  669  ARG A O     1 
ATOM   4545  C  CB    . ARG A 1  669  ? 139.668 155.382 151.111 1.00 43.40  ?  669  ARG A CB    1 
ATOM   4546  C  CG    . ARG A 1  669  ? 139.091 154.007 150.822 1.00 43.40  ?  669  ARG A CG    1 
ATOM   4547  C  CD    . ARG A 1  669  ? 137.569 154.044 150.814 1.00 43.40  ?  669  ARG A CD    1 
ATOM   4548  N  NE    . ARG A 1  669  ? 137.020 155.185 151.549 1.00 43.40  ?  669  ARG A NE    1 
ATOM   4549  C  CZ    . ARG A 1  669  ? 136.561 155.133 152.796 1.00 43.40  ?  669  ARG A CZ    1 
ATOM   4550  N  NH1   . ARG A 1  669  ? 136.593 153.993 153.471 1.00 43.40  1  669  ARG A NH1   1 
ATOM   4551  N  NH2   . ARG A 1  669  ? 136.077 156.225 153.371 1.00 43.40  ?  669  ARG A NH2   1 
ATOM   4552  N  N     . ALA A 1  670  ? 141.742 157.794 151.525 1.00 46.73  ?  670  ALA A N     1 
ATOM   4553  C  CA    . ALA A 1  670  ? 142.101 159.198 151.314 1.00 46.73  ?  670  ALA A CA    1 
ATOM   4554  C  C     . ALA A 1  670  ? 143.404 159.338 150.539 1.00 46.73  ?  670  ALA A C     1 
ATOM   4555  O  O     . ALA A 1  670  ? 143.531 160.215 149.678 1.00 46.73  ?  670  ALA A O     1 
ATOM   4556  C  CB    . ALA A 1  670  ? 142.195 159.931 152.649 1.00 46.73  ?  670  ALA A CB    1 
ATOM   4557  N  N     . LYS A 1  671  ? 144.379 158.457 150.800 1.00 53.90  ?  671  LYS A N     1 
ATOM   4558  C  CA    . LYS A 1  671  ? 145.635 158.518 150.049 1.00 53.90  ?  671  LYS A CA    1 
ATOM   4559  C  C     . LYS A 1  671  ? 145.447 158.055 148.608 1.00 53.90  ?  671  LYS A C     1 
ATOM   4560  O  O     . LYS A 1  671  ? 146.061 158.612 147.687 1.00 53.90  ?  671  LYS A O     1 
ATOM   4561  C  CB    . LYS A 1  671  ? 146.715 157.680 150.730 1.00 53.90  ?  671  LYS A CB    1 
ATOM   4562  C  CG    . LYS A 1  671  ? 147.302 158.285 151.992 1.00 53.90  ?  671  LYS A CG    1 
ATOM   4563  C  CD    . LYS A 1  671  ? 147.731 157.194 152.960 1.00 53.90  ?  671  LYS A CD    1 
ATOM   4564  C  CE    . LYS A 1  671  ? 149.111 156.653 152.643 1.00 53.90  ?  671  LYS A CE    1 
ATOM   4565  N  NZ    . LYS A 1  671  ? 150.175 157.355 153.403 1.00 53.90  1  671  LYS A NZ    1 
ATOM   4566  N  N     . ALA A 1  672  ? 144.612 157.027 148.401 1.00 65.92  ?  672  ALA A N     1 
ATOM   4567  C  CA    . ALA A 1  672  ? 144.293 156.567 147.051 1.00 65.92  ?  672  ALA A CA    1 
ATOM   4568  C  C     . ALA A 1  672  ? 143.584 157.638 146.234 1.00 65.92  ?  672  ALA A C     1 
ATOM   4569  O  O     . ALA A 1  672  ? 143.763 157.706 145.013 1.00 65.92  ?  672  ALA A O     1 
ATOM   4570  C  CB    . ALA A 1  672  ? 143.434 155.310 147.117 1.00 65.92  ?  672  ALA A CB    1 
ATOM   4571  N  N     . GLU A 1  673  ? 142.780 158.480 146.886 1.00 78.55  ?  673  GLU A N     1 
ATOM   4572  C  CA    . GLU A 1  673  ? 142.216 159.636 146.193 1.00 78.55  ?  673  GLU A CA    1 
ATOM   4573  C  C     . GLU A 1  673  ? 143.269 160.718 145.965 1.00 78.55  ?  673  GLU A C     1 
ATOM   4574  O  O     . GLU A 1  673  ? 143.220 161.437 144.964 1.00 78.55  ?  673  GLU A O     1 
ATOM   4575  C  CB    . GLU A 1  673  ? 141.031 160.188 146.987 1.00 78.55  ?  673  GLU A CB    1 
ATOM   4576  C  CG    . GLU A 1  673  ? 140.244 161.281 146.286 1.00 78.55  ?  673  GLU A CG    1 
ATOM   4577  C  CD    . GLU A 1  673  ? 140.684 162.674 146.689 1.00 78.55  ?  673  GLU A CD    1 
ATOM   4578  O  OE1   . GLU A 1  673  ? 141.281 162.820 147.777 1.00 78.55  ?  673  GLU A OE1   1 
ATOM   4579  O  OE2   . GLU A 1  673  ? 140.436 163.620 145.912 1.00 78.55  -1 673  GLU A OE2   1 
ATOM   4580  N  N     . LEU A 1  674  ? 144.222 160.865 146.891 1.00 85.30  ?  674  LEU A N     1 
ATOM   4581  C  CA    . LEU A 1  674  ? 145.225 161.918 146.755 1.00 85.30  ?  674  LEU A CA    1 
ATOM   4582  C  C     . LEU A 1  674  ? 146.250 161.600 145.675 1.00 85.30  ?  674  LEU A C     1 
ATOM   4583  O  O     . LEU A 1  674  ? 146.882 162.515 145.140 1.00 85.30  ?  674  LEU A O     1 
ATOM   4584  C  CB    . LEU A 1  674  ? 145.898 162.162 148.115 1.00 85.30  ?  674  LEU A CB    1 
ATOM   4585  C  CG    . LEU A 1  674  ? 147.288 162.772 148.351 1.00 85.30  ?  674  LEU A CG    1 
ATOM   4586  C  CD1   . LEU A 1  674  ? 147.385 164.225 147.882 1.00 85.30  ?  674  LEU A CD1   1 
ATOM   4587  C  CD2   . LEU A 1  674  ? 147.674 162.651 149.822 1.00 85.30  ?  674  LEU A CD2   1 
ATOM   4588  N  N     . ALA A 1  675  ? 146.377 160.331 145.290 1.00 101.20 ?  675  ALA A N     1 
ATOM   4589  C  CA    . ALA A 1  675  ? 147.366 159.949 144.282 1.00 101.20 ?  675  ALA A CA    1 
ATOM   4590  C  C     . ALA A 1  675  ? 146.984 160.318 142.843 1.00 101.20 ?  675  ALA A C     1 
ATOM   4591  O  O     . ALA A 1  675  ? 147.643 159.832 141.916 1.00 101.20 ?  675  ALA A O     1 
ATOM   4592  C  CB    . ALA A 1  675  ? 147.631 158.446 144.358 1.00 101.20 ?  675  ALA A CB    1 
ATOM   4593  N  N     . LYS A 1  676  ? 145.957 161.146 142.616 1.00 118.66 ?  676  LYS A N     1 
ATOM   4594  C  CA    . LYS A 1  676  ? 145.532 161.512 141.268 1.00 118.66 ?  676  LYS A CA    1 
ATOM   4595  C  C     . LYS A 1  676  ? 145.217 163.005 141.131 1.00 118.66 ?  676  LYS A C     1 
ATOM   4596  O  O     . LYS A 1  676  ? 144.436 163.408 140.267 1.00 118.66 ?  676  LYS A O     1 
ATOM   4597  C  CB    . LYS A 1  676  ? 144.344 160.644 140.837 1.00 118.66 ?  676  LYS A CB    1 
ATOM   4598  C  CG    . LYS A 1  676  ? 143.109 160.699 141.735 1.00 118.66 ?  676  LYS A CG    1 
ATOM   4599  C  CD    . LYS A 1  676  ? 141.985 161.565 141.172 1.00 118.66 ?  676  LYS A CD    1 
ATOM   4600  C  CE    . LYS A 1  676  ? 140.766 161.560 142.070 1.00 118.66 ?  676  LYS A CE    1 
ATOM   4601  N  NZ    . LYS A 1  676  ? 139.677 162.383 141.496 1.00 118.66 1  676  LYS A NZ    1 
ATOM   4602  N  N     . GLU A 1  677  ? 145.855 163.848 141.935 1.00 132.89 ?  677  GLU A N     1 
ATOM   4603  C  CA    . GLU A 1  677  ? 145.710 165.292 141.823 1.00 132.89 ?  677  GLU A CA    1 
ATOM   4604  C  C     . GLU A 1  677  ? 146.941 165.893 141.154 1.00 132.89 ?  677  GLU A C     1 
ATOM   4605  O  O     . GLU A 1  677  ? 148.044 165.350 141.247 1.00 132.89 ?  677  GLU A O     1 
ATOM   4606  C  CB    . GLU A 1  677  ? 145.507 165.925 143.202 1.00 132.89 ?  677  GLU A CB    1 
ATOM   4607  C  CG    . GLU A 1  677  ? 144.919 167.333 143.212 1.00 132.89 ?  677  GLU A CG    1 
ATOM   4608  C  CD    . GLU A 1  677  ? 143.413 167.347 143.065 1.00 132.89 ?  677  GLU A CD    1 
ATOM   4609  O  OE1   . GLU A 1  677  ? 142.788 166.270 143.186 1.00 132.89 ?  677  GLU A OE1   1 
ATOM   4610  O  OE2   . GLU A 1  677  ? 142.850 168.442 142.845 1.00 132.89 -1 677  GLU A OE2   1 
ATOM   4611  N  N     . THR A 1  678  ? 146.739 167.028 140.473 1.00 145.68 ?  678  THR A N     1 
ATOM   4612  C  CA    . THR A 1  678  ? 147.823 167.768 139.839 1.00 145.68 ?  678  THR A CA    1 
ATOM   4613  C  C     . THR A 1  678  ? 148.055 169.159 140.419 1.00 145.68 ?  678  THR A C     1 
ATOM   4614  O  O     . THR A 1  678  ? 149.150 169.703 140.254 1.00 145.68 ?  678  THR A O     1 
ATOM   4615  C  CB    . THR A 1  678  ? 147.562 167.900 138.333 1.00 145.68 ?  678  THR A CB    1 
ATOM   4616  O  OG1   . THR A 1  678  ? 146.335 168.613 138.119 1.00 145.68 ?  678  THR A OG1   1 
ATOM   4617  C  CG2   . THR A 1  678  ? 147.468 166.525 137.687 1.00 145.68 ?  678  THR A CG2   1 
ATOM   4618  N  N     . ASP A 1  679  ? 147.071 169.738 141.090 1.00 141.03 ?  679  ASP A N     1 
ATOM   4619  C  CA    . ASP A 1  679  ? 147.202 171.084 141.638 1.00 141.03 ?  679  ASP A CA    1 
ATOM   4620  C  C     . ASP A 1  679  ? 147.971 171.011 142.959 1.00 141.03 ?  679  ASP A C     1 
ATOM   4621  O  O     . ASP A 1  679  ? 147.765 170.067 143.728 1.00 141.03 ?  679  ASP A O     1 
ATOM   4622  C  CB    . ASP A 1  679  ? 145.808 171.674 141.856 1.00 141.03 ?  679  ASP A CB    1 
ATOM   4623  C  CG    . ASP A 1  679  ? 145.692 173.128 141.428 1.00 141.03 ?  679  ASP A CG    1 
ATOM   4624  O  OD1   . ASP A 1  679  ? 146.661 173.688 140.880 1.00 141.03 ?  679  ASP A OD1   1 
ATOM   4625  O  OD2   . ASP A 1  679  ? 144.593 173.697 141.586 1.00 141.03 -1 679  ASP A OD2   1 
ATOM   4626  N  N     . PRO A 1  680  ? 148.883 171.955 143.248 1.00 135.23 ?  680  PRO A N     1 
ATOM   4627  C  CA    . PRO A 1  680  ? 149.695 171.811 144.475 1.00 135.23 ?  680  PRO A CA    1 
ATOM   4628  C  C     . PRO A 1  680  ? 148.944 172.084 145.768 1.00 135.23 ?  680  PRO A C     1 
ATOM   4629  O  O     . PRO A 1  680  ? 149.093 171.313 146.727 1.00 135.23 ?  680  PRO A O     1 
ATOM   4630  C  CB    . PRO A 1  680  ? 150.833 172.817 144.262 1.00 135.23 ?  680  PRO A CB    1 
ATOM   4631  C  CG    . PRO A 1  680  ? 150.300 173.801 143.297 1.00 135.23 ?  680  PRO A CG    1 
ATOM   4632  C  CD    . PRO A 1  680  ? 149.399 173.031 142.386 1.00 135.23 ?  680  PRO A CD    1 
ATOM   4633  N  N     . LEU A 1  681  ? 148.145 173.162 145.830 1.00 123.70 ?  681  LEU A N     1 
ATOM   4634  C  CA    . LEU A 1  681  ? 147.420 173.467 147.060 1.00 123.70 ?  681  LEU A CA    1 
ATOM   4635  C  C     . LEU A 1  681  ? 146.339 172.430 147.320 1.00 123.70 ?  681  LEU A C     1 
ATOM   4636  O  O     . LEU A 1  681  ? 146.058 172.099 148.477 1.00 123.70 ?  681  LEU A O     1 
ATOM   4637  C  CB    . LEU A 1  681  ? 146.822 174.880 147.003 1.00 123.70 ?  681  LEU A CB    1 
ATOM   4638  C  CG    . LEU A 1  681  ? 146.453 175.579 148.332 1.00 123.70 ?  681  LEU A CG    1 
ATOM   4639  C  CD1   . LEU A 1  681  ? 146.651 177.078 148.252 1.00 123.70 ?  681  LEU A CD1   1 
ATOM   4640  C  CD2   . LEU A 1  681  ? 145.042 175.300 148.793 1.00 123.70 ?  681  LEU A CD2   1 
ATOM   4641  N  N     . ARG A 1  682  ? 145.762 171.869 146.258 1.00 118.63 ?  682  ARG A N     1 
ATOM   4642  C  CA    . ARG A 1  682  ? 144.815 170.781 146.445 1.00 118.63 ?  682  ARG A CA    1 
ATOM   4643  C  C     . ARG A 1  682  ? 145.523 169.529 146.944 1.00 118.63 ?  682  ARG A C     1 
ATOM   4644  O  O     . ARG A 1  682  ? 144.991 168.813 147.801 1.00 118.63 ?  682  ARG A O     1 
ATOM   4645  C  CB    . ARG A 1  682  ? 144.060 170.517 145.147 1.00 118.63 ?  682  ARG A CB    1 
ATOM   4646  C  CG    . ARG A 1  682  ? 143.338 171.746 144.604 1.00 118.63 ?  682  ARG A CG    1 
ATOM   4647  C  CD    . ARG A 1  682  ? 141.953 171.908 145.204 1.00 118.63 ?  682  ARG A CD    1 
ATOM   4648  N  NE    . ARG A 1  682  ? 142.002 172.694 146.433 1.00 118.63 ?  682  ARG A NE    1 
ATOM   4649  C  CZ    . ARG A 1  682  ? 141.873 174.017 146.493 1.00 118.63 ?  682  ARG A CZ    1 
ATOM   4650  N  NH1   . ARG A 1  682  ? 141.674 174.739 145.398 1.00 118.63 1  682  ARG A NH1   1 
ATOM   4651  N  NH2   . ARG A 1  682  ? 141.943 174.622 147.661 1.00 118.63 ?  682  ARG A NH2   1 
ATOM   4652  N  N     . ARG A 1  683  ? 146.746 169.285 146.459 1.00 120.32 ?  683  ARG A N     1 
ATOM   4653  C  CA    . ARG A 1  683  ? 147.518 168.130 146.911 1.00 120.32 ?  683  ARG A CA    1 
ATOM   4654  C  C     . ARG A 1  683  ? 147.866 168.243 148.388 1.00 120.32 ?  683  ARG A C     1 
ATOM   4655  O  O     . ARG A 1  683  ? 147.752 167.264 149.140 1.00 120.32 ?  683  ARG A O     1 
ATOM   4656  C  CB    . ARG A 1  683  ? 148.785 167.990 146.074 1.00 120.32 ?  683  ARG A CB    1 
ATOM   4657  C  CG    . ARG A 1  683  ? 148.634 167.018 144.938 1.00 120.32 ?  683  ARG A CG    1 
ATOM   4658  C  CD    . ARG A 1  683  ? 149.842 167.020 144.043 1.00 120.32 ?  683  ARG A CD    1 
ATOM   4659  N  NE    . ARG A 1  683  ? 150.060 165.699 143.469 1.00 120.32 ?  683  ARG A NE    1 
ATOM   4660  C  CZ    . ARG A 1  683  ? 150.804 164.758 144.035 1.00 120.32 ?  683  ARG A CZ    1 
ATOM   4661  N  NH1   . ARG A 1  683  ? 151.408 164.994 145.191 1.00 120.32 1  683  ARG A NH1   1 
ATOM   4662  N  NH2   . ARG A 1  683  ? 150.949 163.582 143.443 1.00 120.32 ?  683  ARG A NH2   1 
ATOM   4663  N  N     . GLN A 1  684  ? 148.227 169.444 148.843 1.00 107.62 ?  684  GLN A N     1 
ATOM   4664  C  CA    . GLN A 1  684  ? 148.484 169.595 150.266 1.00 107.62 ?  684  GLN A CA    1 
ATOM   4665  C  C     . GLN A 1  684  ? 147.210 169.600 151.113 1.00 107.62 ?  684  GLN A C     1 
ATOM   4666  O  O     . GLN A 1  684  ? 147.281 169.215 152.283 1.00 107.62 ?  684  GLN A O     1 
ATOM   4667  C  CB    . GLN A 1  684  ? 149.337 170.842 150.539 1.00 107.62 ?  684  GLN A CB    1 
ATOM   4668  C  CG    . GLN A 1  684  ? 148.695 172.175 150.286 1.00 107.62 ?  684  GLN A CG    1 
ATOM   4669  C  CD    . GLN A 1  684  ? 148.069 172.777 151.524 1.00 107.62 ?  684  GLN A CD    1 
ATOM   4670  O  OE1   . GLN A 1  684  ? 148.236 172.264 152.628 1.00 107.62 ?  684  GLN A OE1   1 
ATOM   4671  N  NE2   . GLN A 1  684  ? 147.335 173.865 151.343 1.00 107.62 ?  684  GLN A NE2   1 
ATOM   4672  N  N     . VAL A 1  685  ? 146.042 169.978 150.576 1.00 94.09  ?  685  VAL A N     1 
ATOM   4673  C  CA    . VAL A 1  685  ? 144.882 169.882 151.466 1.00 94.09  ?  685  VAL A CA    1 
ATOM   4674  C  C     . VAL A 1  685  ? 144.365 168.438 151.557 1.00 94.09  ?  685  VAL A C     1 
ATOM   4675  O  O     . VAL A 1  685  ? 143.834 168.028 152.606 1.00 94.09  ?  685  VAL A O     1 
ATOM   4676  C  CB    . VAL A 1  685  ? 143.766 170.882 151.096 1.00 94.09  ?  685  VAL A CB    1 
ATOM   4677  C  CG1   . VAL A 1  685  ? 144.269 172.322 151.193 1.00 94.09  ?  685  VAL A CG1   1 
ATOM   4678  C  CG2   . VAL A 1  685  ? 143.151 170.607 149.748 1.00 94.09  ?  685  VAL A CG2   1 
ATOM   4679  N  N     . LEU A 1  686  ? 144.563 167.615 150.517 1.00 86.90  ?  686  LEU A N     1 
ATOM   4680  C  CA    . LEU A 1  686  ? 144.306 166.182 150.701 1.00 86.90  ?  686  LEU A CA    1 
ATOM   4681  C  C     . LEU A 1  686  ? 145.355 165.535 151.603 1.00 86.90  ?  686  LEU A C     1 
ATOM   4682  O  O     . LEU A 1  686  ? 145.041 164.578 152.337 1.00 86.90  ?  686  LEU A O     1 
ATOM   4683  C  CB    . LEU A 1  686  ? 144.231 165.452 149.361 1.00 86.90  ?  686  LEU A CB    1 
ATOM   4684  C  CG    . LEU A 1  686  ? 143.455 166.076 148.196 1.00 86.90  ?  686  LEU A CG    1 
ATOM   4685  C  CD1   . LEU A 1  686  ? 143.476 165.199 146.951 1.00 86.90  ?  686  LEU A CD1   1 
ATOM   4686  C  CD2   . LEU A 1  686  ? 142.019 166.453 148.582 1.00 86.90  ?  686  LEU A CD2   1 
ATOM   4687  N  N     . ASP A 1  687  ? 146.586 166.064 151.598 1.00 68.28  ?  687  ASP A N     1 
ATOM   4688  C  CA    . ASP A 1  687  ? 147.577 165.647 152.589 1.00 68.28  ?  687  ASP A CA    1 
ATOM   4689  C  C     . ASP A 1  687  ? 147.121 166.022 154.002 1.00 68.28  ?  687  ASP A C     1 
ATOM   4690  O  O     . ASP A 1  687  ? 147.334 165.263 154.955 1.00 68.28  ?  687  ASP A O     1 
ATOM   4691  C  CB    . ASP A 1  687  ? 148.930 166.284 152.249 1.00 68.28  ?  687  ASP A CB    1 
ATOM   4692  C  CG    . ASP A 1  687  ? 150.097 165.714 153.056 1.00 68.28  ?  687  ASP A CG    1 
ATOM   4693  O  OD1   . ASP A 1  687  ? 149.914 164.795 153.881 1.00 68.28  ?  687  ASP A OD1   1 
ATOM   4694  O  OD2   . ASP A 1  687  ? 151.227 166.200 152.856 1.00 68.28  -1 687  ASP A OD2   1 
ATOM   4695  N  N     . GLY A 1  688  ? 146.466 167.174 154.145 1.00 59.38  ?  688  GLY A N     1 
ATOM   4696  C  CA    . GLY A 1  688  ? 145.902 167.557 155.433 1.00 59.38  ?  688  GLY A CA    1 
ATOM   4697  C  C     . GLY A 1  688  ? 144.812 166.616 155.914 1.00 59.38  ?  688  GLY A C     1 
ATOM   4698  O  O     . GLY A 1  688  ? 144.754 166.273 157.101 1.00 59.38  ?  688  GLY A O     1 
ATOM   4699  N  N     . ARG A 1  689  ? 143.950 166.174 154.994 1.00 51.11  ?  689  ARG A N     1 
ATOM   4700  C  CA    . ARG A 1  689  ? 142.909 165.199 155.328 1.00 51.11  ?  689  ARG A CA    1 
ATOM   4701  C  C     . ARG A 1  689  ? 143.511 163.872 155.803 1.00 51.11  ?  689  ARG A C     1 
ATOM   4702  O  O     . ARG A 1  689  ? 143.089 163.304 156.828 1.00 51.11  ?  689  ARG A O     1 
ATOM   4703  C  CB    . ARG A 1  689  ? 142.012 164.993 154.107 1.00 51.11  ?  689  ARG A CB    1 
ATOM   4704  C  CG    . ARG A 1  689  ? 140.837 164.041 154.260 1.00 51.11  ?  689  ARG A CG    1 
ATOM   4705  C  CD    . ARG A 1  689  ? 139.855 164.243 153.103 1.00 51.11  ?  689  ARG A CD    1 
ATOM   4706  N  NE    . ARG A 1  689  ? 138.985 163.094 152.866 1.00 51.11  ?  689  ARG A NE    1 
ATOM   4707  C  CZ    . ARG A 1  689  ? 139.116 162.243 151.849 1.00 51.11  ?  689  ARG A CZ    1 
ATOM   4708  N  NH1   . ARG A 1  689  ? 140.090 162.397 150.960 1.00 51.11  1  689  ARG A NH1   1 
ATOM   4709  N  NH2   . ARG A 1  689  ? 138.271 161.230 151.720 1.00 51.11  ?  689  ARG A NH2   1 
ATOM   4710  N  N     . GLN A 1  690  ? 144.540 163.384 155.102 1.00 48.96  ?  690  GLN A N     1 
ATOM   4711  C  CA    . GLN A 1  690  ? 145.098 162.094 155.502 1.00 48.96  ?  690  GLN A CA    1 
ATOM   4712  C  C     . GLN A 1  690  ? 145.940 162.206 156.773 1.00 48.96  ?  690  GLN A C     1 
ATOM   4713  O  O     . GLN A 1  690  ? 146.039 161.239 157.543 1.00 48.96  ?  690  GLN A O     1 
ATOM   4714  C  CB    . GLN A 1  690  ? 145.891 161.457 154.358 1.00 48.96  ?  690  GLN A CB    1 
ATOM   4715  C  CG    . GLN A 1  690  ? 147.164 162.149 153.902 1.00 48.96  ?  690  GLN A CG    1 
ATOM   4716  C  CD    . GLN A 1  690  ? 148.399 161.707 154.665 1.00 48.96  ?  690  GLN A CD    1 
ATOM   4717  O  OE1   . GLN A 1  690  ? 148.360 160.746 155.428 1.00 48.96  ?  690  GLN A OE1   1 
ATOM   4718  N  NE2   . GLN A 1  690  ? 149.504 162.393 154.437 1.00 48.96  ?  690  GLN A NE2   1 
ATOM   4719  N  N     . LEU A 1  691  ? 146.505 163.392 157.000 1.00 42.93  ?  691  LEU A N     1 
ATOM   4720  C  CA    . LEU A 1  691  ? 147.258 163.671 158.217 1.00 42.93  ?  691  LEU A CA    1 
ATOM   4721  C  C     . LEU A 1  691  ? 146.307 163.610 159.418 1.00 42.93  ?  691  LEU A C     1 
ATOM   4722  O  O     . LEU A 1  691  ? 146.650 163.063 160.466 1.00 42.93  ?  691  LEU A O     1 
ATOM   4723  C  CB    . LEU A 1  691  ? 147.929 165.042 158.136 1.00 42.93  ?  691  LEU A CB    1 
ATOM   4724  C  CG    . LEU A 1  691  ? 146.999 166.246 157.972 1.00 42.93  ?  691  LEU A CG    1 
ATOM   4725  C  CD1   . LEU A 1  691  ? 146.664 166.854 159.325 1.00 42.93  ?  691  LEU A CD1   1 
ATOM   4726  C  CD2   . LEU A 1  691  ? 147.624 167.286 157.054 1.00 42.93  ?  691  LEU A CD2   1 
ATOM   4727  N  N     . ALA A 1  692  ? 145.111 164.178 159.252 1.00 33.15  ?  692  ALA A N     1 
ATOM   4728  C  CA    . ALA A 1  692  ? 144.086 164.163 160.290 1.00 33.15  ?  692  ALA A CA    1 
ATOM   4729  C  C     . ALA A 1  692  ? 143.647 162.740 160.622 1.00 33.15  ?  692  ALA A C     1 
ATOM   4730  O  O     . ALA A 1  692  ? 143.468 162.395 161.799 1.00 33.15  ?  692  ALA A O     1 
ATOM   4731  C  CB    . ALA A 1  692  ? 142.892 165.012 159.862 1.00 33.15  ?  692  ALA A CB    1 
ATOM   4732  N  N     . LEU A 1  693  ? 143.513 161.883 159.609 1.00 26.94  ?  693  LEU A N     1 
ATOM   4733  C  CA    . LEU A 1  693  ? 143.119 160.503 159.919 1.00 26.94  ?  693  LEU A CA    1 
ATOM   4734  C  C     . LEU A 1  693  ? 144.249 159.702 160.580 1.00 26.94  ?  693  LEU A C     1 
ATOM   4735  O  O     . LEU A 1  693  ? 143.991 158.853 161.451 1.00 26.94  ?  693  LEU A O     1 
ATOM   4736  C  CB    . LEU A 1  693  ? 142.618 159.815 158.657 1.00 26.94  ?  693  LEU A CB    1 
ATOM   4737  C  CG    . LEU A 1  693  ? 141.311 160.440 158.164 1.00 26.94  ?  693  LEU A CG    1 
ATOM   4738  C  CD1   . LEU A 1  693  ? 141.062 160.145 156.701 1.00 26.94  ?  693  LEU A CD1   1 
ATOM   4739  C  CD2   . LEU A 1  693  ? 140.149 159.953 158.996 1.00 26.94  ?  693  LEU A CD2   1 
ATOM   4740  N  N     . LYS A 1  694  ? 145.505 159.996 160.238 1.00 26.47  ?  694  LYS A N     1 
ATOM   4741  C  CA    . LYS A 1  694  ? 146.619 159.348 160.932 1.00 26.47  ?  694  LYS A CA    1 
ATOM   4742  C  C     . LYS A 1  694  ? 146.764 159.842 162.379 1.00 26.47  ?  694  LYS A C     1 
ATOM   4743  O  O     . LYS A 1  694  ? 147.101 159.049 163.275 1.00 26.47  ?  694  LYS A O     1 
ATOM   4744  C  CB    . LYS A 1  694  ? 147.903 159.565 160.132 1.00 26.47  ?  694  LYS A CB    1 
ATOM   4745  C  CG    . LYS A 1  694  ? 149.184 159.190 160.816 1.00 26.47  ?  694  LYS A CG    1 
ATOM   4746  C  CD    . LYS A 1  694  ? 150.322 160.005 160.256 1.00 26.47  ?  694  LYS A CD    1 
ATOM   4747  C  CE    . LYS A 1  694  ? 151.331 160.382 161.315 1.00 26.47  ?  694  LYS A CE    1 
ATOM   4748  N  NZ    . LYS A 1  694  ? 152.576 160.932 160.724 1.00 26.47  1  694  LYS A NZ    1 
ATOM   4749  N  N     . VAL A 1  695  ? 146.465 161.123 162.633 1.00 24.08  ?  695  VAL A N     1 
ATOM   4750  C  CA    . VAL A 1  695  ? 146.477 161.659 163.993 1.00 24.08  ?  695  VAL A CA    1 
ATOM   4751  C  C     . VAL A 1  695  ? 145.390 161.010 164.838 1.00 24.08  ?  695  VAL A C     1 
ATOM   4752  O  O     . VAL A 1  695  ? 145.612 160.691 166.014 1.00 24.08  ?  695  VAL A O     1 
ATOM   4753  C  CB    . VAL A 1  695  ? 146.349 163.196 163.950 1.00 24.08  ?  695  VAL A CB    1 
ATOM   4754  C  CG1   . VAL A 1  695  ? 145.813 163.777 165.254 1.00 24.08  ?  695  VAL A CG1   1 
ATOM   4755  C  CG2   . VAL A 1  695  ? 147.690 163.809 163.659 1.00 24.08  ?  695  VAL A CG2   1 
ATOM   4756  N  N     . SER A 1  696  ? 144.217 160.759 164.239 1.00 23.97  ?  696  SER A N     1 
ATOM   4757  C  CA    . SER A 1  696  ? 143.145 160.060 164.950 1.00 23.97  ?  696  SER A CA    1 
ATOM   4758  C  C     . SER A 1  696  ? 143.553 158.638 165.331 1.00 23.97  ?  696  SER A C     1 
ATOM   4759  O  O     . SER A 1  696  ? 143.340 158.204 166.481 1.00 23.97  ?  696  SER A O     1 
ATOM   4760  C  CB    . SER A 1  696  ? 141.885 160.034 164.089 1.00 23.97  ?  696  SER A CB    1 
ATOM   4761  O  OG    . SER A 1  696  ? 141.420 161.342 163.823 1.00 23.97  ?  696  SER A OG    1 
ATOM   4762  N  N     . ALA A 1  697  ? 144.178 157.915 164.394 1.00 19.64  ?  697  ALA A N     1 
ATOM   4763  C  CA    . ALA A 1  697  ? 144.604 156.549 164.689 1.00 19.64  ?  697  ALA A CA    1 
ATOM   4764  C  C     . ALA A 1  697  ? 145.693 156.492 165.755 1.00 19.64  ?  697  ALA A C     1 
ATOM   4765  O  O     . ALA A 1  697  ? 145.722 155.547 166.546 1.00 19.64  ?  697  ALA A O     1 
ATOM   4766  C  CB    . ALA A 1  697  ? 145.092 155.855 163.425 1.00 19.64  ?  697  ALA A CB    1 
ATOM   4767  N  N     . ASN A 1  698  ? 146.586 157.487 165.807 1.00 23.74  ?  698  ASN A N     1 
ATOM   4768  C  CA    . ASN A 1  698  ? 147.621 157.470 166.844 1.00 23.74  ?  698  ASN A CA    1 
ATOM   4769  C  C     . ASN A 1  698  ? 147.097 157.944 168.198 1.00 23.74  ?  698  ASN A C     1 
ATOM   4770  O  O     . ASN A 1  698  ? 147.588 157.500 169.248 1.00 23.74  ?  698  ASN A O     1 
ATOM   4771  C  CB    . ASN A 1  698  ? 148.819 158.319 166.412 1.00 23.74  ?  698  ASN A CB    1 
ATOM   4772  C  CG    . ASN A 1  698  ? 149.728 157.600 165.439 1.00 23.74  ?  698  ASN A CG    1 
ATOM   4773  O  OD1   . ASN A 1  698  ? 149.796 156.375 165.415 1.00 23.74  ?  698  ASN A OD1   1 
ATOM   4774  N  ND2   . ASN A 1  698  ? 150.431 158.364 164.626 1.00 23.74  ?  698  ASN A ND2   1 
ATOM   4775  N  N     . SER A 1  699  ? 146.089 158.822 168.204 1.00 22.06  ?  699  SER A N     1 
ATOM   4776  C  CA    . SER A 1  699  ? 145.466 159.229 169.458 1.00 22.06  ?  699  SER A CA    1 
ATOM   4777  C  C     . SER A 1  699  ? 144.640 158.119 170.085 1.00 22.06  ?  699  SER A C     1 
ATOM   4778  O  O     . SER A 1  699  ? 144.385 158.176 171.292 1.00 22.06  ?  699  SER A O     1 
ATOM   4779  C  CB    . SER A 1  699  ? 144.587 160.446 169.245 1.00 22.06  ?  699  SER A CB    1 
ATOM   4780  O  OG    . SER A 1  699  ? 143.695 160.578 170.323 1.00 22.06  ?  699  SER A OG    1 
ATOM   4781  N  N     . VAL A 1  700  ? 144.234 157.117 169.296 1.00 20.33  ?  700  VAL A N     1 
ATOM   4782  C  CA    . VAL A 1  700  ? 143.674 155.888 169.872 1.00 20.33  ?  700  VAL A CA    1 
ATOM   4783  C  C     . VAL A 1  700  ? 144.673 155.215 170.823 1.00 20.33  ?  700  VAL A C     1 
ATOM   4784  O  O     . VAL A 1  700  ? 144.319 154.832 171.942 1.00 20.33  ?  700  VAL A O     1 
ATOM   4785  C  CB    . VAL A 1  700  ? 143.215 154.930 168.759 1.00 20.33  ?  700  VAL A CB    1 
ATOM   4786  C  CG1   . VAL A 1  700  ? 142.904 153.549 169.309 1.00 20.33  ?  700  VAL A CG1   1 
ATOM   4787  C  CG2   . VAL A 1  700  ? 142.010 155.486 168.074 1.00 20.33  ?  700  VAL A CG2   1 
ATOM   4788  N  N     . TYR A 1  701  ? 145.934 155.065 170.396 1.00 17.44  ?  701  TYR A N     1 
ATOM   4789  C  CA    . TYR A 1  701  ? 146.972 154.514 171.275 1.00 17.44  ?  701  TYR A CA    1 
ATOM   4790  C  C     . TYR A 1  701  ? 147.292 155.448 172.435 1.00 17.44  ?  701  TYR A C     1 
ATOM   4791  O  O     . TYR A 1  701  ? 147.546 154.992 173.553 1.00 17.44  ?  701  TYR A O     1 
ATOM   4792  C  CB    . TYR A 1  701  ? 148.244 154.214 170.472 1.00 17.44  ?  701  TYR A CB    1 
ATOM   4793  C  CG    . TYR A 1  701  ? 149.552 154.455 171.217 1.00 17.44  ?  701  TYR A CG    1 
ATOM   4794  C  CD1   . TYR A 1  701  ? 150.069 153.520 172.094 1.00 17.44  ?  701  TYR A CD1   1 
ATOM   4795  C  CD2   . TYR A 1  701  ? 150.273 155.632 171.024 1.00 17.44  ?  701  TYR A CD2   1 
ATOM   4796  C  CE1   . TYR A 1  701  ? 151.264 153.755 172.760 1.00 17.44  ?  701  TYR A CE1   1 
ATOM   4797  C  CE2   . TYR A 1  701  ? 151.442 155.876 171.693 1.00 17.44  ?  701  TYR A CE2   1 
ATOM   4798  C  CZ    . TYR A 1  701  ? 151.939 154.939 172.549 1.00 17.44  ?  701  TYR A CZ    1 
ATOM   4799  O  OH    . TYR A 1  701  ? 153.116 155.197 173.197 1.00 17.44  ?  701  TYR A OH    1 
ATOM   4800  N  N     . GLY A 1  702  ? 147.332 156.755 172.180 1.00 17.74  ?  702  GLY A N     1 
ATOM   4801  C  CA    . GLY A 1  702  ? 147.639 157.694 173.251 1.00 17.74  ?  702  GLY A CA    1 
ATOM   4802  C  C     . GLY A 1  702  ? 146.551 157.834 174.295 1.00 17.74  ?  702  GLY A C     1 
ATOM   4803  O  O     . GLY A 1  702  ? 146.804 158.396 175.364 1.00 17.74  ?  702  GLY A O     1 
ATOM   4804  N  N     . PHE A 1  703  ? 145.336 157.364 173.991 1.00 18.43  ?  703  PHE A N     1 
ATOM   4805  C  CA    . PHE A 1  703  ? 144.271 157.293 174.989 1.00 18.43  ?  703  PHE A CA    1 
ATOM   4806  C  C     . PHE A 1  703  ? 144.632 156.368 176.141 1.00 18.43  ?  703  PHE A C     1 
ATOM   4807  O  O     . PHE A 1  703  ? 144.257 156.626 177.289 1.00 18.43  ?  703  PHE A O     1 
ATOM   4808  C  CB    . PHE A 1  703  ? 142.986 156.813 174.327 1.00 18.43  ?  703  PHE A CB    1 
ATOM   4809  C  CG    . PHE A 1  703  ? 141.799 156.795 175.237 1.00 18.43  ?  703  PHE A CG    1 
ATOM   4810  C  CD1   . PHE A 1  703  ? 141.348 157.957 175.830 1.00 18.43  ?  703  PHE A CD1   1 
ATOM   4811  C  CD2   . PHE A 1  703  ? 141.116 155.617 175.476 1.00 18.43  ?  703  PHE A CD2   1 
ATOM   4812  C  CE1   . PHE A 1  703  ? 140.252 157.947 176.654 1.00 18.43  ?  703  PHE A CE1   1 
ATOM   4813  C  CE2   . PHE A 1  703  ? 140.027 155.599 176.294 1.00 18.43  ?  703  PHE A CE2   1 
ATOM   4814  C  CZ    . PHE A 1  703  ? 139.590 156.769 176.887 1.00 18.43  ?  703  PHE A CZ    1 
ATOM   4815  N  N     . THR A 1  704  ? 145.349 155.281 175.851 1.00 25.83  ?  704  THR A N     1 
ATOM   4816  C  CA    . THR A 1  704  ? 145.612 154.257 176.856 1.00 25.83  ?  704  THR A CA    1 
ATOM   4817  C  C     . THR A 1  704  ? 146.540 154.763 177.962 1.00 25.83  ?  704  THR A C     1 
ATOM   4818  O  O     . THR A 1  704  ? 146.300 154.508 179.146 1.00 25.83  ?  704  THR A O     1 
ATOM   4819  C  CB    . THR A 1  704  ? 146.178 153.021 176.158 1.00 25.83  ?  704  THR A CB    1 
ATOM   4820  O  OG1   . THR A 1  704  ? 145.137 152.379 175.420 1.00 25.83  ?  704  THR A OG1   1 
ATOM   4821  C  CG2   . THR A 1  704  ? 146.757 152.049 177.114 1.00 25.83  ?  704  THR A CG2   1 
ATOM   4822  N  N     . GLY A 1  705  ? 147.560 155.528 177.613 1.00 27.67  ?  705  GLY A N     1 
ATOM   4823  C  CA    . GLY A 1  705  ? 148.531 155.962 178.591 1.00 27.67  ?  705  GLY A CA    1 
ATOM   4824  C  C     . GLY A 1  705  ? 148.231 157.244 179.343 1.00 27.67  ?  705  GLY A C     1 
ATOM   4825  O  O     . GLY A 1  705  ? 149.073 157.677 180.133 1.00 27.67  ?  705  GLY A O     1 
ATOM   4826  N  N     . ALA A 1  706  ? 147.069 157.856 179.146 1.00 31.39  ?  706  ALA A N     1 
ATOM   4827  C  CA    . ALA A 1  706  ? 146.758 159.145 179.767 1.00 31.39  ?  706  ALA A CA    1 
ATOM   4828  C  C     . ALA A 1  706  ? 146.182 158.908 181.155 1.00 31.39  ?  706  ALA A C     1 
ATOM   4829  O  O     . ALA A 1  706  ? 144.982 158.672 181.311 1.00 31.39  ?  706  ALA A O     1 
ATOM   4830  C  CB    . ALA A 1  706  ? 145.796 159.949 178.902 1.00 31.39  ?  706  ALA A CB    1 
ATOM   4831  N  N     . GLN A 1  707  ? 147.039 159.021 182.176 1.00 44.50  ?  707  GLN A N     1 
ATOM   4832  C  CA    . GLN A 1  707  ? 146.656 158.735 183.555 1.00 44.50  ?  707  GLN A CA    1 
ATOM   4833  C  C     . GLN A 1  707  ? 145.661 159.743 184.118 1.00 44.50  ?  707  GLN A C     1 
ATOM   4834  O  O     . GLN A 1  707  ? 145.011 159.453 185.123 1.00 44.50  ?  707  GLN A O     1 
ATOM   4835  C  CB    . GLN A 1  707  ? 147.906 158.679 184.428 1.00 44.50  ?  707  GLN A CB    1 
ATOM   4836  C  CG    . GLN A 1  707  ? 148.890 157.584 184.022 1.00 44.50  ?  707  GLN A CG    1 
ATOM   4837  C  CD    . GLN A 1  707  ? 150.293 157.853 184.522 1.00 44.50  ?  707  GLN A CD    1 
ATOM   4838  O  OE1   . GLN A 1  707  ? 150.483 158.598 185.477 1.00 44.50  ?  707  GLN A OE1   1 
ATOM   4839  N  NE2   . GLN A 1  707  ? 151.282 157.265 183.870 1.00 44.50  ?  707  GLN A NE2   1 
ATOM   4840  N  N     . VAL A 1  708  ? 145.537 160.910 183.505 1.00 45.49  ?  708  VAL A N     1 
ATOM   4841  C  CA    . VAL A 1  708  ? 144.431 161.820 183.754 1.00 45.49  ?  708  VAL A CA    1 
ATOM   4842  C  C     . VAL A 1  708  ? 143.544 161.737 182.517 1.00 45.49  ?  708  VAL A C     1 
ATOM   4843  O  O     . VAL A 1  708  ? 143.875 162.284 181.462 1.00 45.49  ?  708  VAL A O     1 
ATOM   4844  C  CB    . VAL A 1  708  ? 144.915 163.244 184.023 1.00 45.49  ?  708  VAL A CB    1 
ATOM   4845  C  CG1   . VAL A 1  708  ? 143.745 164.188 184.123 1.00 45.49  ?  708  VAL A CG1   1 
ATOM   4846  C  CG2   . VAL A 1  708  ? 145.722 163.281 185.287 1.00 45.49  ?  708  VAL A CG2   1 
ATOM   4847  N  N     . GLY A 1  709  ? 142.421 161.039 182.633 1.00 36.41  ?  709  GLY A N     1 
ATOM   4848  C  CA    . GLY A 1  709  ? 141.645 160.705 181.457 1.00 36.41  ?  709  GLY A CA    1 
ATOM   4849  C  C     . GLY A 1  709  ? 140.317 160.071 181.796 1.00 36.41  ?  709  GLY A C     1 
ATOM   4850  O  O     . GLY A 1  709  ? 139.594 160.571 182.662 1.00 36.41  ?  709  GLY A O     1 
ATOM   4851  N  N     . LYS A 1  710  ? 139.961 158.992 181.102 1.00 31.70  ?  710  LYS A N     1 
ATOM   4852  C  CA    . LYS A 1  710  ? 138.735 158.303 181.467 1.00 31.70  ?  710  LYS A CA    1 
ATOM   4853  C  C     . LYS A 1  710  ? 138.921 156.797 181.619 1.00 31.70  ?  710  LYS A C     1 
ATOM   4854  O  O     . LYS A 1  710  ? 138.157 156.174 182.361 1.00 31.70  ?  710  LYS A O     1 
ATOM   4855  C  CB    . LYS A 1  710  ? 137.621 158.630 180.471 1.00 31.70  ?  710  LYS A CB    1 
ATOM   4856  C  CG    . LYS A 1  710  ? 136.636 159.654 181.035 1.00 31.70  ?  710  LYS A CG    1 
ATOM   4857  C  CD    . LYS A 1  710  ? 135.713 160.258 179.998 1.00 31.70  ?  710  LYS A CD    1 
ATOM   4858  C  CE    . LYS A 1  710  ? 134.674 159.274 179.531 1.00 31.70  ?  710  LYS A CE    1 
ATOM   4859  N  NZ    . LYS A 1  710  ? 133.900 158.722 180.667 1.00 31.70  1  710  LYS A NZ    1 
ATOM   4860  N  N     . LEU A 1  711  ? 139.936 156.202 180.970 1.00 34.04  ?  711  LEU A N     1 
ATOM   4861  C  CA    . LEU A 1  711  ? 140.185 154.770 181.142 1.00 34.04  ?  711  LEU A CA    1 
ATOM   4862  C  C     . LEU A 1  711  ? 141.624 154.384 180.794 1.00 34.04  ?  711  LEU A C     1 
ATOM   4863  O  O     . LEU A 1  711  ? 141.903 153.990 179.655 1.00 34.04  ?  711  LEU A O     1 
ATOM   4864  C  CB    . LEU A 1  711  ? 139.186 153.976 180.294 1.00 34.04  ?  711  LEU A CB    1 
ATOM   4865  C  CG    . LEU A 1  711  ? 139.071 152.460 180.365 1.00 34.04  ?  711  LEU A CG    1 
ATOM   4866  C  CD1   . LEU A 1  711  ? 138.836 152.016 181.775 1.00 34.04  ?  711  LEU A CD1   1 
ATOM   4867  C  CD2   . LEU A 1  711  ? 137.909 152.038 179.500 1.00 34.04  ?  711  LEU A CD2   1 
ATOM   4868  N  N     . PRO A 1  712  ? 142.575 154.473 181.754 1.00 31.23  ?  712  PRO A N     1 
ATOM   4869  C  CA    . PRO A 1  712  ? 143.986 154.184 181.446 1.00 31.23  ?  712  PRO A CA    1 
ATOM   4870  C  C     . PRO A 1  712  ? 144.471 152.768 181.748 1.00 31.23  ?  712  PRO A C     1 
ATOM   4871  O  O     . PRO A 1  712  ? 144.062 152.158 182.737 1.00 31.23  ?  712  PRO A O     1 
ATOM   4872  C  CB    . PRO A 1  712  ? 144.724 155.200 182.315 1.00 31.23  ?  712  PRO A CB    1 
ATOM   4873  C  CG    . PRO A 1  712  ? 143.841 155.335 183.516 1.00 31.23  ?  712  PRO A CG    1 
ATOM   4874  C  CD    . PRO A 1  712  ? 142.423 155.101 183.075 1.00 31.23  ?  712  PRO A CD    1 
ATOM   4875  N  N     . CYS A 1  713  ? 145.351 152.239 180.896 1.00 27.74  ?  713  CYS A N     1 
ATOM   4876  C  CA    . CYS A 1  713  ? 145.880 150.884 181.015 1.00 27.74  ?  713  CYS A CA    1 
ATOM   4877  C  C     . CYS A 1  713  ? 147.366 150.815 180.646 1.00 27.74  ?  713  CYS A C     1 
ATOM   4878  O  O     . CYS A 1  713  ? 147.732 150.161 179.677 1.00 27.74  ?  713  CYS A O     1 
ATOM   4879  C  CB    . CYS A 1  713  ? 145.091 149.898 180.168 1.00 27.74  ?  713  CYS A CB    1 
ATOM   4880  S  SG    . CYS A 1  713  ? 145.391 148.178 180.594 1.00 27.74  ?  713  CYS A SG    1 
ATOM   4881  N  N     . LEU A 1  714  ? 148.223 151.540 181.388 1.00 29.62  ?  714  LEU A N     1 
ATOM   4882  C  CA    . LEU A 1  714  ? 149.654 151.730 181.086 1.00 29.62  ?  714  LEU A CA    1 
ATOM   4883  C  C     . LEU A 1  714  ? 150.461 150.462 180.778 1.00 29.62  ?  714  LEU A C     1 
ATOM   4884  O  O     . LEU A 1  714  ? 151.549 150.568 180.193 1.00 29.62  ?  714  LEU A O     1 
ATOM   4885  C  CB    . LEU A 1  714  ? 150.330 152.423 182.256 1.00 29.62  ?  714  LEU A CB    1 
ATOM   4886  C  CG    . LEU A 1  714  ? 149.763 153.756 182.705 1.00 29.62  ?  714  LEU A CG    1 
ATOM   4887  C  CD1   . LEU A 1  714  ? 150.267 154.047 184.088 1.00 29.62  ?  714  LEU A CD1   1 
ATOM   4888  C  CD2   . LEU A 1  714  ? 150.198 154.829 181.767 1.00 29.62  ?  714  LEU A CD2   1 
ATOM   4889  N  N     . GLU A 1  715  ? 149.967 149.282 181.168 1.00 32.40  ?  715  GLU A N     1 
ATOM   4890  C  CA    . GLU A 1  715  ? 150.548 148.007 180.747 1.00 32.40  ?  715  GLU A CA    1 
ATOM   4891  C  C     . GLU A 1  715  ? 150.616 147.890 179.229 1.00 32.40  ?  715  GLU A C     1 
ATOM   4892  O  O     . GLU A 1  715  ? 151.635 147.457 178.667 1.00 32.40  ?  715  GLU A O     1 
ATOM   4893  C  CB    . GLU A 1  715  ? 149.716 146.860 181.323 1.00 32.40  ?  715  GLU A CB    1 
ATOM   4894  C  CG    . GLU A 1  715  ? 149.705 146.757 182.860 1.00 32.40  ?  715  GLU A CG    1 
ATOM   4895  C  CD    . GLU A 1  715  ? 148.669 147.656 183.539 1.00 32.40  ?  715  GLU A CD    1 
ATOM   4896  O  OE1   . GLU A 1  715  ? 148.793 148.897 183.434 1.00 32.40  ?  715  GLU A OE1   1 
ATOM   4897  O  OE2   . GLU A 1  715  ? 147.743 147.126 184.187 1.00 32.40  -1 715  GLU A OE2   1 
ATOM   4898  N  N     . ILE A 1  716  ? 149.550 148.324 178.553 1.00 28.97  ?  716  ILE A N     1 
ATOM   4899  C  CA    . ILE A 1  716  ? 149.465 148.249 177.098 1.00 28.97  ?  716  ILE A CA    1 
ATOM   4900  C  C     . ILE A 1  716  ? 150.479 149.188 176.451 1.00 28.97  ?  716  ILE A C     1 
ATOM   4901  O  O     . ILE A 1  716  ? 151.204 148.794 175.530 1.00 28.97  ?  716  ILE A O     1 
ATOM   4902  C  CB    . ILE A 1  716  ? 148.024 148.554 176.651 1.00 28.97  ?  716  ILE A CB    1 
ATOM   4903  C  CG1   . ILE A 1  716  ? 147.137 147.334 176.872 1.00 28.97  ?  716  ILE A CG1   1 
ATOM   4904  C  CG2   . ILE A 1  716  ? 147.950 148.990 175.204 1.00 28.97  ?  716  ILE A CG2   1 
ATOM   4905  C  CD1   . ILE A 1  716  ? 145.678 147.670 176.909 1.00 28.97  ?  716  ILE A CD1   1 
ATOM   4906  N  N     . SER A 1  717  ? 150.556 150.426 176.948 1.00 26.37  ?  717  SER A N     1 
ATOM   4907  C  CA    . SER A 1  717  ? 151.503 151.420 176.447 1.00 26.37  ?  717  SER A CA    1 
ATOM   4908  C  C     . SER A 1  717  ? 152.952 150.940 176.559 1.00 26.37  ?  717  SER A C     1 
ATOM   4909  O  O     . SER A 1  717  ? 153.748 151.082 175.613 1.00 26.37  ?  717  SER A O     1 
ATOM   4910  C  CB    . SER A 1  717  ? 151.312 152.711 177.231 1.00 26.37  ?  717  SER A CB    1 
ATOM   4911  O  OG    . SER A 1  717  ? 149.945 153.047 177.305 1.00 26.37  ?  717  SER A OG    1 
ATOM   4912  N  N     . GLN A 1  718  ? 153.296 150.352 177.711 1.00 29.33  ?  718  GLN A N     1 
ATOM   4913  C  CA    . GLN A 1  718  ? 154.635 149.808 177.906 1.00 29.33  ?  718  GLN A CA    1 
ATOM   4914  C  C     . GLN A 1  718  ? 154.926 148.667 176.940 1.00 29.33  ?  718  GLN A C     1 
ATOM   4915  O  O     . GLN A 1  718  ? 156.047 148.563 176.419 1.00 29.33  ?  718  GLN A O     1 
ATOM   4916  C  CB    . GLN A 1  718  ? 154.791 149.340 179.348 1.00 29.33  ?  718  GLN A CB    1 
ATOM   4917  C  CG    . GLN A 1  718  ? 154.797 150.457 180.362 1.00 29.33  ?  718  GLN A CG    1 
ATOM   4918  C  CD    . GLN A 1  718  ? 154.427 149.975 181.748 1.00 29.33  ?  718  GLN A CD    1 
ATOM   4919  O  OE1   . GLN A 1  718  ? 153.512 149.178 181.909 1.00 29.33  ?  718  GLN A OE1   1 
ATOM   4920  N  NE2   . GLN A 1  718  ? 155.136 150.462 182.751 1.00 29.33  ?  718  GLN A NE2   1 
ATOM   4921  N  N     . SER A 1  719  ? 153.927 147.815 176.671 1.00 28.17  ?  719  SER A N     1 
ATOM   4922  C  CA    . SER A 1  719  ? 154.124 146.732 175.708 1.00 28.17  ?  719  SER A CA    1 
ATOM   4923  C  C     . SER A 1  719  ? 154.359 147.263 174.297 1.00 28.17  ?  719  SER A C     1 
ATOM   4924  O  O     . SER A 1  719  ? 155.184 146.720 173.543 1.00 28.17  ?  719  SER A O     1 
ATOM   4925  C  CB    . SER A 1  719  ? 152.917 145.805 175.724 1.00 28.17  ?  719  SER A CB    1 
ATOM   4926  O  OG    . SER A 1  719  ? 152.997 144.909 176.809 1.00 28.17  ?  719  SER A OG    1 
ATOM   4927  N  N     . VAL A 1  720  ? 153.667 148.353 173.948 1.00 29.21  ?  720  VAL A N     1 
ATOM   4928  C  CA    . VAL A 1  720  ? 153.811 148.984 172.635 1.00 29.21  ?  720  VAL A CA    1 
ATOM   4929  C  C     . VAL A 1  720  ? 155.230 149.505 172.432 1.00 29.21  ?  720  VAL A C     1 
ATOM   4930  O  O     . VAL A 1  720  ? 155.903 149.146 171.455 1.00 29.21  ?  720  VAL A O     1 
ATOM   4931  C  CB    . VAL A 1  720  ? 152.767 150.104 172.463 1.00 29.21  ?  720  VAL A CB    1 
ATOM   4932  C  CG1   . VAL A 1  720  ? 153.026 150.886 171.213 1.00 29.21  ?  720  VAL A CG1   1 
ATOM   4933  C  CG2   . VAL A 1  720  ? 151.378 149.520 172.372 1.00 29.21  ?  720  VAL A CG2   1 
ATOM   4934  N  N     . THR A 1  721  ? 155.721 150.328 173.366 1.00 25.98  ?  721  THR A N     1 
ATOM   4935  C  CA    . THR A 1  721  ? 157.046 150.913 173.145 1.00 25.98  ?  721  THR A CA    1 
ATOM   4936  C  C     . THR A 1  721  ? 158.173 149.897 173.313 1.00 25.98  ?  721  THR A C     1 
ATOM   4937  O  O     . THR A 1  721  ? 159.222 150.039 172.671 1.00 25.98  ?  721  THR A O     1 
ATOM   4938  C  CB    . THR A 1  721  ? 157.273 152.112 174.053 1.00 25.98  ?  721  THR A CB    1 
ATOM   4939  O  OG1   . THR A 1  721  ? 157.280 151.685 175.411 1.00 25.98  ?  721  THR A OG1   1 
ATOM   4940  C  CG2   . THR A 1  721  ? 156.178 153.139 173.848 1.00 25.98  ?  721  THR A CG2   1 
ATOM   4941  N  N     . GLY A 1  722  ? 157.967 148.849 174.118 1.00 29.24  ?  722  GLY A N     1 
ATOM   4942  C  CA    . GLY A 1  722  ? 158.930 147.760 174.154 1.00 29.24  ?  722  GLY A CA    1 
ATOM   4943  C  C     . GLY A 1  722  ? 159.042 147.026 172.833 1.00 29.24  ?  722  GLY A C     1 
ATOM   4944  O  O     . GLY A 1  722  ? 160.151 146.710 172.376 1.00 29.24  ?  722  GLY A O     1 
ATOM   4945  N  N     . PHE A 1  723  ? 157.899 146.785 172.177 1.00 29.89  ?  723  PHE A N     1 
ATOM   4946  C  CA    . PHE A 1  723  ? 157.939 146.167 170.854 1.00 29.89  ?  723  PHE A CA    1 
ATOM   4947  C  C     . PHE A 1  723  ? 158.599 147.077 169.823 1.00 29.89  ?  723  PHE A C     1 
ATOM   4948  O  O     . PHE A 1  723  ? 159.331 146.594 168.944 1.00 29.89  ?  723  PHE A O     1 
ATOM   4949  C  CB    . PHE A 1  723  ? 156.537 145.792 170.405 1.00 29.89  ?  723  PHE A CB    1 
ATOM   4950  C  CG    . PHE A 1  723  ? 156.125 144.425 170.827 1.00 29.89  ?  723  PHE A CG    1 
ATOM   4951  C  CD1   . PHE A 1  723  ? 156.905 143.337 170.516 1.00 29.89  ?  723  PHE A CD1   1 
ATOM   4952  C  CD2   . PHE A 1  723  ? 154.942 144.222 171.504 1.00 29.89  ?  723  PHE A CD2   1 
ATOM   4953  C  CE1   . PHE A 1  723  ? 156.523 142.074 170.894 1.00 29.89  ?  723  PHE A CE1   1 
ATOM   4954  C  CE2   . PHE A 1  723  ? 154.562 142.960 171.876 1.00 29.89  ?  723  PHE A CE2   1 
ATOM   4955  C  CZ    . PHE A 1  723  ? 155.356 141.888 171.570 1.00 29.89  ?  723  PHE A CZ    1 
ATOM   4956  N  N     . GLY A 1  724  ? 158.374 148.392 169.944 1.00 31.57  ?  724  GLY A N     1 
ATOM   4957  C  CA    . GLY A 1  724  ? 159.024 149.342 169.047 1.00 31.57  ?  724  GLY A CA    1 
ATOM   4958  C  C     . GLY A 1  724  ? 160.541 149.307 169.129 1.00 31.57  ?  724  GLY A C     1 
ATOM   4959  O  O     . GLY A 1  724  ? 161.230 149.215 168.099 1.00 31.57  ?  724  GLY A O     1 
ATOM   4960  N  N     . ARG A 1  725  ? 161.076 149.359 170.357 1.00 29.46  ?  725  ARG A N     1 
ATOM   4961  C  CA    . ARG A 1  725  ? 162.524 149.320 170.573 1.00 29.46  ?  725  ARG A CA    1 
ATOM   4962  C  C     . ARG A 1  725  ? 163.135 148.030 170.057 1.00 29.46  ?  725  ARG A C     1 
ATOM   4963  O  O     . ARG A 1  725  ? 164.190 148.043 169.396 1.00 29.46  ?  725  ARG A O     1 
ATOM   4964  C  CB    . ARG A 1  725  ? 162.833 149.452 172.058 1.00 29.46  ?  725  ARG A CB    1 
ATOM   4965  C  CG    . ARG A 1  725  ? 162.748 150.836 172.610 1.00 29.46  ?  725  ARG A CG    1 
ATOM   4966  C  CD    . ARG A 1  725  ? 163.326 150.823 173.996 1.00 29.46  ?  725  ARG A CD    1 
ATOM   4967  N  NE    . ARG A 1  725  ? 162.411 150.245 174.969 1.00 29.46  ?  725  ARG A NE    1 
ATOM   4968  C  CZ    . ARG A 1  725  ? 161.585 150.960 175.725 1.00 29.46  ?  725  ARG A CZ    1 
ATOM   4969  N  NH1   . ARG A 1  725  ? 161.557 152.272 175.598 1.00 29.46  1  725  ARG A NH1   1 
ATOM   4970  N  NH2   . ARG A 1  725  ? 160.785 150.365 176.595 1.00 29.46  ?  725  ARG A NH2   1 
ATOM   4971  N  N     . GLN A 1  726  ? 162.485 146.900 170.363 1.00 30.84  ?  726  GLN A N     1 
ATOM   4972  C  CA    . GLN A 1  726  ? 162.968 145.603 169.904 1.00 30.84  ?  726  GLN A CA    1 
ATOM   4973  C  C     . GLN A 1  726  ? 163.031 145.528 168.381 1.00 30.84  ?  726  GLN A C     1 
ATOM   4974  O  O     . GLN A 1  726  ? 164.032 145.063 167.813 1.00 30.84  ?  726  GLN A O     1 
ATOM   4975  C  CB    . GLN A 1  726  ? 162.069 144.507 170.469 1.00 30.84  ?  726  GLN A CB    1 
ATOM   4976  C  CG    . GLN A 1  726  ? 162.195 143.166 169.782 1.00 30.84  ?  726  GLN A CG    1 
ATOM   4977  C  CD    . GLN A 1  726  ? 161.402 142.091 170.481 1.00 30.84  ?  726  GLN A CD    1 
ATOM   4978  O  OE1   . GLN A 1  726  ? 161.546 140.906 170.187 1.00 30.84  ?  726  GLN A OE1   1 
ATOM   4979  N  NE2   . GLN A 1  726  ? 160.560 142.496 171.415 1.00 30.84  ?  726  GLN A NE2   1 
ATOM   4980  N  N     . MET A 1  727  ? 162.014 146.061 167.701 1.00 32.70  ?  727  MET A N     1 
ATOM   4981  C  CA    . MET A 1  727  ? 161.988 145.941 166.248 1.00 32.70  ?  727  MET A CA    1 
ATOM   4982  C  C     . MET A 1  727  ? 162.991 146.863 165.564 1.00 32.70  ?  727  MET A C     1 
ATOM   4983  O  O     . MET A 1  727  ? 163.569 146.479 164.539 1.00 32.70  ?  727  MET A O     1 
ATOM   4984  C  CB    . MET A 1  727  ? 160.580 146.199 165.725 1.00 32.70  ?  727  MET A CB    1 
ATOM   4985  C  CG    . MET A 1  727  ? 159.611 145.064 166.030 1.00 32.70  ?  727  MET A CG    1 
ATOM   4986  S  SD    . MET A 1  727  ? 157.984 145.297 165.305 1.00 32.70  ?  727  MET A SD    1 
ATOM   4987  C  CE    . MET A 1  727  ? 157.744 147.040 165.618 1.00 32.70  ?  727  MET A CE    1 
ATOM   4988  N  N     . ILE A 1  728  ? 163.247 148.058 166.110 1.00 31.17  ?  728  ILE A N     1 
ATOM   4989  C  CA    . ILE A 1  728  ? 164.205 148.933 165.426 1.00 31.17  ?  728  ILE A CA    1 
ATOM   4990  C  C     . ILE A 1  728  ? 165.641 148.429 165.614 1.00 31.17  ?  728  ILE A C     1 
ATOM   4991  O  O     . ILE A 1  728  ? 166.457 148.482 164.677 1.00 31.17  ?  728  ILE A O     1 
ATOM   4992  C  CB    . ILE A 1  728  ? 164.031 150.407 165.853 1.00 31.17  ?  728  ILE A CB    1 
ATOM   4993  C  CG1   . ILE A 1  728  ? 165.076 151.304 165.186 1.00 31.17  ?  728  ILE A CG1   1 
ATOM   4994  C  CG2   . ILE A 1  728  ? 164.112 150.573 167.333 1.00 31.17  ?  728  ILE A CG2   1 
ATOM   4995  C  CD1   . ILE A 1  728  ? 164.910 152.762 165.464 1.00 31.17  ?  728  ILE A CD1   1 
ATOM   4996  N  N     . GLU A 1  729  ? 165.969 147.876 166.792 1.00 32.13  ?  729  GLU A N     1 
ATOM   4997  C  CA    . GLU A 1  729  ? 167.318 147.326 166.911 1.00 32.13  ?  729  GLU A CA    1 
ATOM   4998  C  C     . GLU A 1  729  ? 167.469 146.051 166.088 1.00 32.13  ?  729  GLU A C     1 
ATOM   4999  O  O     . GLU A 1  729  ? 168.570 145.767 165.588 1.00 32.13  ?  729  GLU A O     1 
ATOM   5000  C  CB    . GLU A 1  729  ? 167.690 147.098 168.382 1.00 32.13  ?  729  GLU A CB    1 
ATOM   5001  C  CG    . GLU A 1  729  ? 166.857 146.094 169.158 1.00 32.13  ?  729  GLU A CG    1 
ATOM   5002  C  CD    . GLU A 1  729  ? 167.394 144.682 169.050 1.00 32.13  ?  729  GLU A CD    1 
ATOM   5003  O  OE1   . GLU A 1  729  ? 168.582 144.537 168.700 1.00 32.13  ?  729  GLU A OE1   1 
ATOM   5004  O  OE2   . GLU A 1  729  ? 166.626 143.720 169.297 1.00 32.13  -1 729  GLU A OE2   1 
ATOM   5005  N  N     . LYS A 1  730  ? 166.365 145.317 165.885 1.00 34.87  ?  730  LYS A N     1 
ATOM   5006  C  CA    . LYS A 1  730  ? 166.369 144.197 164.948 1.00 34.87  ?  730  LYS A CA    1 
ATOM   5007  C  C     . LYS A 1  730  ? 166.673 144.660 163.529 1.00 34.87  ?  730  LYS A C     1 
ATOM   5008  O  O     . LYS A 1  730  ? 167.466 144.025 162.814 1.00 34.87  ?  730  LYS A O     1 
ATOM   5009  C  CB    . LYS A 1  730  ? 165.018 143.490 164.998 1.00 34.87  ?  730  LYS A CB    1 
ATOM   5010  C  CG    . LYS A 1  730  ? 164.857 142.407 163.967 1.00 34.87  ?  730  LYS A CG    1 
ATOM   5011  C  CD    . LYS A 1  730  ? 164.030 141.258 164.490 1.00 34.87  ?  730  LYS A CD    1 
ATOM   5012  C  CE    . LYS A 1  730  ? 164.276 139.997 163.677 1.00 34.87  ?  730  LYS A CE    1 
ATOM   5013  N  NZ    . LYS A 1  730  ? 163.413 138.887 164.153 1.00 34.87  1  730  LYS A NZ    1 
ATOM   5014  N  N     . THR A 1  731  ? 166.071 145.783 163.124 1.00 35.13  ?  731  THR A N     1 
ATOM   5015  C  CA    . THR A 1  731  ? 166.303 146.352 161.798 1.00 35.13  ?  731  THR A CA    1 
ATOM   5016  C  C     . THR A 1  731  ? 167.766 146.734 161.601 1.00 35.13  ?  731  THR A C     1 
ATOM   5017  O  O     . THR A 1  731  ? 168.365 146.419 160.566 1.00 35.13  ?  731  THR A O     1 
ATOM   5018  C  CB    . THR A 1  731  ? 165.404 147.571 161.600 1.00 35.13  ?  731  THR A CB    1 
ATOM   5019  O  OG1   . THR A 1  731  ? 164.033 147.172 161.673 1.00 35.13  ?  731  THR A OG1   1 
ATOM   5020  C  CG2   . THR A 1  731  ? 165.656 148.220 160.264 1.00 35.13  ?  731  THR A CG2   1 
ATOM   5021  N  N     . LYS A 1  732  ? 168.369 147.377 162.607 1.00 34.45  ?  732  LYS A N     1 
ATOM   5022  C  CA    . LYS A 1  732  ? 169.744 147.861 162.455 1.00 34.45  ?  732  LYS A CA    1 
ATOM   5023  C  C     . LYS A 1  732  ? 170.746 146.714 162.410 1.00 34.45  ?  732  LYS A C     1 
ATOM   5024  O  O     . LYS A 1  732  ? 171.661 146.718 161.574 1.00 34.45  ?  732  LYS A O     1 
ATOM   5025  C  CB    . LYS A 1  732  ? 170.096 148.830 163.580 1.00 34.45  ?  732  LYS A CB    1 
ATOM   5026  C  CG    . LYS A 1  732  ? 171.464 149.450 163.453 1.00 34.45  ?  732  LYS A CG    1 
ATOM   5027  C  CD    . LYS A 1  732  ? 171.714 150.446 164.561 1.00 34.45  ?  732  LYS A CD    1 
ATOM   5028  C  CE    . LYS A 1  732  ? 171.686 149.768 165.915 1.00 34.45  ?  732  LYS A CE    1 
ATOM   5029  N  NZ    . LYS A 1  732  ? 171.203 150.684 166.989 1.00 34.45  1  732  LYS A NZ    1 
ATOM   5030  N  N     . GLN A 1  733  ? 170.573 145.718 163.290 1.00 36.83  ?  733  GLN A N     1 
ATOM   5031  C  CA    . GLN A 1  733  ? 171.411 144.519 163.248 1.00 36.83  ?  733  GLN A CA    1 
ATOM   5032  C  C     . GLN A 1  733  ? 171.311 143.815 161.903 1.00 36.83  ?  733  GLN A C     1 
ATOM   5033  O  O     . GLN A 1  733  ? 172.333 143.456 161.308 1.00 36.83  ?  733  GLN A O     1 
ATOM   5034  C  CB    . GLN A 1  733  ? 171.014 143.555 164.364 1.00 36.83  ?  733  GLN A CB    1 
ATOM   5035  C  CG    . GLN A 1  733  ? 171.645 143.833 165.708 1.00 36.83  ?  733  GLN A CG    1 
ATOM   5036  C  CD    . GLN A 1  733  ? 170.917 143.128 166.831 1.00 36.83  ?  733  GLN A CD    1 
ATOM   5037  O  OE1   . GLN A 1  733  ? 169.757 142.745 166.687 1.00 36.83  ?  733  GLN A OE1   1 
ATOM   5038  N  NE2   . GLN A 1  733  ? 171.594 142.955 167.958 1.00 36.83  ?  733  GLN A NE2   1 
ATOM   5039  N  N     . LEU A 1  734  ? 170.089 143.671 161.380 1.00 37.74  ?  734  LEU A N     1 
ATOM   5040  C  CA    . LEU A 1  734  ? 169.890 142.921 160.141 1.00 37.74  ?  734  LEU A CA    1 
ATOM   5041  C  C     . LEU A 1  734  ? 170.477 143.646 158.931 1.00 37.74  ?  734  LEU A C     1 
ATOM   5042  O  O     . LEU A 1  734  ? 171.155 143.021 158.094 1.00 37.74  ?  734  LEU A O     1 
ATOM   5043  C  CB    . LEU A 1  734  ? 168.404 142.650 159.950 1.00 37.74  ?  734  LEU A CB    1 
ATOM   5044  C  CG    . LEU A 1  734  ? 167.970 141.274 160.440 1.00 37.74  ?  734  LEU A CG    1 
ATOM   5045  C  CD1   . LEU A 1  734  ? 166.472 141.183 160.469 1.00 37.74  ?  734  LEU A CD1   1 
ATOM   5046  C  CD2   . LEU A 1  734  ? 168.550 140.198 159.534 1.00 37.74  ?  734  LEU A CD2   1 
ATOM   5047  N  N     . VAL A 1  735  ? 170.261 144.963 158.843 1.00 40.03  ?  735  VAL A N     1 
ATOM   5048  C  CA    . VAL A 1  735  ? 170.738 145.737 157.700 1.00 40.03  ?  735  VAL A CA    1 
ATOM   5049  C  C     . VAL A 1  735  ? 172.261 145.799 157.683 1.00 40.03  ?  735  VAL A C     1 
ATOM   5050  O  O     . VAL A 1  735  ? 172.890 145.556 156.646 1.00 40.03  ?  735  VAL A O     1 
ATOM   5051  C  CB    . VAL A 1  735  ? 170.108 147.138 157.703 1.00 40.03  ?  735  VAL A CB    1 
ATOM   5052  C  CG1   . VAL A 1  735  ? 170.763 148.023 156.680 1.00 40.03  ?  735  VAL A CG1   1 
ATOM   5053  C  CG2   . VAL A 1  735  ? 168.647 147.038 157.369 1.00 40.03  ?  735  VAL A CG2   1 
ATOM   5054  N  N     . GLU A 1  736  ? 172.889 146.081 158.830 1.00 48.49  ?  736  GLU A N     1 
ATOM   5055  C  CA    . GLU A 1  736  ? 174.346 146.120 158.823 1.00 48.49  ?  736  GLU A CA    1 
ATOM   5056  C  C     . GLU A 1  736  ? 174.981 144.741 158.754 1.00 48.49  ?  736  GLU A C     1 
ATOM   5057  O  O     . GLU A 1  736  ? 176.158 144.637 158.397 1.00 48.49  ?  736  GLU A O     1 
ATOM   5058  C  CB    . GLU A 1  736  ? 174.872 146.835 160.057 1.00 48.49  ?  736  GLU A CB    1 
ATOM   5059  C  CG    . GLU A 1  736  ? 175.209 148.274 159.831 1.00 48.49  ?  736  GLU A CG    1 
ATOM   5060  C  CD    . GLU A 1  736  ? 175.569 148.966 161.124 1.00 48.49  ?  736  GLU A CD    1 
ATOM   5061  O  OE1   . GLU A 1  736  ? 175.636 148.273 162.162 1.00 48.49  ?  736  GLU A OE1   1 
ATOM   5062  O  OE2   . GLU A 1  736  ? 175.788 150.195 161.114 1.00 48.49  -1 736  GLU A OE2   1 
ATOM   5063  N  N     . SER A 1  737  ? 174.251 143.679 159.076 1.00 54.77  ?  737  SER A N     1 
ATOM   5064  C  CA    . SER A 1  737  ? 174.882 142.375 159.083 1.00 54.77  ?  737  SER A CA    1 
ATOM   5065  C  C     . SER A 1  737  ? 174.815 141.660 157.745 1.00 54.77  ?  737  SER A C     1 
ATOM   5066  O  O     . SER A 1  737  ? 175.728 140.882 157.448 1.00 54.77  ?  737  SER A O     1 
ATOM   5067  C  CB    . SER A 1  737  ? 174.253 141.492 160.165 1.00 54.77  ?  737  SER A CB    1 
ATOM   5068  O  OG    . SER A 1  737  ? 172.846 141.539 160.103 1.00 54.77  ?  737  SER A OG    1 
ATOM   5069  N  N     . LYS A 1  738  ? 173.782 141.880 156.930 1.00 66.43  ?  738  LYS A N     1 
ATOM   5070  C  CA    . LYS A 1  738  ? 173.717 141.021 155.750 1.00 66.43  ?  738  LYS A CA    1 
ATOM   5071  C  C     . LYS A 1  738  ? 174.575 141.494 154.581 1.00 66.43  ?  738  LYS A C     1 
ATOM   5072  O  O     . LYS A 1  738  ? 175.286 140.677 153.987 1.00 66.43  ?  738  LYS A O     1 
ATOM   5073  C  CB    . LYS A 1  738  ? 172.279 140.840 155.260 1.00 66.43  ?  738  LYS A CB    1 
ATOM   5074  C  CG    . LYS A 1  738  ? 172.151 139.612 154.368 1.00 66.43  ?  738  LYS A CG    1 
ATOM   5075  C  CD    . LYS A 1  738  ? 170.805 139.525 153.677 1.00 66.43  ?  738  LYS A CD    1 
ATOM   5076  C  CE    . LYS A 1  738  ? 170.629 138.195 152.971 1.00 66.43  ?  738  LYS A CE    1 
ATOM   5077  N  NZ    . LYS A 1  738  ? 170.495 137.069 153.937 1.00 66.43  1  738  LYS A NZ    1 
ATOM   5078  N  N     . TYR A 1  739  ? 174.543 142.779 154.225 1.00 68.38  ?  739  TYR A N     1 
ATOM   5079  C  CA    . TYR A 1  739  ? 175.157 143.215 152.967 1.00 68.38  ?  739  TYR A CA    1 
ATOM   5080  C  C     . TYR A 1  739  ? 176.585 143.640 153.270 1.00 68.38  ?  739  TYR A C     1 
ATOM   5081  O  O     . TYR A 1  739  ? 176.846 144.766 153.695 1.00 68.38  ?  739  TYR A O     1 
ATOM   5082  C  CB    . TYR A 1  739  ? 174.370 144.343 152.305 1.00 68.38  ?  739  TYR A CB    1 
ATOM   5083  C  CG    . TYR A 1  739  ? 172.896 144.075 152.062 1.00 68.38  ?  739  TYR A CG    1 
ATOM   5084  C  CD1   . TYR A 1  739  ? 172.400 142.777 151.951 1.00 68.38  ?  739  TYR A CD1   1 
ATOM   5085  C  CD2   . TYR A 1  739  ? 171.999 145.126 151.957 1.00 68.38  ?  739  TYR A CD2   1 
ATOM   5086  C  CE1   . TYR A 1  739  ? 171.073 142.538 151.745 1.00 68.38  ?  739  TYR A CE1   1 
ATOM   5087  C  CE2   . TYR A 1  739  ? 170.664 144.891 151.748 1.00 68.38  ?  739  TYR A CE2   1 
ATOM   5088  C  CZ    . TYR A 1  739  ? 170.208 143.588 151.646 1.00 68.38  ?  739  TYR A CZ    1 
ATOM   5089  O  OH    . TYR A 1  739  ? 168.881 143.319 151.437 1.00 68.38  ?  739  TYR A OH    1 
ATOM   5090  N  N     . THR A 1  740  ? 177.524 142.728 153.033 1.00 87.19  ?  740  THR A N     1 
ATOM   5091  C  CA    . THR A 1  740  ? 178.898 142.907 153.473 1.00 87.19  ?  740  THR A CA    1 
ATOM   5092  C  C     . THR A 1  740  ? 179.850 142.449 152.377 1.00 87.19  ?  740  THR A C     1 
ATOM   5093  O  O     . THR A 1  740  ? 179.431 141.923 151.342 1.00 87.19  ?  740  THR A O     1 
ATOM   5094  C  CB    . THR A 1  740  ? 179.142 142.149 154.778 1.00 87.19  ?  740  THR A CB    1 
ATOM   5095  O  OG1   . THR A 1  740  ? 180.370 142.593 155.365 1.00 87.19  ?  740  THR A OG1   1 
ATOM   5096  C  CG2   . THR A 1  740  ? 179.194 140.654 154.519 1.00 87.19  ?  740  THR A CG2   1 
ATOM   5097  N  N     . VAL A 1  741  ? 181.151 142.663 152.609 1.00 94.82  ?  741  VAL A N     1 
ATOM   5098  C  CA    . VAL A 1  741  ? 182.156 142.377 151.590 1.00 94.82  ?  741  VAL A CA    1 
ATOM   5099  C  C     . VAL A 1  741  ? 182.336 140.881 151.389 1.00 94.82  ?  741  VAL A C     1 
ATOM   5100  O  O     . VAL A 1  741  ? 182.640 140.431 150.278 1.00 94.82  ?  741  VAL A O     1 
ATOM   5101  C  CB    . VAL A 1  741  ? 183.494 143.058 151.936 1.00 94.82  ?  741  VAL A CB    1 
ATOM   5102  C  CG1   . VAL A 1  741  ? 183.430 144.545 151.648 1.00 94.82  ?  741  VAL A CG1   1 
ATOM   5103  C  CG2   . VAL A 1  741  ? 183.861 142.826 153.389 1.00 94.82  ?  741  VAL A CG2   1 
ATOM   5104  N  N     . GLU A 1  742  ? 182.150 140.080 152.440 1.00 99.80  ?  742  GLU A N     1 
ATOM   5105  C  CA    . GLU A 1  742  ? 182.306 138.642 152.302 1.00 99.80  ?  742  GLU A CA    1 
ATOM   5106  C  C     . GLU A 1  742  ? 181.091 137.984 151.677 1.00 99.80  ?  742  GLU A C     1 
ATOM   5107  O  O     . GLU A 1  742  ? 181.209 136.869 151.153 1.00 99.80  ?  742  GLU A O     1 
ATOM   5108  C  CB    . GLU A 1  742  ? 182.584 138.004 153.659 1.00 99.80  ?  742  GLU A CB    1 
ATOM   5109  C  CG    . GLU A 1  742  ? 183.791 138.570 154.377 1.00 99.80  ?  742  GLU A CG    1 
ATOM   5110  C  CD    . GLU A 1  742  ? 183.411 139.628 155.394 1.00 99.80  ?  742  GLU A CD    1 
ATOM   5111  O  OE1   . GLU A 1  742  ? 184.069 139.694 156.451 1.00 99.80  ?  742  GLU A OE1   1 
ATOM   5112  O  OE2   . GLU A 1  742  ? 182.460 140.391 155.135 1.00 99.80  -1 742  GLU A OE2   1 
ATOM   5113  N  N     . ASN A 1  743  ? 179.930 138.646 151.708 1.00 96.99  ?  743  ASN A N     1 
ATOM   5114  C  CA    . ASN A 1  743  ? 178.701 138.061 151.188 1.00 96.99  ?  743  ASN A CA    1 
ATOM   5115  C  C     . ASN A 1  743  ? 178.464 138.396 149.726 1.00 96.99  ?  743  ASN A C     1 
ATOM   5116  O  O     . ASN A 1  743  ? 177.311 138.427 149.278 1.00 96.99  ?  743  ASN A O     1 
ATOM   5117  C  CB    . ASN A 1  743  ? 177.503 138.485 152.035 1.00 96.99  ?  743  ASN A CB    1 
ATOM   5118  C  CG    . ASN A 1  743  ? 177.264 137.556 153.212 1.00 96.99  ?  743  ASN A CG    1 
ATOM   5119  O  OD1   . ASN A 1  743  ? 178.204 137.097 153.854 1.00 96.99  ?  743  ASN A OD1   1 
ATOM   5120  N  ND2   . ASN A 1  743  ? 176.000 137.258 153.483 1.00 96.99  ?  743  ASN A ND2   1 
ATOM   5121  N  N     . GLY A 1  744  ? 179.527 138.650 148.966 1.00 96.16  ?  744  GLY A N     1 
ATOM   5122  C  CA    . GLY A 1  744  ? 179.427 138.861 147.541 1.00 96.16  ?  744  GLY A CA    1 
ATOM   5123  C  C     . GLY A 1  744  ? 179.085 140.269 147.127 1.00 96.16  ?  744  GLY A C     1 
ATOM   5124  O  O     . GLY A 1  744  ? 179.228 140.598 145.945 1.00 96.16  ?  744  GLY A O     1 
ATOM   5125  N  N     . TYR A 1  745  ? 178.649 141.115 148.056 1.00 89.01  ?  745  TYR A N     1 
ATOM   5126  C  CA    . TYR A 1  745  ? 178.266 142.477 147.722 1.00 89.01  ?  745  TYR A CA    1 
ATOM   5127  C  C     . TYR A 1  745  ? 179.521 143.336 147.600 1.00 89.01  ?  745  TYR A C     1 
ATOM   5128  O  O     . TYR A 1  745  ? 180.652 142.856 147.707 1.00 89.01  ?  745  TYR A O     1 
ATOM   5129  C  CB    . TYR A 1  745  ? 177.307 143.037 148.764 1.00 89.01  ?  745  TYR A CB    1 
ATOM   5130  C  CG    . TYR A 1  745  ? 176.078 142.196 149.055 1.00 89.01  ?  745  TYR A CG    1 
ATOM   5131  C  CD1   . TYR A 1  745  ? 174.908 142.352 148.316 1.00 89.01  ?  745  TYR A CD1   1 
ATOM   5132  C  CD2   . TYR A 1  745  ? 176.077 141.273 150.097 1.00 89.01  ?  745  TYR A CD2   1 
ATOM   5133  C  CE1   . TYR A 1  745  ? 173.785 141.603 148.598 1.00 89.01  ?  745  TYR A CE1   1 
ATOM   5134  C  CE2   . TYR A 1  745  ? 174.959 140.526 150.386 1.00 89.01  ?  745  TYR A CE2   1 
ATOM   5135  C  CZ    . TYR A 1  745  ? 173.819 140.693 149.633 1.00 89.01  ?  745  TYR A CZ    1 
ATOM   5136  O  OH    . TYR A 1  745  ? 172.704 139.942 149.923 1.00 89.01  ?  745  TYR A OH    1 
ATOM   5137  N  N     . SER A 1  746  ? 179.332 144.637 147.398 1.00 91.85  ?  746  SER A N     1 
ATOM   5138  C  CA    . SER A 1  746  ? 180.474 145.518 147.165 1.00 91.85  ?  746  SER A CA    1 
ATOM   5139  C  C     . SER A 1  746  ? 181.134 145.931 148.479 1.00 91.85  ?  746  SER A C     1 
ATOM   5140  O  O     . SER A 1  746  ? 182.296 145.602 148.738 1.00 91.85  ?  746  SER A O     1 
ATOM   5141  C  CB    . SER A 1  746  ? 180.019 146.745 146.363 1.00 91.85  ?  746  SER A CB    1 
ATOM   5142  O  OG    . SER A 1  746  ? 181.112 147.389 145.735 1.00 91.85  ?  746  SER A OG    1 
ATOM   5143  N  N     . THR A 1  747  ? 180.392 146.643 149.328 1.00 86.63  ?  747  THR A N     1 
ATOM   5144  C  CA    . THR A 1  747  ? 180.913 147.260 150.540 1.00 86.63  ?  747  THR A CA    1 
ATOM   5145  C  C     . THR A 1  747  ? 180.004 146.900 151.704 1.00 86.63  ?  747  THR A C     1 
ATOM   5146  O  O     . THR A 1  747  ? 178.783 146.846 151.542 1.00 86.63  ?  747  THR A O     1 
ATOM   5147  C  CB    . THR A 1  747  ? 180.959 148.796 150.430 1.00 86.63  ?  747  THR A CB    1 
ATOM   5148  O  OG1   . THR A 1  747  ? 179.620 149.297 150.317 1.00 86.63  ?  747  THR A OG1   1 
ATOM   5149  C  CG2   . THR A 1  747  ? 181.765 149.260 149.215 1.00 86.63  ?  747  THR A CG2   1 
ATOM   5150  N  N     . SER A 1  748  ? 180.588 146.681 152.880 1.00 78.41  ?  748  SER A N     1 
ATOM   5151  C  CA    . SER A 1  748  ? 179.782 146.484 154.079 1.00 78.41  ?  748  SER A CA    1 
ATOM   5152  C  C     . SER A 1  748  ? 179.167 147.805 154.503 1.00 78.41  ?  748  SER A C     1 
ATOM   5153  O  O     . SER A 1  748  ? 179.890 148.757 154.813 1.00 78.41  ?  748  SER A O     1 
ATOM   5154  C  CB    . SER A 1  748  ? 180.623 145.914 155.214 1.00 78.41  ?  748  SER A CB    1 
ATOM   5155  O  OG    . SER A 1  748  ? 179.791 145.397 156.236 1.00 78.41  ?  748  SER A OG    1 
ATOM   5156  N  N     . ALA A 1  749  ? 177.839 147.869 154.514 1.00 64.51  ?  749  ALA A N     1 
ATOM   5157  C  CA    . ALA A 1  749  ? 177.157 149.104 154.861 1.00 64.51  ?  749  ALA A CA    1 
ATOM   5158  C  C     . ALA A 1  749  ? 177.218 149.340 156.365 1.00 64.51  ?  749  ALA A C     1 
ATOM   5159  O  O     . ALA A 1  749  ? 177.542 148.444 157.150 1.00 64.51  ?  749  ALA A O     1 
ATOM   5160  C  CB    . ALA A 1  749  ? 175.707 149.073 154.383 1.00 64.51  ?  749  ALA A CB    1 
ATOM   5161  N  N     . LYS A 1  750  ? 176.921 150.577 156.759 1.00 55.86  ?  750  LYS A N     1 
ATOM   5162  C  CA    . LYS A 1  750  ? 177.012 151.008 158.148 1.00 55.86  ?  750  LYS A CA    1 
ATOM   5163  C  C     . LYS A 1  750  ? 175.906 152.014 158.421 1.00 55.86  ?  750  LYS A C     1 
ATOM   5164  O  O     . LYS A 1  750  ? 175.803 153.021 157.715 1.00 55.86  ?  750  LYS A O     1 
ATOM   5165  C  CB    . LYS A 1  750  ? 178.381 151.627 158.450 1.00 55.86  ?  750  LYS A CB    1 
ATOM   5166  C  CG    . LYS A 1  750  ? 179.537 150.637 158.578 1.00 55.86  ?  750  LYS A CG    1 
ATOM   5167  C  CD    . LYS A 1  750  ? 179.401 149.783 159.828 1.00 55.86  ?  750  LYS A CD    1 
ATOM   5168  C  CE    . LYS A 1  750  ? 179.607 150.611 161.083 1.00 55.86  ?  750  LYS A CE    1 
ATOM   5169  N  NZ    . LYS A 1  750  ? 179.196 149.893 162.313 1.00 55.86  1  750  LYS A NZ    1 
ATOM   5170  N  N     . VAL A 1  751  ? 175.093 151.759 159.450 1.00 38.21  ?  751  VAL A N     1 
ATOM   5171  C  CA    . VAL A 1  751  ? 173.975 152.641 159.769 1.00 38.21  ?  751  VAL A CA    1 
ATOM   5172  C  C     . VAL A 1  751  ? 174.487 153.900 160.458 1.00 38.21  ?  751  VAL A C     1 
ATOM   5173  O  O     . VAL A 1  751  ? 175.249 153.828 161.428 1.00 38.21  ?  751  VAL A O     1 
ATOM   5174  C  CB    . VAL A 1  751  ? 172.945 151.909 160.636 1.00 38.21  ?  751  VAL A CB    1 
ATOM   5175  C  CG1   . VAL A 1  751  ? 171.815 152.841 161.040 1.00 38.21  ?  751  VAL A CG1   1 
ATOM   5176  C  CG2   . VAL A 1  751  ? 172.406 150.723 159.885 1.00 38.21  ?  751  VAL A CG2   1 
ATOM   5177  N  N     . VAL A 1  752  ? 174.061 155.059 159.966 1.00 30.73  ?  752  VAL A N     1 
ATOM   5178  C  CA    . VAL A 1  752  ? 174.532 156.316 160.523 1.00 30.73  ?  752  VAL A CA    1 
ATOM   5179  C  C     . VAL A 1  752  ? 173.517 156.904 161.492 1.00 30.73  ?  752  VAL A C     1 
ATOM   5180  O  O     . VAL A 1  752  ? 173.892 157.705 162.353 1.00 30.73  ?  752  VAL A O     1 
ATOM   5181  C  CB    . VAL A 1  752  ? 174.895 157.321 159.407 1.00 30.73  ?  752  VAL A CB    1 
ATOM   5182  C  CG1   . VAL A 1  752  ? 175.870 156.691 158.430 1.00 30.73  ?  752  VAL A CG1   1 
ATOM   5183  C  CG2   . VAL A 1  752  ? 173.684 157.806 158.675 1.00 30.73  ?  752  VAL A CG2   1 
ATOM   5184  N  N     . TYR A 1  753  ? 172.249 156.491 161.407 1.00 30.63  ?  753  TYR A N     1 
ATOM   5185  C  CA    . TYR A 1  753  ? 171.196 157.139 162.189 1.00 30.63  ?  753  TYR A CA    1 
ATOM   5186  C  C     . TYR A 1  753  ? 169.926 156.295 162.202 1.00 30.63  ?  753  TYR A C     1 
ATOM   5187  O  O     . TYR A 1  753  ? 169.643 155.560 161.252 1.00 30.63  ?  753  TYR A O     1 
ATOM   5188  C  CB    . TYR A 1  753  ? 170.879 158.533 161.633 1.00 30.63  ?  753  TYR A CB    1 
ATOM   5189  C  CG    . TYR A 1  753  ? 170.071 159.406 162.551 1.00 30.63  ?  753  TYR A CG    1 
ATOM   5190  C  CD1   . TYR A 1  753  ? 170.293 159.405 163.911 1.00 30.63  ?  753  TYR A CD1   1 
ATOM   5191  C  CD2   . TYR A 1  753  ? 169.090 160.243 162.050 1.00 30.63  ?  753  TYR A CD2   1 
ATOM   5192  C  CE1   . TYR A 1  753  ? 169.553 160.205 164.749 1.00 30.63  ?  753  TYR A CE1   1 
ATOM   5193  C  CE2   . TYR A 1  753  ? 168.345 161.046 162.878 1.00 30.63  ?  753  TYR A CE2   1 
ATOM   5194  C  CZ    . TYR A 1  753  ? 168.581 161.025 164.222 1.00 30.63  ?  753  TYR A CZ    1 
ATOM   5195  O  OH    . TYR A 1  753  ? 167.837 161.824 165.046 1.00 30.63  ?  753  TYR A OH    1 
ATOM   5196  N  N     . GLY A 1  754  ? 169.159 156.429 163.287 1.00 28.59  ?  754  GLY A N     1 
ATOM   5197  C  CA    . GLY A 1  754  ? 167.829 155.855 163.425 1.00 28.59  ?  754  GLY A CA    1 
ATOM   5198  C  C     . GLY A 1  754  ? 167.034 156.484 164.558 1.00 28.59  ?  754  GLY A C     1 
ATOM   5199  O  O     . GLY A 1  754  ? 167.542 156.613 165.672 1.00 28.59  ?  754  GLY A O     1 
ATOM   5200  N  N     . ASP A 1  755  ? 165.788 156.883 164.291 1.00 30.90  ?  755  ASP A N     1 
ATOM   5201  C  CA    . ASP A 1  755  ? 164.934 157.597 165.247 1.00 30.90  ?  755  ASP A CA    1 
ATOM   5202  C  C     . ASP A 1  755  ? 163.567 156.918 165.253 1.00 30.90  ?  755  ASP A C     1 
ATOM   5203  O  O     . ASP A 1  755  ? 162.660 157.380 164.562 1.00 30.90  ?  755  ASP A O     1 
ATOM   5204  C  CB    . ASP A 1  755  ? 164.828 159.080 164.852 1.00 30.90  ?  755  ASP A CB    1 
ATOM   5205  C  CG    . ASP A 1  755  ? 164.070 159.951 165.866 1.00 30.90  ?  755  ASP A CG    1 
ATOM   5206  O  OD1   . ASP A 1  755  ? 163.277 159.466 166.700 1.00 30.90  ?  755  ASP A OD1   1 
ATOM   5207  O  OD2   . ASP A 1  755  ? 164.269 161.185 165.813 1.00 30.90  -1 755  ASP A OD2   1 
ATOM   5208  N  N     . THR A 1  756  ? 163.452 155.802 165.973 1.00 32.30  ?  756  THR A N     1 
ATOM   5209  C  CA    . THR A 1  756  ? 162.254 155.113 166.484 1.00 32.30  ?  756  THR A CA    1 
ATOM   5210  C  C     . THR A 1  756  ? 161.251 154.619 165.448 1.00 32.30  ?  756  THR A C     1 
ATOM   5211  O  O     . THR A 1  756  ? 160.383 153.810 165.786 1.00 32.30  ?  756  THR A O     1 
ATOM   5212  C  CB    . THR A 1  756  ? 161.473 155.941 167.517 1.00 32.30  ?  756  THR A CB    1 
ATOM   5213  O  OG1   . THR A 1  756  ? 160.624 155.045 168.233 1.00 32.30  ?  756  THR A OG1   1 
ATOM   5214  C  CG2   . THR A 1  756  ? 160.529 156.952 166.892 1.00 32.30  ?  756  THR A CG2   1 
ATOM   5215  N  N     . ASP A 1  757  ? 161.358 155.052 164.197 1.00 34.05  ?  757  ASP A N     1 
ATOM   5216  C  CA    . ASP A 1  757  ? 160.587 154.444 163.124 1.00 34.05  ?  757  ASP A CA    1 
ATOM   5217  C  C     . ASP A 1  757  ? 161.376 154.297 161.846 1.00 34.05  ?  757  ASP A C     1 
ATOM   5218  O  O     . ASP A 1  757  ? 160.934 153.559 160.964 1.00 34.05  ?  757  ASP A O     1 
ATOM   5219  C  CB    . ASP A 1  757  ? 159.306 155.239 162.819 1.00 34.05  ?  757  ASP A CB    1 
ATOM   5220  C  CG    . ASP A 1  757  ? 159.588 156.601 162.218 1.00 34.05  ?  757  ASP A CG    1 
ATOM   5221  O  OD1   . ASP A 1  757  ? 160.591 157.240 162.581 1.00 34.05  ?  757  ASP A OD1   1 
ATOM   5222  O  OD2   . ASP A 1  757  ? 158.820 157.008 161.326 1.00 34.05  -1 757  ASP A OD2   1 
ATOM   5223  N  N     . SER A 1  758  ? 162.517 154.965 161.709 1.00 34.69  ?  758  SER A N     1 
ATOM   5224  C  CA    . SER A 1  758  ? 163.249 155.026 160.456 1.00 34.69  ?  758  SER A CA    1 
ATOM   5225  C  C     . SER A 1  758  ? 164.696 154.624 160.683 1.00 34.69  ?  758  SER A C     1 
ATOM   5226  O  O     . SER A 1  758  ? 165.189 154.621 161.809 1.00 34.69  ?  758  SER A O     1 
ATOM   5227  C  CB    . SER A 1  758  ? 163.188 156.431 159.841 1.00 34.69  ?  758  SER A CB    1 
ATOM   5228  O  OG    . SER A 1  758  ? 163.617 157.416 160.761 1.00 34.69  ?  758  SER A OG    1 
ATOM   5229  N  N     . VAL A 1  759  ? 165.360 154.273 159.591 1.00 33.67  ?  759  VAL A N     1 
ATOM   5230  C  CA    . VAL A 1  759  ? 166.750 153.841 159.589 1.00 33.67  ?  759  VAL A CA    1 
ATOM   5231  C  C     . VAL A 1  759  ? 167.401 154.467 158.367 1.00 33.67  ?  759  VAL A C     1 
ATOM   5232  O  O     . VAL A 1  759  ? 166.895 154.314 157.251 1.00 33.67  ?  759  VAL A O     1 
ATOM   5233  C  CB    . VAL A 1  759  ? 166.859 152.301 159.553 1.00 33.67  ?  759  VAL A CB    1 
ATOM   5234  C  CG1   . VAL A 1  759  ? 168.190 151.848 159.011 1.00 33.67  ?  759  VAL A CG1   1 
ATOM   5235  C  CG2   . VAL A 1  759  ? 166.666 151.736 160.931 1.00 33.67  ?  759  VAL A CG2   1 
ATOM   5236  N  N     . MET A 1  760  ? 168.497 155.193 158.566 1.00 34.14  ?  760  MET A N     1 
ATOM   5237  C  CA    . MET A 1  760  ? 169.192 155.854 157.467 1.00 34.14  ?  760  MET A CA    1 
ATOM   5238  C  C     . MET A 1  760  ? 170.505 155.130 157.226 1.00 34.14  ?  760  MET A C     1 
ATOM   5239  O  O     . MET A 1  760  ? 171.524 155.474 157.820 1.00 34.14  ?  760  MET A O     1 
ATOM   5240  C  CB    . MET A 1  760  ? 169.424 157.325 157.778 1.00 34.14  ?  760  MET A CB    1 
ATOM   5241  C  CG    . MET A 1  760  ? 168.168 158.067 158.089 1.00 34.14  ?  760  MET A CG    1 
ATOM   5242  S  SD    . MET A 1  760  ? 168.391 159.826 157.915 1.00 34.14  ?  760  MET A SD    1 
ATOM   5243  C  CE    . MET A 1  760  ? 166.714 160.360 158.204 1.00 34.14  ?  760  MET A CE    1 
ATOM   5244  N  N     . CYS A 1  761  ? 170.492 154.142 156.346 1.00 42.39  ?  761  CYS A N     1 
ATOM   5245  C  CA    . CYS A 1  761  ? 171.664 153.312 156.130 1.00 42.39  ?  761  CYS A CA    1 
ATOM   5246  C  C     . CYS A 1  761  ? 172.494 153.865 154.984 1.00 42.39  ?  761  CYS A C     1 
ATOM   5247  O  O     . CYS A 1  761  ? 171.955 154.259 153.949 1.00 42.39  ?  761  CYS A O     1 
ATOM   5248  C  CB    . CYS A 1  761  ? 171.262 151.873 155.837 1.00 42.39  ?  761  CYS A CB    1 
ATOM   5249  S  SG    . CYS A 1  761  ? 172.587 150.889 155.158 1.00 42.39  ?  761  CYS A SG    1 
ATOM   5250  N  N     . ARG A 1  762  ? 173.812 153.881 155.172 1.00 48.41  ?  762  ARG A N     1 
ATOM   5251  C  CA    . ARG A 1  762  ? 174.751 154.400 154.181 1.00 48.41  ?  762  ARG A CA    1 
ATOM   5252  C  C     . ARG A 1  762  ? 175.388 153.230 153.457 1.00 48.41  ?  762  ARG A C     1 
ATOM   5253  O  O     . ARG A 1  762  ? 176.072 152.411 154.073 1.00 48.41  ?  762  ARG A O     1 
ATOM   5254  C  CB    . ARG A 1  762  ? 175.824 155.270 154.828 1.00 48.41  ?  762  ARG A CB    1 
ATOM   5255  C  CG    . ARG A 1  762  ? 176.699 155.965 153.822 1.00 48.41  ?  762  ARG A CG    1 
ATOM   5256  C  CD    . ARG A 1  762  ? 177.997 156.396 154.454 1.00 48.41  ?  762  ARG A CD    1 
ATOM   5257  N  NE    . ARG A 1  762  ? 179.024 155.360 154.401 1.00 48.41  ?  762  ARG A NE    1 
ATOM   5258  C  CZ    . ARG A 1  762  ? 180.163 155.416 155.080 1.00 48.41  ?  762  ARG A CZ    1 
ATOM   5259  N  NH1   . ARG A 1  762  ? 180.412 156.457 155.862 1.00 48.41  1  762  ARG A NH1   1 
ATOM   5260  N  NH2   . ARG A 1  762  ? 181.048 154.431 154.982 1.00 48.41  ?  762  ARG A NH2   1 
ATOM   5261  N  N     . PHE A 1  763  ? 175.179 153.168 152.147 1.00 55.09  ?  763  PHE A N     1 
ATOM   5262  C  CA    . PHE A 1  763  ? 175.426 151.942 151.409 1.00 55.09  ?  763  PHE A CA    1 
ATOM   5263  C  C     . PHE A 1  763  ? 176.832 151.865 150.834 1.00 55.09  ?  763  PHE A C     1 
ATOM   5264  O  O     . PHE A 1  763  ? 177.454 150.799 150.878 1.00 55.09  ?  763  PHE A O     1 
ATOM   5265  C  CB    . PHE A 1  763  ? 174.384 151.790 150.300 1.00 55.09  ?  763  PHE A CB    1 
ATOM   5266  C  CG    . PHE A 1  763  ? 173.140 151.072 150.743 1.00 55.09  ?  763  PHE A CG    1 
ATOM   5267  C  CD1   . PHE A 1  763  ? 173.165 149.702 150.985 1.00 55.09  ?  763  PHE A CD1   1 
ATOM   5268  C  CD2   . PHE A 1  763  ? 171.951 151.762 150.924 1.00 55.09  ?  763  PHE A CD2   1 
ATOM   5269  C  CE1   . PHE A 1  763  ? 172.031 149.035 151.397 1.00 55.09  ?  763  PHE A CE1   1 
ATOM   5270  C  CE2   . PHE A 1  763  ? 170.818 151.102 151.336 1.00 55.09  ?  763  PHE A CE2   1 
ATOM   5271  C  CZ    . PHE A 1  763  ? 170.857 149.733 151.570 1.00 55.09  ?  763  PHE A CZ    1 
ATOM   5272  N  N     . GLY A 1  764  ? 177.353 152.967 150.292 1.00 62.16  ?  764  GLY A N     1 
ATOM   5273  C  CA    . GLY A 1  764  ? 178.722 153.037 149.814 1.00 62.16  ?  764  GLY A CA    1 
ATOM   5274  C  C     . GLY A 1  764  ? 178.850 153.494 148.375 1.00 62.16  ?  764  GLY A C     1 
ATOM   5275  O  O     . GLY A 1  764  ? 179.832 154.156 148.027 1.00 62.16  ?  764  GLY A O     1 
ATOM   5276  N  N     . VAL A 1  765  ? 177.882 153.147 147.530 1.00 54.82  ?  765  VAL A N     1 
ATOM   5277  C  CA    . VAL A 1  765  ? 177.953 153.549 146.134 1.00 54.82  ?  765  VAL A CA    1 
ATOM   5278  C  C     . VAL A 1  765  ? 177.562 155.017 146.001 1.00 54.82  ?  765  VAL A C     1 
ATOM   5279  O  O     . VAL A 1  765  ? 176.795 155.563 146.806 1.00 54.82  ?  765  VAL A O     1 
ATOM   5280  C  CB    . VAL A 1  765  ? 177.076 152.628 145.264 1.00 54.82  ?  765  VAL A CB    1 
ATOM   5281  C  CG1   . VAL A 1  765  ? 177.395 151.167 145.561 1.00 54.82  ?  765  VAL A CG1   1 
ATOM   5282  C  CG2   . VAL A 1  765  ? 175.601 152.877 145.494 1.00 54.82  ?  765  VAL A CG2   1 
ATOM   5283  N  N     . SER A 1  766  ? 178.139 155.686 145.007 1.00 59.68  ?  766  SER A N     1 
ATOM   5284  C  CA    . SER A 1  766  ? 177.820 157.081 144.737 1.00 59.68  ?  766  SER A CA    1 
ATOM   5285  C  C     . SER A 1  766  ? 176.940 157.251 143.512 1.00 59.68  ?  766  SER A C     1 
ATOM   5286  O  O     . SER A 1  766  ? 176.835 158.361 142.986 1.00 59.68  ?  766  SER A O     1 
ATOM   5287  C  CB    . SER A 1  766  ? 179.091 157.910 144.574 1.00 59.68  ?  766  SER A CB    1 
ATOM   5288  O  OG    . SER A 1  766  ? 178.770 159.288 144.530 1.00 59.68  ?  766  SER A OG    1 
ATOM   5289  N  N     . SER A 1  767  ? 176.319 156.175 143.045 1.00 57.60  ?  767  SER A N     1 
ATOM   5290  C  CA    . SER A 1  767  ? 175.368 156.220 141.946 1.00 57.60  ?  767  SER A CA    1 
ATOM   5291  C  C     . SER A 1  767  ? 173.971 156.027 142.516 1.00 57.60  ?  767  SER A C     1 
ATOM   5292  O  O     . SER A 1  767  ? 173.702 155.018 143.176 1.00 57.60  ?  767  SER A O     1 
ATOM   5293  C  CB    . SER A 1  767  ? 175.687 155.148 140.908 1.00 57.60  ?  767  SER A CB    1 
ATOM   5294  O  OG    . SER A 1  767  ? 177.034 155.242 140.488 1.00 57.60  ?  767  SER A OG    1 
ATOM   5295  N  N     . VAL A 1  768  ? 173.089 156.992 142.250 1.00 53.78  ?  768  VAL A N     1 
ATOM   5296  C  CA    . VAL A 1  768  ? 171.775 157.035 142.882 1.00 53.78  ?  768  VAL A CA    1 
ATOM   5297  C  C     . VAL A 1  768  ? 170.896 155.891 142.392 1.00 53.78  ?  768  VAL A C     1 
ATOM   5298  O  O     . VAL A 1  768  ? 170.052 155.383 143.141 1.00 53.78  ?  768  VAL A O     1 
ATOM   5299  C  CB    . VAL A 1  768  ? 171.150 158.419 142.627 1.00 53.78  ?  768  VAL A CB    1 
ATOM   5300  C  CG1   . VAL A 1  768  ? 169.830 158.571 143.324 1.00 53.78  ?  768  VAL A CG1   1 
ATOM   5301  C  CG2   . VAL A 1  768  ? 172.101 159.508 143.071 1.00 53.78  ?  768  VAL A CG2   1 
ATOM   5302  N  N     . ALA A 1  769  ? 171.132 155.408 141.171 1.00 54.92  ?  769  ALA A N     1 
ATOM   5303  C  CA    . ALA A 1  769  ? 170.378 154.269 140.659 1.00 54.92  ?  769  ALA A CA    1 
ATOM   5304  C  C     . ALA A 1  769  ? 170.694 152.988 141.423 1.00 54.92  ?  769  ALA A C     1 
ATOM   5305  O  O     . ALA A 1  769  ? 169.780 152.240 141.796 1.00 54.92  ?  769  ALA A O     1 
ATOM   5306  C  CB    . ALA A 1  769  ? 170.659 154.080 139.171 1.00 54.92  ?  769  ALA A CB    1 
ATOM   5307  N  N     . GLU A 1  770  ? 171.975 152.735 141.694 1.00 57.11  ?  770  GLU A N     1 
ATOM   5308  C  CA    . GLU A 1  770  ? 172.369 151.525 142.414 1.00 57.11  ?  770  GLU A CA    1 
ATOM   5309  C  C     . GLU A 1  770  ? 171.972 151.577 143.889 1.00 57.11  ?  770  GLU A C     1 
ATOM   5310  O  O     . GLU A 1  770  ? 171.598 150.544 144.465 1.00 57.11  ?  770  GLU A O     1 
ATOM   5311  C  CB    . GLU A 1  770  ? 173.873 151.317 142.263 1.00 57.11  ?  770  GLU A CB    1 
ATOM   5312  C  CG    . GLU A 1  770  ? 174.380 151.686 140.884 1.00 57.11  ?  770  GLU A CG    1 
ATOM   5313  C  CD    . GLU A 1  770  ? 175.893 151.646 140.781 1.00 57.11  ?  770  GLU A CD    1 
ATOM   5314  O  OE1   . GLU A 1  770  ? 176.571 152.051 141.748 1.00 57.11  ?  770  GLU A OE1   1 
ATOM   5315  O  OE2   . GLU A 1  770  ? 176.409 151.225 139.728 1.00 57.11  -1 770  GLU A OE2   1 
ATOM   5316  N  N     . ALA A 1  771  ? 172.012 152.772 144.495 1.00 49.98  ?  771  ALA A N     1 
ATOM   5317  C  CA    . ALA A 1  771  ? 171.540 152.943 145.867 1.00 49.98  ?  771  ALA A CA    1 
ATOM   5318  C  C     . ALA A 1  771  ? 170.041 152.715 145.965 1.00 49.98  ?  771  ALA A C     1 
ATOM   5319  O  O     . ALA A 1  771  ? 169.576 152.058 146.900 1.00 49.98  ?  771  ALA A O     1 
ATOM   5320  C  CB    . ALA A 1  771  ? 171.889 154.337 146.387 1.00 49.98  ?  771  ALA A CB    1 
ATOM   5321  N  N     . MET A 1  772  ? 169.278 153.240 145.000 1.00 51.34  ?  772  MET A N     1 
ATOM   5322  C  CA    . MET A 1  772  ? 167.836 153.024 144.977 1.00 51.34  ?  772  MET A CA    1 
ATOM   5323  C  C     . MET A 1  772  ? 167.493 151.549 144.791 1.00 51.34  ?  772  MET A C     1 
ATOM   5324  O  O     . MET A 1  772  ? 166.596 151.026 145.470 1.00 51.34  ?  772  MET A O     1 
ATOM   5325  C  CB    . MET A 1  772  ? 167.205 153.875 143.881 1.00 51.34  ?  772  MET A CB    1 
ATOM   5326  C  CG    . MET A 1  772  ? 166.903 155.285 144.334 1.00 51.34  ?  772  MET A CG    1 
ATOM   5327  S  SD    . MET A 1  772  ? 166.011 156.275 143.135 1.00 51.34  ?  772  MET A SD    1 
ATOM   5328  C  CE    . MET A 1  772  ? 165.584 157.692 144.142 1.00 51.34  ?  772  MET A CE    1 
ATOM   5329  N  N     . ALA A 1  773  ? 168.240 150.851 143.928 1.00 49.61  ?  773  ALA A N     1 
ATOM   5330  C  CA    . ALA A 1  773  ? 167.981 149.432 143.685 1.00 49.61  ?  773  ALA A CA    1 
ATOM   5331  C  C     . ALA A 1  773  ? 168.268 148.580 144.919 1.00 49.61  ?  773  ALA A C     1 
ATOM   5332  O  O     . ALA A 1  773  ? 167.420 147.771 145.338 1.00 49.61  ?  773  ALA A O     1 
ATOM   5333  C  CB    . ALA A 1  773  ? 168.812 148.951 142.498 1.00 49.61  ?  773  ALA A CB    1 
ATOM   5334  N  N     . LEU A 1  774  ? 169.444 148.766 145.538 1.00 51.63  ?  774  LEU A N     1 
ATOM   5335  C  CA    . LEU A 1  774  ? 169.753 148.018 146.757 1.00 51.63  ?  774  LEU A CA    1 
ATOM   5336  C  C     . LEU A 1  774  ? 168.864 148.404 147.932 1.00 51.63  ?  774  LEU A C     1 
ATOM   5337  O  O     . LEU A 1  774  ? 168.557 147.546 148.765 1.00 51.63  ?  774  LEU A O     1 
ATOM   5338  C  CB    . LEU A 1  774  ? 171.217 148.176 147.153 1.00 51.63  ?  774  LEU A CB    1 
ATOM   5339  C  CG    . LEU A 1  774  ? 172.239 147.405 146.326 1.00 51.63  ?  774  LEU A CG    1 
ATOM   5340  C  CD1   . LEU A 1  774  ? 173.644 147.745 146.782 1.00 51.63  ?  774  LEU A CD1   1 
ATOM   5341  C  CD2   . LEU A 1  774  ? 171.980 145.918 146.484 1.00 51.63  ?  774  LEU A CD2   1 
ATOM   5342  N  N     . GLY A 1  775  ? 168.427 149.662 148.016 1.00 45.68  ?  775  GLY A N     1 
ATOM   5343  C  CA    . GLY A 1  775  ? 167.562 150.053 149.114 1.00 45.68  ?  775  GLY A CA    1 
ATOM   5344  C  C     . GLY A 1  775  ? 166.179 149.440 149.014 1.00 45.68  ?  775  GLY A C     1 
ATOM   5345  O  O     . GLY A 1  775  ? 165.595 149.040 150.027 1.00 45.68  ?  775  GLY A O     1 
ATOM   5346  N  N     . ARG A 1  776  ? 165.641 149.359 147.794 1.00 44.24  ?  776  ARG A N     1 
ATOM   5347  C  CA    . ARG A 1  776  ? 164.361 148.690 147.609 1.00 44.24  ?  776  ARG A CA    1 
ATOM   5348  C  C     . ARG A 1  776  ? 164.475 147.200 147.905 1.00 44.24  ?  776  ARG A C     1 
ATOM   5349  O  O     . ARG A 1  776  ? 163.575 146.615 148.537 1.00 44.24  ?  776  ARG A O     1 
ATOM   5350  C  CB    . ARG A 1  776  ? 163.848 148.929 146.195 1.00 44.24  ?  776  ARG A CB    1 
ATOM   5351  C  CG    . ARG A 1  776  ? 163.308 150.331 145.987 1.00 44.24  ?  776  ARG A CG    1 
ATOM   5352  C  CD    . ARG A 1  776  ? 162.415 150.383 144.771 1.00 44.24  ?  776  ARG A CD    1 
ATOM   5353  N  NE    . ARG A 1  776  ? 161.509 151.520 144.806 1.00 44.24  ?  776  ARG A NE    1 
ATOM   5354  C  CZ    . ARG A 1  776  ? 161.725 152.658 144.163 1.00 44.24  ?  776  ARG A CZ    1 
ATOM   5355  N  NH1   . ARG A 1  776  ? 162.822 152.808 143.440 1.00 44.24  1  776  ARG A NH1   1 
ATOM   5356  N  NH2   . ARG A 1  776  ? 160.849 153.650 144.246 1.00 44.24  ?  776  ARG A NH2   1 
ATOM   5357  N  N     . GLU A 1  777  ? 165.597 146.584 147.505 1.00 51.86  ?  777  GLU A N     1 
ATOM   5358  C  CA    . GLU A 1  777  ? 165.831 145.183 147.854 1.00 51.86  ?  777  GLU A CA    1 
ATOM   5359  C  C     . GLU A 1  777  ? 165.922 144.984 149.367 1.00 51.86  ?  777  GLU A C     1 
ATOM   5360  O  O     . GLU A 1  777  ? 165.364 144.020 149.904 1.00 51.86  ?  777  GLU A O     1 
ATOM   5361  C  CB    . GLU A 1  777  ? 167.093 144.665 147.163 1.00 51.86  ?  777  GLU A CB    1 
ATOM   5362  C  CG    . GLU A 1  777  ? 167.497 143.256 147.596 1.00 51.86  ?  777  GLU A CG    1 
ATOM   5363  C  CD    . GLU A 1  777  ? 168.460 142.584 146.636 1.00 51.86  ?  777  GLU A CD    1 
ATOM   5364  O  OE1   . GLU A 1  777  ? 168.622 143.078 145.501 1.00 51.86  ?  777  GLU A OE1   1 
ATOM   5365  O  OE2   . GLU A 1  777  ? 169.054 141.555 147.021 1.00 51.86  -1 777  GLU A OE2   1 
ATOM   5366  N  N     . ALA A 1  778  ? 166.546 145.929 150.078 1.00 54.47  ?  778  ALA A N     1 
ATOM   5367  C  CA    . ALA A 1  778  ? 166.700 145.803 151.529 1.00 54.47  ?  778  ALA A CA    1 
ATOM   5368  C  C     . ALA A 1  778  ? 165.376 145.951 152.265 1.00 54.47  ?  778  ALA A C     1 
ATOM   5369  O  O     . ALA A 1  778  ? 165.100 145.192 153.202 1.00 54.47  ?  778  ALA A O     1 
ATOM   5370  C  CB    . ALA A 1  778  ? 167.689 146.840 152.049 1.00 54.47  ?  778  ALA A CB    1 
ATOM   5371  N  N     . ALA A 1  779  ? 164.569 146.949 151.874 1.00 48.35  ?  779  ALA A N     1 
ATOM   5372  C  CA    . ALA A 1  779  ? 163.268 147.167 152.501 1.00 48.35  ?  779  ALA A CA    1 
ATOM   5373  C  C     . ALA A 1  779  ? 162.368 145.954 152.328 1.00 48.35  ?  779  ALA A C     1 
ATOM   5374  O  O     . ALA A 1  779  ? 161.830 145.412 153.311 1.00 48.35  ?  779  ALA A O     1 
ATOM   5375  C  CB    . ALA A 1  779  ? 162.607 148.411 151.914 1.00 48.35  ?  779  ALA A CB    1 
ATOM   5376  N  N     . ASP A 1  780  ? 162.259 145.469 151.084 1.00 53.32  ?  780  ASP A N     1 
ATOM   5377  C  CA    . ASP A 1  780  ? 161.420 144.306 150.832 1.00 53.32  ?  780  ASP A CA    1 
ATOM   5378  C  C     . ASP A 1  780  ? 161.994 143.038 151.454 1.00 53.32  ?  780  ASP A C     1 
ATOM   5379  O  O     . ASP A 1  780  ? 161.237 142.118 151.778 1.00 53.32  ?  780  ASP A O     1 
ATOM   5380  C  CB    . ASP A 1  780  ? 161.224 144.124 149.330 1.00 53.32  ?  780  ASP A CB    1 
ATOM   5381  C  CG    . ASP A 1  780  ? 160.584 145.336 148.680 1.00 53.32  ?  780  ASP A CG    1 
ATOM   5382  O  OD1   . ASP A 1  780  ? 159.951 146.133 149.399 1.00 53.32  ?  780  ASP A OD1   1 
ATOM   5383  O  OD2   . ASP A 1  780  ? 160.694 145.481 147.448 1.00 53.32  -1 780  ASP A OD2   1 
ATOM   5384  N  N     . TRP A 1  781  ? 163.312 142.973 151.655 1.00 58.21  ?  781  TRP A N     1 
ATOM   5385  C  CA    . TRP A 1  781  ? 163.903 141.790 152.270 1.00 58.21  ?  781  TRP A CA    1 
ATOM   5386  C  C     . TRP A 1  781  ? 163.611 141.743 153.760 1.00 58.21  ?  781  TRP A C     1 
ATOM   5387  O  O     . TRP A 1  781  ? 163.210 140.703 154.294 1.00 58.21  ?  781  TRP A O     1 
ATOM   5388  C  CB    . TRP A 1  781  ? 165.410 141.778 152.026 1.00 58.21  ?  781  TRP A CB    1 
ATOM   5389  C  CG    . TRP A 1  781  ? 166.183 140.994 153.041 1.00 58.21  ?  781  TRP A CG    1 
ATOM   5390  C  CD1   . TRP A 1  781  ? 166.951 141.490 154.050 1.00 58.21  ?  781  TRP A CD1   1 
ATOM   5391  C  CD2   . TRP A 1  781  ? 166.279 139.574 153.129 1.00 58.21  ?  781  TRP A CD2   1 
ATOM   5392  N  NE1   . TRP A 1  781  ? 167.508 140.466 154.771 1.00 58.21  ?  781  TRP A NE1   1 
ATOM   5393  C  CE2   . TRP A 1  781  ? 167.114 139.278 154.220 1.00 58.21  ?  781  TRP A CE2   1 
ATOM   5394  C  CE3   . TRP A 1  781  ? 165.739 138.522 152.388 1.00 58.21  ?  781  TRP A CE3   1 
ATOM   5395  C  CZ2   . TRP A 1  781  ? 167.418 137.977 154.590 1.00 58.21  ?  781  TRP A CZ2   1 
ATOM   5396  C  CZ3   . TRP A 1  781  ? 166.043 137.233 152.758 1.00 58.21  ?  781  TRP A CZ3   1 
ATOM   5397  C  CH2   . TRP A 1  781  ? 166.876 136.970 153.849 1.00 58.21  ?  781  TRP A CH2   1 
ATOM   5398  N  N     . VAL A 1  782  ? 163.828 142.863 154.451 1.00 58.72  ?  782  VAL A N     1 
ATOM   5399  C  CA    . VAL A 1  782  ? 163.730 142.886 155.905 1.00 58.72  ?  782  VAL A CA    1 
ATOM   5400  C  C     . VAL A 1  782  ? 162.277 142.750 156.344 1.00 58.72  ?  782  VAL A C     1 
ATOM   5401  O  O     . VAL A 1  782  ? 161.998 142.137 157.389 1.00 58.72  ?  782  VAL A O     1 
ATOM   5402  C  CB    . VAL A 1  782  ? 164.410 144.168 156.427 1.00 58.72  ?  782  VAL A CB    1 
ATOM   5403  C  CG1   . VAL A 1  782  ? 164.072 144.475 157.875 1.00 58.72  ?  782  VAL A CG1   1 
ATOM   5404  C  CG2   . VAL A 1  782  ? 165.904 144.045 156.272 1.00 58.72  ?  782  VAL A CG2   1 
ATOM   5405  N  N     . SER A 1  783  ? 161.322 143.223 155.516 1.00 49.19  ?  783  SER A N     1 
ATOM   5406  C  CA    . SER A 1  783  ? 159.906 143.135 155.882 1.00 49.19  ?  783  SER A CA    1 
ATOM   5407  C  C     . SER A 1  783  ? 159.388 141.711 156.056 1.00 49.19  ?  783  SER A C     1 
ATOM   5408  O  O     . SER A 1  783  ? 158.359 141.527 156.708 1.00 49.19  ?  783  SER A O     1 
ATOM   5409  C  CB    . SER A 1  783  ? 159.048 143.835 154.843 1.00 49.19  ?  783  SER A CB    1 
ATOM   5410  O  OG    . SER A 1  783  ? 159.326 145.211 154.834 1.00 49.19  ?  783  SER A OG    1 
ATOM   5411  N  N     . GLY A 1  784  ? 160.076 140.704 155.531 1.00 56.08  ?  784  GLY A N     1 
ATOM   5412  C  CA    . GLY A 1  784  ? 159.608 139.336 155.662 1.00 56.08  ?  784  GLY A CA    1 
ATOM   5413  C  C     . GLY A 1  784  ? 160.052 138.604 156.914 1.00 56.08  ?  784  GLY A C     1 
ATOM   5414  O  O     . GLY A 1  784  ? 160.422 137.427 156.842 1.00 56.08  ?  784  GLY A O     1 
ATOM   5415  N  N     . HIS A 1  785  ? 160.021 139.277 158.064 1.00 54.14  ?  785  HIS A N     1 
ATOM   5416  C  CA    . HIS A 1  785  ? 160.445 138.725 159.349 1.00 54.14  ?  785  HIS A CA    1 
ATOM   5417  C  C     . HIS A 1  785  ? 159.475 139.104 160.459 1.00 54.14  ?  785  HIS A C     1 
ATOM   5418  O  O     . HIS A 1  785  ? 159.873 139.325 161.602 1.00 54.14  ?  785  HIS A O     1 
ATOM   5419  C  CB    . HIS A 1  785  ? 161.843 139.212 159.721 1.00 54.14  ?  785  HIS A CB    1 
ATOM   5420  C  CG    . HIS A 1  785  ? 162.954 138.379 159.169 1.00 54.14  ?  785  HIS A CG    1 
ATOM   5421  N  ND1   . HIS A 1  785  ? 163.268 137.133 159.670 1.00 54.14  ?  785  HIS A ND1   1 
ATOM   5422  C  CD2   . HIS A 1  785  ? 163.851 138.626 158.187 1.00 54.14  ?  785  HIS A CD2   1 
ATOM   5423  C  CE1   . HIS A 1  785  ? 164.300 136.642 159.007 1.00 54.14  ?  785  HIS A CE1   1 
ATOM   5424  N  NE2   . HIS A 1  785  ? 164.673 137.529 158.101 1.00 54.14  ?  785  HIS A NE2   1 
ATOM   5425  N  N     . PHE A 1  786  ? 158.194 139.202 160.140 1.00 46.43  ?  786  PHE A N     1 
ATOM   5426  C  CA    . PHE A 1  786  ? 157.239 139.841 161.033 1.00 46.43  ?  786  PHE A CA    1 
ATOM   5427  C  C     . PHE A 1  786  ? 155.872 139.223 160.797 1.00 46.43  ?  786  PHE A C     1 
ATOM   5428  O  O     . PHE A 1  786  ? 155.666 138.503 159.813 1.00 46.43  ?  786  PHE A O     1 
ATOM   5429  C  CB    . PHE A 1  786  ? 157.182 141.357 160.788 1.00 46.43  ?  786  PHE A CB    1 
ATOM   5430  C  CG    . PHE A 1  786  ? 158.387 142.109 161.275 1.00 46.43  ?  786  PHE A CG    1 
ATOM   5431  C  CD1   . PHE A 1  786  ? 158.617 142.277 162.632 1.00 46.43  ?  786  PHE A CD1   1 
ATOM   5432  C  CD2   . PHE A 1  786  ? 159.280 142.665 160.373 1.00 46.43  ?  786  PHE A CD2   1 
ATOM   5433  C  CE1   . PHE A 1  786  ? 159.725 142.975 163.080 1.00 46.43  ?  786  PHE A CE1   1 
ATOM   5434  C  CE2   . PHE A 1  786  ? 160.385 143.364 160.814 1.00 46.43  ?  786  PHE A CE2   1 
ATOM   5435  C  CZ    . PHE A 1  786  ? 160.607 143.517 162.167 1.00 46.43  ?  786  PHE A CZ    1 
ATOM   5436  N  N     . PRO A 1  787  ? 154.910 139.488 161.681 1.00 37.31  ?  787  PRO A N     1 
ATOM   5437  C  CA    . PRO A 1  787  ? 153.501 139.323 161.312 1.00 37.31  ?  787  PRO A CA    1 
ATOM   5438  C  C     . PRO A 1  787  ? 153.051 140.416 160.351 1.00 37.31  ?  787  PRO A C     1 
ATOM   5439  O  O     . PRO A 1  787  ? 153.795 141.331 160.004 1.00 37.31  ?  787  PRO A O     1 
ATOM   5440  C  CB    . PRO A 1  787  ? 152.762 139.421 162.652 1.00 37.31  ?  787  PRO A CB    1 
ATOM   5441  C  CG    . PRO A 1  787  ? 153.716 140.086 163.572 1.00 37.31  ?  787  PRO A CG    1 
ATOM   5442  C  CD    . PRO A 1  787  ? 155.069 139.630 163.139 1.00 37.31  ?  787  PRO A CD    1 
ATOM   5443  N  N     . SER A 1  788  ? 151.823 140.310 159.919 1.00 35.62  ?  788  SER A N     1 
ATOM   5444  C  CA    . SER A 1  788  ? 151.265 141.359 159.077 1.00 35.62  ?  788  SER A CA    1 
ATOM   5445  C  C     . SER A 1  788  ? 150.214 142.146 159.849 1.00 35.62  ?  788  SER A C     1 
ATOM   5446  O  O     . SER A 1  788  ? 149.560 141.594 160.734 1.00 35.62  ?  788  SER A O     1 
ATOM   5447  C  CB    . SER A 1  788  ? 150.639 140.749 157.822 1.00 35.62  ?  788  SER A CB    1 
ATOM   5448  O  OG    . SER A 1  788  ? 151.495 139.766 157.265 1.00 35.62  ?  788  SER A OG    1 
ATOM   5449  N  N     . PRO A 1  789  ? 149.984 143.437 159.567 1.00 31.46  ?  789  PRO A N     1 
ATOM   5450  C  CA    . PRO A 1  789  ? 150.470 144.348 158.527 1.00 31.46  ?  789  PRO A CA    1 
ATOM   5451  C  C     . PRO A 1  789  ? 151.790 145.068 158.816 1.00 31.46  ?  789  PRO A C     1 
ATOM   5452  O  O     . PRO A 1  789  ? 151.876 146.259 158.539 1.00 31.46  ?  789  PRO A O     1 
ATOM   5453  C  CB    . PRO A 1  789  ? 149.348 145.372 158.444 1.00 31.46  ?  789  PRO A CB    1 
ATOM   5454  C  CG    . PRO A 1  789  ? 148.899 145.485 159.834 1.00 31.46  ?  789  PRO A CG    1 
ATOM   5455  C  CD    . PRO A 1  789  ? 148.998 144.111 160.429 1.00 31.46  ?  789  PRO A CD    1 
ATOM   5456  N  N     . ILE A 1  790  ? 152.789 144.384 159.361 1.00 32.95  ?  790  ILE A N     1 
ATOM   5457  C  CA    . ILE A 1  790  ? 154.082 145.012 159.595 1.00 32.95  ?  790  ILE A CA    1 
ATOM   5458  C  C     . ILE A 1  790  ? 154.899 144.963 158.309 1.00 32.95  ?  790  ILE A C     1 
ATOM   5459  O  O     . ILE A 1  790  ? 155.219 143.884 157.804 1.00 32.95  ?  790  ILE A O     1 
ATOM   5460  C  CB    . ILE A 1  790  ? 154.826 144.337 160.752 1.00 32.95  ?  790  ILE A CB    1 
ATOM   5461  C  CG1   . ILE A 1  790  ? 154.021 144.481 162.041 1.00 32.95  ?  790  ILE A CG1   1 
ATOM   5462  C  CG2   . ILE A 1  790  ? 156.211 144.930 160.900 1.00 32.95  ?  790  ILE A CG2   1 
ATOM   5463  C  CD1   . ILE A 1  790  ? 154.585 143.751 163.205 1.00 32.95  ?  790  ILE A CD1   1 
ATOM   5464  N  N     . ARG A 1  791  ? 155.237 146.135 157.778 1.00 40.18  ?  791  ARG A N     1 
ATOM   5465  C  CA    . ARG A 1  791  ? 156.041 146.233 156.569 1.00 40.18  ?  791  ARG A CA    1 
ATOM   5466  C  C     . ARG A 1  791  ? 156.968 147.439 156.635 1.00 40.18  ?  791  ARG A C     1 
ATOM   5467  O  O     . ARG A 1  791  ? 156.566 148.525 157.061 1.00 40.18  ?  791  ARG A O     1 
ATOM   5468  C  CB    . ARG A 1  791  ? 155.150 146.316 155.326 1.00 40.18  ?  791  ARG A CB    1 
ATOM   5469  C  CG    . ARG A 1  791  ? 153.920 147.161 155.527 1.00 40.18  ?  791  ARG A CG    1 
ATOM   5470  C  CD    . ARG A 1  791  ? 152.806 146.773 154.563 1.00 40.18  ?  791  ARG A CD    1 
ATOM   5471  N  NE    . ARG A 1  791  ? 151.629 147.616 154.751 1.00 40.18  ?  791  ARG A NE    1 
ATOM   5472  C  CZ    . ARG A 1  791  ? 151.442 148.785 154.145 1.00 40.18  ?  791  ARG A CZ    1 
ATOM   5473  N  NH1   . ARG A 1  791  ? 152.356 149.252 153.306 1.00 40.18  1  791  ARG A NH1   1 
ATOM   5474  N  NH2   . ARG A 1  791  ? 150.344 149.486 154.383 1.00 40.18  ?  791  ARG A NH2   1 
ATOM   5475  N  N     . LEU A 1  792  ? 158.212 147.228 156.216 1.00 39.87  ?  792  LEU A N     1 
ATOM   5476  C  CA    . LEU A 1  792  ? 159.215 148.268 156.046 1.00 39.87  ?  792  LEU A CA    1 
ATOM   5477  C  C     . LEU A 1  792  ? 159.202 148.705 154.589 1.00 39.87  ?  792  LEU A C     1 
ATOM   5478  O  O     . LEU A 1  792  ? 158.928 147.895 153.701 1.00 39.87  ?  792  LEU A O     1 
ATOM   5479  C  CB    . LEU A 1  792  ? 160.598 147.736 156.431 1.00 39.87  ?  792  LEU A CB    1 
ATOM   5480  C  CG    . LEU A 1  792  ? 161.876 148.556 156.263 1.00 39.87  ?  792  LEU A CG    1 
ATOM   5481  C  CD1   . LEU A 1  792  ? 161.976 149.603 157.311 1.00 39.87  ?  792  LEU A CD1   1 
ATOM   5482  C  CD2   . LEU A 1  792  ? 163.093 147.666 156.310 1.00 39.87  ?  792  LEU A CD2   1 
ATOM   5483  N  N     . GLU A 1  793  ? 159.483 149.979 154.332 1.00 44.12  ?  793  GLU A N     1 
ATOM   5484  C  CA    . GLU A 1  793  ? 159.440 150.493 152.973 1.00 44.12  ?  793  GLU A CA    1 
ATOM   5485  C  C     . GLU A 1  793  ? 160.563 151.496 152.719 1.00 44.12  ?  793  GLU A C     1 
ATOM   5486  O  O     . GLU A 1  793  ? 160.996 152.228 153.616 1.00 44.12  ?  793  GLU A O     1 
ATOM   5487  C  CB    . GLU A 1  793  ? 158.075 151.126 152.671 1.00 44.12  ?  793  GLU A CB    1 
ATOM   5488  C  CG    . GLU A 1  793  ? 157.823 152.475 153.314 1.00 44.12  ?  793  GLU A CG    1 
ATOM   5489  C  CD    . GLU A 1  793  ? 156.723 153.245 152.627 1.00 44.12  ?  793  GLU A CD    1 
ATOM   5490  O  OE1   . GLU A 1  793  ? 155.598 152.709 152.527 1.00 44.12  ?  793  GLU A OE1   1 
ATOM   5491  O  OE2   . GLU A 1  793  ? 156.982 154.378 152.180 1.00 44.12  -1 793  GLU A OE2   1 
ATOM   5492  N  N     . PHE A 1  794  ? 161.061 151.470 151.482 1.00 37.90  ?  794  PHE A N     1 
ATOM   5493  C  CA    . PHE A 1  794  ? 161.983 152.478 150.973 1.00 37.90  ?  794  PHE A CA    1 
ATOM   5494  C  C     . PHE A 1  794  ? 161.268 153.816 150.905 1.00 37.90  ?  794  PHE A C     1 
ATOM   5495  O  O     . PHE A 1  794  ? 160.083 153.868 150.576 1.00 37.90  ?  794  PHE A O     1 
ATOM   5496  C  CB    . PHE A 1  794  ? 162.459 152.055 149.583 1.00 37.90  ?  794  PHE A CB    1 
ATOM   5497  C  CG    . PHE A 1  794  ? 163.540 152.917 148.999 1.00 37.90  ?  794  PHE A CG    1 
ATOM   5498  C  CD1   . PHE A 1  794  ? 163.235 154.033 148.238 1.00 37.90  ?  794  PHE A CD1   1 
ATOM   5499  C  CD2   . PHE A 1  794  ? 164.869 152.567 149.164 1.00 37.90  ?  794  PHE A CD2   1 
ATOM   5500  C  CE1   . PHE A 1  794  ? 164.227 154.802 147.707 1.00 37.90  ?  794  PHE A CE1   1 
ATOM   5501  C  CE2   . PHE A 1  794  ? 165.862 153.332 148.624 1.00 37.90  ?  794  PHE A CE2   1 
ATOM   5502  C  CZ    . PHE A 1  794  ? 165.538 154.451 147.900 1.00 37.90  ?  794  PHE A CZ    1 
ATOM   5503  N  N     . GLU A 1  795  ? 161.966 154.905 151.195 1.00 40.46  ?  795  GLU A N     1 
ATOM   5504  C  CA    . GLU A 1  795  ? 161.275 156.182 151.096 1.00 40.46  ?  795  GLU A CA    1 
ATOM   5505  C  C     . GLU A 1  795  ? 162.011 157.263 150.324 1.00 40.46  ?  795  GLU A C     1 
ATOM   5506  O  O     . GLU A 1  795  ? 161.347 158.073 149.671 1.00 40.46  ?  795  GLU A O     1 
ATOM   5507  C  CB    . GLU A 1  795  ? 160.934 156.707 152.488 1.00 40.46  ?  795  GLU A CB    1 
ATOM   5508  C  CG    . GLU A 1  795  ? 159.555 156.309 152.915 1.00 40.46  ?  795  GLU A CG    1 
ATOM   5509  C  CD    . GLU A 1  795  ? 158.988 157.187 154.000 1.00 40.46  ?  795  GLU A CD    1 
ATOM   5510  O  OE1   . GLU A 1  795  ? 159.582 158.249 154.288 1.00 40.46  ?  795  GLU A OE1   1 
ATOM   5511  O  OE2   . GLU A 1  795  ? 157.935 156.812 154.557 1.00 40.46  -1 795  GLU A OE2   1 
ATOM   5512  N  N     . LYS A 1  796  ? 163.344 157.301 150.368 1.00 37.25  ?  796  LYS A N     1 
ATOM   5513  C  CA    . LYS A 1  796  ? 164.117 158.374 149.746 1.00 37.25  ?  796  LYS A CA    1 
ATOM   5514  C  C     . LYS A 1  796  ? 165.578 157.967 149.655 1.00 37.25  ?  796  LYS A C     1 
ATOM   5515  O  O     . LYS A 1  796  ? 165.981 156.907 150.133 1.00 37.25  ?  796  LYS A O     1 
ATOM   5516  C  CB    . LYS A 1  796  ? 163.964 159.693 150.507 1.00 37.25  ?  796  LYS A CB    1 
ATOM   5517  C  CG    . LYS A 1  796  ? 163.996 159.567 152.012 1.00 37.25  ?  796  LYS A CG    1 
ATOM   5518  C  CD    . LYS A 1  796  ? 163.504 160.822 152.695 1.00 37.25  ?  796  LYS A CD    1 
ATOM   5519  C  CE    . LYS A 1  796  ? 162.022 161.035 152.475 1.00 37.25  ?  796  LYS A CE    1 
ATOM   5520  N  NZ    . LYS A 1  796  ? 161.198 160.005 153.152 1.00 37.25  1  796  LYS A NZ    1 
ATOM   5521  N  N     . VAL A 1  797  ? 166.356 158.813 148.978 1.00 38.76  ?  797  VAL A N     1 
ATOM   5522  C  CA    . VAL A 1  797  ? 167.817 158.770 148.972 1.00 38.76  ?  797  VAL A CA    1 
ATOM   5523  C  C     . VAL A 1  797  ? 168.302 160.203 149.131 1.00 38.76  ?  797  VAL A C     1 
ATOM   5524  O  O     . VAL A 1  797  ? 167.922 161.079 148.345 1.00 38.76  ?  797  VAL A O     1 
ATOM   5525  C  CB    . VAL A 1  797  ? 168.396 158.131 147.691 1.00 38.76  ?  797  VAL A CB    1 
ATOM   5526  C  CG1   . VAL A 1  797  ? 169.827 158.576 147.441 1.00 38.76  ?  797  VAL A CG1   1 
ATOM   5527  C  CG2   . VAL A 1  797  ? 168.393 156.619 147.798 1.00 38.76  ?  797  VAL A CG2   1 
ATOM   5528  N  N     . TYR A 1  798  ? 169.109 160.454 150.156 1.00 33.66  ?  798  TYR A N     1 
ATOM   5529  C  CA    . TYR A 1  798  ? 169.679 161.776 150.382 1.00 33.66  ?  798  TYR A CA    1 
ATOM   5530  C  C     . TYR A 1  798  ? 171.077 161.844 149.778 1.00 33.66  ?  798  TYR A C     1 
ATOM   5531  O  O     . TYR A 1  798  ? 171.894 160.946 149.988 1.00 33.66  ?  798  TYR A O     1 
ATOM   5532  C  CB    . TYR A 1  798  ? 169.751 162.089 151.871 1.00 33.66  ?  798  TYR A CB    1 
ATOM   5533  C  CG    . TYR A 1  798  ? 168.457 162.488 152.537 1.00 33.66  ?  798  TYR A CG    1 
ATOM   5534  C  CD1   . TYR A 1  798  ? 167.934 163.759 152.370 1.00 33.66  ?  798  TYR A CD1   1 
ATOM   5535  C  CD2   . TYR A 1  798  ? 167.787 161.612 153.380 1.00 33.66  ?  798  TYR A CD2   1 
ATOM   5536  C  CE1   . TYR A 1  798  ? 166.769 164.140 152.995 1.00 33.66  ?  798  TYR A CE1   1 
ATOM   5537  C  CE2   . TYR A 1  798  ? 166.627 161.987 154.014 1.00 33.66  ?  798  TYR A CE2   1 
ATOM   5538  C  CZ    . TYR A 1  798  ? 166.124 163.251 153.811 1.00 33.66  ?  798  TYR A CZ    1 
ATOM   5539  O  OH    . TYR A 1  798  ? 164.962 163.632 154.428 1.00 33.66  ?  798  TYR A OH    1 
ATOM   5540  N  N     . PHE A 1  799  ? 171.346 162.916 149.025 1.00 38.39  ?  799  PHE A N     1 
ATOM   5541  C  CA    . PHE A 1  799  ? 172.609 163.047 148.306 1.00 38.39  ?  799  PHE A CA    1 
ATOM   5542  C  C     . PHE A 1  799  ? 172.899 164.501 147.947 1.00 38.39  ?  799  PHE A C     1 
ATOM   5543  O  O     . PHE A 1  799  ? 172.390 164.989 146.932 1.00 38.39  ?  799  PHE A O     1 
ATOM   5544  C  CB    . PHE A 1  799  ? 172.580 162.184 147.044 1.00 38.39  ?  799  PHE A CB    1 
ATOM   5545  C  CG    . PHE A 1  799  ? 173.799 162.317 146.195 1.00 38.39  ?  799  PHE A CG    1 
ATOM   5546  C  CD1   . PHE A 1  799  ? 175.049 162.042 146.712 1.00 38.39  ?  799  PHE A CD1   1 
ATOM   5547  C  CD2   . PHE A 1  799  ? 173.692 162.731 144.875 1.00 38.39  ?  799  PHE A CD2   1 
ATOM   5548  C  CE1   . PHE A 1  799  ? 176.175 162.159 145.931 1.00 38.39  ?  799  PHE A CE1   1 
ATOM   5549  C  CE2   . PHE A 1  799  ? 174.812 162.860 144.082 1.00 38.39  ?  799  PHE A CE2   1 
ATOM   5550  C  CZ    . PHE A 1  799  ? 176.060 162.572 144.611 1.00 38.39  ?  799  PHE A CZ    1 
ATOM   5551  N  N     . PRO A 1  800  ? 173.702 165.237 148.736 1.00 35.53  ?  800  PRO A N     1 
ATOM   5552  C  CA    . PRO A 1  800  ? 174.472 164.909 149.944 1.00 35.53  ?  800  PRO A CA    1 
ATOM   5553  C  C     . PRO A 1  800  ? 173.662 164.956 151.252 1.00 35.53  ?  800  PRO A C     1 
ATOM   5554  O  O     . PRO A 1  800  ? 172.461 165.171 151.198 1.00 35.53  ?  800  PRO A O     1 
ATOM   5555  C  CB    . PRO A 1  800  ? 175.555 165.983 149.941 1.00 35.53  ?  800  PRO A CB    1 
ATOM   5556  C  CG    . PRO A 1  800  ? 174.890 167.161 149.350 1.00 35.53  ?  800  PRO A CG    1 
ATOM   5557  C  CD    . PRO A 1  800  ? 173.930 166.633 148.320 1.00 35.53  ?  800  PRO A CD    1 
ATOM   5558  N  N     . TYR A 1  801  ? 174.312 164.769 152.404 1.00 30.06  ?  801  TYR A N     1 
ATOM   5559  C  CA    . TYR A 1  801  ? 173.612 164.667 153.682 1.00 30.06  ?  801  TYR A CA    1 
ATOM   5560  C  C     . TYR A 1  801  ? 174.347 165.486 154.738 1.00 30.06  ?  801  TYR A C     1 
ATOM   5561  O  O     . TYR A 1  801  ? 175.566 165.619 154.678 1.00 30.06  ?  801  TYR A O     1 
ATOM   5562  C  CB    . TYR A 1  801  ? 173.513 163.193 154.099 1.00 30.06  ?  801  TYR A CB    1 
ATOM   5563  C  CG    . TYR A 1  801  ? 172.564 162.902 155.235 1.00 30.06  ?  801  TYR A CG    1 
ATOM   5564  C  CD1   . TYR A 1  801  ? 171.412 163.642 155.406 1.00 30.06  ?  801  TYR A CD1   1 
ATOM   5565  C  CD2   . TYR A 1  801  ? 172.826 161.878 156.140 1.00 30.06  ?  801  TYR A CD2   1 
ATOM   5566  C  CE1   . TYR A 1  801  ? 170.548 163.385 156.447 1.00 30.06  ?  801  TYR A CE1   1 
ATOM   5567  C  CE2   . TYR A 1  801  ? 171.965 161.612 157.183 1.00 30.06  ?  801  TYR A CE2   1 
ATOM   5568  C  CZ    . TYR A 1  801  ? 170.829 162.373 157.330 1.00 30.06  ?  801  TYR A CZ    1 
ATOM   5569  O  OH    . TYR A 1  801  ? 169.960 162.122 158.363 1.00 30.06  ?  801  TYR A OH    1 
ATOM   5570  N  N     . LEU A 1  802  ? 173.628 166.028 155.716 1.00 27.88  ?  802  LEU A N     1 
ATOM   5571  C  CA    . LEU A 1  802  ? 174.239 166.886 156.729 1.00 27.88  ?  802  LEU A CA    1 
ATOM   5572  C  C     . LEU A 1  802  ? 173.595 166.622 158.085 1.00 27.88  ?  802  LEU A C     1 
ATOM   5573  O  O     . LEU A 1  802  ? 172.445 167.004 158.308 1.00 27.88  ?  802  LEU A O     1 
ATOM   5574  C  CB    . LEU A 1  802  ? 174.098 168.357 156.342 1.00 27.88  ?  802  LEU A CB    1 
ATOM   5575  C  CG    . LEU A 1  802  ? 174.781 169.341 157.275 1.00 27.88  ?  802  LEU A CG    1 
ATOM   5576  C  CD1   . LEU A 1  802  ? 176.266 169.114 157.197 1.00 27.88  ?  802  LEU A CD1   1 
ATOM   5577  C  CD2   . LEU A 1  802  ? 174.443 170.765 156.911 1.00 27.88  ?  802  LEU A CD2   1 
ATOM   5578  N  N     . LEU A 1  803  ? 174.337 165.995 158.999 1.00 22.32  ?  803  LEU A N     1 
ATOM   5579  C  CA    . LEU A 1  803  ? 173.802 165.546 160.280 1.00 22.32  ?  803  LEU A CA    1 
ATOM   5580  C  C     . LEU A 1  803  ? 174.462 166.340 161.397 1.00 22.32  ?  803  LEU A C     1 
ATOM   5581  O  O     . LEU A 1  803  ? 175.683 166.267 161.565 1.00 22.32  ?  803  LEU A O     1 
ATOM   5582  C  CB    . LEU A 1  803  ? 174.029 164.046 160.444 1.00 22.32  ?  803  LEU A CB    1 
ATOM   5583  C  CG    . LEU A 1  803  ? 173.505 163.333 161.680 1.00 22.32  ?  803  LEU A CG    1 
ATOM   5584  C  CD1   . LEU A 1  803  ? 172.016 163.529 161.809 1.00 22.32  ?  803  LEU A CD1   1 
ATOM   5585  C  CD2   . LEU A 1  803  ? 173.809 161.868 161.532 1.00 22.32  ?  803  LEU A CD2   1 
ATOM   5586  N  N     . ILE A 1  804  ? 173.666 167.092 162.159 1.00 26.80  ?  804  ILE A N     1 
ATOM   5587  C  CA    . ILE A 1  804  ? 174.231 168.018 163.135 1.00 26.80  ?  804  ILE A CA    1 
ATOM   5588  C  C     . ILE A 1  804  ? 174.126 167.469 164.552 1.00 26.80  ?  804  ILE A C     1 
ATOM   5589  O  O     . ILE A 1  804  ? 175.087 167.513 165.319 1.00 26.80  ?  804  ILE A O     1 
ATOM   5590  C  CB    . ILE A 1  804  ? 173.541 169.401 163.011 1.00 26.80  ?  804  ILE A CB    1 
ATOM   5591  C  CG1   . ILE A 1  804  ? 173.580 169.917 161.572 1.00 26.80  ?  804  ILE A CG1   1 
ATOM   5592  C  CG2   . ILE A 1  804  ? 174.162 170.411 163.935 1.00 26.80  ?  804  ILE A CG2   1 
ATOM   5593  C  CD1   . ILE A 1  804  ? 174.942 169.928 160.965 1.00 26.80  ?  804  ILE A CD1   1 
ATOM   5594  N  N     . SER A 1  805  ? 172.969 166.948 164.936 1.00 28.19  ?  805  SER A N     1 
ATOM   5595  C  CA    . SER A 1  805  ? 172.758 166.419 166.276 1.00 28.19  ?  805  SER A CA    1 
ATOM   5596  C  C     . SER A 1  805  ? 171.591 165.441 166.214 1.00 28.19  ?  805  SER A C     1 
ATOM   5597  O  O     . SER A 1  805  ? 171.264 164.923 165.141 1.00 28.19  ?  805  SER A O     1 
ATOM   5598  C  CB    . SER A 1  805  ? 172.535 167.554 167.286 1.00 28.19  ?  805  SER A CB    1 
ATOM   5599  O  OG    . SER A 1  805  ? 171.669 168.532 166.769 1.00 28.19  ?  805  SER A OG    1 
ATOM   5600  N  N     . LYS A 1  806  ? 171.005 165.141 167.364 1.00 28.45  ?  806  LYS A N     1 
ATOM   5601  C  CA    . LYS A 1  806  ? 169.741 164.427 167.387 1.00 28.45  ?  806  LYS A CA    1 
ATOM   5602  C  C     . LYS A 1  806  ? 168.627 165.406 167.047 1.00 28.45  ?  806  LYS A C     1 
ATOM   5603  O  O     . LYS A 1  806  ? 168.611 166.530 167.559 1.00 28.45  ?  806  LYS A O     1 
ATOM   5604  C  CB    . LYS A 1  806  ? 169.507 163.799 168.759 1.00 28.45  ?  806  LYS A CB    1 
ATOM   5605  C  CG    . LYS A 1  806  ? 170.339 162.556 169.045 1.00 28.45  ?  806  LYS A CG    1 
ATOM   5606  C  CD    . LYS A 1  806  ? 170.071 162.062 170.453 1.00 28.45  ?  806  LYS A CD    1 
ATOM   5607  C  CE    . LYS A 1  806  ? 170.878 160.829 170.786 1.00 28.45  ?  806  LYS A CE    1 
ATOM   5608  N  NZ    . LYS A 1  806  ? 170.405 160.169 172.034 1.00 28.45  1  806  LYS A NZ    1 
ATOM   5609  N  N     . LYS A 1  807  ? 167.733 164.986 166.139 1.00 27.13  ?  807  LYS A N     1 
ATOM   5610  C  CA    . LYS A 1  807  ? 166.586 165.766 165.647 1.00 27.13  ?  807  LYS A CA    1 
ATOM   5611  C  C     . LYS A 1  807  ? 167.004 167.050 164.925 1.00 27.13  ?  807  LYS A C     1 
ATOM   5612  O  O     . LYS A 1  807  ? 166.257 168.028 164.908 1.00 27.13  ?  807  LYS A O     1 
ATOM   5613  C  CB    . LYS A 1  807  ? 165.579 166.083 166.767 1.00 27.13  ?  807  LYS A CB    1 
ATOM   5614  C  CG    . LYS A 1  807  ? 165.117 164.868 167.575 1.00 27.13  ?  807  LYS A CG    1 
ATOM   5615  C  CD    . LYS A 1  807  ? 163.750 165.092 168.196 1.00 27.13  ?  807  LYS A CD    1 
ATOM   5616  C  CE    . LYS A 1  807  ? 163.406 164.015 169.201 1.00 27.13  ?  807  LYS A CE    1 
ATOM   5617  N  NZ    . LYS A 1  807  ? 163.390 162.644 168.627 1.00 27.13  1  807  LYS A NZ    1 
ATOM   5618  N  N     . ARG A 1  808  ? 168.191 167.061 164.317 1.00 27.08  ?  808  ARG A N     1 
ATOM   5619  C  CA    . ARG A 1  808  ? 168.681 168.194 163.530 1.00 27.08  ?  808  ARG A CA    1 
ATOM   5620  C  C     . ARG A 1  808  ? 169.492 167.660 162.351 1.00 27.08  ?  808  ARG A C     1 
ATOM   5621  O  O     . ARG A 1  808  ? 170.632 167.204 162.533 1.00 27.08  ?  808  ARG A O     1 
ATOM   5622  C  CB    . ARG A 1  808  ? 169.547 169.134 164.365 1.00 27.08  ?  808  ARG A CB    1 
ATOM   5623  C  CG    . ARG A 1  808  ? 168.918 169.832 165.561 1.00 27.08  ?  808  ARG A CG    1 
ATOM   5624  C  CD    . ARG A 1  808  ? 168.127 171.017 165.120 1.00 27.08  ?  808  ARG A CD    1 
ATOM   5625  N  NE    . ARG A 1  808  ? 167.501 171.718 166.228 1.00 27.08  ?  808  ARG A NE    1 
ATOM   5626  C  CZ    . ARG A 1  808  ? 167.938 172.878 166.704 1.00 27.08  ?  808  ARG A CZ    1 
ATOM   5627  N  NH1   . ARG A 1  808  ? 168.999 173.456 166.163 1.00 27.08  1  808  ARG A NH1   1 
ATOM   5628  N  NH2   . ARG A 1  808  ? 167.307 173.462 167.711 1.00 27.08  ?  808  ARG A NH2   1 
ATOM   5629  N  N     . TYR A 1  809  ? 168.933 167.747 161.142 1.00 25.52  ?  809  TYR A N     1 
ATOM   5630  C  CA    . TYR A 1  809  ? 169.682 167.358 159.951 1.00 25.52  ?  809  TYR A CA    1 
ATOM   5631  C  C     . TYR A 1  809  ? 169.079 168.011 158.716 1.00 25.52  ?  809  TYR A C     1 
ATOM   5632  O  O     . TYR A 1  809  ? 168.081 168.731 158.786 1.00 25.52  ?  809  TYR A O     1 
ATOM   5633  C  CB    . TYR A 1  809  ? 169.759 165.837 159.777 1.00 25.52  ?  809  TYR A CB    1 
ATOM   5634  C  CG    . TYR A 1  809  ? 168.453 165.095 159.657 1.00 25.52  ?  809  TYR A CG    1 
ATOM   5635  C  CD1   . TYR A 1  809  ? 167.712 164.759 160.786 1.00 25.52  ?  809  TYR A CD1   1 
ATOM   5636  C  CD2   . TYR A 1  809  ? 167.988 164.677 158.421 1.00 25.52  ?  809  TYR A CD2   1 
ATOM   5637  C  CE1   . TYR A 1  809  ? 166.538 164.067 160.675 1.00 25.52  ?  809  TYR A CE1   1 
ATOM   5638  C  CE2   . TYR A 1  809  ? 166.813 163.990 158.305 1.00 25.52  ?  809  TYR A CE2   1 
ATOM   5639  C  CZ    . TYR A 1  809  ? 166.100 163.683 159.435 1.00 25.52  ?  809  TYR A CZ    1 
ATOM   5640  O  OH    . TYR A 1  809  ? 164.926 162.995 159.315 1.00 25.52  ?  809  TYR A OH    1 
ATOM   5641  N  N     . ALA A 1  810  ? 169.722 167.759 157.579 1.00 28.39  ?  810  ALA A N     1 
ATOM   5642  C  CA    . ALA A 1  810  ? 169.342 168.356 156.306 1.00 28.39  ?  810  ALA A CA    1 
ATOM   5643  C  C     . ALA A 1  810  ? 169.862 167.491 155.167 1.00 28.39  ?  810  ALA A C     1 
ATOM   5644  O  O     . ALA A 1  810  ? 170.817 166.732 155.322 1.00 28.39  ?  810  ALA A O     1 
ATOM   5645  C  CB    . ALA A 1  810  ? 169.871 169.782 156.175 1.00 28.39  ?  810  ALA A CB    1 
ATOM   5646  N  N     . GLY A 1  811  ? 169.218 167.621 154.016 1.00 32.75  ?  811  GLY A N     1 
ATOM   5647  C  CA    . GLY A 1  811  ? 169.640 166.841 152.865 1.00 32.75  ?  811  GLY A CA    1 
ATOM   5648  C  C     . GLY A 1  811  ? 168.874 167.237 151.624 1.00 32.75  ?  811  GLY A C     1 
ATOM   5649  O  O     . GLY A 1  811  ? 168.034 168.136 151.652 1.00 32.75  ?  811  GLY A O     1 
ATOM   5650  N  N     . LEU A 1  812  ? 169.177 166.556 150.518 1.00 40.16  ?  812  LEU A N     1 
ATOM   5651  C  CA    . LEU A 1  812  ? 168.504 166.780 149.242 1.00 40.16  ?  812  LEU A CA    1 
ATOM   5652  C  C     . LEU A 1  812  ? 167.792 165.520 148.767 1.00 40.16  ?  812  LEU A C     1 
ATOM   5653  O  O     . LEU A 1  812  ? 168.343 164.418 148.833 1.00 40.16  ?  812  LEU A O     1 
ATOM   5654  C  CB    . LEU A 1  812  ? 169.465 167.241 148.158 1.00 40.16  ?  812  LEU A CB    1 
ATOM   5655  C  CG    . LEU A 1  812  ? 169.766 168.726 148.038 1.00 40.16  ?  812  LEU A CG    1 
ATOM   5656  C  CD1   . LEU A 1  812  ? 170.888 168.915 147.038 1.00 40.16  ?  812  LEU A CD1   1 
ATOM   5657  C  CD2   . LEU A 1  812  ? 168.531 169.450 147.562 1.00 40.16  ?  812  LEU A CD2   1 
ATOM   5658  N  N     . LEU A 1  813  ? 166.601 165.718 148.212 1.00 46.94  ?  813  LEU A N     1 
ATOM   5659  C  CA    . LEU A 1  813  ? 165.565 164.697 148.153 1.00 46.94  ?  813  LEU A CA    1 
ATOM   5660  C  C     . LEU A 1  813  ? 165.444 164.131 146.744 1.00 46.94  ?  813  LEU A C     1 
ATOM   5661  O  O     . LEU A 1  813  ? 165.274 164.880 145.777 1.00 46.94  ?  813  LEU A O     1 
ATOM   5662  C  CB    . LEU A 1  813  ? 164.238 165.294 148.621 1.00 46.94  ?  813  LEU A CB    1 
ATOM   5663  C  CG    . LEU A 1  813  ? 163.057 164.410 148.998 1.00 46.94  ?  813  LEU A CG    1 
ATOM   5664  C  CD1   . LEU A 1  813  ? 163.493 163.259 149.838 1.00 46.94  ?  813  LEU A CD1   1 
ATOM   5665  C  CD2   . LEU A 1  813  ? 162.042 165.222 149.747 1.00 46.94  ?  813  LEU A CD2   1 
ATOM   5666  N  N     . PHE A 1  814  ? 165.523 162.808 146.640 1.00 54.90  ?  814  PHE A N     1 
ATOM   5667  C  CA    . PHE A 1  814  ? 165.369 162.076 145.392 1.00 54.90  ?  814  PHE A CA    1 
ATOM   5668  C  C     . PHE A 1  814  ? 164.162 161.160 145.542 1.00 54.90  ?  814  PHE A C     1 
ATOM   5669  O  O     . PHE A 1  814  ? 164.117 160.344 146.468 1.00 54.90  ?  814  PHE A O     1 
ATOM   5670  C  CB    . PHE A 1  814  ? 166.614 161.242 145.074 1.00 54.90  ?  814  PHE A CB    1 
ATOM   5671  C  CG    . PHE A 1  814  ? 167.802 162.033 144.578 1.00 54.90  ?  814  PHE A CG    1 
ATOM   5672  C  CD1   . PHE A 1  814  ? 168.436 162.961 145.377 1.00 54.90  ?  814  PHE A CD1   1 
ATOM   5673  C  CD2   . PHE A 1  814  ? 168.319 161.793 143.320 1.00 54.90  ?  814  PHE A CD2   1 
ATOM   5674  C  CE1   . PHE A 1  814  ? 169.527 163.664 144.917 1.00 54.90  ?  814  PHE A CE1   1 
ATOM   5675  C  CE2   . PHE A 1  814  ? 169.415 162.493 142.862 1.00 54.90  ?  814  PHE A CE2   1 
ATOM   5676  C  CZ    . PHE A 1  814  ? 170.016 163.429 143.666 1.00 54.90  ?  814  PHE A CZ    1 
ATOM   5677  N  N     . SER A 1  815  ? 163.191 161.284 144.640 1.00 74.62  ?  815  SER A N     1 
ATOM   5678  C  CA    . SER A 1  815  ? 162.048 160.377 144.613 1.00 74.62  ?  815  SER A CA    1 
ATOM   5679  C  C     . SER A 1  815  ? 162.211 159.255 143.597 1.00 74.62  ?  815  SER A C     1 
ATOM   5680  O  O     . SER A 1  815  ? 161.962 158.088 143.920 1.00 74.62  ?  815  SER A O     1 
ATOM   5681  C  CB    . SER A 1  815  ? 160.764 161.145 144.298 1.00 74.62  ?  815  SER A CB    1 
ATOM   5682  O  OG    . SER A 1  815  ? 160.717 161.493 142.925 1.00 74.62  ?  815  SER A OG    1 
ATOM   5683  N  N     . SER A 1  816  ? 162.595 159.596 142.370 1.00 83.87  ?  816  SER A N     1 
ATOM   5684  C  CA    . SER A 1  816  ? 162.983 158.657 141.331 1.00 83.87  ?  816  SER A CA    1 
ATOM   5685  C  C     . SER A 1  816  ? 164.387 159.027 140.876 1.00 83.87  ?  816  SER A C     1 
ATOM   5686  O  O     . SER A 1  816  ? 165.018 159.928 141.431 1.00 83.87  ?  816  SER A O     1 
ATOM   5687  C  CB    . SER A 1  816  ? 161.992 158.688 140.160 1.00 83.87  ?  816  SER A CB    1 
ATOM   5688  O  OG    . SER A 1  816  ? 160.663 158.698 140.637 1.00 83.87  ?  816  SER A OG    1 
ATOM   5689  N  N     . ARG A 1  817  ? 164.914 158.303 139.909 1.00 87.23  ?  817  ARG A N     1 
ATOM   5690  C  CA    . ARG A 1  817  ? 166.124 158.839 139.297 1.00 87.23  ?  817  ARG A CA    1 
ATOM   5691  C  C     . ARG A 1  817  ? 165.876 159.866 138.179 1.00 87.23  ?  817  ARG A C     1 
ATOM   5692  O  O     . ARG A 1  817  ? 166.494 160.939 138.242 1.00 87.23  ?  817  ARG A O     1 
ATOM   5693  C  CB    . ARG A 1  817  ? 167.043 157.714 138.809 1.00 87.23  ?  817  ARG A CB    1 
ATOM   5694  C  CG    . ARG A 1  817  ? 168.487 158.173 138.586 1.00 87.23  ?  817  ARG A CG    1 
ATOM   5695  C  CD    . ARG A 1  817  ? 168.937 159.139 139.680 1.00 87.23  ?  817  ARG A CD    1 
ATOM   5696  N  NE    . ARG A 1  817  ? 170.293 159.656 139.533 1.00 87.23  ?  817  ARG A NE    1 
ATOM   5697  C  CZ    . ARG A 1  817  ? 170.571 160.956 139.536 1.00 87.23  ?  817  ARG A CZ    1 
ATOM   5698  N  NH1   . ARG A 1  817  ? 169.577 161.833 139.637 1.00 87.23  1  817  ARG A NH1   1 
ATOM   5699  N  NH2   . ARG A 1  817  ? 171.823 161.386 139.413 1.00 87.23  ?  817  ARG A NH2   1 
ATOM   5700  N  N     . PRO A 1  818  ? 165.029 159.633 137.154 1.00 104.80 ?  818  PRO A N     1 
ATOM   5701  C  CA    . PRO A 1  818  ? 164.932 160.638 136.081 1.00 104.80 ?  818  PRO A CA    1 
ATOM   5702  C  C     . PRO A 1  818  ? 164.106 161.847 136.461 1.00 104.80 ?  818  PRO A C     1 
ATOM   5703  O  O     . PRO A 1  818  ? 164.166 162.866 135.763 1.00 104.80 ?  818  PRO A O     1 
ATOM   5704  C  CB    . PRO A 1  818  ? 164.283 159.858 134.931 1.00 104.80 ?  818  PRO A CB    1 
ATOM   5705  C  CG    . PRO A 1  818  ? 163.395 158.946 135.597 1.00 104.80 ?  818  PRO A CG    1 
ATOM   5706  C  CD    . PRO A 1  818  ? 164.138 158.492 136.827 1.00 104.80 ?  818  PRO A CD    1 
ATOM   5707  N  N     . ASP A 1  819  ? 163.300 161.726 137.515 1.00 97.68  ?  819  ASP A N     1 
ATOM   5708  C  CA    . ASP A 1  819  ? 162.903 162.834 138.376 1.00 97.68  ?  819  ASP A CA    1 
ATOM   5709  C  C     . ASP A 1  819  ? 164.130 163.123 139.238 1.00 97.68  ?  819  ASP A C     1 
ATOM   5710  O  O     . ASP A 1  819  ? 164.398 162.446 140.233 1.00 97.68  ?  819  ASP A O     1 
ATOM   5711  C  CB    . ASP A 1  819  ? 161.681 162.434 139.197 1.00 97.68  ?  819  ASP A CB    1 
ATOM   5712  C  CG    . ASP A 1  819  ? 161.270 163.478 140.222 1.00 97.68  ?  819  ASP A CG    1 
ATOM   5713  O  OD1   . ASP A 1  819  ? 161.616 164.670 140.074 1.00 97.68  ?  819  ASP A OD1   1 
ATOM   5714  O  OD2   . ASP A 1  819  ? 160.593 163.083 141.195 1.00 97.68  -1 819  ASP A OD2   1 
ATOM   5715  N  N     . ALA A 1  820  ? 164.893 164.144 138.829 1.00 87.38  ?  820  ALA A N     1 
ATOM   5716  C  CA    . ALA A 1  820  ? 166.274 164.301 139.292 1.00 87.38  ?  820  ALA A CA    1 
ATOM   5717  C  C     . ALA A 1  820  ? 166.343 164.697 140.766 1.00 87.38  ?  820  ALA A C     1 
ATOM   5718  O  O     . ALA A 1  820  ? 166.875 163.946 141.588 1.00 87.38  ?  820  ALA A O     1 
ATOM   5719  C  CB    . ALA A 1  820  ? 167.005 165.319 138.414 1.00 87.38  ?  820  ALA A CB    1 
ATOM   5720  N  N     . HIS A 1  821  ? 165.814 165.865 141.136 1.00 75.90  ?  821  HIS A N     1 
ATOM   5721  C  CA    . HIS A 1  821  ? 165.719 166.167 142.558 1.00 75.90  ?  821  HIS A CA    1 
ATOM   5722  C  C     . HIS A 1  821  ? 164.444 166.949 142.816 1.00 75.90  ?  821  HIS A C     1 
ATOM   5723  O  O     . HIS A 1  821  ? 163.940 167.656 141.941 1.00 75.90  ?  821  HIS A O     1 
ATOM   5724  C  CB    . HIS A 1  821  ? 166.922 166.951 143.108 1.00 75.90  ?  821  HIS A CB    1 
ATOM   5725  C  CG    . HIS A 1  821  ? 166.937 168.400 142.742 1.00 75.90  ?  821  HIS A CG    1 
ATOM   5726  N  ND1   . HIS A 1  821  ? 167.390 168.861 141.526 1.00 75.90  ?  821  HIS A ND1   1 
ATOM   5727  C  CD2   . HIS A 1  821  ? 166.568 169.497 143.449 1.00 75.90  ?  821  HIS A CD2   1 
ATOM   5728  C  CE1   . HIS A 1  821  ? 167.294 170.180 141.498 1.00 75.90  ?  821  HIS A CE1   1 
ATOM   5729  N  NE2   . HIS A 1  821  ? 166.797 170.589 142.652 1.00 75.90  ?  821  HIS A NE2   1 
ATOM   5730  N  N     . ASP A 1  822  ? 163.927 166.816 144.038 1.00 66.83  ?  822  ASP A N     1 
ATOM   5731  C  CA    . ASP A 1  822  ? 162.655 167.415 144.420 1.00 66.83  ?  822  ASP A CA    1 
ATOM   5732  C  C     . ASP A 1  822  ? 162.837 168.747 145.137 1.00 66.83  ?  822  ASP A C     1 
ATOM   5733  O  O     . ASP A 1  822  ? 162.363 169.781 144.656 1.00 66.83  ?  822  ASP A O     1 
ATOM   5734  C  CB    . ASP A 1  822  ? 161.889 166.450 145.318 1.00 66.83  ?  822  ASP A CB    1 
ATOM   5735  C  CG    . ASP A 1  822  ? 161.484 165.200 144.601 1.00 66.83  ?  822  ASP A CG    1 
ATOM   5736  O  OD1   . ASP A 1  822  ? 161.337 165.244 143.369 1.00 66.83  ?  822  ASP A OD1   1 
ATOM   5737  O  OD2   . ASP A 1  822  ? 161.307 164.177 145.278 1.00 66.83  -1 822  ASP A OD2   1 
ATOM   5738  N  N     . ARG A 1  823  ? 163.541 168.731 146.268 1.00 57.65  ?  823  ARG A N     1 
ATOM   5739  C  CA    . ARG A 1  823  ? 163.722 169.882 147.147 1.00 57.65  ?  823  ARG A CA    1 
ATOM   5740  C  C     . ARG A 1  823  ? 164.770 169.524 148.193 1.00 57.65  ?  823  ARG A C     1 
ATOM   5741  O  O     . ARG A 1  823  ? 165.384 168.454 148.152 1.00 57.65  ?  823  ARG A O     1 
ATOM   5742  C  CB    . ARG A 1  823  ? 162.417 170.276 147.834 1.00 57.65  ?  823  ARG A CB    1 
ATOM   5743  C  CG    . ARG A 1  823  ? 161.786 169.118 148.563 1.00 57.65  ?  823  ARG A CG    1 
ATOM   5744  C  CD    . ARG A 1  823  ? 160.458 169.487 149.180 1.00 57.65  ?  823  ARG A CD    1 
ATOM   5745  N  NE    . ARG A 1  823  ? 159.916 168.372 149.943 1.00 57.65  ?  823  ARG A NE    1 
ATOM   5746  C  CZ    . ARG A 1  823  ? 159.208 167.380 149.418 1.00 57.65  ?  823  ARG A CZ    1 
ATOM   5747  N  NH1   . ARG A 1  823  ? 158.944 167.363 148.118 1.00 57.65  1  823  ARG A NH1   1 
ATOM   5748  N  NH2   . ARG A 1  823  ? 158.762 166.403 150.198 1.00 57.65  ?  823  ARG A NH2   1 
ATOM   5749  N  N     . MET A 1  824  ? 164.955 170.435 149.141 1.00 50.29  ?  824  MET A N     1 
ATOM   5750  C  CA    . MET A 1  824  ? 165.721 170.177 150.348 1.00 50.29  ?  824  MET A CA    1 
ATOM   5751  C  C     . MET A 1  824  ? 164.828 169.610 151.446 1.00 50.29  ?  824  MET A C     1 
ATOM   5752  O  O     . MET A 1  824  ? 163.601 169.681 151.381 1.00 50.29  ?  824  MET A O     1 
ATOM   5753  C  CB    . MET A 1  824  ? 166.384 171.461 150.857 1.00 50.29  ?  824  MET A CB    1 
ATOM   5754  C  CG    . MET A 1  824  ? 167.813 171.677 150.401 1.00 50.29  ?  824  MET A CG    1 
ATOM   5755  S  SD    . MET A 1  824  ? 168.529 173.180 151.076 1.00 50.29  ?  824  MET A SD    1 
ATOM   5756  C  CE    . MET A 1  824  ? 167.313 174.387 150.572 1.00 50.29  ?  824  MET A CE    1 
ATOM   5757  N  N     . ASP A 1  825  ? 165.469 169.045 152.458 1.00 38.43  ?  825  ASP A N     1 
ATOM   5758  C  CA    . ASP A 1  825  ? 164.850 168.672 153.720 1.00 38.43  ?  825  ASP A CA    1 
ATOM   5759  C  C     . ASP A 1  825  ? 165.619 169.327 154.853 1.00 38.43  ?  825  ASP A C     1 
ATOM   5760  O  O     . ASP A 1  825  ? 166.835 169.145 154.957 1.00 38.43  ?  825  ASP A O     1 
ATOM   5761  C  CB    . ASP A 1  825  ? 164.854 167.157 153.907 1.00 38.43  ?  825  ASP A CB    1 
ATOM   5762  C  CG    . ASP A 1  825  ? 163.580 166.516 153.450 1.00 38.43  ?  825  ASP A CG    1 
ATOM   5763  O  OD1   . ASP A 1  825  ? 162.527 167.173 153.548 1.00 38.43  ?  825  ASP A OD1   1 
ATOM   5764  O  OD2   . ASP A 1  825  ? 163.625 165.354 153.011 1.00 38.43  -1 825  ASP A OD2   1 
ATOM   5765  N  N     . CYS A 1  826  ? 164.910 170.066 155.703 1.00 33.37  ?  826  CYS A N     1 
ATOM   5766  C  CA    . CYS A 1  826  ? 165.480 170.778 156.847 1.00 33.37  ?  826  CYS A CA    1 
ATOM   5767  C  C     . CYS A 1  826  ? 164.752 170.311 158.106 1.00 33.37  ?  826  CYS A C     1 
ATOM   5768  O  O     . CYS A 1  826  ? 163.804 170.960 158.554 1.00 33.37  ?  826  CYS A O     1 
ATOM   5769  C  CB    . CYS A 1  826  ? 165.338 172.290 156.684 1.00 33.37  ?  826  CYS A CB    1 
ATOM   5770  S  SG    . CYS A 1  826  ? 166.181 173.035 155.288 1.00 33.37  ?  826  CYS A SG    1 
ATOM   5771  N  N     . LYS A 1  827  ? 165.192 169.199 158.686 1.00 27.48  ?  827  LYS A N     1 
ATOM   5772  C  CA    . LYS A 1  827  ? 164.553 168.650 159.877 1.00 27.48  ?  827  LYS A CA    1 
ATOM   5773  C  C     . LYS A 1  827  ? 165.140 169.317 161.109 1.00 27.48  ?  827  LYS A C     1 
ATOM   5774  O  O     . LYS A 1  827  ? 166.301 169.080 161.454 1.00 27.48  ?  827  LYS A O     1 
ATOM   5775  C  CB    . LYS A 1  827  ? 164.747 167.139 159.947 1.00 27.48  ?  827  LYS A CB    1 
ATOM   5776  C  CG    . LYS A 1  827  ? 164.024 166.383 158.865 1.00 27.48  ?  827  LYS A CG    1 
ATOM   5777  C  CD    . LYS A 1  827  ? 162.560 166.202 159.188 1.00 27.48  ?  827  LYS A CD    1 
ATOM   5778  C  CE    . LYS A 1  827  ? 161.871 165.461 158.068 1.00 27.48  ?  827  LYS A CE    1 
ATOM   5779  N  NZ    . LYS A 1  827  ? 162.421 164.094 157.938 1.00 27.48  1  827  LYS A NZ    1 
ATOM   5780  N  N     . GLY A 1  828  ? 164.349 170.157 161.756 1.00 24.96  ?  828  GLY A N     1 
ATOM   5781  C  CA    . GLY A 1  828  ? 164.656 170.665 163.068 1.00 24.96  ?  828  GLY A CA    1 
ATOM   5782  C  C     . GLY A 1  828  ? 165.405 171.978 163.096 1.00 24.96  ?  828  GLY A C     1 
ATOM   5783  O  O     . GLY A 1  828  ? 165.393 172.650 164.132 1.00 24.96  ?  828  GLY A O     1 
ATOM   5784  N  N     . LEU A 1  829  ? 166.018 172.384 161.988 1.00 26.53  ?  829  LEU A N     1 
ATOM   5785  C  CA    . LEU A 1  829  ? 167.020 173.444 162.010 1.00 26.53  ?  829  LEU A CA    1 
ATOM   5786  C  C     . LEU A 1  829  ? 166.363 174.819 162.158 1.00 26.53  ?  829  LEU A C     1 
ATOM   5787  O  O     . LEU A 1  829  ? 165.165 174.956 162.409 1.00 26.53  ?  829  LEU A O     1 
ATOM   5788  C  CB    . LEU A 1  829  ? 167.898 173.368 160.765 1.00 26.53  ?  829  LEU A CB    1 
ATOM   5789  C  CG    . LEU A 1  829  ? 168.842 172.171 160.634 1.00 26.53  ?  829  LEU A CG    1 
ATOM   5790  C  CD1   . LEU A 1  829  ? 169.748 172.353 159.448 1.00 26.53  ?  829  LEU A CD1   1 
ATOM   5791  C  CD2   . LEU A 1  829  ? 169.656 171.987 161.877 1.00 26.53  ?  829  LEU A CD2   1 
ATOM   5792  N  N     . GLU A 1  830  ? 167.163 175.865 161.988 1.00 36.22  ?  830  GLU A N     1 
ATOM   5793  C  CA    . GLU A 1  830  ? 166.780 177.227 162.328 1.00 36.22  ?  830  GLU A CA    1 
ATOM   5794  C  C     . GLU A 1  830  ? 165.911 177.888 161.273 1.00 36.22  ?  830  GLU A C     1 
ATOM   5795  O  O     . GLU A 1  830  ? 165.697 179.101 161.353 1.00 36.22  ?  830  GLU A O     1 
ATOM   5796  C  CB    . GLU A 1  830  ? 168.030 178.081 162.549 1.00 36.22  ?  830  GLU A CB    1 
ATOM   5797  C  CG    . GLU A 1  830  ? 169.058 177.488 163.492 1.00 36.22  ?  830  GLU A CG    1 
ATOM   5798  C  CD    . GLU A 1  830  ? 168.602 177.430 164.932 1.00 36.22  ?  830  GLU A CD    1 
ATOM   5799  O  OE1   . GLU A 1  830  ? 169.080 176.539 165.660 1.00 36.22  ?  830  GLU A OE1   1 
ATOM   5800  O  OE2   . GLU A 1  830  ? 167.775 178.275 165.341 1.00 36.22  -1 830  GLU A OE2   1 
ATOM   5801  N  N     . ALA A 1  831  ? 165.417 177.129 160.297 1.00 34.24  ?  831  ALA A N     1 
ATOM   5802  C  CA    . ALA A 1  831  ? 164.614 177.654 159.204 1.00 34.24  ?  831  ALA A CA    1 
ATOM   5803  C  C     . ALA A 1  831  ? 163.142 177.300 159.316 1.00 34.24  ?  831  ALA A C     1 
ATOM   5804  O  O     . ALA A 1  831  ? 162.333 177.824 158.545 1.00 34.24  ?  831  ALA A O     1 
ATOM   5805  C  CB    . ALA A 1  831  ? 165.144 177.125 157.870 1.00 34.24  ?  831  ALA A CB    1 
ATOM   5806  N  N     . VAL A 1  832  ? 162.781 176.415 160.241 1.00 33.34  ?  832  VAL A N     1 
ATOM   5807  C  CA    . VAL A 1  832  ? 161.400 175.980 160.413 1.00 33.34  ?  832  VAL A CA    1 
ATOM   5808  C  C     . VAL A 1  832  ? 160.832 176.348 161.772 1.00 33.34  ?  832  VAL A C     1 
ATOM   5809  O  O     . VAL A 1  832  ? 159.608 176.290 161.948 1.00 33.34  ?  832  VAL A O     1 
ATOM   5810  C  CB    . VAL A 1  832  ? 161.256 174.463 160.173 1.00 33.34  ?  832  VAL A CB    1 
ATOM   5811  C  CG1   . VAL A 1  832  ? 161.699 174.111 158.779 1.00 33.34  ?  832  VAL A CG1   1 
ATOM   5812  C  CG2   . VAL A 1  832  ? 162.087 173.697 161.156 1.00 33.34  ?  832  VAL A CG2   1 
ATOM   5813  N  N     . ARG A 1  833  ? 161.667 176.715 162.734 1.00 27.98  ?  833  ARG A N     1 
ATOM   5814  C  CA    . ARG A 1  833  ? 161.192 177.201 164.016 1.00 27.98  ?  833  ARG A CA    1 
ATOM   5815  C  C     . ARG A 1  833  ? 160.740 178.648 163.890 1.00 27.98  ?  833  ARG A C     1 
ATOM   5816  O  O     . ARG A 1  833  ? 161.107 179.356 162.956 1.00 27.98  ?  833  ARG A O     1 
ATOM   5817  C  CB    . ARG A 1  833  ? 162.285 177.066 165.070 1.00 27.98  ?  833  ARG A CB    1 
ATOM   5818  C  CG    . ARG A 1  833  ? 162.883 175.677 165.134 1.00 27.98  ?  833  ARG A CG    1 
ATOM   5819  C  CD    . ARG A 1  833  ? 163.906 175.556 166.237 1.00 27.98  ?  833  ARG A CD    1 
ATOM   5820  N  NE    . ARG A 1  833  ? 163.417 176.147 167.474 1.00 27.98  ?  833  ARG A NE    1 
ATOM   5821  C  CZ    . ARG A 1  833  ? 163.009 175.448 168.525 1.00 27.98  ?  833  ARG A CZ    1 
ATOM   5822  N  NH1   . ARG A 1  833  ? 163.038 174.126 168.496 1.00 27.98  1  833  ARG A NH1   1 
ATOM   5823  N  NH2   . ARG A 1  833  ? 162.576 176.078 169.604 1.00 27.98  ?  833  ARG A NH2   1 
ATOM   5824  N  N     . ARG A 1  834  ? 159.912 179.080 164.840 1.00 28.34  ?  834  ARG A N     1 
ATOM   5825  C  CA    . ARG A 1  834  ? 159.337 180.418 164.811 1.00 28.34  ?  834  ARG A CA    1 
ATOM   5826  C  C     . ARG A 1  834  ? 159.810 181.290 165.965 1.00 28.34  ?  834  ARG A C     1 
ATOM   5827  O  O     . ARG A 1  834  ? 159.257 182.380 166.170 1.00 28.34  ?  834  ARG A O     1 
ATOM   5828  C  CB    . ARG A 1  834  ? 157.809 180.342 164.814 1.00 28.34  ?  834  ARG A CB    1 
ATOM   5829  C  CG    . ARG A 1  834  ? 157.265 179.267 163.907 1.00 28.34  ?  834  ARG A CG    1 
ATOM   5830  C  CD    . ARG A 1  834  ? 155.777 179.372 163.668 1.00 28.34  ?  834  ARG A CD    1 
ATOM   5831  N  NE    . ARG A 1  834  ? 154.940 179.160 164.851 1.00 28.34  ?  834  ARG A NE    1 
ATOM   5832  C  CZ    . ARG A 1  834  ? 154.620 177.968 165.343 1.00 28.34  ?  834  ARG A CZ    1 
ATOM   5833  N  NH1   . ARG A 1  834  ? 155.091 176.868 164.779 1.00 28.34  1  834  ARG A NH1   1 
ATOM   5834  N  NH2   . ARG A 1  834  ? 153.841 177.877 166.408 1.00 28.34  ?  834  ARG A NH2   1 
ATOM   5835  N  N     . ASP A 1  835  ? 160.820 180.852 166.717 1.00 37.94  ?  835  ASP A N     1 
ATOM   5836  C  CA    . ASP A 1  835  ? 161.329 181.597 167.862 1.00 37.94  ?  835  ASP A CA    1 
ATOM   5837  C  C     . ASP A 1  835  ? 162.409 182.616 167.498 1.00 37.94  ?  835  ASP A C     1 
ATOM   5838  O  O     . ASP A 1  835  ? 162.992 183.223 168.399 1.00 37.94  ?  835  ASP A O     1 
ATOM   5839  C  CB    . ASP A 1  835  ? 161.870 180.634 168.927 1.00 37.94  ?  835  ASP A CB    1 
ATOM   5840  C  CG    . ASP A 1  835  ? 162.701 179.487 168.339 1.00 37.94  ?  835  ASP A CG    1 
ATOM   5841  O  OD1   . ASP A 1  835  ? 163.190 179.589 167.195 1.00 37.94  ?  835  ASP A OD1   1 
ATOM   5842  O  OD2   . ASP A 1  835  ? 162.868 178.472 169.039 1.00 37.94  -1 835  ASP A OD2   1 
ATOM   5843  N  N     . ASN A 1  836  ? 162.679 182.833 166.217 1.00 32.48  ?  836  ASN A N     1 
ATOM   5844  C  CA    . ASN A 1  836  ? 163.825 183.628 165.799 1.00 32.48  ?  836  ASN A CA    1 
ATOM   5845  C  C     . ASN A 1  836  ? 163.364 184.741 164.861 1.00 32.48  ?  836  ASN A C     1 
ATOM   5846  O  O     . ASN A 1  836  ? 162.169 185.023 164.713 1.00 32.48  ?  836  ASN A O     1 
ATOM   5847  C  CB    . ASN A 1  836  ? 164.882 182.722 165.166 1.00 32.48  ?  836  ASN A CB    1 
ATOM   5848  C  CG    . ASN A 1  836  ? 164.295 181.736 164.187 1.00 32.48  ?  836  ASN A CG    1 
ATOM   5849  O  OD1   . ASN A 1  836  ? 163.466 182.087 163.355 1.00 32.48  ?  836  ASN A OD1   1 
ATOM   5850  N  ND2   . ASN A 1  836  ? 164.722 180.490 164.281 1.00 32.48  ?  836  ASN A ND2   1 
ATOM   5851  N  N     . CYS A 1  837  ? 164.319 185.398 164.228 1.00 26.84  ?  837  CYS A N     1 
ATOM   5852  C  CA    . CYS A 1  837  ? 164.136 186.473 163.275 1.00 26.84  ?  837  CYS A CA    1 
ATOM   5853  C  C     . CYS A 1  837  ? 163.973 185.919 161.866 1.00 26.84  ?  837  CYS A C     1 
ATOM   5854  O  O     . CYS A 1  837  ? 164.427 184.809 161.580 1.00 26.84  ?  837  CYS A O     1 
ATOM   5855  C  CB    . CYS A 1  837  ? 165.336 187.425 163.309 1.00 26.84  ?  837  CYS A CB    1 
ATOM   5856  S  SG    . CYS A 1  837  ? 165.471 188.366 164.821 1.00 26.84  ?  837  CYS A SG    1 
ATOM   5857  N  N     . PRO A 1  838  ? 163.306 186.652 160.966 1.00 25.10  ?  838  PRO A N     1 
ATOM   5858  C  CA    . PRO A 1  838  ? 163.280 186.216 159.560 1.00 25.10  ?  838  PRO A CA    1 
ATOM   5859  C  C     . PRO A 1  838  ? 164.641 186.298 158.889 1.00 25.10  ?  838  PRO A C     1 
ATOM   5860  O  O     . PRO A 1  838  ? 164.930 185.507 157.981 1.00 25.10  ?  838  PRO A O     1 
ATOM   5861  C  CB    . PRO A 1  838  ? 162.271 187.176 158.921 1.00 25.10  ?  838  PRO A CB    1 
ATOM   5862  C  CG    . PRO A 1  838  ? 161.488 187.731 160.046 1.00 25.10  ?  838  PRO A CG    1 
ATOM   5863  C  CD    . PRO A 1  838  ? 162.420 187.804 161.194 1.00 25.10  ?  838  PRO A CD    1 
ATOM   5864  N  N     . LEU A 1  839  ? 165.473 187.251 159.328 1.00 22.59  ?  839  LEU A N     1 
ATOM   5865  C  CA    . LEU A 1  839  ? 166.829 187.424 158.812 1.00 22.59  ?  839  LEU A CA    1 
ATOM   5866  C  C     . LEU A 1  839  ? 167.662 186.160 158.994 1.00 22.59  ?  839  LEU A C     1 
ATOM   5867  O  O     . LEU A 1  839  ? 168.353 185.722 158.067 1.00 22.59  ?  839  LEU A O     1 
ATOM   5868  C  CB    . LEU A 1  839  ? 167.480 188.605 159.532 1.00 22.59  ?  839  LEU A CB    1 
ATOM   5869  C  CG    . LEU A 1  839  ? 168.744 189.345 159.092 1.00 22.59  ?  839  LEU A CG    1 
ATOM   5870  C  CD1   . LEU A 1  839  ? 168.706 190.699 159.732 1.00 22.59  ?  839  LEU A CD1   1 
ATOM   5871  C  CD2   . LEU A 1  839  ? 170.030 188.663 159.470 1.00 22.59  ?  839  LEU A CD2   1 
ATOM   5872  N  N     . VAL A 1  840  ? 167.559 185.530 160.161 1.00 25.58  ?  840  VAL A N     1 
ATOM   5873  C  CA    . VAL A 1  840  ? 168.385 184.366 160.462 1.00 25.58  ?  840  VAL A CA    1 
ATOM   5874  C  C     . VAL A 1  840  ? 167.911 183.140 159.690 1.00 25.58  ?  840  VAL A C     1 
ATOM   5875  O  O     . VAL A 1  840  ? 168.727 182.370 159.165 1.00 25.58  ?  840  VAL A O     1 
ATOM   5876  C  CB    . VAL A 1  840  ? 168.394 184.109 161.975 1.00 25.58  ?  840  VAL A CB    1 
ATOM   5877  C  CG1   . VAL A 1  840  ? 169.462 183.099 162.323 1.00 25.58  ?  840  VAL A CG1   1 
ATOM   5878  C  CG2   . VAL A 1  840  ? 168.609 185.408 162.709 1.00 25.58  ?  840  VAL A CG2   1 
ATOM   5879  N  N     . ALA A 1  841  ? 166.592 182.938 159.614 1.00 28.43  ?  841  ALA A N     1 
ATOM   5880  C  CA    . ALA A 1  841  ? 166.038 181.802 158.875 1.00 28.43  ?  841  ALA A CA    1 
ATOM   5881  C  C     . ALA A 1  841  ? 166.308 181.924 157.380 1.00 28.43  ?  841  ALA A C     1 
ATOM   5882  O  O     . ALA A 1  841  ? 166.615 180.923 156.714 1.00 28.43  ?  841  ALA A O     1 
ATOM   5883  C  CB    . ALA A 1  841  ? 164.538 181.697 159.141 1.00 28.43  ?  841  ALA A CB    1 
ATOM   5884  N  N     . ASN A 1  842  ? 166.232 183.151 156.848 1.00 27.67  ?  842  ASN A N     1 
ATOM   5885  C  CA    . ASN A 1  842  ? 166.568 183.389 155.448 1.00 27.67  ?  842  ASN A CA    1 
ATOM   5886  C  C     . ASN A 1  842  ? 168.041 183.123 155.173 1.00 27.67  ?  842  ASN A C     1 
ATOM   5887  O  O     . ASN A 1  842  ? 168.378 182.508 154.151 1.00 27.67  ?  842  ASN A O     1 
ATOM   5888  C  CB    . ASN A 1  842  ? 166.210 184.815 155.048 1.00 27.67  ?  842  ASN A CB    1 
ATOM   5889  C  CG    . ASN A 1  842  ? 164.734 185.001 154.823 1.00 27.67  ?  842  ASN A CG    1 
ATOM   5890  O  OD1   . ASN A 1  842  ? 164.253 186.125 154.684 1.00 27.67  ?  842  ASN A OD1   1 
ATOM   5891  N  ND2   . ASN A 1  842  ? 163.996 183.902 154.791 1.00 27.67  ?  842  ASN A ND2   1 
ATOM   5892  N  N     . LEU A 1  843  ? 168.929 183.581 156.065 1.00 26.92  ?  843  LEU A N     1 
ATOM   5893  C  CA    . LEU A 1  843  ? 170.353 183.325 155.895 1.00 26.92  ?  843  LEU A CA    1 
ATOM   5894  C  C     . LEU A 1  843  ? 170.685 181.841 155.974 1.00 26.92  ?  843  LEU A C     1 
ATOM   5895  O  O     . LEU A 1  843  ? 171.540 181.367 155.223 1.00 26.92  ?  843  LEU A O     1 
ATOM   5896  C  CB    . LEU A 1  843  ? 171.146 184.104 156.936 1.00 26.92  ?  843  LEU A CB    1 
ATOM   5897  C  CG    . LEU A 1  843  ? 172.672 184.110 156.877 1.00 26.92  ?  843  LEU A CG    1 
ATOM   5898  C  CD1   . LEU A 1  843  ? 173.192 184.237 155.459 1.00 26.92  ?  843  LEU A CD1   1 
ATOM   5899  C  CD2   . LEU A 1  843  ? 173.178 185.259 157.707 1.00 26.92  ?  843  LEU A CD2   1 
ATOM   5900  N  N     . VAL A 1  844  ? 169.991 181.085 156.823 1.00 24.29  ?  844  VAL A N     1 
ATOM   5901  C  CA    . VAL A 1  844  ? 170.261 179.652 156.905 1.00 24.29  ?  844  VAL A CA    1 
ATOM   5902  C  C     . VAL A 1  844  ? 169.783 178.931 155.643 1.00 24.29  ?  844  VAL A C     1 
ATOM   5903  O  O     . VAL A 1  844  ? 170.489 178.061 155.105 1.00 24.29  ?  844  VAL A O     1 
ATOM   5904  C  CB    . VAL A 1  844  ? 169.634 179.078 158.189 1.00 24.29  ?  844  VAL A CB    1 
ATOM   5905  C  CG1   . VAL A 1  844  ? 169.583 177.572 158.159 1.00 24.29  ?  844  VAL A CG1   1 
ATOM   5906  C  CG2   . VAL A 1  844  ? 170.430 179.528 159.388 1.00 24.29  ?  844  VAL A CG2   1 
ATOM   5907  N  N     . THR A 1  845  ? 168.613 179.322 155.114 1.00 30.33  ?  845  THR A N     1 
ATOM   5908  C  CA    . THR A 1  845  ? 168.120 178.726 153.869 1.00 30.33  ?  845  THR A CA    1 
ATOM   5909  C  C     . THR A 1  845  ? 169.024 179.052 152.683 1.00 30.33  ?  845  THR A C     1 
ATOM   5910  O  O     . THR A 1  845  ? 169.339 178.170 151.875 1.00 30.33  ?  845  THR A O     1 
ATOM   5911  C  CB    . THR A 1  845  ? 166.698 179.198 153.570 1.00 30.33  ?  845  THR A CB    1 
ATOM   5912  O  OG1   . THR A 1  845  ? 166.624 180.621 153.712 1.00 30.33  ?  845  THR A OG1   1 
ATOM   5913  C  CG2   . THR A 1  845  ? 165.701 178.531 154.492 1.00 30.33  ?  845  THR A CG2   1 
ATOM   5914  N  N     . ALA A 1  846  ? 169.472 180.308 152.576 1.00 31.35  ?  846  ALA A N     1 
ATOM   5915  C  CA    . ALA A 1  846  ? 170.334 180.701 151.462 1.00 31.35  ?  846  ALA A CA    1 
ATOM   5916  C  C     . ALA A 1  846  ? 171.717 180.078 151.566 1.00 31.35  ?  846  ALA A C     1 
ATOM   5917  O  O     . ALA A 1  846  ? 172.316 179.742 150.539 1.00 31.35  ?  846  ALA A O     1 
ATOM   5918  C  CB    . ALA A 1  846  ? 170.445 182.222 151.390 1.00 31.35  ?  846  ALA A CB    1 
ATOM   5919  N  N     . SER A 1  847  ? 172.232 179.892 152.784 1.00 34.17  ?  847  SER A N     1 
ATOM   5920  C  CA    . SER A 1  847  ? 173.524 179.241 152.947 1.00 34.17  ?  847  SER A CA    1 
ATOM   5921  C  C     . SER A 1  847  ? 173.450 177.767 152.586 1.00 34.17  ?  847  SER A C     1 
ATOM   5922  O  O     . SER A 1  847  ? 174.340 177.255 151.901 1.00 34.17  ?  847  SER A O     1 
ATOM   5923  C  CB    . SER A 1  847  ? 174.020 179.416 154.376 1.00 34.17  ?  847  SER A CB    1 
ATOM   5924  O  OG    . SER A 1  847  ? 174.547 180.716 154.563 1.00 34.17  ?  847  SER A OG    1 
ATOM   5925  N  N     . LEU A 1  848  ? 172.392 177.066 153.013 1.00 36.06  ?  848  LEU A N     1 
ATOM   5926  C  CA    . LEU A 1  848  ? 172.242 175.673 152.594 1.00 36.06  ?  848  LEU A CA    1 
ATOM   5927  C  C     . LEU A 1  848  ? 171.946 175.543 151.106 1.00 36.06  ?  848  LEU A C     1 
ATOM   5928  O  O     . LEU A 1  848  ? 172.289 174.518 150.503 1.00 36.06  ?  848  LEU A O     1 
ATOM   5929  C  CB    . LEU A 1  848  ? 171.168 174.962 153.415 1.00 36.06  ?  848  LEU A CB    1 
ATOM   5930  C  CG    . LEU A 1  848  ? 171.566 174.252 154.719 1.00 36.06  ?  848  LEU A CG    1 
ATOM   5931  C  CD1   . LEU A 1  848  ? 171.983 175.192 155.806 1.00 36.06  ?  848  LEU A CD1   1 
ATOM   5932  C  CD2   . LEU A 1  848  ? 170.420 173.383 155.205 1.00 36.06  ?  848  LEU A CD2   1 
ATOM   5933  N  N     . ARG A 1  849  ? 171.343 176.564 150.492 1.00 41.34  ?  849  ARG A N     1 
ATOM   5934  C  CA    . ARG A 1  849  ? 171.157 176.536 149.045 1.00 41.34  ?  849  ARG A CA    1 
ATOM   5935  C  C     . ARG A 1  849  ? 172.489 176.649 148.319 1.00 41.34  ?  849  ARG A C     1 
ATOM   5936  O  O     . ARG A 1  849  ? 172.819 175.806 147.479 1.00 41.34  ?  849  ARG A O     1 
ATOM   5937  C  CB    . ARG A 1  849  ? 170.216 177.655 148.607 1.00 41.34  ?  849  ARG A CB    1 
ATOM   5938  C  CG    . ARG A 1  849  ? 168.755 177.263 148.586 1.00 41.34  ?  849  ARG A CG    1 
ATOM   5939  C  CD    . ARG A 1  849  ? 167.889 178.471 148.281 1.00 41.34  ?  849  ARG A CD    1 
ATOM   5940  N  NE    . ARG A 1  849  ? 166.468 178.169 148.375 1.00 41.34  ?  849  ARG A NE    1 
ATOM   5941  C  CZ    . ARG A 1  849  ? 165.524 179.085 148.566 1.00 41.34  ?  849  ARG A CZ    1 
ATOM   5942  N  NH1   . ARG A 1  849  ? 165.852 180.366 148.687 1.00 41.34  1  849  ARG A NH1   1 
ATOM   5943  N  NH2   . ARG A 1  849  ? 164.250 178.722 148.639 1.00 41.34  ?  849  ARG A NH2   1 
ATOM   5944  N  N     . ARG A 1  850  ? 173.281 177.677 148.650 1.00 42.29  ?  850  ARG A N     1 
ATOM   5945  C  CA    . ARG A 1  850  ? 174.579 177.864 148.006 1.00 42.29  ?  850  ARG A CA    1 
ATOM   5946  C  C     . ARG A 1  850  ? 175.562 176.761 148.354 1.00 42.29  ?  850  ARG A C     1 
ATOM   5947  O  O     . ARG A 1  850  ? 176.523 176.550 147.614 1.00 42.29  ?  850  ARG A O     1 
ATOM   5948  C  CB    . ARG A 1  850  ? 175.184 179.212 148.398 1.00 42.29  ?  850  ARG A CB    1 
ATOM   5949  C  CG    . ARG A 1  850  ? 174.366 180.421 147.991 1.00 42.29  ?  850  ARG A CG    1 
ATOM   5950  C  CD    . ARG A 1  850  ? 174.744 180.897 146.613 1.00 42.29  ?  850  ARG A CD    1 
ATOM   5951  N  NE    . ARG A 1  850  ? 173.706 181.741 146.032 1.00 42.29  ?  850  ARG A NE    1 
ATOM   5952  C  CZ    . ARG A 1  850  ? 173.690 182.131 144.761 1.00 42.29  ?  850  ARG A CZ    1 
ATOM   5953  N  NH1   . ARG A 1  850  ? 174.664 181.762 143.941 1.00 42.29  1  850  ARG A NH1   1 
ATOM   5954  N  NH2   . ARG A 1  850  ? 172.704 182.888 144.307 1.00 42.29  ?  850  ARG A NH2   1 
ATOM   5955  N  N     . LEU A 1  851  ? 175.337 176.047 149.450 1.00 37.98  ?  851  LEU A N     1 
ATOM   5956  C  CA    . LEU A 1  851  ? 176.288 175.071 149.942 1.00 37.98  ?  851  LEU A CA    1 
ATOM   5957  C  C     . LEU A 1  851  ? 175.949 173.647 149.534 1.00 37.98  ?  851  LEU A C     1 
ATOM   5958  O  O     . LEU A 1  851  ? 176.846 172.798 149.492 1.00 37.98  ?  851  LEU A O     1 
ATOM   5959  C  CB    . LEU A 1  851  ? 176.347 175.173 151.465 1.00 37.98  ?  851  LEU A CB    1 
ATOM   5960  C  CG    . LEU A 1  851  ? 177.461 174.570 152.299 1.00 37.98  ?  851  LEU A CG    1 
ATOM   5961  C  CD1   . LEU A 1  851  ? 178.719 175.373 152.118 1.00 37.98  ?  851  LEU A CD1   1 
ATOM   5962  C  CD2   . LEU A 1  851  ? 177.023 174.578 153.743 1.00 37.98  ?  851  LEU A CD2   1 
ATOM   5963  N  N     . LEU A 1  852  ? 174.681 173.355 149.242 1.00 38.49  ?  852  LEU A N     1 
ATOM   5964  C  CA    . LEU A 1  852  ? 174.263 171.999 148.905 1.00 38.49  ?  852  LEU A CA    1 
ATOM   5965  C  C     . LEU A 1  852  ? 173.893 171.817 147.444 1.00 38.49  ?  852  LEU A C     1 
ATOM   5966  O  O     . LEU A 1  852  ? 173.994 170.699 146.930 1.00 38.49  ?  852  LEU A O     1 
ATOM   5967  C  CB    . LEU A 1  852  ? 173.065 171.590 149.761 1.00 38.49  ?  852  LEU A CB    1 
ATOM   5968  C  CG    . LEU A 1  852  ? 173.273 171.396 151.257 1.00 38.49  ?  852  LEU A CG    1 
ATOM   5969  C  CD1   . LEU A 1  852  ? 171.934 171.452 151.941 1.00 38.49  ?  852  LEU A CD1   1 
ATOM   5970  C  CD2   . LEU A 1  852  ? 173.955 170.072 151.532 1.00 38.49  ?  852  LEU A CD2   1 
ATOM   5971  N  N     . ILE A 1  853  ? 173.451 172.875 146.773 1.00 41.59  ?  853  ILE A N     1 
ATOM   5972  C  CA    . ILE A 1  853  ? 173.032 172.806 145.375 1.00 41.59  ?  853  ILE A CA    1 
ATOM   5973  C  C     . ILE A 1  853  ? 174.166 173.182 144.425 1.00 41.59  ?  853  ILE A C     1 
ATOM   5974  O  O     . ILE A 1  853  ? 174.441 172.464 143.464 1.00 41.59  ?  853  ILE A O     1 
ATOM   5975  C  CB    . ILE A 1  853  ? 171.775 173.681 145.152 1.00 41.59  ?  853  ILE A CB    1 
ATOM   5976  C  CG1   . ILE A 1  853  ? 170.567 173.055 145.852 1.00 41.59  ?  853  ILE A CG1   1 
ATOM   5977  C  CG2   . ILE A 1  853  ? 171.490 173.909 143.688 1.00 41.59  ?  853  ILE A CG2   1 
ATOM   5978  C  CD1   . ILE A 1  853  ? 169.347 173.916 145.858 1.00 41.59  ?  853  ILE A CD1   1 
ATOM   5979  N  N     . ASP A 1  854  ? 174.854 174.289 144.688 1.00 46.82  ?  854  ASP A N     1 
ATOM   5980  C  CA    . ASP A 1  854  ? 175.943 174.728 143.827 1.00 46.82  ?  854  ASP A CA    1 
ATOM   5981  C  C     . ASP A 1  854  ? 177.316 174.297 144.322 1.00 46.82  ?  854  ASP A C     1 
ATOM   5982  O  O     . ASP A 1  854  ? 178.275 174.364 143.548 1.00 46.82  ?  854  ASP A O     1 
ATOM   5983  C  CB    . ASP A 1  854  ? 175.934 176.251 143.685 1.00 46.82  ?  854  ASP A CB    1 
ATOM   5984  C  CG    . ASP A 1  854  ? 174.603 176.783 143.217 1.00 46.82  ?  854  ASP A CG    1 
ATOM   5985  O  OD1   . ASP A 1  854  ? 173.819 175.992 142.664 1.00 46.82  ?  854  ASP A OD1   1 
ATOM   5986  O  OD2   . ASP A 1  854  ? 174.344 177.992 143.401 1.00 46.82  -1 854  ASP A OD2   1 
ATOM   5987  N  N     . ARG A 1  855  ? 177.419 173.894 145.590 1.00 43.43  ?  855  ARG A N     1 
ATOM   5988  C  CA    . ARG A 1  855  ? 178.640 173.409 146.243 1.00 43.43  ?  855  ARG A CA    1 
ATOM   5989  C  C     . ARG A 1  855  ? 179.771 174.442 146.179 1.00 43.43  ?  855  ARG A C     1 
ATOM   5990  O  O     . ARG A 1  855  ? 180.928 174.121 145.904 1.00 43.43  ?  855  ARG A O     1 
ATOM   5991  C  CB    . ARG A 1  855  ? 179.078 172.067 145.645 1.00 43.43  ?  855  ARG A CB    1 
ATOM   5992  C  CG    . ARG A 1  855  ? 178.065 170.945 145.827 1.00 43.43  ?  855  ARG A CG    1 
ATOM   5993  C  CD    . ARG A 1  855  ? 178.531 169.635 145.216 1.00 43.43  ?  855  ARG A CD    1 
ATOM   5994  N  NE    . ARG A 1  855  ? 177.507 168.597 145.310 1.00 43.43  ?  855  ARG A NE    1 
ATOM   5995  C  CZ    . ARG A 1  855  ? 177.636 167.364 144.828 1.00 43.43  ?  855  ARG A CZ    1 
ATOM   5996  N  NH1   . ARG A 1  855  ? 176.646 166.497 144.945 1.00 43.43  1  855  ARG A NH1   1 
ATOM   5997  N  NH2   . ARG A 1  855  ? 178.755 166.990 144.229 1.00 43.43  ?  855  ARG A NH2   1 
ATOM   5998  N  N     . ASP A 1  856  ? 179.402 175.700 146.366 1.00 52.69  ?  856  ASP A N     1 
ATOM   5999  C  CA    . ASP A 1  856  ? 180.396 176.747 146.362 1.00 52.69  ?  856  ASP A CA    1 
ATOM   6000  C  C     . ASP A 1  856  ? 180.418 177.428 147.718 1.00 52.69  ?  856  ASP A C     1 
ATOM   6001  O  O     . ASP A 1  856  ? 179.544 178.237 148.028 1.00 52.69  ?  856  ASP A O     1 
ATOM   6002  C  CB    . ASP A 1  856  ? 180.096 177.769 145.265 1.00 52.69  ?  856  ASP A CB    1 
ATOM   6003  C  CG    . ASP A 1  856  ? 181.162 178.841 145.158 1.00 52.69  ?  856  ASP A CG    1 
ATOM   6004  O  OD1   . ASP A 1  856  ? 181.915 179.032 146.137 1.00 52.69  ?  856  ASP A OD1   1 
ATOM   6005  O  OD2   . ASP A 1  856  ? 181.247 179.494 144.097 1.00 52.69  -1 856  ASP A OD2   1 
ATOM   6006  N  N     . PRO A 1  857  ? 181.425 177.099 148.533 1.00 54.71  ?  857  PRO A N     1 
ATOM   6007  C  CA    . PRO A 1  857  ? 181.590 177.759 149.838 1.00 54.71  ?  857  PRO A CA    1 
ATOM   6008  C  C     . PRO A 1  857  ? 182.050 179.207 149.756 1.00 54.71  ?  857  PRO A C     1 
ATOM   6009  O  O     . PRO A 1  857  ? 181.862 179.947 150.727 1.00 54.71  ?  857  PRO A O     1 
ATOM   6010  C  CB    . PRO A 1  857  ? 182.638 176.886 150.539 1.00 54.71  ?  857  PRO A CB    1 
ATOM   6011  C  CG    . PRO A 1  857  ? 182.605 175.590 149.810 1.00 54.71  ?  857  PRO A CG    1 
ATOM   6012  C  CD    . PRO A 1  857  ? 182.318 175.937 148.397 1.00 54.71  ?  857  PRO A CD    1 
ATOM   6013  N  N     . GLU A 1  858  ? 182.616 179.646 148.631 1.00 56.39  ?  858  GLU A N     1 
ATOM   6014  C  CA    . GLU A 1  858  ? 183.141 181.005 148.547 1.00 56.39  ?  858  GLU A CA    1 
ATOM   6015  C  C     . GLU A 1  858  ? 182.026 182.016 148.335 1.00 56.39  ?  858  GLU A C     1 
ATOM   6016  O  O     . GLU A 1  858  ? 182.041 183.096 148.935 1.00 56.39  ?  858  GLU A O     1 
ATOM   6017  C  CB    . GLU A 1  858  ? 184.168 181.109 147.420 1.00 56.39  ?  858  GLU A CB    1 
ATOM   6018  C  CG    . GLU A 1  858  ? 185.504 180.456 147.721 1.00 56.39  ?  858  GLU A CG    1 
ATOM   6019  C  CD    . GLU A 1  858  ? 185.465 178.950 147.572 1.00 56.39  ?  858  GLU A CD    1 
ATOM   6020  O  OE1   . GLU A 1  858  ? 184.876 178.470 146.583 1.00 56.39  ?  858  GLU A OE1   1 
ATOM   6021  O  OE2   . GLU A 1  858  ? 186.013 178.250 148.451 1.00 56.39  -1 858  GLU A OE2   1 
ATOM   6022  N  N     . GLY A 1  859  ? 181.039 181.668 147.513 1.00 49.24  ?  859  GLY A N     1 
ATOM   6023  C  CA    . GLY A 1  859  ? 179.832 182.469 147.439 1.00 49.24  ?  859  GLY A CA    1 
ATOM   6024  C  C     . GLY A 1  859  ? 179.041 182.463 148.731 1.00 49.24  ?  859  GLY A C     1 
ATOM   6025  O  O     . GLY A 1  859  ? 178.396 183.456 149.068 1.00 49.24  ?  859  GLY A O     1 
ATOM   6026  N  N     . ALA A 1  860  ? 179.124 181.371 149.494 1.00 44.81  ?  860  ALA A N     1 
ATOM   6027  C  CA    . ALA A 1  860  ? 178.456 181.312 150.791 1.00 44.81  ?  860  ALA A CA    1 
ATOM   6028  C  C     . ALA A 1  860  ? 179.113 182.251 151.795 1.00 44.81  ?  860  ALA A C     1 
ATOM   6029  O  O     . ALA A 1  860  ? 178.419 182.977 152.523 1.00 44.81  ?  860  ALA A O     1 
ATOM   6030  C  CB    . ALA A 1  860  ? 178.453 179.876 151.311 1.00 44.81  ?  860  ALA A CB    1 
ATOM   6031  N  N     . VAL A 1  861  ? 180.452 182.253 151.846 1.00 43.08  ?  861  VAL A N     1 
ATOM   6032  C  CA    . VAL A 1  861  ? 181.182 183.191 152.700 1.00 43.08  ?  861  VAL A CA    1 
ATOM   6033  C  C     . VAL A 1  861  ? 180.911 184.631 152.283 1.00 43.08  ?  861  VAL A C     1 
ATOM   6034  O  O     . VAL A 1  861  ? 180.678 185.498 153.134 1.00 43.08  ?  861  VAL A O     1 
ATOM   6035  C  CB    . VAL A 1  861  ? 182.685 182.875 152.679 1.00 43.08  ?  861  VAL A CB    1 
ATOM   6036  C  CG1   . VAL A 1  861  ? 183.486 183.957 153.385 1.00 43.08  ?  861  VAL A CG1   1 
ATOM   6037  C  CG2   . VAL A 1  861  ? 182.937 181.594 153.350 1.00 43.08  ?  861  VAL A CG2   1 
ATOM   6038  N  N     . ALA A 1  862  ? 180.904 184.902 150.975 1.00 41.91  ?  862  ALA A N     1 
ATOM   6039  C  CA    . ALA A 1  862  ? 180.641 186.257 150.505 1.00 41.91  ?  862  ALA A CA    1 
ATOM   6040  C  C     . ALA A 1  862  ? 179.211 186.688 150.806 1.00 41.91  ?  862  ALA A C     1 
ATOM   6041  O  O     . ALA A 1  862  ? 178.960 187.863 151.117 1.00 41.91  ?  862  ALA A O     1 
ATOM   6042  C  CB    . ALA A 1  862  ? 180.928 186.354 149.012 1.00 41.91  ?  862  ALA A CB    1 
ATOM   6043  N  N     . HIS A 1  863  ? 178.275 185.736 150.783 1.00 38.78  ?  863  HIS A N     1 
ATOM   6044  C  CA    . HIS A 1  863  ? 176.889 186.018 151.126 1.00 38.78  ?  863  HIS A CA    1 
ATOM   6045  C  C     . HIS A 1  863  ? 176.746 186.383 152.595 1.00 38.78  ?  863  HIS A C     1 
ATOM   6046  O  O     . HIS A 1  863  ? 176.114 187.394 152.938 1.00 38.78  ?  863  HIS A O     1 
ATOM   6047  C  CB    . HIS A 1  863  ? 176.029 184.803 150.790 1.00 38.78  ?  863  HIS A CB    1 
ATOM   6048  C  CG    . HIS A 1  863  ? 174.569 185.109 150.679 1.00 38.78  ?  863  HIS A CG    1 
ATOM   6049  N  ND1   . HIS A 1  863  ? 173.699 184.968 151.737 1.00 38.78  ?  863  HIS A ND1   1 
ATOM   6050  C  CD2   . HIS A 1  863  ? 173.829 185.552 149.637 1.00 38.78  ?  863  HIS A CD2   1 
ATOM   6051  C  CE1   . HIS A 1  863  ? 172.484 185.310 151.350 1.00 38.78  ?  863  HIS A CE1   1 
ATOM   6052  N  NE2   . HIS A 1  863  ? 172.535 185.670 150.081 1.00 38.78  ?  863  HIS A NE2   1 
ATOM   6053  N  N     . ALA A 1  864  ? 177.322 185.562 153.480 1.00 36.12  ?  864  ALA A N     1 
ATOM   6054  C  CA    . ALA A 1  864  ? 177.222 185.823 154.913 1.00 36.12  ?  864  ALA A CA    1 
ATOM   6055  C  C     . ALA A 1  864  ? 177.937 187.115 155.289 1.00 36.12  ?  864  ALA A C     1 
ATOM   6056  O  O     . ALA A 1  864  ? 177.463 187.873 156.148 1.00 36.12  ?  864  ALA A O     1 
ATOM   6057  C  CB    . ALA A 1  864  ? 177.784 184.639 155.693 1.00 36.12  ?  864  ALA A CB    1 
ATOM   6058  N  N     . GLN A 1  865  ? 179.046 187.411 154.603 1.00 39.45  ?  865  GLN A N     1 
ATOM   6059  C  CA    . GLN A 1  865  ? 179.728 188.688 154.755 1.00 39.45  ?  865  GLN A CA    1 
ATOM   6060  C  C     . GLN A 1  865  ? 178.860 189.865 154.356 1.00 39.45  ?  865  GLN A C     1 
ATOM   6061  O  O     . GLN A 1  865  ? 178.864 190.881 155.051 1.00 39.45  ?  865  GLN A O     1 
ATOM   6062  C  CB    . GLN A 1  865  ? 180.980 188.714 153.904 1.00 39.45  ?  865  GLN A CB    1 
ATOM   6063  C  CG    . GLN A 1  865  ? 182.158 188.077 154.512 1.00 39.45  ?  865  GLN A CG    1 
ATOM   6064  C  CD    . GLN A 1  865  ? 183.411 188.388 153.734 1.00 39.45  ?  865  GLN A CD    1 
ATOM   6065  O  OE1   . GLN A 1  865  ? 183.639 189.535 153.342 1.00 39.45  ?  865  GLN A OE1   1 
ATOM   6066  N  NE2   . GLN A 1  865  ? 184.229 187.367 153.490 1.00 39.45  ?  865  GLN A NE2   1 
ATOM   6067  N  N     . ASP A 1  866  ? 178.137 189.760 153.234 1.00 40.30  ?  866  ASP A N     1 
ATOM   6068  C  CA    . ASP A 1  866  ? 177.282 190.868 152.822 1.00 40.30  ?  866  ASP A CA    1 
ATOM   6069  C  C     . ASP A 1  866  ? 176.122 191.067 153.784 1.00 40.30  ?  866  ASP A C     1 
ATOM   6070  O  O     . ASP A 1  866  ? 175.724 192.208 154.040 1.00 40.30  ?  866  ASP A O     1 
ATOM   6071  C  CB    . ASP A 1  866  ? 176.757 190.655 151.403 1.00 40.30  ?  866  ASP A CB    1 
ATOM   6072  C  CG    . ASP A 1  866  ? 175.887 191.826 150.911 1.00 40.30  ?  866  ASP A CG    1 
ATOM   6073  O  OD1   . ASP A 1  866  ? 174.658 191.823 151.153 1.00 40.30  ?  866  ASP A OD1   1 
ATOM   6074  O  OD2   . ASP A 1  866  ? 176.432 192.753 150.281 1.00 40.30  -1 866  ASP A OD2   1 
ATOM   6075  N  N     . VAL A 1  867  ? 175.584 189.972 154.340 1.00 34.57  ?  867  VAL A N     1 
ATOM   6076  C  CA    . VAL A 1  867  ? 174.491 190.091 155.305 1.00 34.57  ?  867  VAL A CA    1 
ATOM   6077  C  C     . VAL A 1  867  ? 174.970 190.791 156.574 1.00 34.57  ?  867  VAL A C     1 
ATOM   6078  O  O     . VAL A 1  867  ? 174.312 191.712 157.076 1.00 34.57  ?  867  VAL A O     1 
ATOM   6079  C  CB    . VAL A 1  867  ? 173.879 188.710 155.615 1.00 34.57  ?  867  VAL A CB    1 
ATOM   6080  C  CG1   . VAL A 1  867  ? 172.783 188.841 156.651 1.00 34.57  ?  867  VAL A CG1   1 
ATOM   6081  C  CG2   . VAL A 1  867  ? 173.297 188.072 154.370 1.00 34.57  ?  867  VAL A CG2   1 
ATOM   6082  N  N     . ILE A 1  868  ? 176.148 190.413 157.072 1.00 31.83  ?  868  ILE A N     1 
ATOM   6083  C  CA    . ILE A 1  868  ? 176.685 191.028 158.285 1.00 31.83  ?  868  ILE A CA    1 
ATOM   6084  C  C     . ILE A 1  868  ? 177.082 192.481 158.034 1.00 31.83  ?  868  ILE A C     1 
ATOM   6085  O  O     . ILE A 1  868  ? 176.858 193.361 158.882 1.00 31.83  ?  868  ILE A O     1 
ATOM   6086  C  CB    . ILE A 1  868  ? 177.856 190.181 158.805 1.00 31.83  ?  868  ILE A CB    1 
ATOM   6087  C  CG1   . ILE A 1  868  ? 177.346 188.819 159.246 1.00 31.83  ?  868  ILE A CG1   1 
ATOM   6088  C  CG2   . ILE A 1  868  ? 178.539 190.830 159.971 1.00 31.83  ?  868  ILE A CG2   1 
ATOM   6089  C  CD1   . ILE A 1  868  ? 178.431 187.827 159.528 1.00 31.83  ?  868  ILE A CD1   1 
ATOM   6090  N  N     . SER A 1  869  ? 177.624 192.767 156.848 1.00 35.61  ?  869  SER A N     1 
ATOM   6091  C  CA    . SER A 1  869  ? 178.040 194.121 156.512 1.00 35.61  ?  869  SER A CA    1 
ATOM   6092  C  C     . SER A 1  869  ? 176.842 195.039 156.380 1.00 35.61  ?  869  SER A C     1 
ATOM   6093  O  O     . SER A 1  869  ? 176.873 196.177 156.856 1.00 35.61  ?  869  SER A O     1 
ATOM   6094  C  CB    . SER A 1  869  ? 178.827 194.114 155.203 1.00 35.61  ?  869  SER A CB    1 
ATOM   6095  O  OG    . SER A 1  869  ? 179.982 193.315 155.297 1.00 35.61  ?  869  SER A OG    1 
ATOM   6096  N  N     . ASP A 1  870  ? 175.767 194.551 155.758 1.00 38.34  ?  870  ASP A N     1 
ATOM   6097  C  CA    . ASP A 1  870  ? 174.581 195.374 155.586 1.00 38.34  ?  870  ASP A CA    1 
ATOM   6098  C  C     . ASP A 1  870  ? 173.825 195.503 156.892 1.00 38.34  ?  870  ASP A C     1 
ATOM   6099  O  O     . ASP A 1  870  ? 173.053 196.446 157.082 1.00 38.34  ?  870  ASP A O     1 
ATOM   6100  C  CB    . ASP A 1  870  ? 173.688 194.787 154.494 1.00 38.34  ?  870  ASP A CB    1 
ATOM   6101  C  CG    . ASP A 1  870  ? 172.827 195.841 153.818 1.00 38.34  ?  870  ASP A CG    1 
ATOM   6102  O  OD1   . ASP A 1  870  ? 173.335 196.953 153.583 1.00 38.34  ?  870  ASP A OD1   1 
ATOM   6103  O  OD2   . ASP A 1  870  ? 171.655 195.556 153.508 1.00 38.34  -1 870  ASP A OD2   1 
ATOM   6104  N  N     . LEU A 1  871  ? 174.041 194.557 157.810 1.00 30.37  ?  871  LEU A N     1 
ATOM   6105  C  CA    . LEU A 1  871  ? 173.539 194.707 159.169 1.00 30.37  ?  871  LEU A CA    1 
ATOM   6106  C  C     . LEU A 1  871  ? 174.233 195.858 159.887 1.00 30.37  ?  871  LEU A C     1 
ATOM   6107  O  O     . LEU A 1  871  ? 173.572 196.737 160.448 1.00 30.37  ?  871  LEU A O     1 
ATOM   6108  C  CB    . LEU A 1  871  ? 173.728 193.390 159.924 1.00 30.37  ?  871  LEU A CB    1 
ATOM   6109  C  CG    . LEU A 1  871  ? 173.059 193.107 161.267 1.00 30.37  ?  871  LEU A CG    1 
ATOM   6110  C  CD1   . LEU A 1  871  ? 172.833 191.651 161.354 1.00 30.37  ?  871  LEU A CD1   1 
ATOM   6111  C  CD2   . LEU A 1  871  ? 173.916 193.515 162.434 1.00 30.37  ?  871  LEU A CD2   1 
ATOM   6112  N  N     . LEU A 1  872  ? 175.567 195.872 159.871 1.00 32.62  ?  872  LEU A N     1 
ATOM   6113  C  CA    . LEU A 1  872  ? 176.320 196.871 160.624 1.00 32.62  ?  872  LEU A CA    1 
ATOM   6114  C  C     . LEU A 1  872  ? 176.239 198.262 160.005 1.00 32.62  ?  872  LEU A C     1 
ATOM   6115  O  O     . LEU A 1  872  ? 176.390 199.258 160.715 1.00 32.62  ?  872  LEU A O     1 
ATOM   6116  C  CB    . LEU A 1  872  ? 177.775 196.433 160.746 1.00 32.62  ?  872  LEU A CB    1 
ATOM   6117  C  CG    . LEU A 1  872  ? 177.991 195.115 161.489 1.00 32.62  ?  872  LEU A CG    1 
ATOM   6118  C  CD1   . LEU A 1  872  ? 179.465 194.779 161.614 1.00 32.62  ?  872  LEU A CD1   1 
ATOM   6119  C  CD2   . LEU A 1  872  ? 177.338 195.153 162.854 1.00 32.62  ?  872  LEU A CD2   1 
ATOM   6120  N  N     . CYS A 1  873  ? 175.996 198.350 158.701 1.00 36.52  ?  873  CYS A N     1 
ATOM   6121  C  CA    . CYS A 1  873  ? 175.892 199.623 158.002 1.00 36.52  ?  873  CYS A CA    1 
ATOM   6122  C  C     . CYS A 1  873  ? 174.484 200.199 158.031 1.00 36.52  ?  873  CYS A C     1 
ATOM   6123  O  O     . CYS A 1  873  ? 174.244 201.225 157.386 1.00 36.52  ?  873  CYS A O     1 
ATOM   6124  C  CB    . CYS A 1  873  ? 176.355 199.462 156.554 1.00 36.52  ?  873  CYS A CB    1 
ATOM   6125  S  SG    . CYS A 1  873  ? 178.123 199.132 156.356 1.00 36.52  ?  873  CYS A SG    1 
ATOM   6126  N  N     . ASN A 1  874  ? 173.561 199.541 158.738 1.00 45.68  ?  874  ASN A N     1 
ATOM   6127  C  CA    . ASN A 1  874  ? 172.206 200.020 159.037 1.00 45.68  ?  874  ASN A CA    1 
ATOM   6128  C  C     . ASN A 1  874  ? 171.369 200.199 157.772 1.00 45.68  ?  874  ASN A C     1 
ATOM   6129  O  O     . ASN A 1  874  ? 170.771 201.246 157.530 1.00 45.68  ?  874  ASN A O     1 
ATOM   6130  C  CB    . ASN A 1  874  ? 172.235 201.312 159.864 1.00 45.68  ?  874  ASN A CB    1 
ATOM   6131  C  CG    . ASN A 1  874  ? 172.578 201.062 161.313 1.00 45.68  ?  874  ASN A CG    1 
ATOM   6132  O  OD1   . ASN A 1  874  ? 173.239 200.080 161.641 1.00 45.68  ?  874  ASN A OD1   1 
ATOM   6133  N  ND2   . ASN A 1  874  ? 172.136 201.954 162.189 1.00 45.68  ?  874  ASN A ND2   1 
ATOM   6134  N  N     . ARG A 1  875  ? 171.340 199.146 156.955 1.00 42.94  ?  875  ARG A N     1 
ATOM   6135  C  CA    . ARG A 1  875  ? 170.483 199.108 155.775 1.00 42.94  ?  875  ARG A CA    1 
ATOM   6136  C  C     . ARG A 1  875  ? 169.678 197.814 155.714 1.00 42.94  ?  875  ARG A C     1 
ATOM   6137  O  O     . ARG A 1  875  ? 169.516 197.231 154.642 1.00 42.94  ?  875  ARG A O     1 
ATOM   6138  C  CB    . ARG A 1  875  ? 171.293 199.293 154.494 1.00 42.94  ?  875  ARG A CB    1 
ATOM   6139  C  CG    . ARG A 1  875  ? 172.126 200.562 154.446 1.00 42.94  ?  875  ARG A CG    1 
ATOM   6140  C  CD    . ARG A 1  875  ? 172.932 200.684 153.173 1.00 42.94  ?  875  ARG A CD    1 
ATOM   6141  N  NE    . ARG A 1  875  ? 173.514 199.419 152.740 1.00 42.94  ?  875  ARG A NE    1 
ATOM   6142  C  CZ    . ARG A 1  875  ? 174.606 199.330 151.994 1.00 42.94  ?  875  ARG A CZ    1 
ATOM   6143  N  NH1   . ARG A 1  875  ? 175.068 198.143 151.623 1.00 42.94  1  875  ARG A NH1   1 
ATOM   6144  N  NH2   . ARG A 1  875  ? 175.243 200.430 151.628 1.00 42.94  ?  875  ARG A NH2   1 
ATOM   6145  N  N     . ILE A 1  876  ? 169.166 197.351 156.852 1.00 42.11  ?  876  ILE A N     1 
ATOM   6146  C  CA    . ILE A 1  876  ? 168.329 196.158 156.927 1.00 42.11  ?  876  ILE A CA    1 
ATOM   6147  C  C     . ILE A 1  876  ? 166.958 196.556 157.463 1.00 42.11  ?  876  ILE A C     1 
ATOM   6148  O  O     . ILE A 1  876  ? 166.857 197.253 158.478 1.00 42.11  ?  876  ILE A O     1 
ATOM   6149  C  CB    . ILE A 1  876  ? 168.974 195.067 157.805 1.00 42.11  ?  876  ILE A CB    1 
ATOM   6150  C  CG1   . ILE A 1  876  ? 170.301 194.622 157.203 1.00 42.11  ?  876  ILE A CG1   1 
ATOM   6151  C  CG2   . ILE A 1  876  ? 168.065 193.865 157.944 1.00 42.11  ?  876  ILE A CG2   1 
ATOM   6152  C  CD1   . ILE A 1  876  ? 170.167 193.846 155.916 1.00 42.11  ?  876  ILE A CD1   1 
ATOM   6153  N  N     . ASP A 1  877  ? 165.909 196.121 156.763 1.00 47.51  ?  877  ASP A N     1 
ATOM   6154  C  CA    . ASP A 1  877  ? 164.527 196.427 157.112 1.00 47.51  ?  877  ASP A CA    1 
ATOM   6155  C  C     . ASP A 1  877  ? 164.148 195.833 158.468 1.00 47.51  ?  877  ASP A C     1 
ATOM   6156  O  O     . ASP A 1  877  ? 164.662 194.797 158.894 1.00 47.51  ?  877  ASP A O     1 
ATOM   6157  C  CB    . ASP A 1  877  ? 163.588 195.886 156.034 1.00 47.51  ?  877  ASP A CB    1 
ATOM   6158  C  CG    . ASP A 1  877  ? 162.318 196.692 155.908 1.00 47.51  ?  877  ASP A CG    1 
ATOM   6159  O  OD1   . ASP A 1  877  ? 162.383 197.931 156.034 1.00 47.51  ?  877  ASP A OD1   1 
ATOM   6160  O  OD2   . ASP A 1  877  ? 161.254 196.082 155.686 1.00 47.51  -1 877  ASP A OD2   1 
ATOM   6161  N  N     . ILE A 1  878  ? 163.215 196.504 159.149 1.00 43.04  ?  878  ILE A N     1 
ATOM   6162  C  CA    . ILE A 1  878  ? 162.791 196.037 160.464 1.00 43.04  ?  878  ILE A CA    1 
ATOM   6163  C  C     . ILE A 1  878  ? 161.747 194.935 160.396 1.00 43.04  ?  878  ILE A C     1 
ATOM   6164  O  O     . ILE A 1  878  ? 161.330 194.437 161.449 1.00 43.04  ?  878  ILE A O     1 
ATOM   6165  C  CB    . ILE A 1  878  ? 162.253 197.183 161.344 1.00 43.04  ?  878  ILE A CB    1 
ATOM   6166  C  CG1   . ILE A 1  878  ? 160.924 197.702 160.808 1.00 43.04  ?  878  ILE A CG1   1 
ATOM   6167  C  CG2   . ILE A 1  878  ? 163.269 198.304 161.432 1.00 43.04  ?  878  ILE A CG2   1 
ATOM   6168  C  CD1   . ILE A 1  878  ? 160.170 198.560 161.797 1.00 43.04  ?  878  ILE A CD1   1 
ATOM   6169  N  N     . SER A 1  879  ? 161.294 194.544 159.201 1.00 35.52  ?  879  SER A N     1 
ATOM   6170  C  CA    . SER A 1  879  ? 160.552 193.294 159.084 1.00 35.52  ?  879  SER A CA    1 
ATOM   6171  C  C     . SER A 1  879  ? 161.423 192.107 159.427 1.00 35.52  ?  879  SER A C     1 
ATOM   6172  O  O     . SER A 1  879  ? 160.939 191.131 160.003 1.00 35.52  ?  879  SER A O     1 
ATOM   6173  C  CB    . SER A 1  879  ? 159.995 193.102 157.673 1.00 35.52  ?  879  SER A CB    1 
ATOM   6174  O  OG    . SER A 1  879  ? 158.795 193.812 157.470 1.00 35.52  ?  879  SER A OG    1 
ATOM   6175  N  N     . GLN A 1  880  ? 162.701 192.174 159.081 1.00 32.03  ?  880  GLN A N     1 
ATOM   6176  C  CA    . GLN A 1  880  ? 163.634 191.084 159.283 1.00 32.03  ?  880  GLN A CA    1 
ATOM   6177  C  C     . GLN A 1  880  ? 164.126 191.000 160.723 1.00 32.03  ?  880  GLN A C     1 
ATOM   6178  O  O     . GLN A 1  880  ? 164.868 190.075 161.058 1.00 32.03  ?  880  GLN A O     1 
ATOM   6179  C  CB    . GLN A 1  880  ? 164.812 191.250 158.325 1.00 32.03  ?  880  GLN A CB    1 
ATOM   6180  C  CG    . GLN A 1  880  ? 164.419 191.353 156.851 1.00 32.03  ?  880  GLN A CG    1 
ATOM   6181  C  CD    . GLN A 1  880  ? 164.235 190.010 156.173 1.00 32.03  ?  880  GLN A CD    1 
ATOM   6182  O  OE1   . GLN A 1  880  ? 165.106 189.146 156.232 1.00 32.03  ?  880  GLN A OE1   1 
ATOM   6183  N  NE2   . GLN A 1  880  ? 163.096 189.827 155.529 1.00 32.03  ?  880  GLN A NE2   1 
ATOM   6184  N  N     . LEU A 1  881  ? 163.725 191.940 161.580 1.00 27.48  ?  881  LEU A N     1 
ATOM   6185  C  CA    . LEU A 1  881  ? 164.196 192.014 162.953 1.00 27.48  ?  881  LEU A CA    1 
ATOM   6186  C  C     . LEU A 1  881  ? 163.142 191.661 163.998 1.00 27.48  ?  881  LEU A C     1 
ATOM   6187  O  O     . LEU A 1  881  ? 163.460 191.682 165.188 1.00 27.48  ?  881  LEU A O     1 
ATOM   6188  C  CB    . LEU A 1  881  ? 164.737 193.422 163.248 1.00 27.48  ?  881  LEU A CB    1 
ATOM   6189  C  CG    . LEU A 1  881  ? 165.875 194.010 162.401 1.00 27.48  ?  881  LEU A CG    1 
ATOM   6190  C  CD1   . LEU A 1  881  ? 166.179 195.412 162.844 1.00 27.48  ?  881  LEU A CD1   1 
ATOM   6191  C  CD2   . LEU A 1  881  ? 167.144 193.175 162.426 1.00 27.48  ?  881  LEU A CD2   1 
ATOM   6192  N  N     . VAL A 1  882  ? 161.913 191.329 163.599 1.00 27.80  ?  882  VAL A N     1 
ATOM   6193  C  CA    . VAL A 1  882  ? 160.796 191.115 164.522 1.00 27.80  ?  882  VAL A CA    1 
ATOM   6194  C  C     . VAL A 1  882  ? 160.817 189.689 165.065 1.00 27.80  ?  882  VAL A C     1 
ATOM   6195  O  O     . VAL A 1  882  ? 160.917 188.720 164.305 1.00 27.80  ?  882  VAL A O     1 
ATOM   6196  C  CB    . VAL A 1  882  ? 159.460 191.432 163.828 1.00 27.80  ?  882  VAL A CB    1 
ATOM   6197  C  CG1   . VAL A 1  882  ? 158.274 190.999 164.658 1.00 27.80  ?  882  VAL A CG1   1 
ATOM   6198  C  CG2   . VAL A 1  882  ? 159.356 192.912 163.597 1.00 27.80  ?  882  VAL A CG2   1 
ATOM   6199  N  N     . ILE A 1  883  ? 160.731 189.566 166.391 1.00 24.61  ?  883  ILE A N     1 
ATOM   6200  C  CA    . ILE A 1  883  ? 160.699 188.291 167.099 1.00 24.61  ?  883  ILE A CA    1 
ATOM   6201  C  C     . ILE A 1  883  ? 159.301 188.129 167.687 1.00 24.61  ?  883  ILE A C     1 
ATOM   6202  O  O     . ILE A 1  883  ? 158.719 189.103 168.176 1.00 24.61  ?  883  ILE A O     1 
ATOM   6203  C  CB    . ILE A 1  883  ? 161.775 188.272 168.202 1.00 24.61  ?  883  ILE A CB    1 
ATOM   6204  C  CG1   . ILE A 1  883  ? 163.139 188.599 167.616 1.00 24.61  ?  883  ILE A CG1   1 
ATOM   6205  C  CG2   . ILE A 1  883  ? 161.905 186.898 168.806 1.00 24.61  ?  883  ILE A CG2   1 
ATOM   6206  C  CD1   . ILE A 1  883  ? 164.201 188.890 168.643 1.00 24.61  ?  883  ILE A CD1   1 
ATOM   6207  N  N     . THR A 1  884  ? 158.745 186.915 167.629 1.00 26.57  ?  884  THR A N     1 
ATOM   6208  C  CA    . THR A 1  884  ? 157.427 186.654 168.205 1.00 26.57  ?  884  THR A CA    1 
ATOM   6209  C  C     . THR A 1  884  ? 157.485 185.513 169.210 1.00 26.57  ?  884  THR A C     1 
ATOM   6210  O  O     . THR A 1  884  ? 158.159 184.506 168.981 1.00 26.57  ?  884  THR A O     1 
ATOM   6211  C  CB    . THR A 1  884  ? 156.364 186.318 167.136 1.00 26.57  ?  884  THR A CB    1 
ATOM   6212  O  OG1   . THR A 1  884  ? 156.799 185.222 166.325 1.00 26.57  ?  884  THR A OG1   1 
ATOM   6213  C  CG2   . THR A 1  884  ? 156.075 187.503 166.263 1.00 26.57  ?  884  THR A CG2   1 
ATOM   6214  N  N     . LYS A 1  885  ? 156.755 185.665 170.318 1.00 30.39  ?  885  LYS A N     1 
ATOM   6215  C  CA    . LYS A 1  885  ? 156.658 184.593 171.307 1.00 30.39  ?  885  LYS A CA    1 
ATOM   6216  C  C     . LYS A 1  885  ? 155.244 184.501 171.862 1.00 30.39  ?  885  LYS A C     1 
ATOM   6217  O  O     . LYS A 1  885  ? 154.539 185.503 171.980 1.00 30.39  ?  885  LYS A O     1 
ATOM   6218  C  CB    . LYS A 1  885  ? 157.660 184.772 172.454 1.00 30.39  ?  885  LYS A CB    1 
ATOM   6219  C  CG    . LYS A 1  885  ? 159.008 184.131 172.170 1.00 30.39  ?  885  LYS A CG    1 
ATOM   6220  C  CD    . LYS A 1  885  ? 159.768 183.782 173.422 1.00 30.39  ?  885  LYS A CD    1 
ATOM   6221  C  CE    . LYS A 1  885  ? 160.992 182.963 173.073 1.00 30.39  ?  885  LYS A CE    1 
ATOM   6222  N  NZ    . LYS A 1  885  ? 161.672 182.445 174.289 1.00 30.39  1  885  LYS A NZ    1 
ATOM   6223  N  N     . GLU A 1  886  ? 154.852 183.278 172.218 1.00 36.25  ?  886  GLU A N     1 
ATOM   6224  C  CA    . GLU A 1  886  ? 153.493 182.969 172.653 1.00 36.25  ?  886  GLU A CA    1 
ATOM   6225  C  C     . GLU A 1  886  ? 153.309 183.262 174.139 1.00 36.25  ?  886  GLU A C     1 
ATOM   6226  O  O     . GLU A 1  886  ? 154.092 182.792 174.968 1.00 36.25  ?  886  GLU A O     1 
ATOM   6227  C  CB    . GLU A 1  886  ? 153.182 181.503 172.375 1.00 36.25  ?  886  GLU A CB    1 
ATOM   6228  C  CG    . GLU A 1  886  ? 151.738 181.132 172.619 1.00 36.25  ?  886  GLU A CG    1 
ATOM   6229  C  CD    . GLU A 1  886  ? 151.486 179.657 172.453 1.00 36.25  ?  886  GLU A CD    1 
ATOM   6230  O  OE1   . GLU A 1  886  ? 152.468 178.895 172.316 1.00 36.25  ?  886  GLU A OE1   1 
ATOM   6231  O  OE2   . GLU A 1  886  ? 150.307 179.255 172.460 1.00 36.25  -1 886  GLU A OE2   1 
ATOM   6232  N  N     . LEU A 1  887  ? 152.248 183.993 174.477 1.00 37.25  ?  887  LEU A N     1 
ATOM   6233  C  CA    . LEU A 1  887  ? 151.934 184.349 175.862 1.00 37.25  ?  887  LEU A CA    1 
ATOM   6234  C  C     . LEU A 1  887  ? 151.030 183.274 176.457 1.00 37.25  ?  887  LEU A C     1 
ATOM   6235  O  O     . LEU A 1  887  ? 149.816 183.280 176.256 1.00 37.25  ?  887  LEU A O     1 
ATOM   6236  C  CB    . LEU A 1  887  ? 151.281 185.724 175.926 1.00 37.25  ?  887  LEU A CB    1 
ATOM   6237  C  CG    . LEU A 1  887  ? 150.871 186.200 177.313 1.00 37.25  ?  887  LEU A CG    1 
ATOM   6238  C  CD1   . LEU A 1  887  ? 152.078 186.259 178.202 1.00 37.25  ?  887  LEU A CD1   1 
ATOM   6239  C  CD2   . LEU A 1  887  ? 150.187 187.548 177.241 1.00 37.25  ?  887  LEU A CD2   1 
ATOM   6240  N  N     . THR A 1  888  ? 151.622 182.349 177.196 1.00 46.91  ?  888  THR A N     1 
ATOM   6241  C  CA    . THR A 1  888  ? 150.923 181.191 177.737 1.00 46.91  ?  888  THR A CA    1 
ATOM   6242  C  C     . THR A 1  888  ? 150.305 181.550 179.090 1.00 46.91  ?  888  THR A C     1 
ATOM   6243  O  O     . THR A 1  888  ? 150.077 182.725 179.392 1.00 46.91  ?  888  THR A O     1 
ATOM   6244  C  CB    . THR A 1  888  ? 151.872 179.996 177.832 1.00 46.91  ?  888  THR A CB    1 
ATOM   6245  O  OG1   . THR A 1  888  ? 152.948 180.314 178.716 1.00 46.91  ?  888  THR A OG1   1 
ATOM   6246  C  CG2   . THR A 1  888  ? 152.435 179.668 176.467 1.00 46.91  ?  888  THR A CG2   1 
ATOM   6247  N  N     . ARG A 1  889  ? 149.948 180.532 179.871 1.00 63.75  ?  889  ARG A N     1 
ATOM   6248  C  CA    . ARG A 1  889  ? 149.431 180.674 181.228 1.00 63.75  ?  889  ARG A CA    1 
ATOM   6249  C  C     . ARG A 1  889  ? 150.307 181.557 182.116 1.00 63.75  ?  889  ARG A C     1 
ATOM   6250  O  O     . ARG A 1  889  ? 151.540 181.498 182.059 1.00 63.75  ?  889  ARG A O     1 
ATOM   6251  C  CB    . ARG A 1  889  ? 149.224 179.284 181.861 1.00 63.75  ?  889  ARG A CB    1 
ATOM   6252  C  CG    . ARG A 1  889  ? 150.477 178.455 182.240 1.00 63.75  ?  889  ARG A CG    1 
ATOM   6253  C  CD    . ARG A 1  889  ? 151.073 177.662 181.064 1.00 63.75  ?  889  ARG A CD    1 
ATOM   6254  N  NE    . ARG A 1  889  ? 152.091 176.705 181.488 1.00 63.75  ?  889  ARG A NE    1 
ATOM   6255  C  CZ    . ARG A 1  889  ? 152.901 176.055 180.655 1.00 63.75  ?  889  ARG A CZ    1 
ATOM   6256  N  NH1   . ARG A 1  889  ? 152.818 176.260 179.350 1.00 63.75  1  889  ARG A NH1   1 
ATOM   6257  N  NH2   . ARG A 1  889  ? 153.798 175.199 181.130 1.00 63.75  ?  889  ARG A NH2   1 
ATOM   6258  N  N     . ALA A 1  890  ? 149.663 182.393 182.925 1.00 71.71  ?  890  ALA A N     1 
ATOM   6259  C  CA    . ALA A 1  890  ? 150.331 183.545 183.517 1.00 71.71  ?  890  ALA A CA    1 
ATOM   6260  C  C     . ALA A 1  890  ? 151.226 183.204 184.704 1.00 71.71  ?  890  ALA A C     1 
ATOM   6261  O  O     . ALA A 1  890  ? 152.056 184.038 185.079 1.00 71.71  ?  890  ALA A O     1 
ATOM   6262  C  CB    . ALA A 1  890  ? 149.290 184.588 183.945 1.00 71.71  ?  890  ALA A CB    1 
ATOM   6263  N  N     . ALA A 1  891  ? 151.122 182.003 185.279 1.00 68.37  ?  891  ALA A N     1 
ATOM   6264  C  CA    . ALA A 1  891  ? 151.874 181.698 186.497 1.00 68.37  ?  891  ALA A CA    1 
ATOM   6265  C  C     . ALA A 1  891  ? 153.267 181.162 186.180 1.00 68.37  ?  891  ALA A C     1 
ATOM   6266  O  O     . ALA A 1  891  ? 154.228 181.418 186.914 1.00 68.37  ?  891  ALA A O     1 
ATOM   6267  C  CB    . ALA A 1  891  ? 151.091 180.710 187.363 1.00 68.37  ?  891  ALA A CB    1 
ATOM   6268  N  N     . SER A 1  892  ? 153.391 180.395 185.091 1.00 58.79  ?  892  SER A N     1 
ATOM   6269  C  CA    . SER A 1  892  ? 154.712 179.967 184.638 1.00 58.79  ?  892  SER A CA    1 
ATOM   6270  C  C     . SER A 1  892  ? 155.551 181.165 184.208 1.00 58.79  ?  892  SER A C     1 
ATOM   6271  O  O     . SER A 1  892  ? 156.766 181.205 184.437 1.00 58.79  ?  892  SER A O     1 
ATOM   6272  C  CB    . SER A 1  892  ? 154.577 178.968 183.492 1.00 58.79  ?  892  SER A CB    1 
ATOM   6273  O  OG    . SER A 1  892  ? 153.609 179.409 182.562 1.00 58.79  ?  892  SER A OG    1 
ATOM   6274  N  N     . ASP A 1  893  ? 154.910 182.165 183.607 1.00 57.40  ?  893  ASP A N     1 
ATOM   6275  C  CA    . ASP A 1  893  ? 155.538 183.436 183.294 1.00 57.40  ?  893  ASP A CA    1 
ATOM   6276  C  C     . ASP A 1  893  ? 155.599 184.379 184.493 1.00 57.40  ?  893  ASP A C     1 
ATOM   6277  O  O     . ASP A 1  893  ? 156.267 185.414 184.410 1.00 57.40  ?  893  ASP A O     1 
ATOM   6278  C  CB    . ASP A 1  893  ? 154.800 184.087 182.129 1.00 57.40  ?  893  ASP A CB    1 
ATOM   6279  C  CG    . ASP A 1  893  ? 154.701 183.166 180.933 1.00 57.40  ?  893  ASP A CG    1 
ATOM   6280  O  OD1   . ASP A 1  893  ? 155.521 182.235 180.840 1.00 57.40  ?  893  ASP A OD1   1 
ATOM   6281  O  OD2   . ASP A 1  893  ? 153.810 183.360 180.091 1.00 57.40  -1 893  ASP A OD2   1 
ATOM   6282  N  N     . TYR A 1  894  ? 154.918 184.051 185.598 1.00 68.85  ?  894  TYR A N     1 
ATOM   6283  C  CA    . TYR A 1  894  ? 155.231 184.671 186.881 1.00 68.85  ?  894  TYR A CA    1 
ATOM   6284  C  C     . TYR A 1  894  ? 156.511 184.105 187.479 1.00 68.85  ?  894  TYR A C     1 
ATOM   6285  O  O     . TYR A 1  894  ? 157.220 184.811 188.202 1.00 68.85  ?  894  TYR A O     1 
ATOM   6286  C  CB    . TYR A 1  894  ? 154.097 184.463 187.891 1.00 68.85  ?  894  TYR A CB    1 
ATOM   6287  C  CG    . TYR A 1  894  ? 152.870 185.310 187.709 1.00 68.85  ?  894  TYR A CG    1 
ATOM   6288  C  CD1   . TYR A 1  894  ? 152.919 186.512 187.016 1.00 68.85  ?  894  TYR A CD1   1 
ATOM   6289  C  CD2   . TYR A 1  894  ? 151.651 184.896 188.220 1.00 68.85  ?  894  TYR A CD2   1 
ATOM   6290  C  CE1   . TYR A 1  894  ? 151.787 187.285 186.846 1.00 68.85  ?  894  TYR A CE1   1 
ATOM   6291  C  CE2   . TYR A 1  894  ? 150.513 185.664 188.059 1.00 68.85  ?  894  TYR A CE2   1 
ATOM   6292  C  CZ    . TYR A 1  894  ? 150.590 186.857 187.371 1.00 68.85  ?  894  TYR A CZ    1 
ATOM   6293  O  OH    . TYR A 1  894  ? 149.461 187.621 187.205 1.00 68.85  ?  894  TYR A OH    1 
ATOM   6294  N  N     . ALA A 1  895  ? 156.812 182.837 187.198 1.00 62.28  ?  895  ALA A N     1 
ATOM   6295  C  CA    . ALA A 1  895  ? 157.923 182.147 187.850 1.00 62.28  ?  895  ALA A CA    1 
ATOM   6296  C  C     . ALA A 1  895  ? 159.300 182.643 187.421 1.00 62.28  ?  895  ALA A C     1 
ATOM   6297  O  O     . ALA A 1  895  ? 160.270 182.425 188.154 1.00 62.28  ?  895  ALA A O     1 
ATOM   6298  C  CB    . ALA A 1  895  ? 157.821 180.648 187.583 1.00 62.28  ?  895  ALA A CB    1 
ATOM   6299  N  N     . GLY A 1  896  ? 159.411 183.296 186.263 1.00 52.79  ?  896  GLY A N     1 
ATOM   6300  C  CA    . GLY A 1  896  ? 160.690 183.766 185.758 1.00 52.79  ?  896  GLY A CA    1 
ATOM   6301  C  C     . GLY A 1  896  ? 160.535 184.828 184.688 1.00 52.79  ?  896  GLY A C     1 
ATOM   6302  O  O     . GLY A 1  896  ? 159.688 184.694 183.800 1.00 52.79  ?  896  GLY A O     1 
ATOM   6303  N  N     . LYS A 1  897  ? 161.356 185.878 184.740 1.00 39.37  ?  897  LYS A N     1 
ATOM   6304  C  CA    . LYS A 1  897  ? 161.113 187.088 183.962 1.00 39.37  ?  897  LYS A CA    1 
ATOM   6305  C  C     . LYS A 1  897  ? 161.539 186.914 182.509 1.00 39.37  ?  897  LYS A C     1 
ATOM   6306  O  O     . LYS A 1  897  ? 162.682 186.546 182.228 1.00 39.37  ?  897  LYS A O     1 
ATOM   6307  C  CB    . LYS A 1  897  ? 161.833 188.280 184.584 1.00 39.37  ?  897  LYS A CB    1 
ATOM   6308  C  CG    . LYS A 1  897  ? 161.283 188.647 185.930 1.00 39.37  ?  897  LYS A CG    1 
ATOM   6309  C  CD    . LYS A 1  897  ? 161.822 189.971 186.414 1.00 39.37  ?  897  LYS A CD    1 
ATOM   6310  C  CE    . LYS A 1  897  ? 161.183 191.106 185.658 1.00 39.37  ?  897  LYS A CE    1 
ATOM   6311  N  NZ    . LYS A 1  897  ? 159.736 191.157 185.943 1.00 39.37  1  897  LYS A NZ    1 
ATOM   6312  N  N     . GLN A 1  898  ? 160.611 187.188 181.601 1.00 30.30  ?  898  GLN A N     1 
ATOM   6313  C  CA    . GLN A 1  898  ? 160.794 187.051 180.167 1.00 30.30  ?  898  GLN A CA    1 
ATOM   6314  C  C     . GLN A 1  898  ? 160.614 188.416 179.509 1.00 30.30  ?  898  GLN A C     1 
ATOM   6315  O  O     . GLN A 1  898  ? 160.244 189.399 180.154 1.00 30.30  ?  898  GLN A O     1 
ATOM   6316  C  CB    . GLN A 1  898  ? 159.797 186.041 179.590 1.00 30.30  ?  898  GLN A CB    1 
ATOM   6317  C  CG    . GLN A 1  898  ? 159.684 184.739 180.366 1.00 30.30  ?  898  GLN A CG    1 
ATOM   6318  C  CD    . GLN A 1  898  ? 160.642 183.658 179.898 1.00 30.30  ?  898  GLN A CD    1 
ATOM   6319  O  OE1   . GLN A 1  898  ? 160.750 183.374 178.707 1.00 30.30  ?  898  GLN A OE1   1 
ATOM   6320  N  NE2   . GLN A 1  898  ? 161.335 183.039 180.845 1.00 30.30  ?  898  GLN A NE2   1 
ATOM   6321  N  N     . ALA A 1  899  ? 160.876 188.471 178.206 1.00 30.86  ?  899  ALA A N     1 
ATOM   6322  C  CA    . ALA A 1  899  ? 160.813 189.718 177.448 1.00 30.86  ?  899  ALA A CA    1 
ATOM   6323  C  C     . ALA A 1  899  ? 159.405 190.041 176.950 1.00 30.86  ?  899  ALA A C     1 
ATOM   6324  O  O     . ALA A 1  899  ? 158.926 191.175 177.103 1.00 30.86  ?  899  ALA A O     1 
ATOM   6325  C  CB    . ALA A 1  899  ? 161.782 189.645 176.266 1.00 30.86  ?  899  ALA A CB    1 
ATOM   6326  N  N     . HIS A 1  900  ? 158.732 189.051 176.352 1.00 28.01  ?  900  HIS A N     1 
ATOM   6327  C  CA    . HIS A 1  900  ? 157.409 189.273 175.780 1.00 28.01  ?  900  HIS A CA    1 
ATOM   6328  C  C     . HIS A 1  900  ? 156.356 189.475 176.856 1.00 28.01  ?  900  HIS A C     1 
ATOM   6329  O  O     . HIS A 1  900  ? 155.415 190.253 176.657 1.00 28.01  ?  900  HIS A O     1 
ATOM   6330  C  CB    . HIS A 1  900  ? 157.025 188.107 174.877 1.00 28.01  ?  900  HIS A CB    1 
ATOM   6331  C  CG    . HIS A 1  900  ? 157.120 186.766 175.535 1.00 28.01  ?  900  HIS A CG    1 
ATOM   6332  N  ND1   . HIS A 1  900  ? 158.319 186.132 175.768 1.00 28.01  ?  900  HIS A ND1   1 
ATOM   6333  C  CD2   . HIS A 1  900  ? 156.160 185.927 175.984 1.00 28.01  ?  900  HIS A CD2   1 
ATOM   6334  C  CE1   . HIS A 1  900  ? 158.094 184.968 176.348 1.00 28.01  ?  900  HIS A CE1   1 
ATOM   6335  N  NE2   . HIS A 1  900  ? 156.792 184.820 176.491 1.00 28.01  ?  900  HIS A NE2   1 
ATOM   6336  N  N     . VAL A 1  901  ? 156.513 188.803 177.997 1.00 32.84  ?  901  VAL A N     1 
ATOM   6337  C  CA    . VAL A 1  901  ? 155.617 189.009 179.127 1.00 32.84  ?  901  VAL A CA    1 
ATOM   6338  C  C     . VAL A 1  901  ? 155.757 190.427 179.664 1.00 32.84  ?  901  VAL A C     1 
ATOM   6339  O  O     . VAL A 1  901  ? 154.765 191.080 180.003 1.00 32.84  ?  901  VAL A O     1 
ATOM   6340  C  CB    . VAL A 1  901  ? 155.899 187.956 180.214 1.00 32.84  ?  901  VAL A CB    1 
ATOM   6341  C  CG1   . VAL A 1  901  ? 154.829 187.976 181.278 1.00 32.84  ?  901  VAL A CG1   1 
ATOM   6342  C  CG2   . VAL A 1  901  ? 156.027 186.581 179.591 1.00 32.84  ?  901  VAL A CG2   1 
ATOM   6343  N  N     . GLU A 1  902  ? 156.988 190.936 179.707 1.00 39.58  ?  902  GLU A N     1 
ATOM   6344  C  CA    . GLU A 1  902  ? 157.227 192.301 180.154 1.00 39.58  ?  902  GLU A CA    1 
ATOM   6345  C  C     . GLU A 1  902  ? 156.647 193.323 179.184 1.00 39.58  ?  902  GLU A C     1 
ATOM   6346  O  O     . GLU A 1  902  ? 156.140 194.367 179.608 1.00 39.58  ?  902  GLU A O     1 
ATOM   6347  C  CB    . GLU A 1  902  ? 158.724 192.525 180.326 1.00 39.58  ?  902  GLU A CB    1 
ATOM   6348  C  CG    . GLU A 1  902  ? 159.076 193.826 181.003 1.00 39.58  ?  902  GLU A CG    1 
ATOM   6349  C  CD    . GLU A 1  902  ? 158.797 193.787 182.477 1.00 39.58  ?  902  GLU A CD    1 
ATOM   6350  O  OE1   . GLU A 1  902  ? 158.876 192.688 183.062 1.00 39.58  ?  902  GLU A OE1   1 
ATOM   6351  O  OE2   . GLU A 1  902  ? 158.500 194.855 183.051 1.00 39.58  -1 902  GLU A OE2   1 
ATOM   6352  N  N     . LEU A 1  903  ? 156.721 193.049 177.880 1.00 37.00  ?  903  LEU A N     1 
ATOM   6353  C  CA    . LEU A 1  903  ? 156.139 193.974 176.911 1.00 37.00  ?  903  LEU A CA    1 
ATOM   6354  C  C     . LEU A 1  903  ? 154.613 193.964 176.977 1.00 37.00  ?  903  LEU A C     1 
ATOM   6355  O  O     . LEU A 1  903  ? 153.978 195.024 176.914 1.00 37.00  ?  903  LEU A O     1 
ATOM   6356  C  CB    . LEU A 1  903  ? 156.619 193.632 175.504 1.00 37.00  ?  903  LEU A CB    1 
ATOM   6357  C  CG    . LEU A 1  903  ? 155.975 194.457 174.394 1.00 37.00  ?  903  LEU A CG    1 
ATOM   6358  C  CD1   . LEU A 1  903  ? 156.458 195.896 174.426 1.00 37.00  ?  903  LEU A CD1   1 
ATOM   6359  C  CD2   . LEU A 1  903  ? 156.226 193.841 173.058 1.00 37.00  ?  903  LEU A CD2   1 
ATOM   6360  N  N     . ALA A 1  904  ? 154.011 192.775 177.124 1.00 38.96  ?  904  ALA A N     1 
ATOM   6361  C  CA    . ALA A 1  904  ? 152.555 192.661 177.171 1.00 38.96  ?  904  ALA A CA    1 
ATOM   6362  C  C     . ALA A 1  904  ? 151.976 193.289 178.430 1.00 38.96  ?  904  ALA A C     1 
ATOM   6363  O  O     . ALA A 1  904  ? 151.017 194.064 178.355 1.00 38.96  ?  904  ALA A O     1 
ATOM   6364  C  CB    . ALA A 1  904  ? 152.136 191.195 177.075 1.00 38.96  ?  904  ALA A CB    1 
ATOM   6365  N  N     . GLU A 1  905  ? 152.536 192.961 179.601 1.00 48.74  ?  905  GLU A N     1 
ATOM   6366  C  CA    . GLU A 1  905  ? 151.976 193.464 180.853 1.00 48.74  ?  905  GLU A CA    1 
ATOM   6367  C  C     . GLU A 1  905  ? 152.193 194.957 181.023 1.00 48.74  ?  905  GLU A C     1 
ATOM   6368  O  O     . GLU A 1  905  ? 151.417 195.604 181.730 1.00 48.74  ?  905  GLU A O     1 
ATOM   6369  C  CB    . GLU A 1  905  ? 152.560 192.724 182.062 1.00 48.74  ?  905  GLU A CB    1 
ATOM   6370  C  CG    . GLU A 1  905  ? 152.370 191.188 182.087 1.00 48.74  ?  905  GLU A CG    1 
ATOM   6371  C  CD    . GLU A 1  905  ? 150.924 190.741 182.053 1.00 48.74  ?  905  GLU A CD    1 
ATOM   6372  O  OE1   . GLU A 1  905  ? 150.297 190.669 183.133 1.00 48.74  ?  905  GLU A OE1   1 
ATOM   6373  O  OE2   . GLU A 1  905  ? 150.419 190.455 180.951 1.00 48.74  -1 905  GLU A OE2   1 
ATOM   6374  N  N     . ARG A 1  906  ? 153.214 195.518 180.391 1.00 52.76  ?  906  ARG A N     1 
ATOM   6375  C  CA    . ARG A 1  906  ? 153.339 196.966 180.308 1.00 52.76  ?  906  ARG A CA    1 
ATOM   6376  C  C     . ARG A 1  906  ? 152.333 197.488 179.299 1.00 52.76  ?  906  ARG A C     1 
ATOM   6377  O  O     . ARG A 1  906  ? 152.531 197.341 178.088 1.00 52.76  ?  906  ARG A O     1 
ATOM   6378  C  CB    . ARG A 1  906  ? 154.758 197.371 179.912 1.00 52.76  ?  906  ARG A CB    1 
ATOM   6379  C  CG    . ARG A 1  906  ? 154.997 198.891 179.927 1.00 52.76  ?  906  ARG A CG    1 
ATOM   6380  C  CD    . ARG A 1  906  ? 156.272 199.296 179.190 1.00 52.76  ?  906  ARG A CD    1 
ATOM   6381  N  NE    . ARG A 1  906  ? 157.396 198.394 179.431 1.00 52.76  ?  906  ARG A NE    1 
ATOM   6382  C  CZ    . ARG A 1  906  ? 158.059 197.729 178.488 1.00 52.76  ?  906  ARG A CZ    1 
ATOM   6383  N  NH1   . ARG A 1  906  ? 157.718 197.869 177.211 1.00 52.76  1  906  ARG A NH1   1 
ATOM   6384  N  NH2   . ARG A 1  906  ? 159.065 196.935 178.808 1.00 52.76  ?  906  ARG A NH2   1 
ATOM   6385  N  N     . MET A 1  907  ? 151.266 198.124 179.785 1.00 72.63  ?  907  MET A N     1 
ATOM   6386  C  CA    . MET A 1  907  ? 150.278 198.717 178.898 1.00 72.63  ?  907  MET A CA    1 
ATOM   6387  C  C     . MET A 1  907  ? 150.861 199.917 178.160 1.00 72.63  ?  907  MET A C     1 
ATOM   6388  O  O     . MET A 1  907  ? 152.007 200.331 178.363 1.00 72.63  ?  907  MET A O     1 
ATOM   6389  C  CB    . MET A 1  907  ? 149.030 199.179 179.661 1.00 72.63  ?  907  MET A CB    1 
ATOM   6390  C  CG    . MET A 1  907  ? 148.249 198.107 180.337 1.00 72.63  ?  907  MET A CG    1 
ATOM   6391  S  SD    . MET A 1  907  ? 147.794 196.773 179.232 1.00 72.63  ?  907  MET A SD    1 
ATOM   6392  C  CE    . MET A 1  907  ? 147.261 195.564 180.436 1.00 72.63  ?  907  MET A CE    1 
ATOM   6393  N  N     . ARG A 1  908  ? 150.033 200.490 177.306 1.00 90.88  ?  908  ARG A N     1 
ATOM   6394  C  CA    . ARG A 1  908  ? 150.333 201.754 176.667 1.00 90.88  ?  908  ARG A CA    1 
ATOM   6395  C  C     . ARG A 1  908  ? 149.519 202.871 177.300 1.00 90.88  ?  908  ARG A C     1 
ATOM   6396  O  O     . ARG A 1  908  ? 148.530 202.638 177.999 1.00 90.88  ?  908  ARG A O     1 
ATOM   6397  C  CB    . ARG A 1  908  ? 150.062 201.673 175.166 1.00 90.88  ?  908  ARG A CB    1 
ATOM   6398  C  CG    . ARG A 1  908  ? 151.007 200.781 174.346 1.00 90.88  ?  908  ARG A CG    1 
ATOM   6399  C  CD    . ARG A 1  908  ? 152.415 201.374 174.257 1.00 90.88  ?  908  ARG A CD    1 
ATOM   6400  N  NE    . ARG A 1  908  ? 153.272 200.973 175.356 1.00 90.88  ?  908  ARG A NE    1 
ATOM   6401  C  CZ    . ARG A 1  908  ? 154.414 201.561 175.669 1.00 90.88  ?  908  ARG A CZ    1 
ATOM   6402  N  NH1   . ARG A 1  908  ? 154.829 202.591 174.958 1.00 90.88  1  908  ARG A NH1   1 
ATOM   6403  N  NH2   . ARG A 1  908  ? 155.130 201.142 176.682 1.00 90.88  ?  908  ARG A NH2   1 
ATOM   6404  N  N     . LYS A 1  909  ? 149.984 204.100 177.079 1.00 106.85 ?  909  LYS A N     1 
ATOM   6405  C  CA    . LYS A 1  909  ? 149.213 205.270 177.482 1.00 106.85 ?  909  LYS A CA    1 
ATOM   6406  C  C     . LYS A 1  909  ? 148.028 205.491 176.557 1.00 106.85 ?  909  LYS A C     1 
ATOM   6407  O  O     . LYS A 1  909  ? 147.004 206.039 176.977 1.00 106.85 ?  909  LYS A O     1 
ATOM   6408  C  CB    . LYS A 1  909  ? 150.117 206.502 177.508 1.00 106.85 ?  909  LYS A CB    1 
ATOM   6409  C  CG    . LYS A 1  909  ? 151.363 206.306 178.345 1.00 106.85 ?  909  LYS A CG    1 
ATOM   6410  C  CD    . LYS A 1  909  ? 150.988 205.892 179.755 1.00 106.85 ?  909  LYS A CD    1 
ATOM   6411  C  CE    . LYS A 1  909  ? 151.897 204.804 180.271 1.00 106.85 ?  909  LYS A CE    1 
ATOM   6412  N  NZ    . LYS A 1  909  ? 151.288 204.139 181.450 1.00 106.85 1  909  LYS A NZ    1 
ATOM   6413  N  N     . ARG A 1  910  ? 148.142 205.044 175.306 1.00 96.38  ?  910  ARG A N     1 
ATOM   6414  C  CA    . ARG A 1  910  ? 147.096 205.296 174.322 1.00 96.38  ?  910  ARG A CA    1 
ATOM   6415  C  C     . ARG A 1  910  ? 145.905 204.366 174.511 1.00 96.38  ?  910  ARG A C     1 
ATOM   6416  O  O     . ARG A 1  910  ? 144.760 204.773 174.284 1.00 96.38  ?  910  ARG A O     1 
ATOM   6417  C  CB    . ARG A 1  910  ? 147.663 205.154 172.909 1.00 96.38  ?  910  ARG A CB    1 
ATOM   6418  C  CG    . ARG A 1  910  ? 148.813 204.155 172.814 1.00 96.38  ?  910  ARG A CG    1 
ATOM   6419  C  CD    . ARG A 1  910  ? 148.819 203.375 171.511 1.00 96.38  ?  910  ARG A CD    1 
ATOM   6420  N  NE    . ARG A 1  910  ? 147.694 202.448 171.418 1.00 96.38  ?  910  ARG A NE    1 
ATOM   6421  C  CZ    . ARG A 1  910  ? 147.368 201.777 170.315 1.00 96.38  ?  910  ARG A CZ    1 
ATOM   6422  N  NH1   . ARG A 1  910  ? 148.089 201.918 169.212 1.00 96.38  1  910  ARG A NH1   1 
ATOM   6423  N  NH2   . ARG A 1  910  ? 146.324 200.959 170.317 1.00 96.38  ?  910  ARG A NH2   1 
ATOM   6424  N  N     . ASP A 1  911  ? 146.137 203.122 174.929 1.00 83.35  ?  911  ASP A N     1 
ATOM   6425  C  CA    . ASP A 1  911  ? 145.098 202.094 174.844 1.00 83.35  ?  911  ASP A CA    1 
ATOM   6426  C  C     . ASP A 1  911  ? 145.281 201.042 175.930 1.00 83.35  ?  911  ASP A C     1 
ATOM   6427  O  O     . ASP A 1  911  ? 146.014 200.062 175.752 1.00 83.35  ?  911  ASP A O     1 
ATOM   6428  C  CB    . ASP A 1  911  ? 145.104 201.448 173.462 1.00 83.35  ?  911  ASP A CB    1 
ATOM   6429  C  CG    . ASP A 1  911  ? 143.826 200.715 173.141 1.00 83.35  ?  911  ASP A CG    1 
ATOM   6430  O  OD1   . ASP A 1  911  ? 142.980 200.519 174.038 1.00 83.35  ?  911  ASP A OD1   1 
ATOM   6431  O  OD2   . ASP A 1  911  ? 143.669 200.328 171.966 1.00 83.35  -1 911  ASP A OD2   1 
ATOM   6432  N  N     . PRO A 1  912  ? 144.608 201.203 177.075 1.00 80.12  ?  912  PRO A N     1 
ATOM   6433  C  CA    . PRO A 1  912  ? 144.508 200.087 178.023 1.00 80.12  ?  912  PRO A CA    1 
ATOM   6434  C  C     . PRO A 1  912  ? 143.293 199.208 177.768 1.00 80.12  ?  912  PRO A C     1 
ATOM   6435  O  O     . PRO A 1  912  ? 142.645 198.760 178.720 1.00 80.12  ?  912  PRO A O     1 
ATOM   6436  C  CB    . PRO A 1  912  ? 144.405 200.795 179.379 1.00 80.12  ?  912  PRO A CB    1 
ATOM   6437  C  CG    . PRO A 1  912  ? 144.121 202.295 179.054 1.00 80.12  ?  912  PRO A CG    1 
ATOM   6438  C  CD    . PRO A 1  912  ? 143.915 202.400 177.576 1.00 80.12  ?  912  PRO A CD    1 
ATOM   6439  N  N     . GLY A 1  913  ? 142.995 198.932 176.498 1.00 71.02  ?  913  GLY A N     1 
ATOM   6440  C  CA    . GLY A 1  913  ? 141.852 198.123 176.109 1.00 71.02  ?  913  GLY A CA    1 
ATOM   6441  C  C     . GLY A 1  913  ? 142.131 197.254 174.899 1.00 71.02  ?  913  GLY A C     1 
ATOM   6442  O  O     . GLY A 1  913  ? 141.253 196.534 174.417 1.00 71.02  ?  913  GLY A O     1 
ATOM   6443  N  N     . SER A 1  914  ? 143.354 197.342 174.386 1.00 65.72  ?  914  SER A N     1 
ATOM   6444  C  CA    . SER A 1  914  ? 143.842 196.447 173.349 1.00 65.72  ?  914  SER A CA    1 
ATOM   6445  C  C     . SER A 1  914  ? 145.263 196.073 173.722 1.00 65.72  ?  914  SER A C     1 
ATOM   6446  O  O     . SER A 1  914  ? 146.167 196.913 173.680 1.00 65.72  ?  914  SER A O     1 
ATOM   6447  C  CB    . SER A 1  914  ? 143.815 197.092 171.964 1.00 65.72  ?  914  SER A CB    1 
ATOM   6448  O  OG    . SER A 1  914  ? 144.819 198.082 171.846 1.00 65.72  ?  914  SER A OG    1 
ATOM   6449  N  N     . ALA A 1  915  ? 145.442 194.831 174.089 1.00 53.86  ?  915  ALA A N     1 
ATOM   6450  C  CA    . ALA A 1  915  ? 146.694 194.335 174.620 1.00 53.86  ?  915  ALA A CA    1 
ATOM   6451  C  C     . ALA A 1  915  ? 146.649 192.834 174.418 1.00 53.86  ?  915  ALA A C     1 
ATOM   6452  O  O     . ALA A 1  915  ? 145.557 192.291 174.220 1.00 53.86  ?  915  ALA A O     1 
ATOM   6453  C  CB    . ALA A 1  915  ? 146.847 194.716 176.095 1.00 53.86  ?  915  ALA A CB    1 
ATOM   6454  N  N     . PRO A 1  916  ? 147.789 192.144 174.401 1.00 45.59  ?  916  PRO A N     1 
ATOM   6455  C  CA    . PRO A 1  916  ? 147.767 190.687 174.262 1.00 45.59  ?  916  PRO A CA    1 
ATOM   6456  C  C     . PRO A 1  916  ? 147.055 190.000 175.417 1.00 45.59  ?  916  PRO A C     1 
ATOM   6457  O  O     . PRO A 1  916  ? 147.163 190.406 176.574 1.00 45.59  ?  916  PRO A O     1 
ATOM   6458  C  CB    . PRO A 1  916  ? 149.253 190.324 174.228 1.00 45.59  ?  916  PRO A CB    1 
ATOM   6459  C  CG    . PRO A 1  916  ? 149.883 191.498 173.643 1.00 45.59  ?  916  PRO A CG    1 
ATOM   6460  C  CD    . PRO A 1  916  ? 149.138 192.678 174.159 1.00 45.59  ?  916  PRO A CD    1 
ATOM   6461  N  N     . SER A 1  917  ? 146.295 188.970 175.079 1.00 45.31  ?  917  SER A N     1 
ATOM   6462  C  CA    . SER A 1  917  ? 145.628 188.125 176.051 1.00 45.31  ?  917  SER A CA    1 
ATOM   6463  C  C     . SER A 1  917  ? 146.354 186.785 176.145 1.00 45.31  ?  917  SER A C     1 
ATOM   6464  O  O     . SER A 1  917  ? 147.418 186.583 175.556 1.00 45.31  ?  917  SER A O     1 
ATOM   6465  C  CB    . SER A 1  917  ? 144.158 187.953 175.671 1.00 45.31  ?  917  SER A CB    1 
ATOM   6466  O  OG    . SER A 1  917  ? 143.393 189.071 176.083 1.00 45.31  ?  917  SER A OG    1 
ATOM   6467  N  N     . LEU A 1  918  ? 145.777 185.854 176.895 1.00 47.67  ?  918  LEU A N     1 
ATOM   6468  C  CA    . LEU A 1  918  ? 146.378 184.543 177.074 1.00 47.67  ?  918  LEU A CA    1 
ATOM   6469  C  C     . LEU A 1  918  ? 146.177 183.711 175.812 1.00 47.67  ?  918  LEU A C     1 
ATOM   6470  O  O     . LEU A 1  918  ? 145.048 183.545 175.343 1.00 47.67  ?  918  LEU A O     1 
ATOM   6471  C  CB    . LEU A 1  918  ? 145.765 183.849 178.293 1.00 47.67  ?  918  LEU A CB    1 
ATOM   6472  C  CG    . LEU A 1  918  ? 146.396 182.606 178.933 1.00 47.67  ?  918  LEU A CG    1 
ATOM   6473  C  CD1   . LEU A 1  918  ? 146.048 182.580 180.404 1.00 47.67  ?  918  LEU A CD1   1 
ATOM   6474  C  CD2   . LEU A 1  918  ? 145.945 181.301 178.286 1.00 47.67  ?  918  LEU A CD2   1 
ATOM   6475  N  N     . GLY A 1  919  ? 147.273 183.192 175.263 1.00 43.43  ?  919  GLY A N     1 
ATOM   6476  C  CA    . GLY A 1  919  ? 147.231 182.280 174.139 1.00 43.43  ?  919  GLY A CA    1 
ATOM   6477  C  C     . GLY A 1  919  ? 147.721 182.840 172.825 1.00 43.43  ?  919  GLY A C     1 
ATOM   6478  O  O     . GLY A 1  919  ? 148.020 182.052 171.917 1.00 43.43  ?  919  GLY A O     1 
ATOM   6479  N  N     . ASP A 1  920  ? 147.822 184.162 172.680 1.00 37.69  ?  920  ASP A N     1 
ATOM   6480  C  CA    . ASP A 1  920  ? 148.227 184.749 171.409 1.00 37.69  ?  920  ASP A CA    1 
ATOM   6481  C  C     . ASP A 1  920  ? 149.744 184.910 171.346 1.00 37.69  ?  920  ASP A C     1 
ATOM   6482  O  O     . ASP A 1  920  ? 150.491 184.415 172.193 1.00 37.69  ?  920  ASP A O     1 
ATOM   6483  C  CB    . ASP A 1  920  ? 147.510 186.072 171.169 1.00 37.69  ?  920  ASP A CB    1 
ATOM   6484  C  CG    . ASP A 1  920  ? 147.603 187.015 172.339 1.00 37.69  ?  920  ASP A CG    1 
ATOM   6485  O  OD1   . ASP A 1  920  ? 148.710 187.496 172.648 1.00 37.69  ?  920  ASP A OD1   1 
ATOM   6486  O  OD2   . ASP A 1  920  ? 146.544 187.306 172.928 1.00 37.69  -1 920  ASP A OD2   1 
ATOM   6487  N  N     . ARG A 1  921  ? 150.207 185.603 170.310 1.00 29.71  ?  921  ARG A N     1 
ATOM   6488  C  CA    . ARG A 1  921  ? 151.621 185.822 170.051 1.00 29.71  ?  921  ARG A CA    1 
ATOM   6489  C  C     . ARG A 1  921  ? 151.931 187.308 170.153 1.00 29.71  ?  921  ARG A C     1 
ATOM   6490  O  O     . ARG A 1  921  ? 151.183 188.137 169.627 1.00 29.71  ?  921  ARG A O     1 
ATOM   6491  C  CB    . ARG A 1  921  ? 152.004 185.295 168.677 1.00 29.71  ?  921  ARG A CB    1 
ATOM   6492  C  CG    . ARG A 1  921  ? 152.159 183.804 168.628 1.00 29.71  ?  921  ARG A CG    1 
ATOM   6493  C  CD    . ARG A 1  921  ? 152.899 183.415 167.394 1.00 29.71  ?  921  ARG A CD    1 
ATOM   6494  N  NE    . ARG A 1  921  ? 153.362 182.039 167.432 1.00 29.71  ?  921  ARG A NE    1 
ATOM   6495  C  CZ    . ARG A 1  921  ? 154.598 181.680 167.753 1.00 29.71  ?  921  ARG A CZ    1 
ATOM   6496  N  NH1   . ARG A 1  921  ? 154.938 180.408 167.751 1.00 29.71  1  921  ARG A NH1   1 
ATOM   6497  N  NH2   . ARG A 1  921  ? 155.499 182.586 168.069 1.00 29.71  ?  921  ARG A NH2   1 
ATOM   6498  N  N     . VAL A 1  922  ? 153.010 187.637 170.848 1.00 30.77  ?  922  VAL A N     1 
ATOM   6499  C  CA    . VAL A 1  922  ? 153.464 189.010 171.040 1.00 30.77  ?  922  VAL A CA    1 
ATOM   6500  C  C     . VAL A 1  922  ? 154.673 189.221 170.137 1.00 30.77  ?  922  VAL A C     1 
ATOM   6501  O  O     . VAL A 1  922  ? 155.615 188.414 170.174 1.00 30.77  ?  922  VAL A O     1 
ATOM   6502  C  CB    . VAL A 1  922  ? 153.805 189.296 172.510 1.00 30.77  ?  922  VAL A CB    1 
ATOM   6503  C  CG1   . VAL A 1  922  ? 154.029 190.773 172.731 1.00 30.77  ?  922  VAL A CG1   1 
ATOM   6504  C  CG2   . VAL A 1  922  ? 152.685 188.830 173.399 1.00 30.77  ?  922  VAL A CG2   1 
ATOM   6505  N  N     . PRO A 1  923  ? 154.645 190.220 169.244 1.00 33.34  ?  923  PRO A N     1 
ATOM   6506  C  CA    . PRO A 1  923  ? 155.842 190.595 168.485 1.00 33.34  ?  923  PRO A CA    1 
ATOM   6507  C  C     . PRO A 1  923  ? 156.609 191.752 169.113 1.00 33.34  ?  923  PRO A C     1 
ATOM   6508  O  O     . PRO A 1  923  ? 156.005 192.663 169.688 1.00 33.34  ?  923  PRO A O     1 
ATOM   6509  C  CB    . PRO A 1  923  ? 155.265 190.978 167.121 1.00 33.34  ?  923  PRO A CB    1 
ATOM   6510  C  CG    . PRO A 1  923  ? 153.901 191.490 167.428 1.00 33.34  ?  923  PRO A CG    1 
ATOM   6511  C  CD    . PRO A 1  923  ? 153.432 190.863 168.713 1.00 33.34  ?  923  PRO A CD    1 
ATOM   6512  N  N     . TYR A 1  924  ? 157.936 191.730 168.993 1.00 26.92  ?  924  TYR A N     1 
ATOM   6513  C  CA    . TYR A 1  924  ? 158.798 192.738 169.602 1.00 26.92  ?  924  TYR A CA    1 
ATOM   6514  C  C     . TYR A 1  924  ? 160.114 192.790 168.838 1.00 26.92  ?  924  TYR A C     1 
ATOM   6515  O  O     . TYR A 1  924  ? 160.459 191.866 168.101 1.00 26.92  ?  924  TYR A O     1 
ATOM   6516  C  CB    . TYR A 1  924  ? 159.041 192.452 171.100 1.00 26.92  ?  924  TYR A CB    1 
ATOM   6517  C  CG    . TYR A 1  924  ? 159.797 191.170 171.401 1.00 26.92  ?  924  TYR A CG    1 
ATOM   6518  C  CD1   . TYR A 1  924  ? 159.156 189.938 171.384 1.00 26.92  ?  924  TYR A CD1   1 
ATOM   6519  C  CD2   . TYR A 1  924  ? 161.147 191.193 171.710 1.00 26.92  ?  924  TYR A CD2   1 
ATOM   6520  C  CE1   . TYR A 1  924  ? 159.835 188.773 171.644 1.00 26.92  ?  924  TYR A CE1   1 
ATOM   6521  C  CE2   . TYR A 1  924  ? 161.837 190.028 171.974 1.00 26.92  ?  924  TYR A CE2   1 
ATOM   6522  C  CZ    . TYR A 1  924  ? 161.174 188.822 171.943 1.00 26.92  ?  924  TYR A CZ    1 
ATOM   6523  O  OH    . TYR A 1  924  ? 161.844 187.656 172.211 1.00 26.92  ?  924  TYR A OH    1 
ATOM   6524  N  N     . VAL A 1  925  ? 160.839 193.898 169.014 1.00 33.03  ?  925  VAL A N     1 
ATOM   6525  C  CA    . VAL A 1  925  ? 162.234 194.027 168.606 1.00 33.03  ?  925  VAL A CA    1 
ATOM   6526  C  C     . VAL A 1  925  ? 163.036 194.537 169.797 1.00 33.03  ?  925  VAL A C     1 
ATOM   6527  O  O     . VAL A 1  925  ? 162.484 195.081 170.754 1.00 33.03  ?  925  VAL A O     1 
ATOM   6528  C  CB    . VAL A 1  925  ? 162.424 194.967 167.399 1.00 33.03  ?  925  VAL A CB    1 
ATOM   6529  C  CG1   . VAL A 1  925  ? 161.779 194.395 166.165 1.00 33.03  ?  925  VAL A CG1   1 
ATOM   6530  C  CG2   . VAL A 1  925  ? 161.843 196.332 167.706 1.00 33.03  ?  925  VAL A CG2   1 
ATOM   6531  N  N     . ILE A 1  926  ? 164.355 194.367 169.721 1.00 34.06  ?  926  ILE A N     1 
ATOM   6532  C  CA    . ILE A 1  926  ? 165.262 194.699 170.815 1.00 34.06  ?  926  ILE A CA    1 
ATOM   6533  C  C     . ILE A 1  926  ? 166.033 195.956 170.447 1.00 34.06  ?  926  ILE A C     1 
ATOM   6534  O  O     . ILE A 1  926  ? 166.749 195.985 169.443 1.00 34.06  ?  926  ILE A O     1 
ATOM   6535  C  CB    . ILE A 1  926  ? 166.217 193.546 171.141 1.00 34.06  ?  926  ILE A CB    1 
ATOM   6536  C  CG1   . ILE A 1  926  ? 165.450 192.409 171.804 1.00 34.06  ?  926  ILE A CG1   1 
ATOM   6537  C  CG2   . ILE A 1  926  ? 167.336 194.016 172.041 1.00 34.06  ?  926  ILE A CG2   1 
ATOM   6538  C  CD1   . ILE A 1  926  ? 164.847 192.779 173.123 1.00 34.06  ?  926  ILE A CD1   1 
ATOM   6539  N  N     . ILE A 1  927  ? 165.902 196.991 171.269 1.00 52.08  ?  927  ILE A N     1 
ATOM   6540  C  CA    . ILE A 1  927  ? 166.589 198.257 171.050 1.00 52.08  ?  927  ILE A CA    1 
ATOM   6541  C  C     . ILE A 1  927  ? 167.862 198.296 171.880 1.00 52.08  ?  927  ILE A C     1 
ATOM   6542  O  O     . ILE A 1  927  ? 168.049 197.486 172.789 1.00 52.08  ?  927  ILE A O     1 
ATOM   6543  C  CB    . ILE A 1  927  ? 165.669 199.442 171.387 1.00 52.08  ?  927  ILE A CB    1 
ATOM   6544  C  CG1   . ILE A 1  927  ? 165.411 199.510 172.894 1.00 52.08  ?  927  ILE A CG1   1 
ATOM   6545  C  CG2   . ILE A 1  927  ? 164.371 199.324 170.608 1.00 52.08  ?  927  ILE A CG2   1 
ATOM   6546  C  CD1   . ILE A 1  927  ? 164.410 200.564 173.303 1.00 52.08  ?  927  ILE A CD1   1 
ATOM   6547  N  N     . SER A 1  928  ? 168.753 199.228 171.573 1.00 66.45  ?  928  SER A N     1 
ATOM   6548  C  CA    . SER A 1  928  ? 170.031 199.316 172.258 1.00 66.45  ?  928  SER A CA    1 
ATOM   6549  C  C     . SER A 1  928  ? 169.929 200.193 173.498 1.00 66.45  ?  928  SER A C     1 
ATOM   6550  O  O     . SER A 1  928  ? 169.338 201.275 173.464 1.00 66.45  ?  928  SER A O     1 
ATOM   6551  C  CB    . SER A 1  928  ? 171.107 199.867 171.322 1.00 66.45  ?  928  SER A CB    1 
ATOM   6552  O  OG    . SER A 1  928  ? 172.357 199.951 171.979 1.00 66.45  ?  928  SER A OG    1 
ATOM   6553  N  N     . ALA A 1  929  ? 170.514 199.712 174.591 1.00 87.88  ?  929  ALA A N     1 
ATOM   6554  C  CA    . ALA A 1  929  ? 170.626 200.459 175.838 1.00 87.88  ?  929  ALA A CA    1 
ATOM   6555  C  C     . ALA A 1  929  ? 171.837 199.922 176.592 1.00 87.88  ?  929  ALA A C     1 
ATOM   6556  O  O     . ALA A 1  929  ? 172.585 199.084 176.081 1.00 87.88  ?  929  ALA A O     1 
ATOM   6557  C  CB    . ALA A 1  929  ? 169.336 200.362 176.662 1.00 87.88  ?  929  ALA A CB    1 
ATOM   6558  N  N     . ALA A 1  930  ? 172.023 200.393 177.827 1.00 105.35 ?  930  ALA A N     1 
ATOM   6559  C  CA    . ALA A 1  930  ? 173.192 200.036 178.622 1.00 105.35 ?  930  ALA A CA    1 
ATOM   6560  C  C     . ALA A 1  930  ? 172.839 199.172 179.830 1.00 105.35 ?  930  ALA A C     1 
ATOM   6561  O  O     . ALA A 1  930  ? 173.605 199.129 180.798 1.00 105.35 ?  930  ALA A O     1 
ATOM   6562  C  CB    . ALA A 1  930  ? 173.933 201.295 179.077 1.00 105.35 ?  930  ALA A CB    1 
ATOM   6563  N  N     . LYS A 1  931  ? 171.702 198.482 179.799 1.00 100.03 ?  931  LYS A N     1 
ATOM   6564  C  CA    . LYS A 1  931  ? 171.298 197.595 180.889 1.00 100.03 ?  931  LYS A CA    1 
ATOM   6565  C  C     . LYS A 1  931  ? 171.589 196.172 180.417 1.00 100.03 ?  931  LYS A C     1 
ATOM   6566  O  O     . LYS A 1  931  ? 170.706 195.460 179.942 1.00 100.03 ?  931  LYS A O     1 
ATOM   6567  C  CB    . LYS A 1  931  ? 169.829 197.811 181.245 1.00 100.03 ?  931  LYS A CB    1 
ATOM   6568  C  CG    . LYS A 1  931  ? 169.468 197.559 182.711 1.00 100.03 ?  931  LYS A CG    1 
ATOM   6569  C  CD    . LYS A 1  931  ? 169.320 196.087 183.049 1.00 100.03 ?  931  LYS A CD    1 
ATOM   6570  C  CE    . LYS A 1  931  ? 168.689 195.894 184.421 1.00 100.03 ?  931  LYS A CE    1 
ATOM   6571  N  NZ    . LYS A 1  931  ? 168.811 194.490 184.907 1.00 100.03 1  931  LYS A NZ    1 
ATOM   6572  N  N     . GLY A 1  932  ? 172.849 195.755 180.571 1.00 102.99 ?  932  GLY A N     1 
ATOM   6573  C  CA    . GLY A 1  932  ? 173.316 194.485 180.045 1.00 102.99 ?  932  GLY A CA    1 
ATOM   6574  C  C     . GLY A 1  932  ? 172.898 193.260 180.826 1.00 102.99 ?  932  GLY A C     1 
ATOM   6575  O  O     . GLY A 1  932  ? 173.000 192.147 180.302 1.00 102.99 ?  932  GLY A O     1 
ATOM   6576  N  N     . VAL A 1  933  ? 172.426 193.443 182.063 1.00 90.91  ?  933  VAL A N     1 
ATOM   6577  C  CA    . VAL A 1  933  ? 171.958 192.327 182.879 1.00 90.91  ?  933  VAL A CA    1 
ATOM   6578  C  C     . VAL A 1  933  ? 170.643 191.762 182.350 1.00 90.91  ?  933  VAL A C     1 
ATOM   6579  O  O     . VAL A 1  933  ? 170.322 190.594 182.610 1.00 90.91  ?  933  VAL A O     1 
ATOM   6580  C  CB    . VAL A 1  933  ? 171.811 192.791 184.344 1.00 90.91  ?  933  VAL A CB    1 
ATOM   6581  C  CG1   . VAL A 1  933  ? 171.734 191.608 185.322 1.00 90.91  ?  933  VAL A CG1   1 
ATOM   6582  C  CG2   . VAL A 1  933  ? 172.938 193.741 184.727 1.00 90.91  ?  933  VAL A CG2   1 
ATOM   6583  N  N     . ALA A 1  934  ? 169.890 192.543 181.577 1.00 66.95  ?  934  ALA A N     1 
ATOM   6584  C  CA    . ALA A 1  934  ? 168.517 192.210 181.232 1.00 66.95  ?  934  ALA A CA    1 
ATOM   6585  C  C     . ALA A 1  934  ? 168.226 192.513 179.772 1.00 66.95  ?  934  ALA A C     1 
ATOM   6586  O  O     . ALA A 1  934  ? 168.237 193.675 179.364 1.00 66.95  ?  934  ALA A O     1 
ATOM   6587  C  CB    . ALA A 1  934  ? 167.553 192.991 182.114 1.00 66.95  ?  934  ALA A CB    1 
ATOM   6588  N  N     . ALA A 1  935  ? 167.936 191.473 178.998 1.00 45.69  ?  935  ALA A N     1 
ATOM   6589  C  CA    . ALA A 1  935  ? 167.382 191.628 177.661 1.00 45.69  ?  935  ALA A CA    1 
ATOM   6590  C  C     . ALA A 1  935  ? 165.872 191.781 177.677 1.00 45.69  ?  935  ALA A C     1 
ATOM   6591  O  O     . ALA A 1  935  ? 165.272 191.967 176.618 1.00 45.69  ?  935  ALA A O     1 
ATOM   6592  C  CB    . ALA A 1  935  ? 167.772 190.442 176.777 1.00 45.69  ?  935  ALA A CB    1 
ATOM   6593  N  N     . TYR A 1  936  ? 165.246 191.697 178.849 1.00 45.71  ?  936  TYR A N     1 
ATOM   6594  C  CA    . TYR A 1  936  ? 163.832 191.986 179.017 1.00 45.71  ?  936  TYR A CA    1 
ATOM   6595  C  C     . TYR A 1  936  ? 163.575 193.445 179.360 1.00 45.71  ?  936  TYR A C     1 
ATOM   6596  O  O     . TYR A 1  936  ? 162.427 193.815 179.611 1.00 45.71  ?  936  TYR A O     1 
ATOM   6597  C  CB    . TYR A 1  936  ? 163.219 191.080 180.097 1.00 45.71  ?  936  TYR A CB    1 
ATOM   6598  C  CG    . TYR A 1  936  ? 163.907 191.111 181.449 1.00 45.71  ?  936  TYR A CG    1 
ATOM   6599  C  CD1   . TYR A 1  936  ? 163.567 192.055 182.412 1.00 45.71  ?  936  TYR A CD1   1 
ATOM   6600  C  CD2   . TYR A 1  936  ? 164.883 190.177 181.769 1.00 45.71  ?  936  TYR A CD2   1 
ATOM   6601  C  CE1   . TYR A 1  936  ? 164.195 192.082 183.635 1.00 45.71  ?  936  TYR A CE1   1 
ATOM   6602  C  CE2   . TYR A 1  936  ? 165.511 190.191 182.997 1.00 45.71  ?  936  TYR A CE2   1 
ATOM   6603  C  CZ    . TYR A 1  936  ? 165.167 191.145 183.923 1.00 45.71  ?  936  TYR A CZ    1 
ATOM   6604  O  OH    . TYR A 1  936  ? 165.797 191.160 185.142 1.00 45.71  ?  936  TYR A OH    1 
ATOM   6605  N  N     . MET A 1  937  ? 164.612 194.274 179.395 1.00 51.92  ?  937  MET A N     1 
ATOM   6606  C  CA    . MET A 1  937  ? 164.450 195.707 179.601 1.00 51.92  ?  937  MET A CA    1 
ATOM   6607  C  C     . MET A 1  937  ? 164.659 196.500 178.318 1.00 51.92  ?  937  MET A C     1 
ATOM   6608  O  O     . MET A 1  937  ? 164.554 197.731 178.336 1.00 51.92  ?  937  MET A O     1 
ATOM   6609  C  CB    . MET A 1  937  ? 165.409 196.201 180.684 1.00 51.92  ?  937  MET A CB    1 
ATOM   6610  C  CG    . MET A 1  937  ? 165.073 195.705 182.069 1.00 51.92  ?  937  MET A CG    1 
ATOM   6611  S  SD    . MET A 1  937  ? 163.504 196.328 182.681 1.00 51.92  ?  937  MET A SD    1 
ATOM   6612  C  CE    . MET A 1  937  ? 163.492 195.587 184.308 1.00 51.92  ?  937  MET A CE    1 
ATOM   6613  N  N     . LYS A 1  938  ? 164.938 195.823 177.204 1.00 44.76  ?  938  LYS A N     1 
ATOM   6614  C  CA    . LYS A 1  938  ? 165.229 196.476 175.937 1.00 44.76  ?  938  LYS A CA    1 
ATOM   6615  C  C     . LYS A 1  938  ? 164.233 196.121 174.840 1.00 44.76  ?  938  LYS A C     1 
ATOM   6616  O  O     . LYS A 1  938  ? 164.545 196.307 173.662 1.00 44.76  ?  938  LYS A O     1 
ATOM   6617  C  CB    . LYS A 1  938  ? 166.642 196.115 175.482 1.00 44.76  ?  938  LYS A CB    1 
ATOM   6618  C  CG    . LYS A 1  938  ? 167.738 196.521 176.447 1.00 44.76  ?  938  LYS A CG    1 
ATOM   6619  C  CD    . LYS A 1  938  ? 168.811 195.452 176.505 1.00 44.76  ?  938  LYS A CD    1 
ATOM   6620  C  CE    . LYS A 1  938  ? 169.569 195.369 175.214 1.00 44.76  ?  938  LYS A CE    1 
ATOM   6621  N  NZ    . LYS A 1  938  ? 170.385 194.137 175.152 1.00 44.76  1  938  LYS A NZ    1 
ATOM   6622  N  N     . SER A 1  939  ? 163.051 195.618 175.183 1.00 41.16  ?  939  SER A N     1 
ATOM   6623  C  CA    . SER A 1  939  ? 162.100 195.154 174.182 1.00 41.16  ?  939  SER A CA    1 
ATOM   6624  C  C     . SER A 1  939  ? 160.987 196.172 173.981 1.00 41.16  ?  939  SER A C     1 
ATOM   6625  O  O     . SER A 1  939  ? 160.544 196.819 174.933 1.00 41.16  ?  939  SER A O     1 
ATOM   6626  C  CB    . SER A 1  939  ? 161.521 193.801 174.590 1.00 41.16  ?  939  SER A CB    1 
ATOM   6627  O  OG    . SER A 1  939  ? 160.446 193.959 175.494 1.00 41.16  ?  939  SER A OG    1 
ATOM   6628  N  N     . GLU A 1  940  ? 160.535 196.307 172.733 1.00 57.15  ?  940  GLU A N     1 
ATOM   6629  C  CA    . GLU A 1  940  ? 159.575 197.339 172.373 1.00 57.15  ?  940  GLU A CA    1 
ATOM   6630  C  C     . GLU A 1  940  ? 158.686 196.848 171.236 1.00 57.15  ?  940  GLU A C     1 
ATOM   6631  O  O     . GLU A 1  940  ? 159.088 196.001 170.434 1.00 57.15  ?  940  GLU A O     1 
ATOM   6632  C  CB    . GLU A 1  940  ? 160.305 198.636 171.991 1.00 57.15  ?  940  GLU A CB    1 
ATOM   6633  C  CG    . GLU A 1  940  ? 159.449 199.900 171.942 1.00 57.15  ?  940  GLU A CG    1 
ATOM   6634  C  CD    . GLU A 1  940  ? 158.559 200.075 173.154 1.00 57.15  ?  940  GLU A CD    1 
ATOM   6635  O  OE1   . GLU A 1  940  ? 159.030 200.622 174.166 1.00 57.15  ?  940  GLU A OE1   1 
ATOM   6636  O  OE2   . GLU A 1  940  ? 157.378 199.675 173.097 1.00 57.15  -1 940  GLU A OE2   1 
ATOM   6637  N  N     . ASP A 1  941  ? 157.457 197.367 171.204 1.00 73.33  ?  941  ASP A N     1 
ATOM   6638  C  CA    . ASP A 1  941  ? 156.518 197.105 170.116 1.00 73.33  ?  941  ASP A CA    1 
ATOM   6639  C  C     . ASP A 1  941  ? 157.060 197.636 168.791 1.00 73.33  ?  941  ASP A C     1 
ATOM   6640  O  O     . ASP A 1  941  ? 157.652 198.721 168.759 1.00 73.33  ?  941  ASP A O     1 
ATOM   6641  C  CB    . ASP A 1  941  ? 155.175 197.774 170.399 1.00 73.33  ?  941  ASP A CB    1 
ATOM   6642  C  CG    . ASP A 1  941  ? 154.076 197.300 169.465 1.00 73.33  ?  941  ASP A CG    1 
ATOM   6643  O  OD1   . ASP A 1  941  ? 153.887 196.071 169.338 1.00 73.33  ?  941  ASP A OD1   1 
ATOM   6644  O  OD2   . ASP A 1  941  ? 153.416 198.156 168.840 1.00 73.33  -1 941  ASP A OD2   1 
ATOM   6645  N  N     . PRO A 1  942  ? 156.880 196.895 167.690 1.00 80.13  ?  942  PRO A N     1 
ATOM   6646  C  CA    . PRO A 1  942  ? 157.335 197.392 166.377 1.00 80.13  ?  942  PRO A CA    1 
ATOM   6647  C  C     . PRO A 1  942  ? 156.675 198.687 165.916 1.00 80.13  ?  942  PRO A C     1 
ATOM   6648  O  O     . PRO A 1  942  ? 157.348 199.534 165.308 1.00 80.13  ?  942  PRO A O     1 
ATOM   6649  C  CB    . PRO A 1  942  ? 156.997 196.227 165.443 1.00 80.13  ?  942  PRO A CB    1 
ATOM   6650  C  CG    . PRO A 1  942  ? 157.136 195.031 166.306 1.00 80.13  ?  942  PRO A CG    1 
ATOM   6651  C  CD    . PRO A 1  942  ? 156.633 195.446 167.664 1.00 80.13  ?  942  PRO A CD    1 
ATOM   6652  N  N     . LEU A 1  943  ? 155.389 198.889 166.199 1.00 94.06  ?  943  LEU A N     1 
ATOM   6653  C  CA    . LEU A 1  943  ? 154.763 200.148 165.816 1.00 94.06  ?  943  LEU A CA    1 
ATOM   6654  C  C     . LEU A 1  943  ? 155.230 201.300 166.697 1.00 94.06  ?  943  LEU A C     1 
ATOM   6655  O  O     . LEU A 1  943  ? 155.314 202.436 166.227 1.00 94.06  ?  943  LEU A O     1 
ATOM   6656  C  CB    . LEU A 1  943  ? 153.242 200.027 165.858 1.00 94.06  ?  943  LEU A CB    1 
ATOM   6657  C  CG    . LEU A 1  943  ? 152.490 200.882 164.833 1.00 94.06  ?  943  LEU A CG    1 
ATOM   6658  C  CD1   . LEU A 1  943  ? 152.811 200.436 163.418 1.00 94.06  ?  943  LEU A CD1   1 
ATOM   6659  C  CD2   . LEU A 1  943  ? 150.995 200.832 165.080 1.00 94.06  ?  943  LEU A CD2   1 
ATOM   6660  N  N     . PHE A 1  944  ? 155.568 201.029 167.960 1.00 97.06  ?  944  PHE A N     1 
ATOM   6661  C  CA    . PHE A 1  944  ? 156.044 202.101 168.828 1.00 97.06  ?  944  PHE A CA    1 
ATOM   6662  C  C     . PHE A 1  944  ? 157.448 202.549 168.443 1.00 97.06  ?  944  PHE A C     1 
ATOM   6663  O  O     . PHE A 1  944  ? 157.746 203.750 168.457 1.00 97.06  ?  944  PHE A O     1 
ATOM   6664  C  CB    . PHE A 1  944  ? 156.001 201.671 170.290 1.00 97.06  ?  944  PHE A CB    1 
ATOM   6665  C  CG    . PHE A 1  944  ? 155.905 202.821 171.244 1.00 97.06  ?  944  PHE A CG    1 
ATOM   6666  C  CD1   . PHE A 1  944  ? 154.704 203.481 171.431 1.00 97.06  ?  944  PHE A CD1   1 
ATOM   6667  C  CD2   . PHE A 1  944  ? 157.021 203.260 171.932 1.00 97.06  ?  944  PHE A CD2   1 
ATOM   6668  C  CE1   . PHE A 1  944  ? 154.613 204.547 172.303 1.00 97.06  ?  944  PHE A CE1   1 
ATOM   6669  C  CE2   . PHE A 1  944  ? 156.939 204.328 172.804 1.00 97.06  ?  944  PHE A CE2   1 
ATOM   6670  C  CZ    . PHE A 1  944  ? 155.733 204.973 172.987 1.00 97.06  ?  944  PHE A CZ    1 
ATOM   6671  N  N     . VAL A 1  945  ? 158.324 201.606 168.075 1.00 101.76 ?  945  VAL A N     1 
ATOM   6672  C  CA    . VAL A 1  945  ? 159.654 201.999 167.614 1.00 101.76 ?  945  VAL A CA    1 
ATOM   6673  C  C     . VAL A 1  945  ? 159.560 202.583 166.202 1.00 101.76 ?  945  VAL A C     1 
ATOM   6674  O  O     . VAL A 1  945  ? 160.433 203.351 165.778 1.00 101.76 ?  945  VAL A O     1 
ATOM   6675  C  CB    . VAL A 1  945  ? 160.634 200.803 167.713 1.00 101.76 ?  945  VAL A CB    1 
ATOM   6676  C  CG1   . VAL A 1  945  ? 160.220 199.657 166.828 1.00 101.76 ?  945  VAL A CG1   1 
ATOM   6677  C  CG2   . VAL A 1  945  ? 162.091 201.198 167.454 1.00 101.76 ?  945  VAL A CG2   1 
ATOM   6678  N  N     . LEU A 1  946  ? 158.482 202.276 165.471 1.00 103.33 ?  946  LEU A N     1 
ATOM   6679  C  CA    . LEU A 1  946  ? 158.224 202.967 164.210 1.00 103.33 ?  946  LEU A CA    1 
ATOM   6680  C  C     . LEU A 1  946  ? 157.895 204.441 164.437 1.00 103.33 ?  946  LEU A C     1 
ATOM   6681  O  O     . LEU A 1  946  ? 158.555 205.324 163.880 1.00 103.33 ?  946  LEU A O     1 
ATOM   6682  C  CB    . LEU A 1  946  ? 157.089 202.278 163.457 1.00 103.33 ?  946  LEU A CB    1 
ATOM   6683  C  CG    . LEU A 1  946  ? 156.822 202.683 162.009 1.00 103.33 ?  946  LEU A CG    1 
ATOM   6684  C  CD1   . LEU A 1  946  ? 156.514 201.439 161.238 1.00 103.33 ?  946  LEU A CD1   1 
ATOM   6685  C  CD2   . LEU A 1  946  ? 155.653 203.652 161.898 1.00 103.33 ?  946  LEU A CD2   1 
ATOM   6686  N  N     . GLU A 1  947  ? 156.866 204.726 165.244 1.00 109.63 ?  947  GLU A N     1 
ATOM   6687  C  CA    . GLU A 1  947  ? 156.438 206.115 165.399 1.00 109.63 ?  947  GLU A CA    1 
ATOM   6688  C  C     . GLU A 1  947  ? 157.374 206.935 166.284 1.00 109.63 ?  947  GLU A C     1 
ATOM   6689  O  O     . GLU A 1  947  ? 157.340 208.169 166.218 1.00 109.63 ?  947  GLU A O     1 
ATOM   6690  C  CB    . GLU A 1  947  ? 155.012 206.212 165.963 1.00 109.63 ?  947  GLU A CB    1 
ATOM   6691  C  CG    . GLU A 1  947  ? 153.986 205.218 165.427 1.00 109.63 ?  947  GLU A CG    1 
ATOM   6692  C  CD    . GLU A 1  947  ? 153.453 205.542 164.043 1.00 109.63 ?  947  GLU A CD    1 
ATOM   6693  O  OE1   . GLU A 1  947  ? 153.843 206.570 163.453 1.00 109.63 ?  947  GLU A OE1   1 
ATOM   6694  O  OE2   . GLU A 1  947  ? 152.628 204.750 163.546 1.00 109.63 -1 947  GLU A OE2   1 
ATOM   6695  N  N     . HIS A 1  948  ? 158.208 206.300 167.112 1.00 113.77 ?  948  HIS A N     1 
ATOM   6696  C  CA    . HIS A 1  948  ? 159.057 207.050 168.029 1.00 113.77 ?  948  HIS A CA    1 
ATOM   6697  C  C     . HIS A 1  948  ? 160.549 206.944 167.729 1.00 113.77 ?  948  HIS A C     1 
ATOM   6698  O  O     . HIS A 1  948  ? 161.338 207.626 168.395 1.00 113.77 ?  948  HIS A O     1 
ATOM   6699  C  CB    . HIS A 1  948  ? 158.783 206.628 169.478 1.00 113.77 ?  948  HIS A CB    1 
ATOM   6700  C  CG    . HIS A 1  948  ? 157.543 207.238 170.054 1.00 113.77 ?  948  HIS A CG    1 
ATOM   6701  N  ND1   . HIS A 1  948  ? 157.394 207.498 171.400 1.00 113.77 ?  948  HIS A ND1   1 
ATOM   6702  C  CD2   . HIS A 1  948  ? 156.388 207.633 169.467 1.00 113.77 ?  948  HIS A CD2   1 
ATOM   6703  C  CE1   . HIS A 1  948  ? 156.207 208.037 171.614 1.00 113.77 ?  948  HIS A CE1   1 
ATOM   6704  N  NE2   . HIS A 1  948  ? 155.574 208.124 170.458 1.00 113.77 ?  948  HIS A NE2   1 
ATOM   6705  N  N     . SER A 1  949  ? 160.948 206.110 166.759 1.00 117.83 ?  949  SER A N     1 
ATOM   6706  C  CA    . SER A 1  949  ? 162.284 206.090 166.143 1.00 117.83 ?  949  SER A CA    1 
ATOM   6707  C  C     . SER A 1  949  ? 163.393 205.809 167.167 1.00 117.83 ?  949  SER A C     1 
ATOM   6708  O  O     . SER A 1  949  ? 164.257 206.643 167.445 1.00 117.83 ?  949  SER A O     1 
ATOM   6709  C  CB    . SER A 1  949  ? 162.551 207.397 165.387 1.00 117.83 ?  949  SER A CB    1 
ATOM   6710  O  OG    . SER A 1  949  ? 161.431 207.772 164.607 1.00 117.83 ?  949  SER A OG    1 
ATOM   6711  N  N     . LEU A 1  950  ? 163.339 204.602 167.729 1.00 112.47 ?  950  LEU A N     1 
ATOM   6712  C  CA    . LEU A 1  950  ? 164.409 204.207 168.639 1.00 112.47 ?  950  LEU A CA    1 
ATOM   6713  C  C     . LEU A 1  950  ? 165.453 203.370 167.901 1.00 112.47 ?  950  LEU A C     1 
ATOM   6714  O  O     . LEU A 1  950  ? 165.108 202.624 166.978 1.00 112.47 ?  950  LEU A O     1 
ATOM   6715  C  CB    . LEU A 1  950  ? 163.846 203.408 169.818 1.00 112.47 ?  950  LEU A CB    1 
ATOM   6716  C  CG    . LEU A 1  950  ? 162.484 203.843 170.370 1.00 112.47 ?  950  LEU A CG    1 
ATOM   6717  C  CD1   . LEU A 1  950  ? 161.953 202.819 171.364 1.00 112.47 ?  950  LEU A CD1   1 
ATOM   6718  C  CD2   . LEU A 1  950  ? 162.571 205.217 171.018 1.00 112.47 ?  950  LEU A CD2   1 
ATOM   6719  N  N     . PRO A 1  951  ? 166.734 203.471 168.258 1.00 99.74  ?  951  PRO A N     1 
ATOM   6720  C  CA    . PRO A 1  951  ? 167.777 202.730 167.536 1.00 99.74  ?  951  PRO A CA    1 
ATOM   6721  C  C     . PRO A 1  951  ? 167.740 201.236 167.839 1.00 99.74  ?  951  PRO A C     1 
ATOM   6722  O  O     . PRO A 1  951  ? 166.996 200.759 168.692 1.00 99.74  ?  951  PRO A O     1 
ATOM   6723  C  CB    . PRO A 1  951  ? 169.083 203.360 168.043 1.00 99.74  ?  951  PRO A CB    1 
ATOM   6724  C  CG    . PRO A 1  951  ? 168.679 204.662 168.663 1.00 99.74  ?  951  PRO A CG    1 
ATOM   6725  C  CD    . PRO A 1  951  ? 167.315 204.423 169.221 1.00 99.74  ?  951  PRO A CD    1 
ATOM   6726  N  N     . ILE A 1  952  ? 168.567 200.494 167.107 1.00 67.86  ?  952  ILE A N     1 
ATOM   6727  C  CA    . ILE A 1  952  ? 168.585 199.037 167.153 1.00 67.86  ?  952  ILE A CA    1 
ATOM   6728  C  C     . ILE A 1  952  ? 169.951 198.584 167.657 1.00 67.86  ?  952  ILE A C     1 
ATOM   6729  O  O     . ILE A 1  952  ? 170.973 199.203 167.349 1.00 67.86  ?  952  ILE A O     1 
ATOM   6730  C  CB    . ILE A 1  952  ? 168.266 198.431 165.769 1.00 67.86  ?  952  ILE A CB    1 
ATOM   6731  C  CG1   . ILE A 1  952  ? 166.998 199.061 165.199 1.00 67.86  ?  952  ILE A CG1   1 
ATOM   6732  C  CG2   . ILE A 1  952  ? 168.050 196.929 165.845 1.00 67.86  ?  952  ILE A CG2   1 
ATOM   6733  C  CD1   . ILE A 1  952  ? 165.767 198.836 166.047 1.00 67.86  ?  952  ILE A CD1   1 
ATOM   6734  N  N     . ASP A 1  953  ? 169.958 197.514 168.448 1.00 45.14  ?  953  ASP A N     1 
ATOM   6735  C  CA    . ASP A 1  953  ? 171.169 196.946 169.028 1.00 45.14  ?  953  ASP A CA    1 
ATOM   6736  C  C     . ASP A 1  953  ? 171.778 195.976 168.031 1.00 45.14  ?  953  ASP A C     1 
ATOM   6737  O  O     . ASP A 1  953  ? 171.467 194.788 168.043 1.00 45.14  ?  953  ASP A O     1 
ATOM   6738  C  CB    . ASP A 1  953  ? 170.832 196.252 170.338 1.00 45.14  ?  953  ASP A CB    1 
ATOM   6739  C  CG    . ASP A 1  953  ? 172.046 195.973 171.193 1.00 45.14  ?  953  ASP A CG    1 
ATOM   6740  O  OD1   . ASP A 1  953  ? 173.185 196.245 170.767 1.00 45.14  ?  953  ASP A OD1   1 
ATOM   6741  O  OD2   . ASP A 1  953  ? 171.857 195.459 172.311 1.00 45.14  -1 953  ASP A OD2   1 
ATOM   6742  N  N     . THR A 1  954  ? 172.672 196.470 167.174 1.00 36.28  ?  954  THR A N     1 
ATOM   6743  C  CA    . THR A 1  954  ? 173.289 195.619 166.163 1.00 36.28  ?  954  THR A CA    1 
ATOM   6744  C  C     . THR A 1  954  ? 174.250 194.590 166.746 1.00 36.28  ?  954  THR A C     1 
ATOM   6745  O  O     . THR A 1  954  ? 174.493 193.556 166.111 1.00 36.28  ?  954  THR A O     1 
ATOM   6746  C  CB    . THR A 1  954  ? 174.019 196.479 165.133 1.00 36.28  ?  954  THR A CB    1 
ATOM   6747  O  OG1   . THR A 1  954  ? 174.735 197.519 165.805 1.00 36.28  ?  954  THR A OG1   1 
ATOM   6748  C  CG2   . THR A 1  954  ? 173.031 197.105 164.178 1.00 36.28  ?  954  THR A CG2   1 
ATOM   6749  N  N     . GLN A 1  955  ? 174.770 194.821 167.951 1.00 33.25  ?  955  GLN A N     1 
ATOM   6750  C  CA    . GLN A 1  955  ? 175.669 193.846 168.558 1.00 33.25  ?  955  GLN A CA    1 
ATOM   6751  C  C     . GLN A 1  955  ? 174.909 192.685 169.184 1.00 33.25  ?  955  GLN A C     1 
ATOM   6752  O  O     . GLN A 1  955  ? 175.408 191.549 169.180 1.00 33.25  ?  955  GLN A O     1 
ATOM   6753  C  CB    . GLN A 1  955  ? 176.552 194.528 169.600 1.00 33.25  ?  955  GLN A CB    1 
ATOM   6754  C  CG    . GLN A 1  955  ? 177.912 193.886 169.742 1.00 33.25  ?  955  GLN A CG    1 
ATOM   6755  C  CD    . GLN A 1  955  ? 178.655 193.822 168.424 1.00 33.25  ?  955  GLN A CD    1 
ATOM   6756  O  OE1   . GLN A 1  955  ? 178.806 194.829 167.733 1.00 33.25  ?  955  GLN A OE1   1 
ATOM   6757  N  NE2   . GLN A 1  955  ? 179.119 192.629 168.064 1.00 33.25  ?  955  GLN A NE2   1 
ATOM   6758  N  N     . TYR A 1  956  ? 173.710 192.962 169.711 1.00 30.71  ?  956  TYR A N     1 
ATOM   6759  C  CA    . TYR A 1  956  ? 172.802 191.917 170.170 1.00 30.71  ?  956  TYR A CA    1 
ATOM   6760  C  C     . TYR A 1  956  ? 172.440 190.975 169.030 1.00 30.71  ?  956  TYR A C     1 
ATOM   6761  O  O     . TYR A 1  956  ? 172.594 189.754 169.144 1.00 30.71  ?  956  TYR A O     1 
ATOM   6762  C  CB    . TYR A 1  956  ? 171.547 192.564 170.759 1.00 30.71  ?  956  TYR A CB    1 
ATOM   6763  C  CG    . TYR A 1  956  ? 170.469 191.597 171.167 1.00 30.71  ?  956  TYR A CG    1 
ATOM   6764  C  CD1   . TYR A 1  956  ? 170.602 190.817 172.309 1.00 30.71  ?  956  TYR A CD1   1 
ATOM   6765  C  CD2   . TYR A 1  956  ? 169.318 191.461 170.410 1.00 30.71  ?  956  TYR A CD2   1 
ATOM   6766  C  CE1   . TYR A 1  956  ? 169.622 189.922 172.678 1.00 30.71  ?  956  TYR A CE1   1 
ATOM   6767  C  CE2   . TYR A 1  956  ? 168.341 190.572 170.765 1.00 30.71  ?  956  TYR A CE2   1 
ATOM   6768  C  CZ    . TYR A 1  956  ? 168.495 189.805 171.900 1.00 30.71  ?  956  TYR A CZ    1 
ATOM   6769  O  OH    . TYR A 1  956  ? 167.508 188.918 172.255 1.00 30.71  ?  956  TYR A OH    1 
ATOM   6770  N  N     . TYR A 1  957  ? 172.005 191.539 167.903 1.00 23.79  ?  957  TYR A N     1 
ATOM   6771  C  CA    . TYR A 1  957  ? 171.654 190.744 166.737 1.00 23.79  ?  957  TYR A CA    1 
ATOM   6772  C  C     . TYR A 1  957  ? 172.868 190.061 166.127 1.00 23.79  ?  957  TYR A C     1 
ATOM   6773  O  O     . TYR A 1  957  ? 172.733 188.991 165.528 1.00 23.79  ?  957  TYR A O     1 
ATOM   6774  C  CB    . TYR A 1  957  ? 170.964 191.623 165.698 1.00 23.79  ?  957  TYR A CB    1 
ATOM   6775  C  CG    . TYR A 1  957  ? 169.524 191.941 166.013 1.00 23.79  ?  957  TYR A CG    1 
ATOM   6776  C  CD1   . TYR A 1  957  ? 168.523 191.027 165.753 1.00 23.79  ?  957  TYR A CD1   1 
ATOM   6777  C  CD2   . TYR A 1  957  ? 169.167 193.158 166.551 1.00 23.79  ?  957  TYR A CD2   1 
ATOM   6778  C  CE1   . TYR A 1  957  ? 167.214 191.312 166.036 1.00 23.79  ?  957  TYR A CE1   1 
ATOM   6779  C  CE2   . TYR A 1  957  ? 167.862 193.448 166.842 1.00 23.79  ?  957  TYR A CE2   1 
ATOM   6780  C  CZ    . TYR A 1  957  ? 166.893 192.526 166.574 1.00 23.79  ?  957  TYR A CZ    1 
ATOM   6781  O  OH    . TYR A 1  957  ? 165.595 192.812 166.862 1.00 23.79  ?  957  TYR A OH    1 
ATOM   6782  N  N     . LEU A 1  958  ? 174.062 190.642 166.284 1.00 28.71  ?  958  LEU A N     1 
ATOM   6783  C  CA    . LEU A 1  958  ? 175.241 190.019 165.695 1.00 28.71  ?  958  LEU A CA    1 
ATOM   6784  C  C     . LEU A 1  958  ? 175.735 188.830 166.510 1.00 28.71  ?  958  LEU A C     1 
ATOM   6785  O  O     . LEU A 1  958  ? 176.024 187.774 165.938 1.00 28.71  ?  958  LEU A O     1 
ATOM   6786  C  CB    . LEU A 1  958  ? 176.358 191.046 165.528 1.00 28.71  ?  958  LEU A CB    1 
ATOM   6787  C  CG    . LEU A 1  958  ? 177.660 190.557 164.882 1.00 28.71  ?  958  LEU A CG    1 
ATOM   6788  C  CD1   . LEU A 1  958  ? 177.431 189.735 163.615 1.00 28.71  ?  958  LEU A CD1   1 
ATOM   6789  C  CD2   . LEU A 1  958  ? 178.543 191.731 164.582 1.00 28.71  ?  958  LEU A CD2   1 
ATOM   6790  N  N     . GLU A 1  959  ? 175.853 188.961 167.833 1.00 29.79  ?  959  GLU A N     1 
ATOM   6791  C  CA    . GLU A 1  959  ? 176.446 187.863 168.588 1.00 29.79  ?  959  GLU A CA    1 
ATOM   6792  C  C     . GLU A 1  959  ? 175.433 186.905 169.205 1.00 29.79  ?  959  GLU A C     1 
ATOM   6793  O  O     . GLU A 1  959  ? 175.804 185.766 169.512 1.00 29.79  ?  959  GLU A O     1 
ATOM   6794  C  CB    . GLU A 1  959  ? 177.377 188.401 169.679 1.00 29.79  ?  959  GLU A CB    1 
ATOM   6795  C  CG    . GLU A 1  959  ? 176.693 188.961 170.893 1.00 29.79  ?  959  GLU A CG    1 
ATOM   6796  C  CD    . GLU A 1  959  ? 177.623 189.815 171.728 1.00 29.79  ?  959  GLU A CD    1 
ATOM   6797  O  OE1   . GLU A 1  959  ? 178.503 190.483 171.145 1.00 29.79  ?  959  GLU A OE1   1 
ATOM   6798  O  OE2   . GLU A 1  959  ? 177.474 189.824 172.968 1.00 29.79  -1 959  GLU A OE2   1 
ATOM   6799  N  N     . GLN A 1  960  ? 174.169 187.303 169.363 1.00 27.31  ?  960  GLN A N     1 
ATOM   6800  C  CA    . GLN A 1  960  ? 173.179 186.467 170.030 1.00 27.31  ?  960  GLN A CA    1 
ATOM   6801  C  C     . GLN A 1  960  ? 172.181 185.818 169.077 1.00 27.31  ?  960  GLN A C     1 
ATOM   6802  O  O     . GLN A 1  960  ? 171.803 184.665 169.296 1.00 27.31  ?  960  GLN A O     1 
ATOM   6803  C  CB    . GLN A 1  960  ? 172.460 187.282 171.105 1.00 27.31  ?  960  GLN A CB    1 
ATOM   6804  C  CG    . GLN A 1  960  ? 173.303 187.375 172.365 1.00 27.31  ?  960  GLN A CG    1 
ATOM   6805  C  CD    . GLN A 1  960  ? 172.742 188.300 173.404 1.00 27.31  ?  960  GLN A CD    1 
ATOM   6806  O  OE1   . GLN A 1  960  ? 173.176 189.440 173.524 1.00 27.31  ?  960  GLN A OE1   1 
ATOM   6807  N  NE2   . GLN A 1  960  ? 171.790 187.813 174.185 1.00 27.31  ?  960  GLN A NE2   1 
ATOM   6808  N  N     . GLN A 1  961  ? 171.757 186.506 168.027 1.00 23.53  ?  961  GLN A N     1 
ATOM   6809  C  CA    . GLN A 1  961  ? 170.870 185.880 167.052 1.00 23.53  ?  961  GLN A CA    1 
ATOM   6810  C  C     . GLN A 1  961  ? 171.621 185.130 165.962 1.00 23.53  ?  961  GLN A C     1 
ATOM   6811  O  O     . GLN A 1  961  ? 171.385 183.938 165.777 1.00 23.53  ?  961  GLN A O     1 
ATOM   6812  C  CB    . GLN A 1  961  ? 169.954 186.918 166.387 1.00 23.53  ?  961  GLN A CB    1 
ATOM   6813  C  CG    . GLN A 1  961  ? 169.219 187.905 167.299 1.00 23.53  ?  961  GLN A CG    1 
ATOM   6814  C  CD    . GLN A 1  961  ? 168.110 187.304 168.131 1.00 23.53  ?  961  GLN A CD    1 
ATOM   6815  O  OE1   . GLN A 1  961  ? 168.108 187.422 169.353 1.00 23.53  ?  961  GLN A OE1   1 
ATOM   6816  N  NE2   . GLN A 1  961  ? 167.158 186.661 167.476 1.00 23.53  ?  961  GLN A NE2   1 
ATOM   6817  N  N     . LEU A 1  962  ? 172.542 185.783 165.257 1.00 26.46  ?  962  LEU A N     1 
ATOM   6818  C  CA    . LEU A 1  962  ? 173.149 185.227 164.050 1.00 26.46  ?  962  LEU A CA    1 
ATOM   6819  C  C     . LEU A 1  962  ? 174.237 184.200 164.289 1.00 26.46  ?  962  LEU A C     1 
ATOM   6820  O  O     . LEU A 1  962  ? 174.252 183.173 163.605 1.00 26.46  ?  962  LEU A O     1 
ATOM   6821  C  CB    . LEU A 1  962  ? 173.772 186.324 163.187 1.00 26.46  ?  962  LEU A CB    1 
ATOM   6822  C  CG    . LEU A 1  962  ? 172.910 187.166 162.275 1.00 26.46  ?  962  LEU A CG    1 
ATOM   6823  C  CD1   . LEU A 1  962  ? 173.809 188.147 161.602 1.00 26.46  ?  962  LEU A CD1   1 
ATOM   6824  C  CD2   . LEU A 1  962  ? 172.268 186.268 161.257 1.00 26.46  ?  962  LEU A CD2   1 
ATOM   6825  N  N     . ALA A 1  963  ? 175.154 184.473 165.224 1.00 31.09  ?  963  ALA A N     1 
ATOM   6826  C  CA    . ALA A 1  963  ? 176.499 183.906 165.156 1.00 31.09  ?  963  ALA A CA    1 
ATOM   6827  C  C     . ALA A 1  963  ? 176.516 182.409 165.428 1.00 31.09  ?  963  ALA A C     1 
ATOM   6828  O  O     . ALA A 1  963  ? 177.122 181.642 164.667 1.00 31.09  ?  963  ALA A O     1 
ATOM   6829  C  CB    . ALA A 1  963  ? 177.409 184.635 166.139 1.00 31.09  ?  963  ALA A CB    1 
ATOM   6830  N  N     . LYS A 1  964  ? 175.852 181.974 166.482 1.00 36.14  ?  964  LYS A N     1 
ATOM   6831  C  CA    . LYS A 1  964  ? 175.901 180.560 166.837 1.00 36.14  ?  964  LYS A CA    1 
ATOM   6832  C  C     . LYS A 1  964  ? 175.186 179.580 165.895 1.00 36.14  ?  964  LYS A C     1 
ATOM   6833  O  O     . LYS A 1  964  ? 175.738 178.492 165.708 1.00 36.14  ?  964  LYS A O     1 
ATOM   6834  C  CB    . LYS A 1  964  ? 175.463 180.387 168.292 1.00 36.14  ?  964  LYS A CB    1 
ATOM   6835  C  CG    . LYS A 1  964  ? 174.413 181.358 168.814 1.00 36.14  ?  964  LYS A CG    1 
ATOM   6836  C  CD    . LYS A 1  964  ? 174.138 181.112 170.276 1.00 36.14  ?  964  LYS A CD    1 
ATOM   6837  C  CE    . LYS A 1  964  ? 175.295 181.540 171.163 1.00 36.14  ?  964  LYS A CE    1 
ATOM   6838  N  NZ    . LYS A 1  964  ? 175.394 183.023 171.301 1.00 36.14  1  964  LYS A NZ    1 
ATOM   6839  N  N     . PRO A 1  965  ? 174.033 179.877 165.255 1.00 34.12  ?  965  PRO A N     1 
ATOM   6840  C  CA    . PRO A 1  965  ? 173.558 178.966 164.186 1.00 34.12  ?  965  PRO A CA    1 
ATOM   6841  C  C     . PRO A 1  965  ? 174.528 178.796 163.027 1.00 34.12  ?  965  PRO A C     1 
ATOM   6842  O  O     . PRO A 1  965  ? 174.681 177.682 162.490 1.00 34.12  ?  965  PRO A O     1 
ATOM   6843  C  CB    . PRO A 1  965  ? 172.259 179.631 163.731 1.00 34.12  ?  965  PRO A CB    1 
ATOM   6844  C  CG    . PRO A 1  965  ? 171.772 180.312 164.897 1.00 34.12  ?  965  PRO A CG    1 
ATOM   6845  C  CD    . PRO A 1  965  ? 172.968 180.847 165.584 1.00 34.12  ?  965  PRO A CD    1 
ATOM   6846  N  N     . LEU A 1  966  ? 175.205 179.878 162.641 1.00 36.24  ?  966  LEU A N     1 
ATOM   6847  C  CA    . LEU A 1  966  ? 176.233 179.802 161.610 1.00 36.24  ?  966  LEU A CA    1 
ATOM   6848  C  C     . LEU A 1  966  ? 177.397 178.927 162.048 1.00 36.24  ?  966  LEU A C     1 
ATOM   6849  O  O     . LEU A 1  966  ? 177.944 178.171 161.241 1.00 36.24  ?  966  LEU A O     1 
ATOM   6850  C  CB    . LEU A 1  966  ? 176.724 181.200 161.276 1.00 36.24  ?  966  LEU A CB    1 
ATOM   6851  C  CG    . LEU A 1  966  ? 175.727 182.092 160.558 1.00 36.24  ?  966  LEU A CG    1 
ATOM   6852  C  CD1   . LEU A 1  966  ? 176.360 183.440 160.318 1.00 36.24  ?  966  LEU A CD1   1 
ATOM   6853  C  CD2   . LEU A 1  966  ? 175.312 181.440 159.258 1.00 36.24  ?  966  LEU A CD2   1 
ATOM   6854  N  N     . LEU A 1  967  ? 177.798 179.018 163.317 1.00 38.33  ?  967  LEU A N     1 
ATOM   6855  C  CA    . LEU A 1  967  ? 178.860 178.134 163.793 1.00 38.33  ?  967  LEU A CA    1 
ATOM   6856  C  C     . LEU A 1  967  ? 178.395 176.685 163.929 1.00 38.33  ?  967  LEU A C     1 
ATOM   6857  O  O     . LEU A 1  967  ? 179.232 175.777 163.922 1.00 38.33  ?  967  LEU A O     1 
ATOM   6858  C  CB    . LEU A 1  967  ? 179.421 178.634 165.120 1.00 38.33  ?  967  LEU A CB    1 
ATOM   6859  C  CG    . LEU A 1  967  ? 180.006 180.045 165.130 1.00 38.33  ?  967  LEU A CG    1 
ATOM   6860  C  CD1   . LEU A 1  967  ? 180.265 180.501 166.554 1.00 38.33  ?  967  LEU A CD1   1 
ATOM   6861  C  CD2   . LEU A 1  967  ? 181.268 180.127 164.292 1.00 38.33  ?  967  LEU A CD2   1 
ATOM   6862  N  N     . ARG A 1  968  ? 177.087 176.439 164.079 1.00 37.37  ?  968  ARG A N     1 
ATOM   6863  C  CA    . ARG A 1  968  ? 176.598 175.066 163.918 1.00 37.37  ?  968  ARG A CA    1 
ATOM   6864  C  C     . ARG A 1  968  ? 176.807 174.565 162.499 1.00 37.37  ?  968  ARG A C     1 
ATOM   6865  O  O     . ARG A 1  968  ? 177.343 173.472 162.294 1.00 37.37  ?  968  ARG A O     1 
ATOM   6866  C  CB    . ARG A 1  968  ? 175.111 174.935 164.254 1.00 37.37  ?  968  ARG A CB    1 
ATOM   6867  C  CG    . ARG A 1  968  ? 174.715 174.520 165.648 1.00 37.37  ?  968  ARG A CG    1 
ATOM   6868  C  CD    . ARG A 1  968  ? 174.992 175.593 166.590 1.00 37.37  ?  968  ARG A CD    1 
ATOM   6869  N  NE    . ARG A 1  968  ? 174.414 175.382 167.891 1.00 37.37  ?  968  ARG A NE    1 
ATOM   6870  C  CZ    . ARG A 1  968  ? 173.199 175.795 168.203 1.00 37.37  ?  968  ARG A CZ    1 
ATOM   6871  N  NH1   . ARG A 1  968  ? 172.458 176.425 167.301 1.00 37.37  1  968  ARG A NH1   1 
ATOM   6872  N  NH2   . ARG A 1  968  ? 172.739 175.580 169.412 1.00 37.37  ?  968  ARG A NH2   1 
ATOM   6873  N  N     . ILE A 1  969  ? 176.380 175.348 161.513 1.00 40.01  ?  969  ILE A N     1 
ATOM   6874  C  CA    . ILE A 1  969  ? 176.309 174.849 160.142 1.00 40.01  ?  969  ILE A CA    1 
ATOM   6875  C  C     . ILE A 1  969  ? 177.681 174.781 159.481 1.00 40.01  ?  969  ILE A C     1 
ATOM   6876  O  O     . ILE A 1  969  ? 178.002 173.800 158.805 1.00 40.01  ?  969  ILE A O     1 
ATOM   6877  C  CB    . ILE A 1  969  ? 175.337 175.723 159.329 1.00 40.01  ?  969  ILE A CB    1 
ATOM   6878  C  CG1   . ILE A 1  969  ? 173.920 175.574 159.869 1.00 40.01  ?  969  ILE A CG1   1 
ATOM   6879  C  CG2   . ILE A 1  969  ? 175.365 175.359 157.847 1.00 40.01  ?  969  ILE A CG2   1 
ATOM   6880  C  CD1   . ILE A 1  969  ? 172.958 176.491 159.215 1.00 40.01  ?  969  ILE A CD1   1 
ATOM   6881  N  N     . PHE A 1  970  ? 178.521 175.795 159.659 1.00 44.77  ?  970  PHE A N     1 
ATOM   6882  C  CA    . PHE A 1  970  ? 179.687 175.938 158.796 1.00 44.77  ?  970  PHE A CA    1 
ATOM   6883  C  C     . PHE A 1  970  ? 180.899 175.152 159.264 1.00 44.77  ?  970  PHE A C     1 
ATOM   6884  O  O     . PHE A 1  970  ? 181.799 174.892 158.462 1.00 44.77  ?  970  PHE A O     1 
ATOM   6885  C  CB    . PHE A 1  970  ? 180.036 177.415 158.657 1.00 44.77  ?  970  PHE A CB    1 
ATOM   6886  C  CG    . PHE A 1  970  ? 179.366 178.060 157.500 1.00 44.77  ?  970  PHE A CG    1 
ATOM   6887  C  CD1   . PHE A 1  970  ? 179.663 177.657 156.211 1.00 44.77  ?  970  PHE A CD1   1 
ATOM   6888  C  CD2   . PHE A 1  970  ? 178.417 179.034 157.695 1.00 44.77  ?  970  PHE A CD2   1 
ATOM   6889  C  CE1   . PHE A 1  970  ? 179.043 178.234 155.141 1.00 44.77  ?  970  PHE A CE1   1 
ATOM   6890  C  CE2   . PHE A 1  970  ? 177.786 179.622 156.622 1.00 44.77  ?  970  PHE A CE2   1 
ATOM   6891  C  CZ    . PHE A 1  970  ? 178.100 179.223 155.345 1.00 44.77  ?  970  PHE A CZ    1 
ATOM   6892  N  N     . GLU A 1  971  ? 180.934 174.757 160.529 1.00 54.72  ?  971  GLU A N     1 
ATOM   6893  C  CA    . GLU A 1  971  ? 182.066 173.983 161.032 1.00 54.72  ?  971  GLU A CA    1 
ATOM   6894  C  C     . GLU A 1  971  ? 182.250 172.573 160.458 1.00 54.72  ?  971  GLU A C     1 
ATOM   6895  O  O     . GLU A 1  971  ? 183.403 172.252 160.132 1.00 54.72  ?  971  GLU A O     1 
ATOM   6896  C  CB    . GLU A 1  971  ? 182.003 173.925 162.563 1.00 54.72  ?  971  GLU A CB    1 
ATOM   6897  C  CG    . GLU A 1  971  ? 182.371 175.229 163.226 1.00 54.72  ?  971  GLU A CG    1 
ATOM   6898  C  CD    . GLU A 1  971  ? 182.594 175.066 164.707 1.00 54.72  ?  971  GLU A CD    1 
ATOM   6899  O  OE1   . GLU A 1  971  ? 182.925 173.939 165.123 1.00 54.72  ?  971  GLU A OE1   1 
ATOM   6900  O  OE2   . GLU A 1  971  ? 182.446 176.059 165.453 1.00 54.72  -1 971  GLU A OE2   1 
ATOM   6901  N  N     . PRO A 1  972  ? 181.232 171.686 160.328 1.00 53.17  ?  972  PRO A N     1 
ATOM   6902  C  CA    . PRO A 1  972  ? 181.546 170.267 160.029 1.00 53.17  ?  972  PRO A CA    1 
ATOM   6903  C  C     . PRO A 1  972  ? 182.179 169.991 158.670 1.00 53.17  ?  972  PRO A C     1 
ATOM   6904  O  O     . PRO A 1  972  ? 182.704 168.892 158.459 1.00 53.17  ?  972  PRO A O     1 
ATOM   6905  C  CB    . PRO A 1  972  ? 180.177 169.584 160.122 1.00 53.17  ?  972  PRO A CB    1 
ATOM   6906  C  CG    . PRO A 1  972  ? 179.393 170.429 160.969 1.00 53.17  ?  972  PRO A CG    1 
ATOM   6907  C  CD    . PRO A 1  972  ? 179.787 171.806 160.620 1.00 53.17  ?  972  PRO A CD    1 
ATOM   6908  N  N     . ILE A 1  973  ? 182.141 170.944 157.742 1.00 54.67  ?  973  ILE A N     1 
ATOM   6909  C  CA    . ILE A 1  973  ? 182.767 170.748 156.442 1.00 54.67  ?  973  ILE A CA    1 
ATOM   6910  C  C     . ILE A 1  973  ? 184.272 171.008 156.509 1.00 54.67  ?  973  ILE A C     1 
ATOM   6911  O  O     . ILE A 1  973  ? 185.037 170.486 155.685 1.00 54.67  ?  973  ILE A O     1 
ATOM   6912  C  CB    . ILE A 1  973  ? 182.002 171.637 155.442 1.00 54.67  ?  973  ILE A CB    1 
ATOM   6913  C  CG1   . ILE A 1  973  ? 180.525 171.240 155.458 1.00 54.67  ?  973  ILE A CG1   1 
ATOM   6914  C  CG2   . ILE A 1  973  ? 182.521 171.517 154.026 1.00 54.67  ?  973  ILE A CG2   1 
ATOM   6915  C  CD1   . ILE A 1  973  ? 179.646 172.113 154.648 1.00 54.67  ?  973  ILE A CD1   1 
ATOM   6916  N  N     . LEU A 1  974  ? 184.722 171.745 157.519 1.00 66.77  ?  974  LEU A N     1 
ATOM   6917  C  CA    . LEU A 1  974  ? 186.115 172.165 157.659 1.00 66.77  ?  974  LEU A CA    1 
ATOM   6918  C  C     . LEU A 1  974  ? 186.534 171.939 159.112 1.00 66.77  ?  974  LEU A C     1 
ATOM   6919  O  O     . LEU A 1  974  ? 185.955 171.132 159.850 1.00 66.77  ?  974  LEU A O     1 
ATOM   6920  C  CB    . LEU A 1  974  ? 186.301 173.607 157.171 1.00 66.77  ?  974  LEU A CB    1 
ATOM   6921  C  CG    . LEU A 1  974  ? 186.029 173.913 155.691 1.00 66.77  ?  974  LEU A CG    1 
ATOM   6922  C  CD1   . LEU A 1  974  ? 184.592 174.327 155.379 1.00 66.77  ?  974  LEU A CD1   1 
ATOM   6923  C  CD2   . LEU A 1  974  ? 187.001 174.970 155.196 1.00 66.77  ?  974  LEU A CD2   1 
ATOM   6924  N  N     . GLY A 1  975  ? 187.622 172.567 159.532 1.00 77.83  ?  975  GLY A N     1 
ATOM   6925  C  CA    . GLY A 1  975  ? 188.050 172.399 160.906 1.00 77.83  ?  975  GLY A CA    1 
ATOM   6926  C  C     . GLY A 1  975  ? 187.571 173.489 161.844 1.00 77.83  ?  975  GLY A C     1 
ATOM   6927  O  O     . GLY A 1  975  ? 186.412 173.904 161.786 1.00 77.83  ?  975  GLY A O     1 
ATOM   6928  N  N     . GLU A 1  976  ? 188.456 173.938 162.734 1.00 82.79  ?  976  GLU A N     1 
ATOM   6929  C  CA    . GLU A 1  976  ? 188.236 175.136 163.532 1.00 82.79  ?  976  GLU A CA    1 
ATOM   6930  C  C     . GLU A 1  976  ? 188.879 176.364 162.918 1.00 82.79  ?  976  GLU A C     1 
ATOM   6931  O  O     . GLU A 1  976  ? 188.708 177.470 163.443 1.00 82.79  ?  976  GLU A O     1 
ATOM   6932  C  CB    . GLU A 1  976  ? 188.756 174.939 164.956 1.00 82.79  ?  976  GLU A CB    1 
ATOM   6933  C  CG    . GLU A 1  976  ? 187.741 174.316 165.882 1.00 82.79  ?  976  GLU A CG    1 
ATOM   6934  C  CD    . GLU A 1  976  ? 186.595 175.253 166.176 1.00 82.79  ?  976  GLU A CD    1 
ATOM   6935  O  OE1   . GLU A 1  976  ? 185.465 174.770 166.382 1.00 82.79  ?  976  GLU A OE1   1 
ATOM   6936  O  OE2   . GLU A 1  976  ? 186.828 176.475 166.206 1.00 82.79  -1 976  GLU A OE2   1 
ATOM   6937  N  N     . GLY A 1  977  ? 189.599 176.199 161.809 1.00 71.11  ?  977  GLY A N     1 
ATOM   6938  C  CA    . GLY A 1  977  ? 189.971 177.342 160.998 1.00 71.11  ?  977  GLY A CA    1 
ATOM   6939  C  C     . GLY A 1  977  ? 188.802 177.909 160.223 1.00 71.11  ?  977  GLY A C     1 
ATOM   6940  O  O     . GLY A 1  977  ? 188.914 178.975 159.615 1.00 71.11  ?  977  GLY A O     1 
ATOM   6941  N  N     . ARG A 1  978  ? 187.671 177.206 160.231 1.00 64.03  ?  978  ARG A N     1 
ATOM   6942  C  CA    . ARG A 1  978  ? 186.436 177.700 159.650 1.00 64.03  ?  978  ARG A CA    1 
ATOM   6943  C  C     . ARG A 1  978  ? 185.699 178.640 160.591 1.00 64.03  ?  978  ARG A C     1 
ATOM   6944  O  O     . ARG A 1  978  ? 185.088 179.618 160.136 1.00 64.03  ?  978  ARG A O     1 
ATOM   6945  C  CB    . ARG A 1  978  ? 185.551 176.515 159.285 1.00 64.03  ?  978  ARG A CB    1 
ATOM   6946  C  CG    . ARG A 1  978  ? 184.455 176.862 158.346 1.00 64.03  ?  978  ARG A CG    1 
ATOM   6947  C  CD    . ARG A 1  978  ? 184.991 177.482 157.095 1.00 64.03  ?  978  ARG A CD    1 
ATOM   6948  N  NE    . ARG A 1  978  ? 183.927 177.562 156.120 1.00 64.03  ?  978  ARG A NE    1 
ATOM   6949  C  CZ    . ARG A 1  978  ? 183.439 178.700 155.659 1.00 64.03  ?  978  ARG A CZ    1 
ATOM   6950  N  NH1   . ARG A 1  978  ? 183.944 179.850 156.074 1.00 64.03  1  978  ARG A NH1   1 
ATOM   6951  N  NH2   . ARG A 1  978  ? 182.451 178.680 154.780 1.00 64.03  ?  978  ARG A NH2   1 
ATOM   6952  N  N     . ALA A 1  979  ? 185.743 178.359 161.895 1.00 66.74  ?  979  ALA A N     1 
ATOM   6953  C  CA    . ALA A 1  979  ? 185.298 179.340 162.874 1.00 66.74  ?  979  ALA A CA    1 
ATOM   6954  C  C     . ALA A 1  979  ? 186.117 180.615 162.766 1.00 66.74  ?  979  ALA A C     1 
ATOM   6955  O  O     . ALA A 1  979  ? 185.558 181.710 162.733 1.00 66.74  ?  979  ALA A O     1 
ATOM   6956  C  CB    . ALA A 1  979  ? 185.390 178.763 164.283 1.00 66.74  ?  979  ALA A CB    1 
ATOM   6957  N  N     . GLU A 1  980  ? 187.439 180.486 162.626 1.00 70.73  ?  980  GLU A N     1 
ATOM   6958  C  CA    . GLU A 1  980  ? 188.282 181.646 162.377 1.00 70.73  ?  980  GLU A CA    1 
ATOM   6959  C  C     . GLU A 1  980  ? 188.068 182.259 161.000 1.00 70.73  ?  980  GLU A C     1 
ATOM   6960  O  O     . GLU A 1  980  ? 188.263 183.464 160.851 1.00 70.73  ?  980  GLU A O     1 
ATOM   6961  C  CB    . GLU A 1  980  ? 189.746 181.269 162.552 1.00 70.73  ?  980  GLU A CB    1 
ATOM   6962  C  CG    . GLU A 1  980  ? 190.064 180.730 163.934 1.00 70.73  ?  980  GLU A CG    1 
ATOM   6963  C  CD    . GLU A 1  980  ? 189.653 181.690 165.042 1.00 70.73  ?  980  GLU A CD    1 
ATOM   6964  O  OE1   . GLU A 1  980  ? 188.627 181.435 165.701 1.00 70.73  ?  980  GLU A OE1   1 
ATOM   6965  O  OE2   . GLU A 1  980  ? 190.357 182.700 165.251 1.00 70.73  -1 980  GLU A OE2   1 
ATOM   6966  N  N     . ALA A 1  981  ? 187.620 181.479 160.013 1.00 63.92  ?  981  ALA A N     1 
ATOM   6967  C  CA    . ALA A 1  981  ? 187.374 182.029 158.684 1.00 63.92  ?  981  ALA A CA    1 
ATOM   6968  C  C     . ALA A 1  981  ? 186.129 182.902 158.668 1.00 63.92  ?  981  ALA A C     1 
ATOM   6969  O  O     . ALA A 1  981  ? 186.139 183.989 158.087 1.00 63.92  ?  981  ALA A O     1 
ATOM   6970  C  CB    . ALA A 1  981  ? 187.250 180.904 157.660 1.00 63.92  ?  981  ALA A CB    1 
ATOM   6971  N  N     . VAL A 1  982  ? 185.054 182.464 159.327 1.00 61.53  ?  982  VAL A N     1 
ATOM   6972  C  CA    . VAL A 1  982  ? 183.869 183.317 159.401 1.00 61.53  ?  982  VAL A CA    1 
ATOM   6973  C  C     . VAL A 1  982  ? 184.043 184.425 160.434 1.00 61.53  ?  982  VAL A C     1 
ATOM   6974  O  O     . VAL A 1  982  ? 183.534 185.533 160.231 1.00 61.53  ?  982  VAL A O     1 
ATOM   6975  C  CB    . VAL A 1  982  ? 182.593 182.499 159.682 1.00 61.53  ?  982  VAL A CB    1 
ATOM   6976  C  CG1   . VAL A 1  982  ? 181.337 183.337 159.459 1.00 61.53  ?  982  VAL A CG1   1 
ATOM   6977  C  CG2   . VAL A 1  982  ? 182.535 181.300 158.786 1.00 61.53  ?  982  VAL A CG2   1 
ATOM   6978  N  N     . LEU A 1  983  ? 184.805 184.202 161.502 1.00 65.02  ?  983  LEU A N     1 
ATOM   6979  C  CA    . LEU A 1  983  ? 185.072 185.290 162.429 1.00 65.02  ?  983  LEU A CA    1 
ATOM   6980  C  C     . LEU A 1  983  ? 186.144 186.244 161.915 1.00 65.02  ?  983  LEU A C     1 
ATOM   6981  O  O     . LEU A 1  983  ? 186.317 187.313 162.500 1.00 65.02  ?  983  LEU A O     1 
ATOM   6982  C  CB    . LEU A 1  983  ? 185.483 184.753 163.809 1.00 65.02  ?  983  LEU A CB    1 
ATOM   6983  C  CG    . LEU A 1  983  ? 184.496 183.989 164.707 1.00 65.02  ?  983  LEU A CG    1 
ATOM   6984  C  CD1   . LEU A 1  983  ? 185.200 183.483 165.967 1.00 65.02  ?  983  LEU A CD1   1 
ATOM   6985  C  CD2   . LEU A 1  983  ? 183.219 184.750 165.044 1.00 65.02  ?  983  LEU A CD2   1 
ATOM   6986  N  N     . LEU A 1  984  ? 186.851 185.891 160.840 1.00 69.10  ?  984  LEU A N     1 
ATOM   6987  C  CA    . LEU A 1  984  ? 187.741 186.799 160.129 1.00 69.10  ?  984  LEU A CA    1 
ATOM   6988  C  C     . LEU A 1  984  ? 187.052 187.484 158.961 1.00 69.10  ?  984  LEU A C     1 
ATOM   6989  O  O     . LEU A 1  984  ? 187.428 188.599 158.589 1.00 69.10  ?  984  LEU A O     1 
ATOM   6990  C  CB    . LEU A 1  984  ? 188.960 186.030 159.611 1.00 69.10  ?  984  LEU A CB    1 
ATOM   6991  C  CG    . LEU A 1  984  ? 190.169 186.813 159.095 1.00 69.10  ?  984  LEU A CG    1 
ATOM   6992  C  CD1   . LEU A 1  984  ? 190.951 187.427 160.252 1.00 69.10  ?  984  LEU A CD1   1 
ATOM   6993  C  CD2   . LEU A 1  984  ? 191.059 185.921 158.245 1.00 69.10  ?  984  LEU A CD2   1 
ATOM   6994  N  N     . ARG A 1  985  ? 186.056 186.820 158.379 1.00 63.10  ?  985  ARG A N     1 
ATOM   6995  C  CA    . ARG A 1  985  ? 185.202 187.423 157.372 1.00 63.10  ?  985  ARG A CA    1 
ATOM   6996  C  C     . ARG A 1  985  ? 184.259 188.431 158.002 1.00 63.10  ?  985  ARG A C     1 
ATOM   6997  O  O     . ARG A 1  985  ? 183.841 189.399 157.353 1.00 63.10  ?  985  ARG A O     1 
ATOM   6998  C  CB    . ARG A 1  985  ? 184.407 186.349 156.627 1.00 30.00  ?  985  ARG A CB    1 
ATOM   6999  C  CG    . ARG A 1  985  ? 185.263 185.414 155.788 1.00 30.00  ?  985  ARG A CG    1 
ATOM   7000  C  CD    . ARG A 1  985  ? 184.469 184.392 154.990 1.00 30.00  ?  985  ARG A CD    1 
ATOM   7001  N  NE    . ARG A 1  985  ? 185.335 183.504 154.220 1.00 30.00  ?  985  ARG A NE    1 
ATOM   7002  C  CZ    . ARG A 1  985  ? 185.843 183.804 153.034 1.00 30.00  ?  985  ARG A CZ    1 
ATOM   7003  N  NH1   . ARG A 1  985  ? 185.577 184.977 152.472 1.00 30.00  1  985  ARG A NH1   1 
ATOM   7004  N  NH2   . ARG A 1  985  ? 186.622 182.934 152.404 1.00 30.00  ?  985  ARG A NH2   1 
ATOM   7005  N  N     . GLY A 1  986  ? 183.900 188.204 159.257 1.00 68.49  ?  986  GLY A N     1 
ATOM   7006  C  CA    . GLY A 1  986  ? 183.436 189.261 160.112 1.00 68.49  ?  986  GLY A CA    1 
ATOM   7007  C  C     . GLY A 1  986  ? 184.502 190.318 160.320 1.00 68.49  ?  986  GLY A C     1 
ATOM   7008  O  O     . GLY A 1  986  ? 184.185 191.496 160.199 1.00 68.49  ?  986  GLY A O     1 
ATOM   7009  N  N     . ASP A 1  987  ? 185.761 189.929 160.595 1.00 70.88  ?  987  ASP A N     1 
ATOM   7010  C  CA    . ASP A 1  987  ? 186.785 190.897 161.006 1.00 70.88  ?  987  ASP A CA    1 
ATOM   7011  C  C     . ASP A 1  987  ? 187.167 191.878 159.910 1.00 70.88  ?  987  ASP A C     1 
ATOM   7012  O  O     . ASP A 1  987  ? 187.501 193.025 160.207 1.00 70.88  ?  987  ASP A O     1 
ATOM   7013  C  CB    . ASP A 1  987  ? 188.051 190.198 161.497 1.00 70.88  ?  987  ASP A CB    1 
ATOM   7014  C  CG    . ASP A 1  987  ? 187.974 189.808 162.945 1.00 70.88  ?  987  ASP A CG    1 
ATOM   7015  O  OD1   . ASP A 1  987  ? 187.274 190.508 163.709 1.00 70.88  ?  987  ASP A OD1   1 
ATOM   7016  O  OD2   . ASP A 1  987  ? 188.603 188.799 163.318 1.00 70.88  -1 987  ASP A OD2   1 
ATOM   7017  N  N     . HIS A 1  988  ? 187.145 191.463 158.654 1.00 70.23  ?  988  HIS A N     1 
ATOM   7018  C  CA    . HIS A 1  988  ? 187.366 192.429 157.587 1.00 70.23  ?  988  HIS A CA    1 
ATOM   7019  C  C     . HIS A 1  988  ? 186.146 193.318 157.397 1.00 70.23  ?  988  HIS A C     1 
ATOM   7020  O  O     . HIS A 1  988  ? 186.262 194.428 156.872 1.00 70.23  ?  988  HIS A O     1 
ATOM   7021  C  CB    . HIS A 1  988  ? 187.713 191.694 156.299 1.00 70.23  ?  988  HIS A CB    1 
ATOM   7022  C  CG    . HIS A 1  988  ? 188.822 190.703 156.466 1.00 70.23  ?  988  HIS A CG    1 
ATOM   7023  N  ND1   . HIS A 1  988  ? 189.911 190.940 157.275 1.00 70.23  ?  988  HIS A ND1   1 
ATOM   7024  C  CD2   . HIS A 1  988  ? 189.004 189.467 155.946 1.00 70.23  ?  988  HIS A CD2   1 
ATOM   7025  C  CE1   . HIS A 1  988  ? 190.720 189.897 157.240 1.00 70.23  ?  988  HIS A CE1   1 
ATOM   7026  N  NE2   . HIS A 1  988  ? 190.193 188.990 156.441 1.00 70.23  ?  988  HIS A NE2   1 
ATOM   7027  N  N     . THR A 1  989  ? 184.982 192.856 157.845 1.00 62.61  ?  989  THR A N     1 
ATOM   7028  C  CA    . THR A 1  989  ? 183.715 193.540 157.652 1.00 62.61  ?  989  THR A CA    1 
ATOM   7029  C  C     . THR A 1  989  ? 183.123 194.111 158.936 1.00 62.61  ?  989  THR A C     1 
ATOM   7030  O  O     . THR A 1  989  ? 182.139 194.851 158.863 1.00 62.61  ?  989  THR A O     1 
ATOM   7031  C  CB    . THR A 1  989  ? 182.724 192.584 156.999 1.00 62.61  ?  989  THR A CB    1 
ATOM   7032  O  OG1   . THR A 1  989  ? 182.593 191.409 157.800 1.00 62.61  ?  989  THR A OG1   1 
ATOM   7033  C  CG2   . THR A 1  989  ? 183.214 192.186 155.647 1.00 62.61  ?  989  THR A CG2   1 
ATOM   7034  N  N     . ARG A 1  990  ? 183.692 193.797 160.106 1.00 63.35  ?  990  ARG A N     1 
ATOM   7035  C  CA    . ARG A 1  990  ? 183.264 194.422 161.352 1.00 63.35  ?  990  ARG A CA    1 
ATOM   7036  C  C     . ARG A 1  990  ? 183.799 195.830 161.511 1.00 63.35  ?  990  ARG A C     1 
ATOM   7037  O  O     . ARG A 1  990  ? 183.291 196.578 162.347 1.00 63.35  ?  990  ARG A O     1 
ATOM   7038  C  CB    . ARG A 1  990  ? 183.709 193.603 162.569 1.00 63.35  ?  990  ARG A CB    1 
ATOM   7039  C  CG    . ARG A 1  990  ? 182.805 192.445 162.948 1.00 63.35  ?  990  ARG A CG    1 
ATOM   7040  C  CD    . ARG A 1  990  ? 183.632 191.298 163.517 1.00 63.35  ?  990  ARG A CD    1 
ATOM   7041  N  NE    . ARG A 1  990  ? 182.826 190.111 163.795 1.00 63.35  ?  990  ARG A NE    1 
ATOM   7042  C  CZ    . ARG A 1  990  ? 183.262 188.860 163.684 1.00 63.35  ?  990  ARG A CZ    1 
ATOM   7043  N  NH1   . ARG A 1  990  ? 184.502 188.620 163.298 1.00 63.35  1  990  ARG A NH1   1 
ATOM   7044  N  NH2   . ARG A 1  990  ? 182.452 187.847 163.948 1.00 63.35  ?  990  ARG A NH2   1 
ATOM   7045  N  N     . CYS A 1  991  ? 184.808 196.217 160.735 1.00 57.52  ?  991  CYS A N     1 
ATOM   7046  C  CA    . CYS A 1  991  ? 185.420 197.525 160.880 1.00 57.52  ?  991  CYS A CA    1 
ATOM   7047  C  C     . CYS A 1  991  ? 184.689 198.607 160.104 1.00 57.52  ?  991  CYS A C     1 
ATOM   7048  O  O     . CYS A 1  991  ? 185.167 199.738 160.049 1.00 57.52  ?  991  CYS A O     1 
ATOM   7049  C  CB    . CYS A 1  991  ? 186.886 197.482 160.455 1.00 57.52  ?  991  CYS A CB    1 
ATOM   7050  S  SG    . CYS A 1  991  ? 187.813 196.066 161.038 1.00 57.52  ?  991  CYS A SG    1 
ATOM   7051  N  N     . LYS A 1  992  ? 183.530 198.251 159.543 1.00 50.76  ?  992  LYS A N     1 
ATOM   7052  C  CA    . LYS A 1  992  ? 182.681 199.208 158.783 1.00 50.76  ?  992  LYS A CA    1 
ATOM   7053  C  C     . LYS A 1  992  ? 181.336 199.338 159.508 1.00 50.76  ?  992  LYS A C     1 
ATOM   7054  O  O     . LYS A 1  992  ? 180.459 198.490 159.268 1.00 50.76  ?  992  LYS A O     1 
ATOM   7055  C  CB    . LYS A 1  992  ? 182.472 198.720 157.345 1.00 50.76  ?  992  LYS A CB    1 
ATOM   7056  C  CG    . LYS A 1  992  ? 183.678 198.060 156.691 1.00 50.76  ?  992  LYS A CG    1 
ATOM   7057  C  CD    . LYS A 1  992  ? 183.594 198.031 155.178 1.00 50.76  ?  992  LYS A CD    1 
ATOM   7058  C  CE    . LYS A 1  992  ? 184.176 196.771 154.570 1.00 50.76  ?  992  LYS A CE    1 
ATOM   7059  N  NZ    . LYS A 1  992  ? 183.623 196.502 153.222 1.00 50.76  1  992  LYS A NZ    1 
ATOM   7060  N  N     . THR A 1  993  ? 181.194 200.352 160.366 1.00 48.98  ?  993  THR A N     1 
ATOM   7061  C  CA    . THR A 1  993  ? 179.934 200.555 161.133 1.00 48.98  ?  993  THR A CA    1 
ATOM   7062  C  C     . THR A 1  993  ? 179.378 201.958 160.860 1.00 48.98  ?  993  THR A C     1 
ATOM   7063  O  O     . THR A 1  993  ? 180.180 202.907 160.791 1.00 48.98  ?  993  THR A O     1 
ATOM   7064  C  CB    . THR A 1  993  ? 180.139 200.288 162.631 1.00 48.98  ?  993  THR A CB    1 
ATOM   7065  O  OG1   . THR A 1  993  ? 180.293 201.540 163.301 1.00 48.98  ?  993  THR A OG1   1 
ATOM   7066  C  CG2   . THR A 1  993  ? 181.333 199.405 162.917 1.00 48.98  ?  993  THR A CG2   1 
ATOM   7067  N  N     . VAL A 1  994  ? 178.053 202.070 160.722 1.00 55.04  ?  994  VAL A N     1 
ATOM   7068  C  CA    . VAL A 1  994  ? 177.393 203.384 160.461 1.00 55.04  ?  994  VAL A CA    1 
ATOM   7069  C  C     . VAL A 1  994  ? 176.748 203.871 161.765 1.00 55.04  ?  994  VAL A C     1 
ATOM   7070  O  O     . VAL A 1  994  ? 176.111 203.048 162.451 1.00 55.04  ?  994  VAL A O     1 
ATOM   7071  C  CB    . VAL A 1  994  ? 176.359 203.277 159.325 1.00 55.04  ?  994  VAL A CB    1 
ATOM   7072  C  CG1   . VAL A 1  994  ? 175.473 204.510 159.249 1.00 55.04  ?  994  VAL A CG1   1 
ATOM   7073  C  CG2   . VAL A 1  994  ? 177.022 203.008 157.984 1.00 55.04  ?  994  VAL A CG2   1 
ATOM   7074  N  N     . LEU A 1  995  ? 176.918 205.157 162.086 1.00 68.20  ?  995  LEU A N     1 
ATOM   7075  C  CA    . LEU A 1  995  ? 176.347 205.748 163.326 1.00 68.20  ?  995  LEU A CA    1 
ATOM   7076  C  C     . LEU A 1  995  ? 174.856 205.404 163.414 1.00 68.20  ?  995  LEU A C     1 
ATOM   7077  O  O     . LEU A 1  995  ? 174.488 204.729 164.394 1.00 68.20  ?  995  LEU A O     1 
ATOM   7078  C  CB    . LEU A 1  995  ? 176.562 207.265 163.300 1.00 68.20  ?  995  LEU A CB    1 
ATOM   7079  C  CG    . LEU A 1  995  ? 175.876 208.005 162.153 1.00 68.20  ?  995  LEU A CG    1 
ATOM   7080  C  CD1   . LEU A 1  995  ? 174.404 208.228 162.457 1.00 68.20  ?  995  LEU A CD1   1 
ATOM   7081  C  CD2   . LEU A 1  995  ? 176.569 209.329 161.870 1.00 68.20  ?  995  LEU A CD2   1 
ATOM   7082  N  N     . GLY A 1  1001 ? 166.509 214.370 174.393 1.00 64.85  ?  1001 GLY A N     1 
ATOM   7083  C  CA    . GLY A 1  1001 ? 166.652 215.568 175.194 1.00 64.85  ?  1001 GLY A CA    1 
ATOM   7084  C  C     . GLY A 1  1001 ? 167.764 216.463 174.695 1.00 64.85  ?  1001 GLY A C     1 
ATOM   7085  O  O     . GLY A 1  1001 ? 167.534 217.584 174.242 1.00 64.85  ?  1001 GLY A O     1 
ATOM   7086  N  N     . LEU A 1  1002 ? 168.989 215.949 174.779 1.00 63.55  ?  1002 LEU A N     1 
ATOM   7087  C  CA    . LEU A 1  1002 ? 170.152 216.674 174.284 1.00 63.55  ?  1002 LEU A CA    1 
ATOM   7088  C  C     . LEU A 1  1002 ? 170.200 216.717 172.761 1.00 63.55  ?  1002 LEU A C     1 
ATOM   7089  O  O     . LEU A 1  1002 ? 170.852 217.606 172.201 1.00 63.55  ?  1002 LEU A O     1 
ATOM   7090  C  CB    . LEU A 1  1002 ? 171.414 216.021 174.840 1.00 63.55  ?  1002 LEU A CB    1 
ATOM   7091  C  CG    . LEU A 1  1002 ? 172.780 216.660 174.615 1.00 63.55  ?  1002 LEU A CG    1 
ATOM   7092  C  CD1   . LEU A 1  1002 ? 172.992 217.883 175.485 1.00 63.55  ?  1002 LEU A CD1   1 
ATOM   7093  C  CD2   . LEU A 1  1002 ? 173.809 215.626 174.873 1.00 63.55  ?  1002 LEU A CD2   1 
ATOM   7094  N  N     . LEU A 1  1003 ? 169.494 215.798 172.087 1.00 64.58  ?  1003 LEU A N     1 
ATOM   7095  C  CA    . LEU A 1  1003 ? 169.565 215.647 170.634 1.00 64.58  ?  1003 LEU A CA    1 
ATOM   7096  C  C     . LEU A 1  1003 ? 169.074 216.872 169.880 1.00 64.58  ?  1003 LEU A C     1 
ATOM   7097  O  O     . LEU A 1  1003 ? 169.424 217.040 168.706 1.00 64.58  ?  1003 LEU A O     1 
ATOM   7098  C  CB    . LEU A 1  1003 ? 168.745 214.434 170.192 1.00 64.58  ?  1003 LEU A CB    1 
ATOM   7099  C  CG    . LEU A 1  1003 ? 169.339 213.047 170.426 1.00 64.58  ?  1003 LEU A CG    1 
ATOM   7100  C  CD1   . LEU A 1  1003 ? 168.233 212.000 170.479 1.00 64.58  ?  1003 LEU A CD1   1 
ATOM   7101  C  CD2   . LEU A 1  1003 ? 170.348 212.716 169.341 1.00 64.58  ?  1003 LEU A CD2   1 
ATOM   7102  N  N     . ALA A 1  1004 ? 168.277 217.725 170.523 1.00 72.53  ?  1004 ALA A N     1 
ATOM   7103  C  CA    . ALA A 1  1004 ? 167.764 218.912 169.856 1.00 72.53  ?  1004 ALA A CA    1 
ATOM   7104  C  C     . ALA A 1  1004 ? 168.819 220.006 169.751 1.00 72.53  ?  1004 ALA A C     1 
ATOM   7105  O  O     . ALA A 1  1004 ? 168.782 220.809 168.811 1.00 72.53  ?  1004 ALA A O     1 
ATOM   7106  C  CB    . ALA A 1  1004 ? 166.530 219.428 170.597 1.00 72.53  ?  1004 ALA A CB    1 
ATOM   7107  N  N     . PHE A 1  1005 ? 169.773 220.049 170.686 1.00 73.34  ?  1005 PHE A N     1 
ATOM   7108  C  CA    . PHE A 1  1005 ? 170.765 221.130 170.740 1.00 73.34  ?  1005 PHE A CA    1 
ATOM   7109  C  C     . PHE A 1  1005 ? 171.977 220.791 169.863 1.00 73.34  ?  1005 PHE A C     1 
ATOM   7110  O  O     . PHE A 1  1005 ? 173.126 220.734 170.301 1.00 73.34  ?  1005 PHE A O     1 
ATOM   7111  C  CB    . PHE A 1  1005 ? 171.158 221.407 172.184 1.00 73.34  ?  1005 PHE A CB    1 
ATOM   7112  C  CG    . PHE A 1  1005 ? 170.109 222.154 172.957 1.00 73.34  ?  1005 PHE A CG    1 
ATOM   7113  C  CD1   . PHE A 1  1005 ? 169.242 223.025 172.309 1.00 73.34  ?  1005 PHE A CD1   1 
ATOM   7114  C  CD2   . PHE A 1  1005 ? 169.983 221.985 174.324 1.00 73.34  ?  1005 PHE A CD2   1 
ATOM   7115  C  CE1   . PHE A 1  1005 ? 168.271 223.714 173.013 1.00 73.34  ?  1005 PHE A CE1   1 
ATOM   7116  C  CE2   . PHE A 1  1005 ? 169.012 222.673 175.037 1.00 73.34  ?  1005 PHE A CE2   1 
ATOM   7117  C  CZ    . PHE A 1  1005 ? 168.155 223.534 174.380 1.00 73.34  ?  1005 PHE A CZ    1 
ATOM   7118  N  N     . ALA A 1  1006 ? 171.686 220.597 168.581 1.00 79.93  ?  1006 ALA A N     1 
ATOM   7119  C  CA    . ALA A 1  1006 ? 172.685 220.249 167.586 1.00 79.93  ?  1006 ALA A CA    1 
ATOM   7120  C  C     . ALA A 1  1006 ? 173.513 221.462 167.193 1.00 79.93  ?  1006 ALA A C     1 
ATOM   7121  O  O     . ALA A 1  1006 ? 173.107 222.611 167.403 1.00 79.93  ?  1006 ALA A O     1 
ATOM   7122  C  CB    . ALA A 1  1006 ? 172.014 219.672 166.340 1.00 79.93  ?  1006 ALA A CB    1 
ATOM   7123  N  N     . LYS A 1  1007 ? 174.684 221.198 166.633 1.00 74.28  ?  1007 LYS A N     1 
ATOM   7124  C  CA    . LYS A 1  1007 ? 175.472 222.231 165.984 1.00 74.28  ?  1007 LYS A CA    1 
ATOM   7125  C  C     . LYS A 1  1007 ? 175.572 222.021 164.484 1.00 74.28  ?  1007 LYS A C     1 
ATOM   7126  O  O     . LYS A 1  1007 ? 175.768 222.994 163.749 1.00 74.28  ?  1007 LYS A O     1 
ATOM   7127  C  CB    . LYS A 1  1007 ? 176.878 222.292 166.589 1.00 74.28  ?  1007 LYS A CB    1 
ATOM   7128  N  N     . ARG A 1  1008 ? 175.439 220.765 164.041 1.00 64.86  ?  1008 ARG A N     1 
ATOM   7129  C  CA    . ARG A 1  1008 ? 175.437 220.343 162.638 1.00 64.86  ?  1008 ARG A CA    1 
ATOM   7130  C  C     . ARG A 1  1008 ? 176.725 220.767 161.925 1.00 64.86  ?  1008 ARG A C     1 
ATOM   7131  O  O     . ARG A 1  1008 ? 176.725 221.566 160.988 1.00 64.86  ?  1008 ARG A O     1 
ATOM   7132  C  CB    . ARG A 1  1008 ? 174.193 220.858 161.904 1.00 64.86  ?  1008 ARG A CB    1 
ATOM   7133  N  N     . ARG A 1  1009 ? 177.832 220.212 162.413 1.00 55.04  ?  1009 ARG A N     1 
ATOM   7134  C  CA    . ARG A 1  1009 ? 179.130 220.486 161.817 1.00 55.04  ?  1009 ARG A CA    1 
ATOM   7135  C  C     . ARG A 1  1009 ? 179.235 219.825 160.450 1.00 55.04  ?  1009 ARG A C     1 
ATOM   7136  O  O     . ARG A 1  1009 ? 178.966 218.629 160.305 1.00 55.04  ?  1009 ARG A O     1 
ATOM   7137  C  CB    . ARG A 1  1009 ? 180.251 219.991 162.728 1.00 55.04  ?  1009 ARG A CB    1 
ATOM   7138  N  N     . ASN A 1  1010 ? 179.619 220.608 159.447 1.00 47.01  ?  1010 ASN A N     1 
ATOM   7139  C  CA    . ASN A 1  1010 ? 179.832 220.074 158.113 1.00 47.01  ?  1010 ASN A CA    1 
ATOM   7140  C  C     . ASN A 1  1010 ? 181.143 219.306 158.062 1.00 47.01  ?  1010 ASN A C     1 
ATOM   7141  O  O     . ASN A 1  1010 ? 182.015 219.465 158.914 1.00 47.01  ?  1010 ASN A O     1 
ATOM   7142  C  CB    . ASN A 1  1010 ? 179.846 221.195 157.077 1.00 47.01  ?  1010 ASN A CB    1 
ATOM   7143  C  CG    . ASN A 1  1010 ? 178.484 221.816 156.882 1.00 47.01  ?  1010 ASN A CG    1 
ATOM   7144  O  OD1   . ASN A 1  1010 ? 178.271 222.983 157.198 1.00 47.01  ?  1010 ASN A OD1   1 
ATOM   7145  N  ND2   . ASN A 1  1010 ? 177.548 221.032 156.368 1.00 47.01  ?  1010 ASN A ND2   1 
ATOM   7146  N  N     . CYS A 1  1011 ? 181.282 218.475 157.036 1.00 34.14  ?  1011 CYS A N     1 
ATOM   7147  C  CA    . CYS A 1  1011 ? 182.431 217.592 156.931 1.00 34.14  ?  1011 CYS A CA    1 
ATOM   7148  C  C     . CYS A 1  1011 ? 182.832 217.413 155.475 1.00 34.14  ?  1011 CYS A C     1 
ATOM   7149  O  O     . CYS A 1  1011 ? 181.989 217.430 154.577 1.00 34.14  ?  1011 CYS A O     1 
ATOM   7150  C  CB    . CYS A 1  1011 ? 182.141 216.224 157.553 1.00 34.14  ?  1011 CYS A CB    1 
ATOM   7151  S  SG    . CYS A 1  1011 ? 182.076 216.202 159.352 1.00 34.14  ?  1011 CYS A SG    1 
ATOM   7152  N  N     . CYS A 1  1012 ? 184.131 217.231 155.259 1.00 40.62  ?  1012 CYS A N     1 
ATOM   7153  C  CA    . CYS A 1  1012 ? 184.657 217.001 153.923 1.00 40.62  ?  1012 CYS A CA    1 
ATOM   7154  C  C     . CYS A 1  1012 ? 184.207 215.640 153.411 1.00 40.62  ?  1012 CYS A C     1 
ATOM   7155  O  O     . CYS A 1  1012 ? 184.254 214.645 154.133 1.00 40.62  ?  1012 CYS A O     1 
ATOM   7156  C  CB    . CYS A 1  1012 ? 186.184 217.094 153.938 1.00 40.62  ?  1012 CYS A CB    1 
ATOM   7157  S  SG    . CYS A 1  1012 ? 187.056 216.847 152.363 1.00 40.62  ?  1012 CYS A SG    1 
ATOM   7158  N  N     . ILE A 1  1013 ? 183.769 215.606 152.151 1.00 24.87  ?  1013 ILE A N     1 
ATOM   7159  C  CA    . ILE A 1  1013 ? 183.246 214.393 151.541 1.00 24.87  ?  1013 ILE A CA    1 
ATOM   7160  C  C     . ILE A 1  1013 ? 184.373 213.417 151.217 1.00 24.87  ?  1013 ILE A C     1 
ATOM   7161  O  O     . ILE A 1  1013 ? 184.143 212.204 151.133 1.00 24.87  ?  1013 ILE A O     1 
ATOM   7162  C  CB    . ILE A 1  1013 ? 182.382 214.837 150.334 1.00 24.87  ?  1013 ILE A CB    1 
ATOM   7163  C  CG1   . ILE A 1  1013 ? 181.198 215.652 150.855 1.00 24.87  ?  1013 ILE A CG1   1 
ATOM   7164  C  CG2   . ILE A 1  1013 ? 181.851 213.679 149.493 1.00 24.87  ?  1013 ILE A CG2   1 
ATOM   7165  C  CD1   . ILE A 1  1013 ? 180.202 216.076 149.819 1.00 24.87  ?  1013 ILE A CD1   1 
ATOM   7166  N  N     . GLY A 1  1014 ? 185.606 213.901 151.124 1.00 31.26  ?  1014 GLY A N     1 
ATOM   7167  C  CA    . GLY A 1  1014 ? 186.722 213.057 150.751 1.00 31.26  ?  1014 GLY A CA    1 
ATOM   7168  C  C     . GLY A 1  1014 ? 187.460 212.384 151.891 1.00 31.26  ?  1014 GLY A C     1 
ATOM   7169  O  O     . GLY A 1  1014 ? 187.780 211.196 151.797 1.00 31.26  ?  1014 GLY A O     1 
ATOM   7170  N  N     . CYS A 1  1015 ? 187.742 213.122 152.976 1.00 40.62  ?  1015 CYS A N     1 
ATOM   7171  C  CA    . CYS A 1  1015 ? 188.643 212.629 154.014 1.00 40.62  ?  1015 CYS A CA    1 
ATOM   7172  C  C     . CYS A 1  1015 ? 188.115 212.882 155.424 1.00 40.62  ?  1015 CYS A C     1 
ATOM   7173  O  O     . CYS A 1  1015 ? 188.850 212.682 156.398 1.00 40.62  ?  1015 CYS A O     1 
ATOM   7174  C  CB    . CYS A 1  1015 ? 190.031 213.256 153.869 1.00 40.62  ?  1015 CYS A CB    1 
ATOM   7175  S  SG    . CYS A 1  1015 ? 190.066 215.048 154.097 1.00 40.62  ?  1015 CYS A SG    1 
ATOM   7176  N  N     . ARG A 1  1016 ? 186.866 213.350 155.547 1.00 36.39  ?  1016 ARG A N     1 
ATOM   7177  C  CA    . ARG A 1  1016 ? 186.097 213.444 156.799 1.00 36.39  ?  1016 ARG A CA    1 
ATOM   7178  C  C     . ARG A 1  1016 ? 186.736 214.400 157.817 1.00 36.39  ?  1016 ARG A C     1 
ATOM   7179  O  O     . ARG A 1  1016 ? 186.919 214.075 158.983 1.00 36.39  ?  1016 ARG A O     1 
ATOM   7180  C  CB    . ARG A 1  1016 ? 185.901 212.064 157.439 1.00 36.39  ?  1016 ARG A CB    1 
ATOM   7181  C  CG    . ARG A 1  1016 ? 185.211 211.041 156.589 1.00 36.39  ?  1016 ARG A CG    1 
ATOM   7182  C  CD    . ARG A 1  1016 ? 185.571 209.651 157.077 1.00 36.39  ?  1016 ARG A CD    1 
ATOM   7183  N  NE    . ARG A 1  1016 ? 184.544 208.665 156.769 1.00 36.39  ?  1016 ARG A NE    1 
ATOM   7184  C  CZ    . ARG A 1  1016 ? 184.776 207.362 156.671 1.00 36.39  ?  1016 ARG A CZ    1 
ATOM   7185  N  NH1   . ARG A 1  1016 ? 186.006 206.905 156.853 1.00 36.39  1  1016 ARG A NH1   1 
ATOM   7186  N  NH2   . ARG A 1  1016 ? 183.791 206.521 156.390 1.00 36.39  ?  1016 ARG A NH2   1 
ATOM   7187  N  N     . THR A 1  1017 ? 187.087 215.598 157.372 1.00 30.53  ?  1017 THR A N     1 
ATOM   7188  C  CA    . THR A 1  1017 ? 187.681 216.553 158.293 1.00 30.53  ?  1017 THR A CA    1 
ATOM   7189  C  C     . THR A 1  1017 ? 186.712 217.697 158.541 1.00 30.53  ?  1017 THR A C     1 
ATOM   7190  O  O     . THR A 1  1017 ? 186.330 218.405 157.614 1.00 30.53  ?  1017 THR A O     1 
ATOM   7191  C  CB    . THR A 1  1017 ? 188.997 217.072 157.740 1.00 30.53  ?  1017 THR A CB    1 
ATOM   7192  N  N     . VAL A 1  1018 ? 186.270 217.846 159.784 1.00 34.85  ?  1018 VAL A N     1 
ATOM   7193  C  CA    . VAL A 1  1018 ? 185.338 218.913 160.109 1.00 34.85  ?  1018 VAL A CA    1 
ATOM   7194  C  C     . VAL A 1  1018 ? 186.028 220.248 159.890 1.00 34.85  ?  1018 VAL A C     1 
ATOM   7195  O  O     . VAL A 1  1018 ? 187.187 220.419 160.257 1.00 34.85  ?  1018 VAL A O     1 
ATOM   7196  C  CB    . VAL A 1  1018 ? 184.866 218.789 161.548 1.00 34.85  ?  1018 VAL A CB    1 
ATOM   7197  N  N     . LEU A 1  1019 ? 185.321 221.193 159.281 1.00 47.76  ?  1019 LEU A N     1 
ATOM   7198  C  CA    . LEU A 1  1019 ? 185.901 222.505 159.033 1.00 47.76  ?  1019 LEU A CA    1 
ATOM   7199  C  C     . LEU A 1  1019 ? 184.864 223.609 158.867 1.00 47.76  ?  1019 LEU A C     1 
ATOM   7200  O  O     . LEU A 1  1019 ? 183.701 223.347 158.566 1.00 47.76  ?  1019 LEU A O     1 
ATOM   7201  C  CB    . LEU A 1  1019 ? 186.798 222.457 157.794 1.00 30.00  ?  1019 LEU A CB    1 
ATOM   7202  C  CG    . LEU A 1  1019 ? 186.130 222.824 156.468 1.00 30.00  ?  1019 LEU A CG    1 
ATOM   7203  C  CD1   . LEU A 1  1019 ? 187.103 223.577 155.573 1.00 30.00  ?  1019 LEU A CD1   1 
ATOM   7204  C  CD2   . LEU A 1  1019 ? 185.602 221.581 155.767 1.00 30.00  ?  1019 LEU A CD2   1 
ATOM   7205  N  N     . SER A 1  1020 ? 185.303 224.849 159.067 1.00 68.12  ?  1020 SER A N     1 
ATOM   7206  C  CA    . SER A 1  1020 ? 184.451 226.019 158.889 1.00 68.12  ?  1020 SER A CA    1 
ATOM   7207  C  C     . SER A 1  1020 ? 184.211 226.185 157.395 1.00 68.12  ?  1020 SER A C     1 
ATOM   7208  O  O     . SER A 1  1020 ? 185.116 225.885 156.618 1.00 68.12  ?  1020 SER A O     1 
ATOM   7209  C  CB    . SER A 1  1020 ? 185.115 227.257 159.467 1.00 68.12  ?  1020 SER A CB    1 
ATOM   7210  N  N     . HIS A 1  1021 ? 183.004 226.665 157.055 1.00 82.53  ?  1021 HIS A N     1 
ATOM   7211  C  CA    . HIS A 1  1021 ? 182.399 226.925 155.712 1.00 82.53  ?  1021 HIS A CA    1 
ATOM   7212  C  C     . HIS A 1  1021 ? 181.599 225.739 155.148 1.00 82.53  ?  1021 HIS A C     1 
ATOM   7213  O  O     . HIS A 1  1021 ? 181.784 224.596 155.566 1.00 82.53  ?  1021 HIS A O     1 
ATOM   7214  C  CB    . HIS A 1  1021 ? 183.291 227.624 154.653 1.00 30.00  ?  1021 HIS A CB    1 
ATOM   7215  C  CG    . HIS A 1  1021 ? 183.997 226.683 153.725 1.00 30.00  ?  1021 HIS A CG    1 
ATOM   7216  N  ND1   . HIS A 1  1021 ? 184.864 227.116 152.745 1.00 30.00  ?  1021 HIS A ND1   1 
ATOM   7217  C  CD2   . HIS A 1  1021 ? 183.998 225.331 153.656 1.00 30.00  ?  1021 HIS A CD2   1 
ATOM   7218  C  CE1   . HIS A 1  1021 ? 185.353 226.072 152.100 1.00 30.00  ?  1021 HIS A CE1   1 
ATOM   7219  N  NE2   . HIS A 1  1021 ? 184.851 224.976 152.640 1.00 30.00  ?  1021 HIS A NE2   1 
ATOM   7220  N  N     . GLN A 1  1022 ? 180.713 226.028 154.198 1.00 66.84  ?  1022 GLN A N     1 
ATOM   7221  C  CA    . GLN A 1  1022 ? 179.826 225.015 153.619 1.00 66.84  ?  1022 GLN A CA    1 
ATOM   7222  C  C     . GLN A 1  1022 ? 180.282 224.232 152.381 1.00 66.84  ?  1022 GLN A C     1 
ATOM   7223  O  O     . GLN A 1  1022 ? 179.571 223.330 151.939 1.00 66.84  ?  1022 GLN A O     1 
ATOM   7224  C  CB    . GLN A 1  1022 ? 178.449 225.629 153.351 1.00 30.00  ?  1022 GLN A CB    1 
ATOM   7225  C  CG    . GLN A 1  1022 ? 177.895 226.425 154.521 1.00 30.00  ?  1022 GLN A CG    1 
ATOM   7226  C  CD    . GLN A 1  1022 ? 176.681 225.769 155.147 1.00 30.00  ?  1022 GLN A CD    1 
ATOM   7227  O  OE1   . GLN A 1  1022 ? 175.986 224.980 154.504 1.00 30.00  ?  1022 GLN A OE1   1 
ATOM   7228  N  NE2   . GLN A 1  1022 ? 176.418 226.090 156.408 1.00 30.00  ?  1022 GLN A NE2   1 
ATOM   7229  N  N     . GLY A 1  1023 ? 181.437 224.553 151.812 1.00 42.83  ?  1023 GLY A N     1 
ATOM   7230  C  CA    . GLY A 1  1023 ? 181.874 223.816 150.626 1.00 42.83  ?  1023 GLY A CA    1 
ATOM   7231  C  C     . GLY A 1  1023 ? 182.143 222.343 150.935 1.00 42.83  ?  1023 GLY A C     1 
ATOM   7232  O  O     . GLY A 1  1023 ? 182.700 221.996 151.975 1.00 42.83  ?  1023 GLY A O     1 
ATOM   7233  N  N     . ALA A 1  1024 ? 181.730 221.487 150.011 1.00 27.94  ?  1024 ALA A N     1 
ATOM   7234  C  CA    . ALA A 1  1024 ? 181.867 220.040 150.129 1.00 27.94  ?  1024 ALA A CA    1 
ATOM   7235  C  C     . ALA A 1  1024 ? 183.277 219.441 150.165 1.00 27.94  ?  1024 ALA A C     1 
ATOM   7236  O  O     . ALA A 1  1024 ? 183.517 218.470 150.882 1.00 27.94  ?  1024 ALA A O     1 
ATOM   7237  C  CB    . ALA A 1  1024 ? 181.045 219.356 149.044 1.00 27.94  ?  1024 ALA A CB    1 
ATOM   7238  N  N     . VAL A 1  1025 ? 184.199 219.994 149.384 1.00 27.67  ?  1025 VAL A N     1 
ATOM   7239  C  CA    . VAL A 1  1025 ? 185.523 219.410 149.271 1.00 27.67  ?  1025 VAL A CA    1 
ATOM   7240  C  C     . VAL A 1  1025 ? 186.512 220.106 150.194 1.00 27.67  ?  1025 VAL A C     1 
ATOM   7241  O  O     . VAL A 1  1025 ? 186.365 221.277 150.546 1.00 27.67  ?  1025 VAL A O     1 
ATOM   7242  C  CB    . VAL A 1  1025 ? 186.024 219.472 147.829 1.00 27.67  ?  1025 VAL A CB    1 
ATOM   7243  N  N     . CYS A 1  1026 ? 187.536 219.349 150.571 1.00 40.62  ?  1026 CYS A N     1 
ATOM   7244  C  CA    . CYS A 1  1026 ? 188.628 219.789 151.424 1.00 40.62  ?  1026 CYS A CA    1 
ATOM   7245  C  C     . CYS A 1  1026 ? 189.716 220.406 150.556 1.00 40.62  ?  1026 CYS A C     1 
ATOM   7246  O  O     . CYS A 1  1026 ? 189.807 220.100 149.363 1.00 40.62  ?  1026 CYS A O     1 
ATOM   7247  C  CB    . CYS A 1  1026 ? 189.154 218.588 152.220 1.00 40.62  ?  1026 CYS A CB    1 
ATOM   7248  S  SG    . CYS A 1  1026 ? 190.687 218.759 153.088 1.00 40.62  ?  1026 CYS A SG    1 
ATOM   7249  N  N     . GLU A 1  1027 ? 190.529 221.288 151.142 1.00 29.71  ?  1027 GLU A N     1 
ATOM   7250  C  CA    . GLU A 1  1027 ? 191.512 222.024 150.348 1.00 29.71  ?  1027 GLU A CA    1 
ATOM   7251  C  C     . GLU A 1  1027 ? 192.649 221.129 149.877 1.00 29.71  ?  1027 GLU A C     1 
ATOM   7252  O  O     . GLU A 1  1027 ? 193.280 221.412 148.853 1.00 29.71  ?  1027 GLU A O     1 
ATOM   7253  C  CB    . GLU A 1  1027 ? 192.062 223.199 151.150 1.00 29.71  ?  1027 GLU A CB    1 
ATOM   7254  N  N     . PHE A 1  1028 ? 192.920 220.045 150.597 1.00 30.90  ?  1028 PHE A N     1 
ATOM   7255  C  CA    . PHE A 1  1028 ? 193.932 219.097 150.154 1.00 30.90  ?  1028 PHE A CA    1 
ATOM   7256  C  C     . PHE A 1  1028 ? 193.359 218.121 149.141 1.00 30.90  ?  1028 PHE A C     1 
ATOM   7257  O  O     . PHE A 1  1028 ? 194.072 217.665 148.243 1.00 30.90  ?  1028 PHE A O     1 
ATOM   7258  C  CB    . PHE A 1  1028 ? 194.505 218.347 151.352 1.00 30.90  ?  1028 PHE A CB    1 
ATOM   7259  N  N     . CYS A 1  1029 ? 192.067 217.829 149.282 1.00 40.62  ?  1029 CYS A N     1 
ATOM   7260  C  CA    . CYS A 1  1029 ? 191.396 216.898 148.343 1.00 40.62  ?  1029 CYS A CA    1 
ATOM   7261  C  C     . CYS A 1  1029 ? 190.507 217.698 147.384 1.00 40.62  ?  1029 CYS A C     1 
ATOM   7262  O  O     . CYS A 1  1029 ? 189.273 217.524 147.438 1.00 40.62  ?  1029 CYS A O     1 
ATOM   7263  C  CB    . CYS A 1  1029 ? 190.548 215.883 149.100 1.00 40.62  ?  1029 CYS A CB    1 
ATOM   7264  S  SG    . CYS A 1  1029 ? 189.701 216.582 150.541 1.00 40.62  ?  1029 CYS A SG    1 
ATOM   7265  N  N     . GLN A 1  1030 ? 191.119 218.539 146.544 1.00 30.00  ?  1030 GLN A N     1 
ATOM   7266  C  CA    . GLN A 1  1030 ? 190.366 219.371 145.575 1.00 30.00  ?  1030 GLN A CA    1 
ATOM   7267  C  C     . GLN A 1  1030 ? 190.608 218.860 144.150 1.00 30.00  ?  1030 GLN A C     1 
ATOM   7268  O  O     . GLN A 1  1030 ? 189.620 218.695 143.407 1.00 30.00  ?  1030 GLN A O     1 
ATOM   7269  C  CB    . GLN A 1  1030 ? 190.770 220.842 145.693 1.00 30.00  ?  1030 GLN A CB    1 
ATOM   7270  C  CG    . GLN A 1  1030 ? 190.352 221.499 146.998 1.00 30.00  ?  1030 GLN A CG    1 
ATOM   7271  C  CD    . GLN A 1  1030 ? 190.831 222.932 147.110 1.00 30.00  ?  1030 GLN A CD    1 
ATOM   7272  O  OE1   . GLN A 1  1030 ? 191.821 223.313 146.484 1.00 30.00  ?  1030 GLN A OE1   1 
ATOM   7273  N  NE2   . GLN A 1  1030 ? 190.130 223.731 147.908 1.00 30.00  ?  1030 GLN A NE2   1 
ATOM   7274  N  N     . PRO A 1  1031 ? 191.872 218.613 143.736 1.00 33.32  ?  1031 PRO A N     1 
ATOM   7275  C  CA    . PRO A 1  1031 ? 192.169 218.123 142.385 1.00 33.32  ?  1031 PRO A CA    1 
ATOM   7276  C  C     . PRO A 1  1031 ? 191.324 216.889 142.033 1.00 33.32  ?  1031 PRO A C     1 
ATOM   7277  O  O     . PRO A 1  1031 ? 191.273 216.524 140.872 1.00 33.32  ?  1031 PRO A O     1 
ATOM   7278  C  CB    . PRO A 1  1031 ? 193.652 217.734 142.470 1.00 33.32  ?  1031 PRO A CB    1 
ATOM   7279  C  CG    . PRO A 1  1031 ? 194.207 218.647 143.539 1.00 33.32  ?  1031 PRO A CG    1 
ATOM   7280  C  CD    . PRO A 1  1031 ? 193.082 218.796 144.542 1.00 33.32  ?  1031 PRO A CD    1 
ATOM   7281  N  N     . ARG A 1  1032 ? 190.690 216.288 143.045 1.00 28.69  ?  1032 ARG A N     1 
ATOM   7282  C  CA    . ARG A 1  1032 ? 189.856 215.118 142.855 1.00 28.69  ?  1032 ARG A CA    1 
ATOM   7283  C  C     . ARG A 1  1032 ? 188.460 215.515 143.347 1.00 28.69  ?  1032 ARG A C     1 
ATOM   7284  O  O     . ARG A 1  1032 ? 188.080 215.253 144.484 1.00 28.69  ?  1032 ARG A O     1 
ATOM   7285  C  CB    . ARG A 1  1032 ? 190.476 213.982 143.645 1.00 28.69  ?  1032 ARG A CB    1 
ATOM   7286  C  CG    . ARG A 1  1032 ? 189.841 212.636 143.540 1.00 28.69  ?  1032 ARG A CG    1 
ATOM   7287  C  CD    . ARG A 1  1032 ? 190.592 211.693 144.463 1.00 28.69  ?  1032 ARG A CD    1 
ATOM   7288  N  NE    . ARG A 1  1032 ? 190.659 212.242 145.813 1.00 28.69  ?  1032 ARG A NE    1 
ATOM   7289  C  CZ    . ARG A 1  1032 ? 190.100 211.678 146.878 1.00 28.69  ?  1032 ARG A CZ    1 
ATOM   7290  N  NH1   . ARG A 1  1032 ? 189.442 210.537 146.757 1.00 28.69  1  1032 ARG A NH1   1 
ATOM   7291  N  NH2   . ARG A 1  1032 ? 190.203 212.251 148.069 1.00 28.69  ?  1032 ARG A NH2   1 
ATOM   7292  N  N     . GLU A 1  1033 ? 187.701 216.173 142.484 1.00 23.18  ?  1033 GLU A N     1 
ATOM   7293  C  CA    . GLU A 1  1033 ? 186.334 216.566 142.774 1.00 23.18  ?  1033 GLU A CA    1 
ATOM   7294  C  C     . GLU A 1  1033 ? 185.348 216.094 141.719 1.00 23.18  ?  1033 GLU A C     1 
ATOM   7295  O  O     . GLU A 1  1033 ? 184.201 215.795 142.052 1.00 23.18  ?  1033 GLU A O     1 
ATOM   7296  C  CB    . GLU A 1  1033 ? 186.228 218.089 142.898 1.00 23.18  ?  1033 GLU A CB    1 
ATOM   7297  C  CG    . GLU A 1  1033 ? 184.916 218.576 143.459 1.00 23.18  ?  1033 GLU A CG    1 
ATOM   7298  C  CD    . GLU A 1  1033 ? 184.584 219.969 143.030 1.00 23.18  ?  1033 GLU A CD    1 
ATOM   7299  O  OE1   . GLU A 1  1033 ? 185.336 220.529 142.210 1.00 23.18  ?  1033 GLU A OE1   1 
ATOM   7300  O  OE2   . GLU A 1  1033 ? 183.567 220.506 143.501 1.00 23.18  -1 1033 GLU A OE2   1 
ATOM   7301  N  N     . SER A 1  1034 ? 185.772 216.016 140.458 1.00 25.39  ?  1034 SER A N     1 
ATOM   7302  C  CA    . SER A 1  1034 ? 184.937 215.444 139.413 1.00 25.39  ?  1034 SER A CA    1 
ATOM   7303  C  C     . SER A 1  1034 ? 184.663 213.970 139.679 1.00 25.39  ?  1034 SER A C     1 
ATOM   7304  O  O     . SER A 1  1034 ? 183.543 213.491 139.469 1.00 25.39  ?  1034 SER A O     1 
ATOM   7305  C  CB    . SER A 1  1034 ? 185.614 215.642 138.059 1.00 25.39  ?  1034 SER A CB    1 
ATOM   7306  O  OG    . SER A 1  1034 ? 184.873 215.054 137.015 1.00 25.39  ?  1034 SER A OG    1 
ATOM   7307  N  N     . GLU A 1  1035 ? 185.657 213.246 140.180 1.00 25.26  ?  1035 GLU A N     1 
ATOM   7308  C  CA    . GLU A 1  1035 ? 185.460 211.864 140.582 1.00 25.26  ?  1035 GLU A CA    1 
ATOM   7309  C  C     . GLU A 1  1035 ? 184.607 211.728 141.839 1.00 25.26  ?  1035 GLU A C     1 
ATOM   7310  O  O     . GLU A 1  1035 ? 183.831 210.775 141.944 1.00 25.26  ?  1035 GLU A O     1 
ATOM   7311  C  CB    . GLU A 1  1035 ? 186.814 211.213 140.796 1.00 25.26  ?  1035 GLU A CB    1 
ATOM   7312  C  CG    . GLU A 1  1035 ? 186.787 209.720 140.850 1.00 25.26  ?  1035 GLU A CG    1 
ATOM   7313  C  CD    . GLU A 1  1035 ? 188.175 209.142 140.969 1.00 25.26  ?  1035 GLU A CD    1 
ATOM   7314  O  OE1   . GLU A 1  1035 ? 189.138 209.936 140.978 1.00 25.26  ?  1035 GLU A OE1   1 
ATOM   7315  O  OE2   . GLU A 1  1035 ? 188.309 207.902 141.052 1.00 25.26  -1 1035 GLU A OE2   1 
ATOM   7316  N  N     . LEU A 1  1036 ? 184.693 212.681 142.770 1.00 20.60  ?  1036 LEU A N     1 
ATOM   7317  C  CA    . LEU A 1  1036 ? 183.850 212.658 143.956 1.00 20.60  ?  1036 LEU A CA    1 
ATOM   7318  C  C     . LEU A 1  1036 ? 182.431 213.135 143.698 1.00 20.60  ?  1036 LEU A C     1 
ATOM   7319  O  O     . LEU A 1  1036 ? 181.545 212.835 144.498 1.00 20.60  ?  1036 LEU A O     1 
ATOM   7320  C  CB    . LEU A 1  1036 ? 184.449 213.514 145.079 1.00 20.60  ?  1036 LEU A CB    1 
ATOM   7321  C  CG    . LEU A 1  1036 ? 185.679 213.060 145.870 1.00 20.60  ?  1036 LEU A CG    1 
ATOM   7322  C  CD1   . LEU A 1  1036 ? 186.015 214.060 146.954 1.00 20.60  ?  1036 LEU A CD1   1 
ATOM   7323  C  CD2   . LEU A 1  1036 ? 185.510 211.682 146.455 1.00 20.60  ?  1036 LEU A CD2   1 
ATOM   7324  N  N     . TYR A 1  1037 ? 182.193 213.910 142.642 1.00 21.77  ?  1037 TYR A N     1 
ATOM   7325  C  CA    . TYR A 1  1037 ? 180.826 214.156 142.202 1.00 21.77  ?  1037 TYR A CA    1 
ATOM   7326  C  C     . TYR A 1  1037 ? 180.290 212.969 141.435 1.00 21.77  ?  1037 TYR A C     1 
ATOM   7327  O  O     . TYR A 1  1037 ? 179.091 212.696 141.480 1.00 21.77  ?  1037 TYR A O     1 
ATOM   7328  C  CB    . TYR A 1  1037 ? 180.750 215.398 141.316 1.00 21.77  ?  1037 TYR A CB    1 
ATOM   7329  C  CG    . TYR A 1  1037 ? 179.341 215.788 140.922 1.00 21.77  ?  1037 TYR A CG    1 
ATOM   7330  C  CD1   . TYR A 1  1037 ? 178.576 216.589 141.748 1.00 21.77  ?  1037 TYR A CD1   1 
ATOM   7331  C  CD2   . TYR A 1  1037 ? 178.782 215.371 139.717 1.00 21.77  ?  1037 TYR A CD2   1 
ATOM   7332  C  CE1   . TYR A 1  1037 ? 177.297 216.956 141.399 1.00 21.77  ?  1037 TYR A CE1   1 
ATOM   7333  C  CE2   . TYR A 1  1037 ? 177.497 215.719 139.370 1.00 21.77  ?  1037 TYR A CE2   1 
ATOM   7334  C  CZ    . TYR A 1  1037 ? 176.762 216.514 140.214 1.00 21.77  ?  1037 TYR A CZ    1 
ATOM   7335  O  OH    . TYR A 1  1037 ? 175.483 216.882 139.873 1.00 21.77  ?  1037 TYR A OH    1 
ATOM   7336  N  N     . GLN A 1  1038 ? 181.155 212.312 140.670 1.00 23.91  ?  1038 GLN A N     1 
ATOM   7337  C  CA    . GLN A 1  1038 ? 180.739 211.155 139.901 1.00 23.91  ?  1038 GLN A CA    1 
ATOM   7338  C  C     . GLN A 1  1038 ? 180.295 210.125 140.913 1.00 23.91  ?  1038 GLN A C     1 
ATOM   7339  O  O     . GLN A 1  1038 ? 179.308 209.423 140.714 1.00 23.91  ?  1038 GLN A O     1 
ATOM   7340  C  CB    . GLN A 1  1038 ? 181.885 210.614 139.052 1.00 23.91  ?  1038 GLN A CB    1 
ATOM   7341  C  CG    . GLN A 1  1038 ? 181.646 210.712 137.556 1.00 23.91  ?  1038 GLN A CG    1 
ATOM   7342  C  CD    . GLN A 1  1038 ? 182.929 210.638 136.754 1.00 23.91  ?  1038 GLN A CD    1 
ATOM   7343  O  OE1   . GLN A 1  1038 ? 183.638 211.631 136.605 1.00 23.91  ?  1038 GLN A OE1   1 
ATOM   7344  N  NE2   . GLN A 1  1038 ? 183.233 209.458 136.232 1.00 23.91  ?  1038 GLN A NE2   1 
ATOM   7345  N  N     . LYS A 1  1039 ? 181.038 210.041 142.008 1.00 27.20  ?  1039 LYS A N     1 
ATOM   7346  C  CA    . LYS A 1  1039 ? 180.700 209.113 143.066 1.00 27.20  ?  1039 LYS A CA    1 
ATOM   7347  C  C     . LYS A 1  1039 ? 179.622 209.745 143.931 1.00 27.20  ?  1039 LYS A C     1 
ATOM   7348  O  O     . LYS A 1  1039 ? 179.764 210.860 144.428 1.00 27.20  ?  1039 LYS A O     1 
ATOM   7349  C  CB    . LYS A 1  1039 ? 181.930 208.766 143.904 1.00 27.20  ?  1039 LYS A CB    1 
ATOM   7350  C  CG    . LYS A 1  1039 ? 182.600 207.462 143.501 1.00 27.20  ?  1039 LYS A CG    1 
ATOM   7351  C  CD    . LYS A 1  1039 ? 182.485 207.227 142.003 1.00 27.20  ?  1039 LYS A CD    1 
ATOM   7352  C  CE    . LYS A 1  1039 ? 183.856 207.137 141.346 1.00 27.20  ?  1039 LYS A CE    1 
ATOM   7353  N  NZ    . LYS A 1  1039 ? 183.835 206.273 140.133 1.00 27.20  1  1039 LYS A NZ    1 
ATOM   7354  N  N     . GLU A 1  1040 ? 178.544 209.000 144.104 1.00 27.14  ?  1040 GLU A N     1 
ATOM   7355  C  CA    . GLU A 1  1040 ? 177.374 209.410 144.898 1.00 27.14  ?  1040 GLU A CA    1 
ATOM   7356  C  C     . GLU A 1  1040 ? 176.206 209.927 144.044 1.00 27.14  ?  1040 GLU A C     1 
ATOM   7357  O  O     . GLU A 1  1040 ? 175.058 209.879 144.511 1.00 27.14  ?  1040 GLU A O     1 
ATOM   7358  C  CB    . GLU A 1  1040 ? 177.670 210.493 145.960 1.00 27.14  ?  1040 GLU A CB    1 
ATOM   7359  C  CG    . GLU A 1  1040 ? 177.631 211.943 145.471 1.00 27.14  ?  1040 GLU A CG    1 
ATOM   7360  C  CD    . GLU A 1  1040 ? 178.267 212.900 146.438 1.00 27.14  ?  1040 GLU A CD    1 
ATOM   7361  O  OE1   . GLU A 1  1040 ? 178.789 212.423 147.465 1.00 27.14  ?  1040 GLU A OE1   1 
ATOM   7362  O  OE2   . GLU A 1  1040 ? 178.269 214.117 146.163 1.00 27.14  -1 1040 GLU A OE2   1 
ATOM   7363  N  N     . VAL A 1  1041 ? 176.412 210.266 142.774 1.00 25.48  ?  1041 VAL A N     1 
ATOM   7364  C  CA    . VAL A 1  1041 ? 175.270 210.543 141.917 1.00 25.48  ?  1041 VAL A CA    1 
ATOM   7365  C  C     . VAL A 1  1041 ? 174.720 209.240 141.354 1.00 25.48  ?  1041 VAL A C     1 
ATOM   7366  O  O     . VAL A 1  1041 ? 173.510 209.149 141.109 1.00 25.48  ?  1041 VAL A O     1 
ATOM   7367  C  CB    . VAL A 1  1041 ? 175.609 211.564 140.804 1.00 25.48  ?  1041 VAL A CB    1 
ATOM   7368  C  CG1   . VAL A 1  1041 ? 176.413 210.952 139.658 1.00 25.48  ?  1041 VAL A CG1   1 
ATOM   7369  C  CG2   . VAL A 1  1041 ? 174.347 212.239 140.293 1.00 25.48  ?  1041 VAL A CG2   1 
ATOM   7370  N  N     . SER A 1  1042 ? 175.545 208.197 141.261 1.00 27.33  ?  1042 SER A N     1 
ATOM   7371  C  CA    . SER A 1  1042 ? 175.097 206.837 141.010 1.00 27.33  ?  1042 SER A CA    1 
ATOM   7372  C  C     . SER A 1  1042 ? 174.446 206.198 142.224 1.00 27.33  ?  1042 SER A C     1 
ATOM   7373  O  O     . SER A 1  1042 ? 173.929 205.084 142.111 1.00 27.33  ?  1042 SER A O     1 
ATOM   7374  C  CB    . SER A 1  1042 ? 176.276 205.977 140.559 1.00 27.33  ?  1042 SER A CB    1 
ATOM   7375  O  OG    . SER A 1  1042 ? 175.880 204.634 140.366 1.00 27.33  ?  1042 SER A OG    1 
ATOM   7376  N  N     . HIS A 1  1043 ? 174.489 206.857 143.379 1.00 21.28  ?  1043 HIS A N     1 
ATOM   7377  C  CA    . HIS A 1  1043 ? 173.727 206.450 144.547 1.00 21.28  ?  1043 HIS A CA    1 
ATOM   7378  C  C     . HIS A 1  1043 ? 172.376 207.147 144.606 1.00 21.28  ?  1043 HIS A C     1 
ATOM   7379  O  O     . HIS A 1  1043 ? 171.362 206.496 144.893 1.00 21.28  ?  1043 HIS A O     1 
ATOM   7380  C  CB    . HIS A 1  1043 ? 174.527 206.735 145.817 1.00 21.28  ?  1043 HIS A CB    1 
ATOM   7381  C  CG    . HIS A 1  1043 ? 173.860 206.258 147.066 1.00 21.28  ?  1043 HIS A CG    1 
ATOM   7382  N  ND1   . HIS A 1  1043 ? 173.576 204.930 147.297 1.00 21.28  ?  1043 HIS A ND1   1 
ATOM   7383  C  CD2   . HIS A 1  1043 ? 173.407 206.934 148.148 1.00 21.28  ?  1043 HIS A CD2   1 
ATOM   7384  C  CE1   . HIS A 1  1043 ? 172.983 204.809 148.470 1.00 21.28  ?  1043 HIS A CE1   1 
ATOM   7385  N  NE2   . HIS A 1  1043 ? 172.870 206.009 149.007 1.00 21.28  ?  1043 HIS A NE2   1 
ATOM   7386  N  N     . LEU A 1  1044 ? 172.358 208.463 144.348 1.00 14.62  ?  1044 LEU A N     1 
ATOM   7387  C  CA    . LEU A 1  1044 ? 171.088 209.172 144.174 1.00 14.62  ?  1044 LEU A CA    1 
ATOM   7388  C  C     . LEU A 1  1044 ? 170.238 208.558 143.064 1.00 14.62  ?  1044 LEU A C     1 
ATOM   7389  O  O     . LEU A 1  1044 ? 169.031 208.378 143.243 1.00 14.62  ?  1044 LEU A O     1 
ATOM   7390  C  CB    . LEU A 1  1044 ? 171.327 210.651 143.880 1.00 14.62  ?  1044 LEU A CB    1 
ATOM   7391  C  CG    . LEU A 1  1044 ? 170.060 211.456 143.585 1.00 14.62  ?  1044 LEU A CG    1 
ATOM   7392  C  CD1   . LEU A 1  1044 ? 169.330 211.784 144.861 1.00 14.62  ?  1044 LEU A CD1   1 
ATOM   7393  C  CD2   . LEU A 1  1044 ? 170.334 212.717 142.811 1.00 14.62  ?  1044 LEU A CD2   1 
ATOM   7394  N  N     . ASN A 1  1045 ? 170.861 208.185 141.941 1.00 24.71  ?  1045 ASN A N     1 
ATOM   7395  C  CA    . ASN A 1  1045 ? 170.202 207.505 140.833 1.00 24.71  ?  1045 ASN A CA    1 
ATOM   7396  C  C     . ASN A 1  1045 ? 169.553 206.187 141.221 1.00 24.71  ?  1045 ASN A C     1 
ATOM   7397  O  O     . ASN A 1  1045 ? 168.517 205.838 140.654 1.00 24.71  ?  1045 ASN A O     1 
ATOM   7398  C  CB    . ASN A 1  1045 ? 171.220 207.249 139.726 1.00 24.71  ?  1045 ASN A CB    1 
ATOM   7399  C  CG    . ASN A 1  1045 ? 170.592 206.766 138.455 1.00 24.71  ?  1045 ASN A CG    1 
ATOM   7400  O  OD1   . ASN A 1  1045 ? 170.098 207.558 137.659 1.00 24.71  ?  1045 ASN A OD1   1 
ATOM   7401  N  ND2   . ASN A 1  1045 ? 170.631 205.461 138.236 1.00 24.71  ?  1045 ASN A ND2   1 
ATOM   7402  N  N     . ALA A 1  1046 ? 170.129 205.442 142.157 1.00 18.63  ?  1046 ALA A N     1 
ATOM   7403  C  CA    . ALA A 1  1046 ? 169.554 204.175 142.570 1.00 18.63  ?  1046 ALA A CA    1 
ATOM   7404  C  C     . ALA A 1  1046 ? 168.533 204.326 143.686 1.00 18.63  ?  1046 ALA A C     1 
ATOM   7405  O  O     . ALA A 1  1046 ? 167.727 203.419 143.890 1.00 18.63  ?  1046 ALA A O     1 
ATOM   7406  C  CB    . ALA A 1  1046 ? 170.652 203.215 143.013 1.00 18.63  ?  1046 ALA A CB    1 
ATOM   7407  N  N     . LEU A 1  1047 ? 168.554 205.431 144.417 1.00 23.75  ?  1047 LEU A N     1 
ATOM   7408  C  CA    . LEU A 1  1047 ? 167.475 205.702 145.361 1.00 23.75  ?  1047 LEU A CA    1 
ATOM   7409  C  C     . LEU A 1  1047 ? 166.214 206.192 144.663 1.00 23.75  ?  1047 LEU A C     1 
ATOM   7410  O  O     . LEU A 1  1047 ? 165.099 205.865 145.100 1.00 23.75  ?  1047 LEU A O     1 
ATOM   7411  C  CB    . LEU A 1  1047 ? 167.923 206.752 146.378 1.00 23.75  ?  1047 LEU A CB    1 
ATOM   7412  C  CG    . LEU A 1  1047 ? 168.445 206.390 147.766 1.00 23.75  ?  1047 LEU A CG    1 
ATOM   7413  C  CD1   . LEU A 1  1047 ? 169.477 205.302 147.698 1.00 23.75  ?  1047 LEU A CD1   1 
ATOM   7414  C  CD2   . LEU A 1  1047 ? 169.039 207.626 148.383 1.00 23.75  ?  1047 LEU A CD2   1 
ATOM   7415  N  N     . GLU A 1  1048 ? 166.386 206.989 143.596 1.00 24.62  ?  1048 GLU A N     1 
ATOM   7416  C  CA    . GLU A 1  1048 ? 165.269 207.430 142.767 1.00 24.62  ?  1048 GLU A CA    1 
ATOM   7417  C  C     . GLU A 1  1048 ? 164.535 206.261 142.142 1.00 24.62  ?  1048 GLU A C     1 
ATOM   7418  O  O     . GLU A 1  1048 ? 163.311 206.303 142.001 1.00 24.62  ?  1048 GLU A O     1 
ATOM   7419  C  CB    . GLU A 1  1048 ? 165.758 208.339 141.652 1.00 24.62  ?  1048 GLU A CB    1 
ATOM   7420  C  CG    . GLU A 1  1048 ? 166.358 209.625 142.079 1.00 24.62  ?  1048 GLU A CG    1 
ATOM   7421  C  CD    . GLU A 1  1048 ? 165.405 210.751 141.987 1.00 24.62  ?  1048 GLU A CD    1 
ATOM   7422  O  OE1   . GLU A 1  1048 ? 164.201 210.473 141.979 1.00 24.62  ?  1048 GLU A OE1   1 
ATOM   7423  O  OE2   . GLU A 1  1048 ? 165.851 211.910 141.902 1.00 24.62  -1 1048 GLU A OE2   1 
ATOM   7424  N  N     . GLU A 1  1049 ? 165.258 205.222 141.751 1.00 34.73  ?  1049 GLU A N     1 
ATOM   7425  C  CA    . GLU A 1  1049 ? 164.639 204.072 141.124 1.00 34.73  ?  1049 GLU A CA    1 
ATOM   7426  C  C     . GLU A 1  1049 ? 163.884 203.213 142.126 1.00 34.73  ?  1049 GLU A C     1 
ATOM   7427  O  O     . GLU A 1  1049 ? 162.984 202.470 141.732 1.00 34.73  ?  1049 GLU A O     1 
ATOM   7428  C  CB    . GLU A 1  1049 ? 165.729 203.283 140.382 1.00 34.73  ?  1049 GLU A CB    1 
ATOM   7429  C  CG    . GLU A 1  1049 ? 165.277 202.225 139.373 1.00 34.73  ?  1049 GLU A CG    1 
ATOM   7430  C  CD    . GLU A 1  1049 ? 164.977 200.856 139.967 1.00 34.73  ?  1049 GLU A CD    1 
ATOM   7431  O  OE1   . GLU A 1  1049 ? 165.183 200.644 141.180 1.00 34.73  ?  1049 GLU A OE1   1 
ATOM   7432  O  OE2   . GLU A 1  1049 ? 164.532 199.977 139.201 1.00 34.73  -1 1049 GLU A OE2   1 
ATOM   7433  N  N     . ARG A 1  1050 ? 164.201 203.323 143.412 1.00 35.42  ?  1050 ARG A N     1 
ATOM   7434  C  CA    . ARG A 1  1050 ? 163.532 202.548 144.447 1.00 35.42  ?  1050 ARG A CA    1 
ATOM   7435  C  C     . ARG A 1  1050 ? 162.303 203.248 145.013 1.00 35.42  ?  1050 ARG A C     1 
ATOM   7436  O  O     . ARG A 1  1050 ? 161.356 202.565 145.406 1.00 35.42  ?  1050 ARG A O     1 
ATOM   7437  C  CB    . ARG A 1  1050 ? 164.527 202.224 145.571 1.00 35.42  ?  1050 ARG A CB    1 
ATOM   7438  C  CG    . ARG A 1  1050 ? 164.029 201.269 146.636 1.00 35.42  ?  1050 ARG A CG    1 
ATOM   7439  C  CD    . ARG A 1  1050 ? 164.811 201.422 147.925 1.00 35.42  ?  1050 ARG A CD    1 
ATOM   7440  N  NE    . ARG A 1  1050 ? 166.236 201.635 147.685 1.00 35.42  ?  1050 ARG A NE    1 
ATOM   7441  C  CZ    . ARG A 1  1050 ? 167.112 201.991 148.619 1.00 35.42  ?  1050 ARG A CZ    1 
ATOM   7442  N  NH1   . ARG A 1  1050 ? 166.716 202.187 149.871 1.00 35.42  1  1050 ARG A NH1   1 
ATOM   7443  N  NH2   . ARG A 1  1050 ? 168.384 202.155 148.298 1.00 35.42  ?  1050 ARG A NH2   1 
ATOM   7444  N  N     . PHE A 1  1051 ? 162.308 204.585 145.064 1.00 40.62  ?  1051 PHE A N     1 
ATOM   7445  C  CA    . PHE A 1  1051 ? 161.103 205.348 145.412 1.00 40.62  ?  1051 PHE A CA    1 
ATOM   7446  C  C     . PHE A 1  1051 ? 159.906 204.995 144.526 1.00 40.62  ?  1051 PHE A C     1 
ATOM   7447  O  O     . PHE A 1  1051 ? 158.803 204.717 145.031 1.00 40.62  ?  1051 PHE A O     1 
ATOM   7448  C  CB    . PHE A 1  1051 ? 161.413 206.844 145.303 1.00 40.62  ?  1051 PHE A CB    1 
ATOM   7449  C  CG    . PHE A 1  1051 ? 160.309 207.749 145.769 1.00 40.62  ?  1051 PHE A CG    1 
ATOM   7450  C  CD1   . PHE A 1  1051 ? 160.224 208.117 147.090 1.00 40.62  ?  1051 PHE A CD1   1 
ATOM   7451  C  CD2   . PHE A 1  1051 ? 159.393 208.278 144.877 1.00 40.62  ?  1051 PHE A CD2   1 
ATOM   7452  C  CE1   . PHE A 1  1051 ? 159.234 208.967 147.521 1.00 40.62  ?  1051 PHE A CE1   1 
ATOM   7453  C  CE2   . PHE A 1  1051 ? 158.398 209.119 145.308 1.00 40.62  ?  1051 PHE A CE2   1 
ATOM   7454  C  CZ    . PHE A 1  1051 ? 158.322 209.464 146.629 1.00 40.62  ?  1051 PHE A CZ    1 
ATOM   7455  N  N     . SER A 1  1052 ? 160.112 204.974 143.211 1.00 39.13  ?  1052 SER A N     1 
ATOM   7456  C  CA    . SER A 1  1052 ? 159.026 204.839 142.249 1.00 39.13  ?  1052 SER A CA    1 
ATOM   7457  C  C     . SER A 1  1052 ? 158.471 203.430 142.154 1.00 39.13  ?  1052 SER A C     1 
ATOM   7458  O  O     . SER A 1  1052 ? 157.272 203.278 141.915 1.00 39.13  ?  1052 SER A O     1 
ATOM   7459  C  CB    . SER A 1  1052 ? 159.490 205.293 140.866 1.00 39.13  ?  1052 SER A CB    1 
ATOM   7460  O  OG    . SER A 1  1052 ? 159.423 206.701 140.756 1.00 39.13  ?  1052 SER A OG    1 
ATOM   7461  N  N     . ARG A 1  1053 ? 159.294 202.397 142.330 1.00 37.25  ?  1053 ARG A N     1 
ATOM   7462  C  CA    . ARG A 1  1053 ? 158.772 201.038 142.283 1.00 37.25  ?  1053 ARG A CA    1 
ATOM   7463  C  C     . ARG A 1  1053 ? 157.886 200.716 143.468 1.00 37.25  ?  1053 ARG A C     1 
ATOM   7464  O  O     . ARG A 1  1053 ? 156.992 199.887 143.330 1.00 37.25  ?  1053 ARG A O     1 
ATOM   7465  C  CB    . ARG A 1  1053 ? 159.896 200.012 142.234 1.00 37.25  ?  1053 ARG A CB    1 
ATOM   7466  C  CG    . ARG A 1  1053 ? 160.539 199.854 140.887 1.00 37.25  ?  1053 ARG A CG    1 
ATOM   7467  C  CD    . ARG A 1  1053 ? 161.356 198.582 140.837 1.00 37.25  ?  1053 ARG A CD    1 
ATOM   7468  N  NE    . ARG A 1  1053 ? 160.551 197.437 140.427 1.00 37.25  ?  1053 ARG A NE    1 
ATOM   7469  C  CZ    . ARG A 1  1053 ? 160.885 196.170 140.644 1.00 37.25  ?  1053 ARG A CZ    1 
ATOM   7470  N  NH1   . ARG A 1  1053 ? 162.010 195.876 141.274 1.00 37.25  1  1053 ARG A NH1   1 
ATOM   7471  N  NH2   . ARG A 1  1053 ? 160.091 195.197 140.234 1.00 37.25  ?  1053 ARG A NH2   1 
ATOM   7472  N  N     . LEU A 1  1054 ? 158.093 201.371 144.608 1.00 40.62  ?  1054 LEU A N     1 
ATOM   7473  C  CA    . LEU A 1  1054 ? 157.341 201.118 145.828 1.00 40.62  ?  1054 LEU A CA    1 
ATOM   7474  C  C     . LEU A 1  1054 ? 156.078 201.958 145.925 1.00 40.62  ?  1054 LEU A C     1 
ATOM   7475  O  O     . LEU A 1  1054 ? 155.026 201.436 146.281 1.00 40.62  ?  1054 LEU A O     1 
ATOM   7476  C  CB    . LEU A 1  1054 ? 158.209 201.391 147.059 1.00 40.62  ?  1054 LEU A CB    1 
ATOM   7477  C  CG    . LEU A 1  1054 ? 159.404 200.521 147.429 1.00 40.62  ?  1054 LEU A CG    1 
ATOM   7478  C  CD1   . LEU A 1  1054 ? 160.181 201.196 148.513 1.00 40.62  ?  1054 LEU A CD1   1 
ATOM   7479  C  CD2   . LEU A 1  1054 ? 158.967 199.181 147.884 1.00 40.62  ?  1054 LEU A CD2   1 
ATOM   7480  N  N     . TRP A 1  1055 ? 156.151 203.255 145.630 1.00 40.62  ?  1055 TRP A N     1 
ATOM   7481  C  CA    . TRP A 1  1055 ? 154.973 204.067 145.893 1.00 40.62  ?  1055 TRP A CA    1 
ATOM   7482  C  C     . TRP A 1  1055 ? 153.883 203.931 144.838 1.00 40.62  ?  1055 TRP A C     1 
ATOM   7483  O  O     . TRP A 1  1055 ? 152.799 204.488 145.019 1.00 40.62  ?  1055 TRP A O     1 
ATOM   7484  C  CB    . TRP A 1  1055 ? 155.365 205.526 146.054 1.00 40.62  ?  1055 TRP A CB    1 
ATOM   7485  C  CG    . TRP A 1  1055 ? 155.599 205.878 147.480 1.00 40.62  ?  1055 TRP A CG    1 
ATOM   7486  C  CD1   . TRP A 1  1055 ? 156.793 205.919 148.123 1.00 40.62  ?  1055 TRP A CD1   1 
ATOM   7487  C  CD2   . TRP A 1  1055 ? 154.608 206.213 148.455 1.00 40.62  ?  1055 TRP A CD2   1 
ATOM   7488  N  NE1   . TRP A 1  1055 ? 156.614 206.271 149.432 1.00 40.62  ?  1055 TRP A NE1   1 
ATOM   7489  C  CE2   . TRP A 1  1055 ? 155.279 206.454 149.663 1.00 40.62  ?  1055 TRP A CE2   1 
ATOM   7490  C  CE3   . TRP A 1  1055 ? 153.214 206.329 148.425 1.00 40.62  ?  1055 TRP A CE3   1 
ATOM   7491  C  CZ2   . TRP A 1  1055 ? 154.607 206.812 150.825 1.00 40.62  ?  1055 TRP A CZ2   1 
ATOM   7492  C  CZ3   . TRP A 1  1055 ? 152.555 206.679 149.584 1.00 40.62  ?  1055 TRP A CZ3   1 
ATOM   7493  C  CH2   . TRP A 1  1055 ? 153.249 206.919 150.760 1.00 40.62  ?  1055 TRP A CH2   1 
ATOM   7494  N  N     . THR A 1  1056 ? 154.124 203.197 143.762 1.00 28.61  ?  1056 THR A N     1 
ATOM   7495  C  CA    . THR A 1  1056 ? 153.081 202.890 142.807 1.00 28.61  ?  1056 THR A CA    1 
ATOM   7496  C  C     . THR A 1  1056 ? 152.573 201.464 142.961 1.00 28.61  ?  1056 THR A C     1 
ATOM   7497  O  O     . THR A 1  1056 ? 151.560 201.117 142.358 1.00 28.61  ?  1056 THR A O     1 
ATOM   7498  C  CB    . THR A 1  1056 ? 153.585 203.126 141.371 1.00 28.61  ?  1056 THR A CB    1 
ATOM   7499  O  OG1   . THR A 1  1056 ? 152.474 203.192 140.477 1.00 28.61  ?  1056 THR A OG1   1 
ATOM   7500  C  CG2   . THR A 1  1056 ? 154.453 201.992 140.907 1.00 28.61  ?  1056 THR A CG2   1 
ATOM   7501  N  N     . GLN A 1  1057 ? 153.252 200.638 143.758 1.00 35.07  ?  1057 GLN A N     1 
ATOM   7502  C  CA    . GLN A 1  1057 ? 152.771 199.304 144.095 1.00 35.07  ?  1057 GLN A CA    1 
ATOM   7503  C  C     . GLN A 1  1057 ? 151.585 199.367 145.050 1.00 35.07  ?  1057 GLN A C     1 
ATOM   7504  O  O     . GLN A 1  1057 ? 150.669 198.542 144.960 1.00 35.07  ?  1057 GLN A O     1 
ATOM   7505  C  CB    . GLN A 1  1057 ? 153.926 198.503 144.685 1.00 35.07  ?  1057 GLN A CB    1 
ATOM   7506  C  CG    . GLN A 1  1057 ? 153.564 197.310 145.513 1.00 35.07  ?  1057 GLN A CG    1 
ATOM   7507  C  CD    . GLN A 1  1057 ? 152.919 196.228 144.697 1.00 35.07  ?  1057 GLN A CD    1 
ATOM   7508  O  OE1   . GLN A 1  1057 ? 153.555 195.609 143.851 1.00 35.07  ?  1057 GLN A OE1   1 
ATOM   7509  N  NE2   . GLN A 1  1057 ? 151.644 195.993 144.945 1.00 35.07  ?  1057 GLN A NE2   1 
ATOM   7510  N  N     . CYS A 1  1058 ? 151.570 200.359 145.936 1.00 40.62  ?  1058 CYS A N     1 
ATOM   7511  C  CA    . CYS A 1  1058 ? 150.434 200.581 146.819 1.00 40.62  ?  1058 CYS A CA    1 
ATOM   7512  C  C     . CYS A 1  1058 ? 149.179 200.951 146.046 1.00 40.62  ?  1058 CYS A C     1 
ATOM   7513  O  O     . CYS A 1  1058 ? 148.075 200.611 146.471 1.00 40.62  ?  1058 CYS A O     1 
ATOM   7514  C  CB    . CYS A 1  1058 ? 150.769 201.679 147.829 1.00 40.62  ?  1058 CYS A CB    1 
ATOM   7515  S  SG    . CYS A 1  1058 ? 151.729 201.135 149.246 1.00 40.62  ?  1058 CYS A SG    1 
ATOM   7516  N  N     . GLN A 1  1059 ? 149.334 201.620 144.905 1.00 40.62  ?  1059 GLN A N     1 
ATOM   7517  C  CA    . GLN A 1  1059 ? 148.198 201.993 144.071 1.00 40.62  ?  1059 GLN A CA    1 
ATOM   7518  C  C     . GLN A 1  1059 ? 147.559 200.787 143.399 1.00 40.62  ?  1059 GLN A C     1 
ATOM   7519  O  O     . GLN A 1  1059 ? 146.353 200.793 143.155 1.00 40.62  ?  1059 GLN A O     1 
ATOM   7520  C  CB    . GLN A 1  1059 ? 148.641 203.002 143.022 1.00 40.62  ?  1059 GLN A CB    1 
ATOM   7521  C  CG    . GLN A 1  1059 ? 148.581 204.417 143.476 1.00 40.62  ?  1059 GLN A CG    1 
ATOM   7522  C  CD    . GLN A 1  1059 ? 148.926 205.375 142.380 1.00 40.62  ?  1059 GLN A CD    1 
ATOM   7523  O  OE1   . GLN A 1  1059 ? 149.632 205.026 141.448 1.00 40.62  ?  1059 GLN A OE1   1 
ATOM   7524  N  NE2   . GLN A 1  1059 ? 148.436 206.588 142.484 1.00 40.62  ?  1059 GLN A NE2   1 
ATOM   7525  N  N     . ARG A 1  1060 ? 148.336 199.759 143.088 1.00 31.23  ?  1060 ARG A N     1 
ATOM   7526  C  CA    . ARG A 1  1060 ? 147.802 198.540 142.494 1.00 31.23  ?  1060 ARG A CA    1 
ATOM   7527  C  C     . ARG A 1  1060 ? 147.305 197.543 143.529 1.00 31.23  ?  1060 ARG A C     1 
ATOM   7528  O  O     . ARG A 1  1060 ? 146.440 196.723 143.222 1.00 31.23  ?  1060 ARG A O     1 
ATOM   7529  C  CB    . ARG A 1  1060 ? 148.865 197.848 141.648 1.00 31.23  ?  1060 ARG A CB    1 
ATOM   7530  C  CG    . ARG A 1  1060 ? 149.096 198.448 140.303 1.00 31.23  ?  1060 ARG A CG    1 
ATOM   7531  C  CD    . ARG A 1  1060 ? 150.317 197.834 139.682 1.00 31.23  ?  1060 ARG A CD    1 
ATOM   7532  N  NE    . ARG A 1  1060 ? 151.525 198.531 140.084 1.00 31.23  ?  1060 ARG A NE    1 
ATOM   7533  C  CZ    . ARG A 1  1060 ? 152.712 197.952 140.203 1.00 31.23  ?  1060 ARG A CZ    1 
ATOM   7534  N  NH1   . ARG A 1  1060 ? 152.844 196.659 139.956 1.00 31.23  1  1060 ARG A NH1   1 
ATOM   7535  N  NH2   . ARG A 1  1060 ? 153.761 198.660 140.577 1.00 31.23  ?  1060 ARG A NH2   1 
ATOM   7536  N  N     . CYS A 1  1061 ? 147.862 197.563 144.737 1.00 24.79  ?  1061 CYS A N     1 
ATOM   7537  C  CA    . CYS A 1  1061 ? 147.339 196.748 145.824 1.00 24.79  ?  1061 CYS A CA    1 
ATOM   7538  C  C     . CYS A 1  1061 ? 146.087 197.373 146.433 1.00 24.79  ?  1061 CYS A C     1 
ATOM   7539  O  O     . CYS A 1  1061 ? 145.272 196.676 147.036 1.00 24.79  ?  1061 CYS A O     1 
ATOM   7540  C  CB    . CYS A 1  1061 ? 148.447 196.545 146.864 1.00 24.79  ?  1061 CYS A CB    1 
ATOM   7541  S  SG    . CYS A 1  1061 ? 148.057 195.907 148.503 1.00 24.79  ?  1061 CYS A SG    1 
ATOM   7542  N  N     . GLN A 1  1062 ? 145.898 198.670 146.250 1.00 40.62  ?  1062 GLN A N     1 
ATOM   7543  C  CA    . GLN A 1  1062 ? 144.728 199.342 146.787 1.00 40.62  ?  1062 GLN A CA    1 
ATOM   7544  C  C     . GLN A 1  1062 ? 143.540 199.236 145.844 1.00 40.62  ?  1062 GLN A C     1 
ATOM   7545  O  O     . GLN A 1  1062 ? 142.394 199.146 146.292 1.00 40.62  ?  1062 GLN A O     1 
ATOM   7546  C  CB    . GLN A 1  1062 ? 145.093 200.799 147.056 1.00 40.62  ?  1062 GLN A CB    1 
ATOM   7547  C  CG    . GLN A 1  1062 ? 144.006 201.670 147.487 1.00 40.62  ?  1062 GLN A CG    1 
ATOM   7548  C  CD    . GLN A 1  1062 ? 144.200 203.055 146.998 1.00 40.62  ?  1062 GLN A CD    1 
ATOM   7549  O  OE1   . GLN A 1  1062 ? 144.537 203.263 145.848 1.00 40.62  ?  1062 GLN A OE1   1 
ATOM   7550  N  NE2   . GLN A 1  1062 ? 143.985 204.019 147.861 1.00 40.62  ?  1062 GLN A NE2   1 
ATOM   7551  N  N     . GLY A 1  1063 ? 143.789 199.242 144.539 1.00 34.30  ?  1063 GLY A N     1 
ATOM   7552  C  CA    . GLY A 1  1063 ? 142.723 199.179 143.559 1.00 34.30  ?  1063 GLY A CA    1 
ATOM   7553  C  C     . GLY A 1  1063 ? 142.582 200.404 142.678 1.00 34.30  ?  1063 GLY A C     1 
ATOM   7554  O  O     . GLY A 1  1063 ? 142.342 200.276 141.480 1.00 34.30  ?  1063 GLY A O     1 
ATOM   7555  N  N     . SER A 1  1064 ? 142.748 201.589 143.250 1.00 38.45  ?  1064 SER A N     1 
ATOM   7556  C  CA    . SER A 1  1064 ? 142.477 202.850 142.582 1.00 38.45  ?  1064 SER A CA    1 
ATOM   7557  C  C     . SER A 1  1064 ? 143.764 203.569 142.195 1.00 38.45  ?  1064 SER A C     1 
ATOM   7558  O  O     . SER A 1  1064 ? 144.790 203.437 142.860 1.00 38.45  ?  1064 SER A O     1 
ATOM   7559  C  CB    . SER A 1  1064 ? 141.640 203.750 143.483 1.00 38.45  ?  1064 SER A CB    1 
ATOM   7560  O  OG    . SER A 1  1064 ? 141.429 205.005 142.882 1.00 38.45  ?  1064 SER A OG    1 
ATOM   7561  N  N     . LEU A 1  1065 ? 143.704 204.341 141.109 1.00 40.62  ?  1065 LEU A N     1 
ATOM   7562  C  CA    . LEU A 1  1065 ? 144.803 205.207 140.701 1.00 40.62  ?  1065 LEU A CA    1 
ATOM   7563  C  C     . LEU A 1  1065 ? 144.508 206.680 140.923 1.00 40.62  ?  1065 LEU A C     1 
ATOM   7564  O  O     . LEU A 1  1065 ? 145.347 207.515 140.599 1.00 40.62  ?  1065 LEU A O     1 
ATOM   7565  C  CB    . LEU A 1  1065 ? 145.156 205.005 139.220 1.00 40.62  ?  1065 LEU A CB    1 
ATOM   7566  C  CG    . LEU A 1  1065 ? 145.630 203.686 138.606 1.00 40.62  ?  1065 LEU A CG    1 
ATOM   7567  C  CD1   . LEU A 1  1065 ? 145.937 203.894 137.142 1.00 40.62  ?  1065 LEU A CD1   1 
ATOM   7568  C  CD2   . LEU A 1  1065 ? 146.833 203.111 139.294 1.00 40.62  ?  1065 LEU A CD2   1 
ATOM   7569  N  N     . HIS A 1  1066 ? 143.356 207.028 141.476 1.00 40.62  ?  1066 HIS A N     1 
ATOM   7570  C  CA    . HIS A 1  1066 ? 142.968 208.423 141.564 1.00 40.62  ?  1066 HIS A CA    1 
ATOM   7571  C  C     . HIS A 1  1066 ? 142.739 208.915 142.980 1.00 40.62  ?  1066 HIS A C     1 
ATOM   7572  O  O     . HIS A 1  1066 ? 142.458 210.102 143.158 1.00 40.62  ?  1066 HIS A O     1 
ATOM   7573  C  CB    . HIS A 1  1066 ? 141.700 208.682 140.736 1.00 40.62  ?  1066 HIS A CB    1 
ATOM   7574  C  CG    . HIS A 1  1066 ? 141.859 208.394 139.277 1.00 40.62  ?  1066 HIS A CG    1 
ATOM   7575  N  ND1   . HIS A 1  1066 ? 141.908 209.385 138.327 1.00 40.62  ?  1066 HIS A ND1   1 
ATOM   7576  C  CD2   . HIS A 1  1066 ? 141.969 207.224 138.606 1.00 40.62  ?  1066 HIS A CD2   1 
ATOM   7577  C  CE1   . HIS A 1  1066 ? 142.053 208.840 137.133 1.00 40.62  ?  1066 HIS A CE1   1 
ATOM   7578  N  NE2   . HIS A 1  1066 ? 142.093 207.530 137.274 1.00 40.62  ?  1066 HIS A NE2   1 
ATOM   7579  N  N     . GLU A 1  1067 ? 142.842 208.056 143.988 1.00 34.81  ?  1067 GLU A N     1 
ATOM   7580  C  CA    . GLU A 1  1067 ? 142.606 208.450 145.371 1.00 34.81  ?  1067 GLU A CA    1 
ATOM   7581  C  C     . GLU A 1  1067 ? 143.745 207.966 146.259 1.00 34.81  ?  1067 GLU A C     1 
ATOM   7582  O  O     . GLU A 1  1067 ? 144.554 207.123 145.869 1.00 34.81  ?  1067 GLU A O     1 
ATOM   7583  C  CB    . GLU A 1  1067 ? 141.261 207.919 145.875 1.00 34.81  ?  1067 GLU A CB    1 
ATOM   7584  C  CG    . GLU A 1  1067 ? 140.074 208.649 145.293 1.00 34.81  ?  1067 GLU A CG    1 
ATOM   7585  C  CD    . GLU A 1  1067 ? 138.756 208.064 145.728 1.00 34.81  ?  1067 GLU A CD    1 
ATOM   7586  O  OE1   . GLU A 1  1067 ? 138.758 206.922 146.236 1.00 34.81  ?  1067 GLU A OE1   1 
ATOM   7587  O  OE2   . GLU A 1  1067 ? 137.719 208.742 145.562 1.00 34.81  -1 1067 GLU A OE2   1 
ATOM   7588  N  N     . ASP A 1  1068 ? 143.781 208.517 147.475 1.00 24.49  ?  1068 ASP A N     1 
ATOM   7589  C  CA    . ASP A 1  1068 ? 144.878 208.336 148.422 1.00 24.49  ?  1068 ASP A CA    1 
ATOM   7590  C  C     . ASP A 1  1068 ? 145.003 206.899 148.906 1.00 24.49  ?  1068 ASP A C     1 
ATOM   7591  O  O     . ASP A 1  1068 ? 144.040 206.138 148.918 1.00 24.49  ?  1068 ASP A O     1 
ATOM   7592  C  CB    . ASP A 1  1068 ? 144.668 209.233 149.633 1.00 24.49  ?  1068 ASP A CB    1 
ATOM   7593  C  CG    . ASP A 1  1068 ? 144.443 210.666 149.258 1.00 24.49  ?  1068 ASP A CG    1 
ATOM   7594  O  OD1   . ASP A 1  1068 ? 145.290 211.231 148.554 1.00 24.49  ?  1068 ASP A OD1   1 
ATOM   7595  O  OD2   . ASP A 1  1068 ? 143.411 211.230 149.661 1.00 24.49  -1 1068 ASP A OD2   1 
ATOM   7596  N  N     . VAL A 1  1069 ? 146.212 206.534 149.315 1.00 20.49  ?  1069 VAL A N     1 
ATOM   7597  C  CA    . VAL A 1  1069 ? 146.483 205.235 149.916 1.00 20.49  ?  1069 VAL A CA    1 
ATOM   7598  C  C     . VAL A 1  1069 ? 146.384 205.376 151.425 1.00 20.49  ?  1069 VAL A C     1 
ATOM   7599  O  O     . VAL A 1  1069 ? 146.936 206.313 152.004 1.00 20.49  ?  1069 VAL A O     1 
ATOM   7600  C  CB    . VAL A 1  1069 ? 147.868 204.713 149.504 1.00 20.49  ?  1069 VAL A CB    1 
ATOM   7601  C  CG1   . VAL A 1  1069 ? 148.098 203.317 150.036 1.00 20.49  ?  1069 VAL A CG1   1 
ATOM   7602  C  CG2   . VAL A 1  1069 ? 147.995 204.705 148.017 1.00 20.49  ?  1069 VAL A CG2   1 
ATOM   7603  N  N     . ILE A 1  1070 ? 145.629 204.481 152.063 1.00 21.75  ?  1070 ILE A N     1 
ATOM   7604  C  CA    . ILE A 1  1070 ? 145.573 204.377 153.523 1.00 21.75  ?  1070 ILE A CA    1 
ATOM   7605  C  C     . ILE A 1  1070 ? 145.685 202.896 153.864 1.00 21.75  ?  1070 ILE A C     1 
ATOM   7606  O  O     . ILE A 1  1070 ? 144.696 202.165 153.849 1.00 21.75  ?  1070 ILE A O     1 
ATOM   7607  C  CB    . ILE A 1  1070 ? 144.292 204.959 154.122 1.00 21.75  ?  1070 ILE A CB    1 
ATOM   7608  C  CG1   . ILE A 1  1070 ? 143.967 206.354 153.610 1.00 21.75  ?  1070 ILE A CG1   1 
ATOM   7609  C  CG2   . ILE A 1  1070 ? 144.455 204.995 155.588 1.00 21.75  ?  1070 ILE A CG2   1 
ATOM   7610  C  CD1   . ILE A 1  1070 ? 142.539 206.688 153.776 1.00 21.75  ?  1070 ILE A CD1   1 
ATOM   7611  N  N     . CYS A 1  1071 ? 146.881 202.446 154.185 1.00 40.62  ?  1071 CYS A N     1 
ATOM   7612  C  CA    . CYS A 1  1071 ? 147.077 201.050 154.535 1.00 40.62  ?  1071 CYS A CA    1 
ATOM   7613  C  C     . CYS A 1  1071 ? 148.320 201.009 155.395 1.00 40.62  ?  1071 CYS A C     1 
ATOM   7614  O  O     . CYS A 1  1071 ? 149.428 201.121 154.877 1.00 40.62  ?  1071 CYS A O     1 
ATOM   7615  C  CB    . CYS A 1  1071 ? 147.237 200.172 153.305 1.00 40.62  ?  1071 CYS A CB    1 
ATOM   7616  S  SG    . CYS A 1  1071 ? 147.902 198.547 153.626 1.00 40.62  ?  1071 CYS A SG    1 
ATOM   7617  N  N     . THR A 1  1072 ? 148.142 200.862 156.694 1.00 40.62  ?  1072 THR A N     1 
ATOM   7618  C  CA    . THR A 1  1072 ? 149.254 200.781 157.621 1.00 40.62  ?  1072 THR A CA    1 
ATOM   7619  C  C     . THR A 1  1072 ? 149.403 199.352 158.112 1.00 40.62  ?  1072 THR A C     1 
ATOM   7620  O  O     . THR A 1  1072 ? 149.605 199.099 159.295 1.00 40.62  ?  1072 THR A O     1 
ATOM   7621  C  CB    . THR A 1  1072 ? 149.073 201.757 158.771 1.00 40.62  ?  1072 THR A CB    1 
ATOM   7622  O  OG1   . THR A 1  1072 ? 148.006 201.309 159.599 1.00 40.62  ?  1072 THR A OG1   1 
ATOM   7623  C  CG2   . THR A 1  1072 ? 148.732 203.117 158.244 1.00 40.62  ?  1072 THR A CG2   1 
ATOM   7624  N  N     . SER A 1  1073 ? 149.264 198.407 157.194 1.00 35.83  ?  1073 SER A N     1 
ATOM   7625  C  CA    . SER A 1  1073 ? 149.290 196.987 157.491 1.00 35.83  ?  1073 SER A CA    1 
ATOM   7626  C  C     . SER A 1  1073 ? 150.636 196.523 158.022 1.00 35.83  ?  1073 SER A C     1 
ATOM   7627  O  O     . SER A 1  1073 ? 151.604 196.414 157.265 1.00 35.83  ?  1073 SER A O     1 
ATOM   7628  C  CB    . SER A 1  1073 ? 148.936 196.199 156.238 1.00 35.83  ?  1073 SER A CB    1 
ATOM   7629  O  OG    . SER A 1  1073 ? 149.386 194.872 156.343 1.00 35.83  ?  1073 SER A OG    1 
ATOM   7630  N  N     . ARG A 1  1074 ? 150.692 196.195 159.313 1.00 37.10  ?  1074 ARG A N     1 
ATOM   7631  C  CA    . ARG A 1  1074 ? 151.932 195.824 159.987 1.00 37.10  ?  1074 ARG A CA    1 
ATOM   7632  C  C     . ARG A 1  1074 ? 152.491 194.487 159.544 1.00 37.10  ?  1074 ARG A C     1 
ATOM   7633  O  O     . ARG A 1  1074 ? 153.621 194.166 159.906 1.00 37.10  ?  1074 ARG A O     1 
ATOM   7634  C  CB    . ARG A 1  1074 ? 151.729 195.771 161.489 1.00 37.10  ?  1074 ARG A CB    1 
ATOM   7635  C  CG    . ARG A 1  1074 ? 151.825 197.104 162.175 1.00 37.10  ?  1074 ARG A CG    1 
ATOM   7636  C  CD    . ARG A 1  1074 ? 150.481 197.785 162.194 1.00 37.10  ?  1074 ARG A CD    1 
ATOM   7637  N  NE    . ARG A 1  1074 ? 149.509 197.023 162.965 1.00 37.10  ?  1074 ARG A NE    1 
ATOM   7638  C  CZ    . ARG A 1  1074 ? 148.202 197.054 162.744 1.00 37.10  ?  1074 ARG A CZ    1 
ATOM   7639  N  NH1   . ARG A 1  1074 ? 147.712 197.794 161.757 1.00 37.10  1  1074 ARG A NH1   1 
ATOM   7640  N  NH2   . ARG A 1  1074 ? 147.387 196.331 163.497 1.00 37.10  ?  1074 ARG A NH2   1 
ATOM   7641  N  N     . ASP A 1  1075 ? 151.744 193.693 158.805 1.00 39.50  ?  1075 ASP A N     1 
ATOM   7642  C  CA    . ASP A 1  1075 ? 152.265 192.444 158.300 1.00 39.50  ?  1075 ASP A CA    1 
ATOM   7643  C  C     . ASP A 1  1075 ? 152.741 192.555 156.860 1.00 39.50  ?  1075 ASP A C     1 
ATOM   7644  O  O     . ASP A 1  1075 ? 153.198 191.558 156.296 1.00 39.50  ?  1075 ASP A O     1 
ATOM   7645  C  CB    . ASP A 1  1075 ? 151.203 191.349 158.428 1.00 39.50  ?  1075 ASP A CB    1 
ATOM   7646  C  CG    . ASP A 1  1075 ? 150.977 190.912 159.872 1.00 39.50  ?  1075 ASP A CG    1 
ATOM   7647  O  OD1   . ASP A 1  1075 ? 150.270 191.624 160.610 1.00 39.50  ?  1075 ASP A OD1   1 
ATOM   7648  O  OD2   . ASP A 1  1075 ? 151.498 189.849 160.269 1.00 39.50  -1 1075 ASP A OD2   1 
ATOM   7649  N  N     . CYS A 1  1076 ? 152.651 193.766 156.246 1.00 30.94  ?  1076 CYS A N     1 
ATOM   7650  C  CA    . CYS A 1  1076 ? 153.153 194.000 154.896 1.00 30.94  ?  1076 CYS A CA    1 
ATOM   7651  C  C     . CYS A 1  1076 ? 154.560 194.553 154.964 1.00 30.94  ?  1076 CYS A C     1 
ATOM   7652  O  O     . CYS A 1  1076 ? 154.791 195.524 155.697 1.00 30.94  ?  1076 CYS A O     1 
ATOM   7653  C  CB    . CYS A 1  1076 ? 152.259 194.973 154.128 1.00 30.94  ?  1076 CYS A CB    1 
ATOM   7654  S  SG    . CYS A 1  1076 ? 152.465 194.923 152.320 1.00 30.94  ?  1076 CYS A SG    1 
ATOM   7655  N  N     . PRO A 1  1077 ? 155.517 193.962 154.244 1.00 28.79  ?  1077 PRO A N     1 
ATOM   7656  C  CA    . PRO A 1  1077 ? 156.829 194.602 154.102 1.00 28.79  ?  1077 PRO A CA    1 
ATOM   7657  C  C     . PRO A 1  1077 ? 156.769 195.949 153.402 1.00 28.79  ?  1077 PRO A C     1 
ATOM   7658  O  O     . PRO A 1  1077 ? 157.641 196.774 153.650 1.00 28.79  ?  1077 PRO A O     1 
ATOM   7659  C  CB    . PRO A 1  1077 ? 157.628 193.589 153.270 1.00 28.79  ?  1077 PRO A CB    1 
ATOM   7660  C  CG    . PRO A 1  1077 ? 156.866 192.348 153.303 1.00 28.79  ?  1077 PRO A CG    1 
ATOM   7661  C  CD    . PRO A 1  1077 ? 155.441 192.703 153.494 1.00 28.79  ?  1077 PRO A CD    1 
ATOM   7662  N  N     . ILE A 1  1078 ? 155.779 196.151 152.529 1.00 40.62  ?  1078 ILE A N     1 
ATOM   7663  C  CA    . ILE A 1  1078 ? 155.531 197.401 151.808 1.00 40.62  ?  1078 ILE A CA    1 
ATOM   7664  C  C     . ILE A 1  1078 ? 155.461 198.589 152.752 1.00 40.62  ?  1078 ILE A C     1 
ATOM   7665  O  O     . ILE A 1  1078 ? 156.145 199.591 152.544 1.00 40.62  ?  1078 ILE A O     1 
ATOM   7666  C  CB    . ILE A 1  1078 ? 154.264 197.230 150.931 1.00 40.62  ?  1078 ILE A CB    1 
ATOM   7667  C  CG1   . ILE A 1  1078 ? 154.660 196.376 149.717 1.00 40.62  ?  1078 ILE A CG1   1 
ATOM   7668  C  CG2   . ILE A 1  1078 ? 153.371 198.511 150.662 1.00 40.62  ?  1078 ILE A CG2   1 
ATOM   7669  C  CD1   . ILE A 1  1078 ? 155.772 196.970 148.929 1.00 40.62  ?  1078 ILE A CD1   1 
ATOM   7670  N  N     . PHE A 1  1079 ? 154.666 198.485 153.809 1.00 40.62  ?  1079 PHE A N     1 
ATOM   7671  C  CA    . PHE A 1  1079 ? 154.635 199.515 154.838 1.00 40.62  ?  1079 PHE A CA    1 
ATOM   7672  C  C     . PHE A 1  1079 ? 155.976 199.516 155.556 1.00 40.62  ?  1079 PHE A C     1 
ATOM   7673  O  O     . PHE A 1  1079 ? 156.611 198.475 155.666 1.00 40.62  ?  1079 PHE A O     1 
ATOM   7674  C  CB    . PHE A 1  1079 ? 153.482 199.226 155.797 1.00 40.62  ?  1079 PHE A CB    1 
ATOM   7675  C  CG    . PHE A 1  1079 ? 153.321 200.215 156.906 1.00 40.62  ?  1079 PHE A CG    1 
ATOM   7676  C  CD1   . PHE A 1  1079 ? 152.762 201.446 156.680 1.00 40.62  ?  1079 PHE A CD1   1 
ATOM   7677  C  CD2   . PHE A 1  1079 ? 153.684 199.885 158.192 1.00 40.62  ?  1079 PHE A CD2   1 
ATOM   7678  C  CE1   . PHE A 1  1079 ? 152.600 202.342 157.716 1.00 40.62  ?  1079 PHE A CE1   1 
ATOM   7679  C  CE2   . PHE A 1  1079 ? 153.520 200.776 159.219 1.00 40.62  ?  1079 PHE A CE2   1 
ATOM   7680  C  CZ    . PHE A 1  1079 ? 152.980 202.000 158.985 1.00 40.62  ?  1079 PHE A CZ    1 
ATOM   7681  N  N     . TYR A 1  1080 ? 156.462 200.706 155.908 1.00 40.59  ?  1080 TYR A N     1 
ATOM   7682  C  CA    . TYR A 1  1080 ? 157.717 201.099 156.564 1.00 40.59  ?  1080 TYR A CA    1 
ATOM   7683  C  C     . TYR A 1  1080 ? 158.972 200.802 155.749 1.00 40.59  ?  1080 TYR A C     1 
ATOM   7684  O  O     . TYR A 1  1080 ? 160.045 201.238 156.142 1.00 40.59  ?  1080 TYR A O     1 
ATOM   7685  C  CB    . TYR A 1  1080 ? 157.916 200.555 158.003 1.00 40.59  ?  1080 TYR A CB    1 
ATOM   7686  C  CG    . TYR A 1  1080 ? 157.865 199.063 158.306 1.00 40.59  ?  1080 TYR A CG    1 
ATOM   7687  C  CD1   . TYR A 1  1080 ? 158.815 198.183 157.805 1.00 40.59  ?  1080 TYR A CD1   1 
ATOM   7688  C  CD2   . TYR A 1  1080 ? 156.881 198.552 159.145 1.00 40.59  ?  1080 TYR A CD2   1 
ATOM   7689  C  CE1   . TYR A 1  1080 ? 158.749 196.855 158.078 1.00 40.59  ?  1080 TYR A CE1   1 
ATOM   7690  C  CE2   . TYR A 1  1080 ? 156.813 197.219 159.438 1.00 40.59  ?  1080 TYR A CE2   1 
ATOM   7691  C  CZ    . TYR A 1  1080 ? 157.747 196.373 158.900 1.00 40.59  ?  1080 TYR A CZ    1 
ATOM   7692  O  OH    . TYR A 1  1080 ? 157.686 195.033 159.189 1.00 40.59  ?  1080 TYR A OH    1 
ATOM   7693  N  N     . MET A 1  1081 ? 158.882 200.113 154.621 1.00 40.72  ?  1081 MET A N     1 
ATOM   7694  C  CA    . MET A 1  1081 ? 159.900 200.149 153.585 1.00 40.72  ?  1081 MET A CA    1 
ATOM   7695  C  C     . MET A 1  1081 ? 159.621 201.284 152.613 1.00 40.72  ?  1081 MET A C     1 
ATOM   7696  O  O     . MET A 1  1081 ? 160.527 201.764 151.940 1.00 40.72  ?  1081 MET A O     1 
ATOM   7697  C  CB    . MET A 1  1081 ? 159.927 198.803 152.872 1.00 40.72  ?  1081 MET A CB    1 
ATOM   7698  C  CG    . MET A 1  1081 ? 161.005 198.514 151.909 1.00 40.72  ?  1081 MET A CG    1 
ATOM   7699  S  SD    . MET A 1  1081 ? 160.880 196.752 151.556 1.00 40.72  ?  1081 MET A SD    1 
ATOM   7700  C  CE    . MET A 1  1081 ? 162.042 196.572 150.224 1.00 40.72  ?  1081 MET A CE    1 
ATOM   7701  N  N     . ARG A 1  1082 ? 158.371 201.744 152.559 1.00 40.62  ?  1082 ARG A N     1 
ATOM   7702  C  CA    . ARG A 1  1082 ? 158.049 202.925 151.776 1.00 40.62  ?  1082 ARG A CA    1 
ATOM   7703  C  C     . ARG A 1  1082 ? 158.266 204.191 152.587 1.00 40.62  ?  1082 ARG A C     1 
ATOM   7704  O  O     . ARG A 1  1082 ? 158.145 205.300 152.060 1.00 40.62  ?  1082 ARG A O     1 
ATOM   7705  C  CB    . ARG A 1  1082 ? 156.611 202.861 151.258 1.00 40.62  ?  1082 ARG A CB    1 
ATOM   7706  C  CG    . ARG A 1  1082 ? 155.498 202.771 152.282 1.00 40.62  ?  1082 ARG A CG    1 
ATOM   7707  C  CD    . ARG A 1  1082 ? 154.237 203.235 151.618 1.00 40.62  ?  1082 ARG A CD    1 
ATOM   7708  N  NE    . ARG A 1  1082 ? 152.969 202.738 152.157 1.00 40.62  ?  1082 ARG A NE    1 
ATOM   7709  C  CZ    . ARG A 1  1082 ? 152.232 203.335 153.083 1.00 40.62  ?  1082 ARG A CZ    1 
ATOM   7710  N  NH1   . ARG A 1  1082 ? 151.094 202.797 153.455 1.00 40.62  1  1082 ARG A NH1   1 
ATOM   7711  N  NH2   . ARG A 1  1082 ? 152.618 204.463 153.633 1.00 40.62  ?  1082 ARG A NH2   1 
ATOM   7712  N  N     . LYS A 1  1083 ? 158.592 204.046 153.871 1.00 41.56  ?  1083 LYS A N     1 
ATOM   7713  C  CA    . LYS A 1  1083 ? 158.759 205.216 154.726 1.00 41.56  ?  1083 LYS A CA    1 
ATOM   7714  C  C     . LYS A 1  1083 ? 160.214 205.660 154.813 1.00 41.56  ?  1083 LYS A C     1 
ATOM   7715  O  O     . LYS A 1  1083 ? 160.491 206.858 154.941 1.00 41.56  ?  1083 LYS A O     1 
ATOM   7716  C  CB    . LYS A 1  1083 ? 158.211 204.922 156.121 1.00 41.56  ?  1083 LYS A CB    1 
ATOM   7717  C  CG    . LYS A 1  1083 ? 158.062 206.150 156.991 1.00 41.56  ?  1083 LYS A CG    1 
ATOM   7718  C  CD    . LYS A 1  1083 ? 157.669 205.780 158.400 1.00 41.56  ?  1083 LYS A CD    1 
ATOM   7719  C  CE    . LYS A 1  1083 ? 157.307 207.008 159.192 1.00 41.56  ?  1083 LYS A CE    1 
ATOM   7720  N  NZ    . LYS A 1  1083 ? 156.221 207.769 158.526 1.00 41.56  1  1083 LYS A NZ    1 
ATOM   7721  N  N     . LYS A 1  1084 ? 161.158 204.723 154.733 1.00 43.61  ?  1084 LYS A N     1 
ATOM   7722  C  CA    . LYS A 1  1084 ? 162.566 205.058 154.906 1.00 43.61  ?  1084 LYS A CA    1 
ATOM   7723  C  C     . LYS A 1  1084 ? 163.228 205.596 153.640 1.00 43.61  ?  1084 LYS A C     1 
ATOM   7724  O  O     . LYS A 1  1084 ? 164.227 206.325 153.742 1.00 43.61  ?  1084 LYS A O     1 
ATOM   7725  C  CB    . LYS A 1  1084 ? 163.342 203.835 155.407 1.00 43.61  ?  1084 LYS A CB    1 
ATOM   7726  C  CG    . LYS A 1  1084 ? 163.392 202.674 154.433 1.00 43.61  ?  1084 LYS A CG    1 
ATOM   7727  C  CD    . LYS A 1  1084 ? 163.930 201.417 155.085 1.00 43.61  ?  1084 LYS A CD    1 
ATOM   7728  C  CE    . LYS A 1  1084 ? 163.801 200.225 154.154 1.00 43.61  ?  1084 LYS A CE    1 
ATOM   7729  N  NZ    . LYS A 1  1084 ? 164.607 200.398 152.916 1.00 43.61  1  1084 LYS A NZ    1 
ATOM   7730  N  N     . VAL A 1  1085 ? 162.705 205.261 152.457 1.00 32.87  ?  1085 VAL A N     1 
ATOM   7731  C  CA    . VAL A 1  1085 ? 163.302 205.743 151.217 1.00 32.87  ?  1085 VAL A CA    1 
ATOM   7732  C  C     . VAL A 1  1085 ? 163.012 207.219 151.011 1.00 32.87  ?  1085 VAL A C     1 
ATOM   7733  O  O     . VAL A 1  1085 ? 163.822 207.910 150.388 1.00 32.87  ?  1085 VAL A O     1 
ATOM   7734  C  CB    . VAL A 1  1085 ? 162.822 204.884 150.036 1.00 32.87  ?  1085 VAL A CB    1 
ATOM   7735  C  CG1   . VAL A 1  1085 ? 163.665 205.119 148.807 1.00 32.87  ?  1085 VAL A CG1   1 
ATOM   7736  C  CG2   . VAL A 1  1085 ? 162.899 203.432 150.417 1.00 32.87  ?  1085 VAL A CG2   1 
ATOM   7737  N  N     . ARG A 1  1086 ? 161.914 207.726 151.576 1.00 31.66  ?  1086 ARG A N     1 
ATOM   7738  C  CA    . ARG A 1  1086 ? 161.673 209.165 151.600 1.00 31.66  ?  1086 ARG A CA    1 
ATOM   7739  C  C     . ARG A 1  1086 ? 162.784 209.905 152.331 1.00 31.66  ?  1086 ARG A C     1 
ATOM   7740  O  O     . ARG A 1  1086 ? 163.254 210.945 151.862 1.00 31.66  ?  1086 ARG A O     1 
ATOM   7741  C  CB    . ARG A 1  1086 ? 160.323 209.465 152.249 1.00 31.66  ?  1086 ARG A CB    1 
ATOM   7742  C  CG    . ARG A 1  1086 ? 159.164 209.505 151.290 1.00 31.66  ?  1086 ARG A CG    1 
ATOM   7743  C  CD    . ARG A 1  1086 ? 157.912 210.005 151.958 1.00 31.66  ?  1086 ARG A CD    1 
ATOM   7744  N  NE    . ARG A 1  1086 ? 156.763 209.959 151.062 1.00 31.66  ?  1086 ARG A NE    1 
ATOM   7745  C  CZ    . ARG A 1  1086 ? 155.525 210.279 151.419 1.00 31.66  ?  1086 ARG A CZ    1 
ATOM   7746  N  NH1   . ARG A 1  1086 ? 154.546 210.205 150.534 1.00 31.66  1  1086 ARG A NH1   1 
ATOM   7747  N  NH2   . ARG A 1  1086 ? 155.265 210.681 152.655 1.00 31.66  ?  1086 ARG A NH2   1 
ATOM   7748  N  N     . LYS A 1  1087 ? 163.278 209.340 153.430 1.00 31.41  ?  1087 LYS A N     1 
ATOM   7749  C  CA    . LYS A 1  1087 ? 164.323 209.984 154.216 1.00 31.41  ?  1087 LYS A CA    1 
ATOM   7750  C  C     . LYS A 1  1087 ? 165.718 209.789 153.642 1.00 31.41  ?  1087 LYS A C     1 
ATOM   7751  O  O     . LYS A 1  1087 ? 166.539 210.717 153.713 1.00 31.41  ?  1087 LYS A O     1 
ATOM   7752  C  CB    . LYS A 1  1087 ? 164.279 209.470 155.655 1.00 31.41  ?  1087 LYS A CB    1 
ATOM   7753  C  CG    . LYS A 1  1087 ? 163.011 209.876 156.376 1.00 31.41  ?  1087 LYS A CG    1 
ATOM   7754  C  CD    . LYS A 1  1087 ? 162.872 211.389 156.400 1.00 31.41  ?  1087 LYS A CD    1 
ATOM   7755  C  CE    . LYS A 1  1087 ? 161.449 211.820 156.109 1.00 31.41  ?  1087 LYS A CE    1 
ATOM   7756  N  NZ    . LYS A 1  1087 ? 161.169 211.746 154.649 1.00 31.41  1  1087 LYS A NZ    1 
ATOM   7757  N  N     . ASP A 1  1088 ? 165.999 208.602 153.083 1.00 28.92  ?  1088 ASP A N     1 
ATOM   7758  C  CA    . ASP A 1  1088 ? 167.230 208.399 152.325 1.00 28.92  ?  1088 ASP A CA    1 
ATOM   7759  C  C     . ASP A 1  1088 ? 167.338 209.384 151.175 1.00 28.92  ?  1088 ASP A C     1 
ATOM   7760  O  O     . ASP A 1  1088 ? 168.393 209.991 150.965 1.00 28.92  ?  1088 ASP A O     1 
ATOM   7761  C  CB    . ASP A 1  1088 ? 167.297 206.976 151.775 1.00 28.92  ?  1088 ASP A CB    1 
ATOM   7762  C  CG    . ASP A 1  1088 ? 167.673 205.961 152.819 1.00 28.92  ?  1088 ASP A CG    1 
ATOM   7763  O  OD1   . ASP A 1  1088 ? 168.419 206.312 153.752 1.00 28.92  ?  1088 ASP A OD1   1 
ATOM   7764  O  OD2   . ASP A 1  1088 ? 167.234 204.801 152.697 1.00 28.92  -1 1088 ASP A OD2   1 
ATOM   7765  N  N     . LEU A 1  1089 ? 166.247 209.571 150.435 1.00 24.86  ?  1089 LEU A N     1 
ATOM   7766  C  CA    . LEU A 1  1089 ? 166.234 210.516 149.334 1.00 24.86  ?  1089 LEU A CA    1 
ATOM   7767  C  C     . LEU A 1  1089 ? 166.321 211.956 149.819 1.00 24.86  ?  1089 LEU A C     1 
ATOM   7768  O  O     . LEU A 1  1089 ? 166.993 212.767 149.183 1.00 24.86  ?  1089 LEU A O     1 
ATOM   7769  C  CB    . LEU A 1  1089 ? 164.974 210.288 148.506 1.00 24.86  ?  1089 LEU A CB    1 
ATOM   7770  C  CG    . LEU A 1  1089 ? 164.959 210.579 147.017 1.00 24.86  ?  1089 LEU A CG    1 
ATOM   7771  C  CD1   . LEU A 1  1089 ? 166.143 209.964 146.353 1.00 24.86  ?  1089 LEU A CD1   1 
ATOM   7772  C  CD2   . LEU A 1  1089 ? 163.713 209.977 146.458 1.00 24.86  ?  1089 LEU A CD2   1 
ATOM   7773  N  N     . GLU A 1  1090 ? 165.679 212.266 150.948 1.00 24.39  ?  1090 GLU A N     1 
ATOM   7774  C  CA    . GLU A 1  1090 ? 165.758 213.587 151.563 1.00 24.39  ?  1090 GLU A CA    1 
ATOM   7775  C  C     . GLU A 1  1090 ? 167.184 213.976 151.927 1.00 24.39  ?  1090 GLU A C     1 
ATOM   7776  O  O     . GLU A 1  1090 ? 167.580 215.130 151.741 1.00 24.39  ?  1090 GLU A O     1 
ATOM   7777  C  CB    . GLU A 1  1090 ? 164.878 213.610 152.809 1.00 24.39  ?  1090 GLU A CB    1 
ATOM   7778  C  CG    . GLU A 1  1090 ? 164.921 214.894 153.604 1.00 24.39  ?  1090 GLU A CG    1 
ATOM   7779  C  CD    . GLU A 1  1090 ? 164.295 216.056 152.889 1.00 24.39  ?  1090 GLU A CD    1 
ATOM   7780  O  OE1   . GLU A 1  1090 ? 163.368 215.832 152.089 1.00 24.39  ?  1090 GLU A OE1   1 
ATOM   7781  O  OE2   . GLU A 1  1090 ? 164.741 217.195 153.116 1.00 24.39  -1 1090 GLU A OE2   1 
ATOM   7782  N  N     . ASP A 1  1091 ? 167.915 213.030 152.521 1.00 26.80  ?  1091 ASP A N     1 
ATOM   7783  C  CA    . ASP A 1  1091 ? 169.336 213.189 152.874 1.00 26.80  ?  1091 ASP A CA    1 
ATOM   7784  C  C     . ASP A 1  1091 ? 170.355 213.237 151.708 1.00 26.80  ?  1091 ASP A C     1 
ATOM   7785  O  O     . ASP A 1  1091 ? 171.269 214.062 151.711 1.00 26.80  ?  1091 ASP A O     1 
ATOM   7786  C  CB    . ASP A 1  1091 ? 169.753 212.108 153.876 1.00 26.80  ?  1091 ASP A CB    1 
ATOM   7787  C  CG    . ASP A 1  1091 ? 169.768 210.722 153.265 1.00 26.80  ?  1091 ASP A CG    1 
ATOM   7788  O  OD1   . ASP A 1  1091 ? 170.307 210.567 152.149 1.00 26.80  ?  1091 ASP A OD1   1 
ATOM   7789  O  OD2   . ASP A 1  1091 ? 169.239 209.785 153.900 1.00 26.80  -1 1091 ASP A OD2   1 
ATOM   7790  N  N     . GLN A 1  1092 ? 170.187 212.350 150.724 1.00 14.69  ?  1092 GLN A N     1 
ATOM   7791  C  CA    . GLN A 1  1092 ? 171.069 212.249 149.569 1.00 14.69  ?  1092 GLN A CA    1 
ATOM   7792  C  C     . GLN A 1  1092 ? 170.825 213.357 148.556 1.00 14.69  ?  1092 GLN A C     1 
ATOM   7793  O  O     . GLN A 1  1092 ? 171.750 213.736 147.836 1.00 14.69  ?  1092 GLN A O     1 
ATOM   7794  C  CB    . GLN A 1  1092 ? 170.894 210.875 148.931 1.00 14.69  ?  1092 GLN A CB    1 
ATOM   7795  C  CG    . GLN A 1  1092 ? 171.818 210.533 147.786 1.00 14.69  ?  1092 GLN A CG    1 
ATOM   7796  C  CD    . GLN A 1  1092 ? 173.272 210.429 148.182 1.00 14.69  ?  1092 GLN A CD    1 
ATOM   7797  O  OE1   . GLN A 1  1092 ? 174.157 210.799 147.418 1.00 14.69  ?  1092 GLN A OE1   1 
ATOM   7798  N  NE2   . GLN A 1  1092 ? 173.530 209.908 149.371 1.00 14.69  ?  1092 GLN A NE2   1 
ATOM   7799  N  N     . GLU A 1  1093 ? 169.626 213.932 148.526 1.00 26.61  ?  1093 GLU A N     1 
ATOM   7800  C  CA    . GLU A 1  1093 ? 169.390 215.104 147.697 1.00 26.61  ?  1093 GLU A CA    1 
ATOM   7801  C  C     . GLU A 1  1093 ? 170.053 216.345 148.270 1.00 26.61  ?  1093 GLU A C     1 
ATOM   7802  O  O     . GLU A 1  1093 ? 170.526 217.197 147.516 1.00 26.61  ?  1093 GLU A O     1 
ATOM   7803  C  CB    . GLU A 1  1093 ? 167.887 215.326 147.549 1.00 26.61  ?  1093 GLU A CB    1 
ATOM   7804  C  CG    . GLU A 1  1093 ? 167.501 216.345 146.517 1.00 26.61  ?  1093 GLU A CG    1 
ATOM   7805  C  CD    . GLU A 1  1093 ? 167.175 217.691 147.126 1.00 26.61  ?  1093 GLU A CD    1 
ATOM   7806  O  OE1   . GLU A 1  1093 ? 167.334 217.843 148.353 1.00 26.61  ?  1093 GLU A OE1   1 
ATOM   7807  O  OE2   . GLU A 1  1093 ? 166.754 218.599 146.377 1.00 26.61  -1 1093 GLU A OE2   1 
ATOM   7808  N  N     . GLN A 1  1094 ? 170.089 216.475 149.591 1.00 29.21  ?  1094 GLN A N     1 
ATOM   7809  C  CA    . GLN A 1  1094 ? 170.698 217.629 150.229 1.00 29.21  ?  1094 GLN A CA    1 
ATOM   7810  C  C     . GLN A 1  1094 ? 172.215 217.558 150.272 1.00 29.21  ?  1094 GLN A C     1 
ATOM   7811  O  O     . GLN A 1  1094 ? 172.865 218.597 150.419 1.00 29.21  ?  1094 GLN A O     1 
ATOM   7812  C  CB    . GLN A 1  1094 ? 170.165 217.779 151.655 1.00 29.21  ?  1094 GLN A CB    1 
ATOM   7813  C  CG    . GLN A 1  1094 ? 168.751 218.287 151.733 1.00 29.21  ?  1094 GLN A CG    1 
ATOM   7814  C  CD    . GLN A 1  1094 ? 168.701 219.784 151.906 1.00 29.21  ?  1094 GLN A CD    1 
ATOM   7815  O  OE1   . GLN A 1  1094 ? 169.696 220.476 151.695 1.00 29.21  ?  1094 GLN A OE1   1 
ATOM   7816  N  NE2   . GLN A 1  1094 ? 167.543 220.298 152.301 1.00 29.21  ?  1094 GLN A NE2   1 
ATOM   7817  N  N     . LEU A 1  1095 ? 172.793 216.366 150.161 1.00 27.09  ?  1095 LEU A N     1 
ATOM   7818  C  CA    . LEU A 1  1095 ? 174.248 216.276 150.117 1.00 27.09  ?  1095 LEU A CA    1 
ATOM   7819  C  C     . LEU A 1  1095 ? 174.805 216.764 148.780 1.00 27.09  ?  1095 LEU A C     1 
ATOM   7820  O  O     . LEU A 1  1095 ? 175.956 217.206 148.718 1.00 27.09  ?  1095 LEU A O     1 
ATOM   7821  C  CB    . LEU A 1  1095 ? 174.677 214.837 150.417 1.00 27.09  ?  1095 LEU A CB    1 
ATOM   7822  C  CG    . LEU A 1  1095 ? 176.124 214.460 150.732 1.00 27.09  ?  1095 LEU A CG    1 
ATOM   7823  C  CD1   . LEU A 1  1095 ? 176.129 213.255 151.649 1.00 27.09  ?  1095 LEU A CD1   1 
ATOM   7824  C  CD2   . LEU A 1  1095 ? 176.904 214.126 149.503 1.00 27.09  ?  1095 LEU A CD2   1 
ATOM   7825  N  N     . LEU A 1  1096 ? 174.020 216.692 147.706 1.00 18.79  ?  1096 LEU A N     1 
ATOM   7826  C  CA    . LEU A 1  1096 ? 174.483 217.120 146.395 1.00 18.79  ?  1096 LEU A CA    1 
ATOM   7827  C  C     . LEU A 1  1096 ? 174.234 218.594 146.128 1.00 18.79  ?  1096 LEU A C     1 
ATOM   7828  O  O     . LEU A 1  1096 ? 174.707 219.111 145.115 1.00 18.79  ?  1096 LEU A O     1 
ATOM   7829  C  CB    . LEU A 1  1096 ? 173.826 216.283 145.307 1.00 18.79  ?  1096 LEU A CB    1 
ATOM   7830  C  CG    . LEU A 1  1096 ? 174.392 214.874 145.190 1.00 18.79  ?  1096 LEU A CG    1 
ATOM   7831  C  CD1   . LEU A 1  1096 ? 173.325 213.889 144.788 1.00 18.79  ?  1096 LEU A CD1   1 
ATOM   7832  C  CD2   . LEU A 1  1096 ? 175.492 214.863 144.175 1.00 18.79  ?  1096 LEU A CD2   1 
ATOM   7833  N  N     . ARG A 1  1097 ? 173.522 219.282 147.006 1.00 25.91  ?  1097 ARG A N     1 
ATOM   7834  C  CA    . ARG A 1  1097 ? 173.387 220.726 146.935 1.00 25.91  ?  1097 ARG A CA    1 
ATOM   7835  C  C     . ARG A 1  1097 ? 174.518 221.454 147.645 1.00 25.91  ?  1097 ARG A C     1 
ATOM   7836  O  O     . ARG A 1  1097 ? 174.417 222.663 147.863 1.00 25.91  ?  1097 ARG A O     1 
ATOM   7837  C  CB    . ARG A 1  1097 ? 172.058 221.162 147.533 1.00 25.91  ?  1097 ARG A CB    1 
ATOM   7838  C  CG    . ARG A 1  1097 ? 170.857 220.541 146.899 1.00 25.91  ?  1097 ARG A CG    1 
ATOM   7839  C  CD    . ARG A 1  1097 ? 169.719 221.529 146.776 1.00 25.91  ?  1097 ARG A CD    1 
ATOM   7840  N  NE    . ARG A 1  1097 ? 169.099 221.838 148.058 1.00 25.91  ?  1097 ARG A NE    1 
ATOM   7841  C  CZ    . ARG A 1  1097 ? 169.317 222.954 148.747 1.00 25.91  ?  1097 ARG A CZ    1 
ATOM   7842  N  NH1   . ARG A 1  1097 ? 170.157 223.870 148.282 1.00 25.91  1  1097 ARG A NH1   1 
ATOM   7843  N  NH2   . ARG A 1  1097 ? 168.704 223.150 149.906 1.00 25.91  ?  1097 ARG A NH2   1 
ATOM   7844  N  N     . ARG A 1  1098 ? 175.490 220.676 148.122 1.00 28.23  ?  1098 ARG A N     1 
ATOM   7845  C  CA    . ARG A 1  1098 ? 176.734 221.211 148.656 1.00 28.23  ?  1098 ARG A CA    1 
ATOM   7846  C  C     . ARG A 1  1098 ? 177.450 221.770 147.421 1.00 28.23  ?  1098 ARG A C     1 
ATOM   7847  O  O     . ARG A 1  1098 ? 178.030 222.854 147.450 1.00 28.23  ?  1098 ARG A O     1 
ATOM   7848  C  CB    . ARG A 1  1098 ? 177.562 220.115 149.319 1.00 28.23  ?  1098 ARG A CB    1 
ATOM   7849  C  CG    . ARG A 1  1098 ? 177.726 220.300 150.818 1.00 28.23  ?  1098 ARG A CG    1 
ATOM   7850  C  CD    . ARG A 1  1098 ? 177.196 219.102 151.588 1.00 28.23  ?  1098 ARG A CD    1 
ATOM   7851  N  NE    . ARG A 1  1098 ? 178.276 218.323 152.182 1.00 28.23  ?  1098 ARG A NE    1 
ATOM   7852  C  CZ    . ARG A 1  1098 ? 179.222 218.832 152.963 1.00 28.23  ?  1098 ARG A CZ    1 
ATOM   7853  N  NH1   . ARG A 1  1098 ? 180.168 218.047 153.458 1.00 28.23  1  1098 ARG A NH1   1 
ATOM   7854  N  NH2   . ARG A 1  1098 ? 179.224 220.126 153.250 1.00 28.23  ?  1098 ARG A NH2   1 
ATOM   7855  N  N     . PHE A 1  1099 ? 177.388 220.991 146.334 1.00 21.32  ?  1099 PHE A N     1 
ATOM   7856  C  CA    . PHE A 1  1099 ? 177.906 221.364 145.018 1.00 21.32  ?  1099 PHE A CA    1 
ATOM   7857  C  C     . PHE A 1  1099 ? 176.911 222.411 144.529 1.00 21.32  ?  1099 PHE A C     1 
ATOM   7858  O  O     . PHE A 1  1099 ? 175.706 222.262 144.764 1.00 21.32  ?  1099 PHE A O     1 
ATOM   7859  C  CB    . PHE A 1  1099 ? 177.909 220.170 144.069 1.00 21.32  ?  1099 PHE A CB    1 
ATOM   7860  C  CG    . PHE A 1  1099 ? 178.893 219.097 144.436 1.00 21.32  ?  1099 PHE A CG    1 
ATOM   7861  C  CD1   . PHE A 1  1099 ? 178.535 218.075 145.297 1.00 21.32  ?  1099 PHE A CD1   1 
ATOM   7862  C  CD2   . PHE A 1  1099 ? 180.169 219.095 143.900 1.00 21.32  ?  1099 PHE A CD2   1 
ATOM   7863  C  CE1   . PHE A 1  1099 ? 179.434 217.077 145.627 1.00 21.32  ?  1099 PHE A CE1   1 
ATOM   7864  C  CE2   . PHE A 1  1099 ? 181.073 218.103 144.226 1.00 21.32  ?  1099 PHE A CE2   1 
ATOM   7865  C  CZ    . PHE A 1  1099 ? 180.705 217.091 145.092 1.00 21.32  ?  1099 PHE A CZ    1 
ATOM   7866  N  N     A GLY A 1  1100 ? 177.334 223.274 143.614 0.50 28.63  ?  1100 GLY A N     1 
ATOM   7867  N  N     B GLY A 1  1100 ? 177.334 223.274 143.614 0.50 28.63  ?  1100 GLY A N     1 
ATOM   7868  C  CA    A GLY A 1  1100 ? 176.415 224.290 143.164 0.50 28.63  ?  1100 GLY A CA    1 
ATOM   7869  C  CA    B GLY A 1  1100 ? 176.415 224.290 143.164 0.50 28.63  ?  1100 GLY A CA    1 
ATOM   7870  C  C     A GLY A 1  1100 ? 175.303 223.729 142.303 0.50 28.63  ?  1100 GLY A C     1 
ATOM   7871  C  C     B GLY A 1  1100 ? 175.303 223.729 142.303 0.50 28.63  ?  1100 GLY A C     1 
ATOM   7872  O  O     A GLY A 1  1100 ? 175.142 222.514 142.173 0.50 28.63  ?  1100 GLY A O     1 
ATOM   7873  O  O     B GLY A 1  1100 ? 175.142 222.514 142.173 0.50 28.63  ?  1100 GLY A O     1 
ATOM   7874  N  N     . PRO A 1  1101 ? 174.503 224.607 141.706 1.00 29.85  ?  1101 PRO A N     1 
ATOM   7875  C  CA    . PRO A 1  1101 ? 173.507 224.158 140.738 1.00 29.85  ?  1101 PRO A CA    1 
ATOM   7876  C  C     . PRO A 1  1101 ? 174.129 223.998 139.364 1.00 29.85  ?  1101 PRO A C     1 
ATOM   7877  O  O     . PRO A 1  1101 ? 175.079 224.714 139.019 1.00 29.85  ?  1101 PRO A O     1 
ATOM   7878  C  CB    . PRO A 1  1101 ? 172.466 225.283 140.759 1.00 29.85  ?  1101 PRO A CB    1 
ATOM   7879  C  CG    . PRO A 1  1101 ? 173.228 226.480 141.148 1.00 29.85  ?  1101 PRO A CG    1 
ATOM   7880  C  CD    . PRO A 1  1101 ? 174.348 226.032 142.037 1.00 29.85  ?  1101 PRO A CD    1 
ATOM   7881  N  N     . PRO A 1  1102 ? 173.639 223.060 138.549 1.00 32.84  ?  1102 PRO A N     1 
ATOM   7882  C  CA    . PRO A 1  1102 ? 174.196 222.904 137.198 1.00 32.84  ?  1102 PRO A CA    1 
ATOM   7883  C  C     . PRO A 1  1102 ? 173.704 223.928 136.188 1.00 32.84  ?  1102 PRO A C     1 
ATOM   7884  O  O     . PRO A 1  1102 ? 173.978 223.762 134.997 1.00 32.84  ?  1102 PRO A O     1 
ATOM   7885  C  CB    . PRO A 1  1102 ? 173.764 221.490 136.804 1.00 32.84  ?  1102 PRO A CB    1 
ATOM   7886  C  CG    . PRO A 1  1102 ? 172.610 221.190 137.678 1.00 32.84  ?  1102 PRO A CG    1 
ATOM   7887  C  CD    . PRO A 1  1102 ? 172.846 221.891 138.955 1.00 32.84  ?  1102 PRO A CD    1 
ATOM   7888  N  N     . GLY A 1  1103 ? 172.990 224.967 136.608 1.00 40.99  ?  1103 GLY A N     1 
ATOM   7889  C  CA    . GLY A 1  1103 ? 172.557 226.018 135.719 1.00 40.99  ?  1103 GLY A CA    1 
ATOM   7890  C  C     . GLY A 1  1103 ? 171.603 226.968 136.408 1.00 40.99  ?  1103 GLY A C     1 
ATOM   7891  O  O     . GLY A 1  1103 ? 171.272 226.804 137.584 1.00 40.99  ?  1103 GLY A O     1 
ATOM   7892  N  N     . PRO A 1  1104 ? 171.146 227.988 135.693 1.00 52.68  ?  1104 PRO A N     1 
ATOM   7893  C  CA    . PRO A 1  1104 ? 170.115 228.874 136.240 1.00 52.68  ?  1104 PRO A CA    1 
ATOM   7894  C  C     . PRO A 1  1104 ? 168.734 228.239 136.132 1.00 52.68  ?  1104 PRO A C     1 
ATOM   7895  O  O     . PRO A 1  1104 ? 168.543 227.193 135.513 1.00 52.68  ?  1104 PRO A O     1 
ATOM   7896  C  CB    . PRO A 1  1104 ? 170.221 230.116 135.358 1.00 52.68  ?  1104 PRO A CB    1 
ATOM   7897  C  CG    . PRO A 1  1104 ? 170.678 229.577 134.049 1.00 52.68  ?  1104 PRO A CG    1 
ATOM   7898  C  CD    . PRO A 1  1104 ? 171.622 228.445 134.378 1.00 52.68  ?  1104 PRO A CD    1 
ATOM   7899  N  N     . GLU A 1  1105 ? 167.762 228.898 136.760 1.00 68.99  ?  1105 GLU A N     1 
ATOM   7900  C  CA    . GLU A 1  1105 ? 166.386 228.426 136.724 1.00 68.99  ?  1105 GLU A CA    1 
ATOM   7901  C  C     . GLU A 1  1105 ? 165.331 229.514 136.561 1.00 68.99  ?  1105 GLU A C     1 
ATOM   7902  O  O     . GLU A 1  1105 ? 164.149 229.175 136.466 1.00 68.99  ?  1105 GLU A O     1 
ATOM   7903  C  CB    . GLU A 1  1105 ? 166.102 227.604 137.987 1.00 68.99  ?  1105 GLU A CB    1 
ATOM   7904  C  CG    . GLU A 1  1105 ? 166.342 228.332 139.307 1.00 68.99  ?  1105 GLU A CG    1 
ATOM   7905  C  CD    . GLU A 1  1105 ? 165.108 229.032 139.856 1.00 68.99  ?  1105 GLU A CD    1 
ATOM   7906  O  OE1   . GLU A 1  1105 ? 163.989 228.662 139.456 1.00 68.99  ?  1105 GLU A OE1   1 
ATOM   7907  O  OE2   . GLU A 1  1105 ? 165.258 229.940 140.698 1.00 68.99  -1 1105 GLU A OE2   1 
ATOM   7908  N  N     . ALA A 1  1106 ? 165.699 230.790 136.500 1.00 73.26  ?  1106 ALA A N     1 
ATOM   7909  C  CA    . ALA A 1  1106 ? 164.737 231.882 136.414 1.00 73.26  ?  1106 ALA A CA    1 
ATOM   7910  C  C     . ALA A 1  1106 ? 164.688 232.523 135.034 1.00 73.26  ?  1106 ALA A C     1 
ATOM   7911  O  O     . ALA A 1  1106 ? 164.057 233.573 134.873 1.00 73.26  ?  1106 ALA A O     1 
ATOM   7912  C  CB    . ALA A 1  1106 ? 165.052 232.951 137.465 1.00 73.26  ?  1106 ALA A CB    1 
ATOM   7913  N  N     . TRP A 1  1107 ? 165.338 231.924 134.049 1.00 56.47  ?  1107 TRP A N     1 
ATOM   7914  C  CA    . TRP A 1  1107 ? 165.419 232.462 132.702 1.00 56.47  ?  1107 TRP A CA    1 
ATOM   7915  C  C     . TRP A 1  1107 ? 164.102 232.293 131.958 1.00 56.47  ?  1107 TRP A C     1 
ATOM   7916  O  O     . TRP A 1  1107 ? 163.143 233.025 132.195 1.00 56.47  ?  1107 TRP A O     1 
ATOM   7917  C  CB    . TRP A 1  1107 ? 166.551 231.776 131.931 1.00 56.47  ?  1107 TRP A CB    1 
ATOM   7918  C  CG    . TRP A 1  1107 ? 166.548 230.273 132.063 1.00 56.47  ?  1107 TRP A CG    1 
ATOM   7919  C  CD1   . TRP A 1  1107 ? 167.060 229.532 133.091 1.00 56.47  ?  1107 TRP A CD1   1 
ATOM   7920  C  CD2   . TRP A 1  1107 ? 166.014 229.336 131.128 1.00 56.47  ?  1107 TRP A CD2   1 
ATOM   7921  N  NE1   . TRP A 1  1107 ? 166.859 228.197 132.863 1.00 56.47  ?  1107 TRP A NE1   1 
ATOM   7922  C  CE2   . TRP A 1  1107 ? 166.224 228.049 131.660 1.00 56.47  ?  1107 TRP A CE2   1 
ATOM   7923  C  CE3   . TRP A 1  1107 ? 165.375 229.460 129.899 1.00 56.47  ?  1107 TRP A CE3   1 
ATOM   7924  C  CZ2   . TRP A 1  1107 ? 165.823 226.899 131.004 1.00 56.47  ?  1107 TRP A CZ2   1 
ATOM   7925  C  CZ3   . TRP A 1  1107 ? 164.983 228.323 129.251 1.00 56.47  ?  1107 TRP A CZ3   1 
ATOM   7926  C  CH2   . TRP A 1  1107 ? 165.206 227.057 129.801 1.00 56.47  ?  1107 TRP A CH2   1 
ATOM   7927  N  N     . MET B 2  1    ? 169.524 219.057 98.098  1.00 50.08  ?  1    MET B N     1 
ATOM   7928  C  CA    . MET B 2  1    ? 169.797 219.585 99.423  1.00 50.08  ?  1    MET B CA    1 
ATOM   7929  C  C     . MET B 2  1    ? 171.279 219.923 99.606  1.00 50.08  ?  1    MET B C     1 
ATOM   7930  O  O     . MET B 2  1    ? 171.742 220.976 99.176  1.00 50.08  ?  1    MET B O     1 
ATOM   7931  C  CB    . MET B 2  1    ? 169.353 218.580 100.489 1.00 50.08  ?  1    MET B CB    1 
ATOM   7932  C  CG    . MET B 2  1    ? 168.008 218.875 101.123 1.00 50.08  ?  1    MET B CG    1 
ATOM   7933  S  SD    . MET B 2  1    ? 167.321 217.462 102.010 1.00 50.08  ?  1    MET B SD    1 
ATOM   7934  C  CE    . MET B 2  1    ? 168.258 217.523 103.536 1.00 50.08  ?  1    MET B CE    1 
ATOM   7935  N  N     . PHE B 2  2    ? 172.007 219.001 100.237 1.00 48.79  ?  2    PHE B N     1 
ATOM   7936  C  CA    . PHE B 2  2    ? 173.376 219.190 100.714 1.00 48.79  ?  2    PHE B CA    1 
ATOM   7937  C  C     . PHE B 2  2    ? 174.391 218.610 99.731  1.00 48.79  ?  2    PHE B C     1 
ATOM   7938  O  O     . PHE B 2  2    ? 175.295 219.313 99.264  1.00 48.79  ?  2    PHE B O     1 
ATOM   7939  C  CB    . PHE B 2  2    ? 173.490 218.543 102.106 1.00 48.79  ?  2    PHE B CB    1 
ATOM   7940  C  CG    . PHE B 2  2    ? 174.876 218.538 102.710 1.00 48.79  ?  2    PHE B CG    1 
ATOM   7941  C  CD1   . PHE B 2  2    ? 175.295 219.587 103.510 1.00 48.79  ?  2    PHE B CD1   1 
ATOM   7942  C  CD2   . PHE B 2  2    ? 175.724 217.443 102.553 1.00 48.79  ?  2    PHE B CD2   1 
ATOM   7943  C  CE1   . PHE B 2  2    ? 176.551 219.568 104.092 1.00 48.79  ?  2    PHE B CE1   1 
ATOM   7944  C  CE2   . PHE B 2  2    ? 176.983 217.428 103.119 1.00 48.79  ?  2    PHE B CE2   1 
ATOM   7945  C  CZ    . PHE B 2  2    ? 177.396 218.488 103.889 1.00 48.79  ?  2    PHE B CZ    1 
ATOM   7946  N  N     . SER B 2  3    ? 174.242 217.325 99.402  1.00 56.28  ?  3    SER B N     1 
ATOM   7947  C  CA    . SER B 2  3    ? 175.183 216.674 98.500  1.00 56.28  ?  3    SER B CA    1 
ATOM   7948  C  C     . SER B 2  3    ? 174.988 217.113 97.057  1.00 56.28  ?  3    SER B C     1 
ATOM   7949  O  O     . SER B 2  3    ? 175.874 216.900 96.222  1.00 56.28  ?  3    SER B O     1 
ATOM   7950  C  CB    . SER B 2  3    ? 175.047 215.165 98.603  1.00 56.28  ?  3    SER B CB    1 
ATOM   7951  O  OG    . SER B 2  3    ? 175.889 214.555 97.654  1.00 56.28  ?  3    SER B OG    1 
ATOM   7952  N  N     . GLU B 2  4    ? 173.829 217.690 96.738  1.00 69.18  ?  4    GLU B N     1 
ATOM   7953  C  CA    . GLU B 2  4    ? 173.646 218.333 95.444  1.00 69.18  ?  4    GLU B CA    1 
ATOM   7954  C  C     . GLU B 2  4    ? 174.530 219.568 95.327  1.00 69.18  ?  4    GLU B C     1 
ATOM   7955  O  O     . GLU B 2  4    ? 175.206 219.763 94.311  1.00 69.18  ?  4    GLU B O     1 
ATOM   7956  C  CB    . GLU B 2  4    ? 172.171 218.699 95.264  1.00 69.18  ?  4    GLU B CB    1 
ATOM   7957  C  CG    . GLU B 2  4    ? 171.766 219.188 93.883  1.00 69.18  ?  4    GLU B CG    1 
ATOM   7958  C  CD    . GLU B 2  4    ? 171.917 220.688 93.719  1.00 69.18  ?  4    GLU B CD    1 
ATOM   7959  O  OE1   . GLU B 2  4    ? 171.858 221.403 94.740  1.00 69.18  ?  4    GLU B OE1   1 
ATOM   7960  O  OE2   . GLU B 2  4    ? 172.090 221.149 92.572  1.00 69.18  -1 4    GLU B OE2   1 
ATOM   7961  N  N     . GLN B 2  5    ? 174.534 220.411 96.359  1.00 68.14  ?  5    GLN B N     1 
ATOM   7962  C  CA    . GLN B 2  5    ? 175.326 221.632 96.354  1.00 68.14  ?  5    GLN B CA    1 
ATOM   7963  C  C     . GLN B 2  5    ? 176.813 221.350 96.528  1.00 68.14  ?  5    GLN B C     1 
ATOM   7964  O  O     . GLN B 2  5    ? 177.646 222.154 96.097  1.00 68.14  ?  5    GLN B O     1 
ATOM   7965  C  CB    . GLN B 2  5    ? 174.821 222.558 97.463  1.00 68.14  ?  5    GLN B CB    1 
ATOM   7966  C  CG    . GLN B 2  5    ? 175.383 223.970 97.451  1.00 68.14  ?  5    GLN B CG    1 
ATOM   7967  C  CD    . GLN B 2  5    ? 174.878 224.802 98.598  1.00 68.14  ?  5    GLN B CD    1 
ATOM   7968  O  OE1   . GLN B 2  5    ? 174.134 224.319 99.446  1.00 68.14  ?  5    GLN B OE1   1 
ATOM   7969  N  NE2   . GLN B 2  5    ? 175.284 226.057 98.637  1.00 68.14  ?  5    GLN B NE2   1 
ATOM   7970  N  N     . ALA B 2  6    ? 177.166 220.195 97.097  1.00 66.24  ?  6    ALA B N     1 
ATOM   7971  C  CA    . ALA B 2  6    ? 178.568 219.886 97.364  1.00 66.24  ?  6    ALA B CA    1 
ATOM   7972  C  C     . ALA B 2  6    ? 179.374 219.565 96.107  1.00 66.24  ?  6    ALA B C     1 
ATOM   7973  O  O     . ALA B 2  6    ? 180.596 219.407 96.194  1.00 66.24  ?  6    ALA B O     1 
ATOM   7974  C  CB    . ALA B 2  6    ? 178.664 218.718 98.344  1.00 66.24  ?  6    ALA B CB    1 
ATOM   7975  N  N     . ALA B 2  7    ? 178.733 219.429 94.948  1.00 70.14  ?  7    ALA B N     1 
ATOM   7976  C  CA    . ALA B 2  7    ? 179.438 219.208 93.693  1.00 70.14  ?  7    ALA B CA    1 
ATOM   7977  C  C     . ALA B 2  7    ? 179.351 220.402 92.756  1.00 70.14  ?  7    ALA B C     1 
ATOM   7978  O  O     . ALA B 2  7    ? 179.812 220.320 91.615  1.00 70.14  ?  7    ALA B O     1 
ATOM   7979  C  CB    . ALA B 2  7    ? 178.904 217.955 92.998  1.00 70.14  ?  7    ALA B CB    1 
ATOM   7980  N  N     . GLN B 2  8    ? 178.805 221.522 93.228  1.00 74.10  ?  8    GLN B N     1 
ATOM   7981  C  CA    . GLN B 2  8    ? 178.457 222.669 92.398  1.00 74.10  ?  8    GLN B CA    1 
ATOM   7982  C  C     . GLN B 2  8    ? 179.643 223.536 91.989  1.00 74.10  ?  8    GLN B C     1 
ATOM   7983  O  O     . GLN B 2  8    ? 179.425 224.657 91.515  1.00 74.10  ?  8    GLN B O     1 
ATOM   7984  C  CB    . GLN B 2  8    ? 177.441 223.551 93.136  1.00 74.10  ?  8    GLN B CB    1 
ATOM   7985  C  CG    . GLN B 2  8    ? 175.985 223.259 92.821  1.00 74.10  ?  8    GLN B CG    1 
ATOM   7986  C  CD    . GLN B 2  8    ? 175.475 224.078 91.657  1.00 74.10  ?  8    GLN B CD    1 
ATOM   7987  O  OE1   . GLN B 2  8    ? 176.233 224.806 91.019  1.00 74.10  ?  8    GLN B OE1   1 
ATOM   7988  N  NE2   . GLN B 2  8    ? 174.182 223.972 91.377  1.00 74.10  ?  8    GLN B NE2   1 
ATOM   7989  N  N     . ARG B 2  9    ? 180.883 223.071 92.158  1.00 69.00  ?  9    ARG B N     1 
ATOM   7990  C  CA    . ARG B 2  9    ? 182.057 223.900 91.913  1.00 69.00  ?  9    ARG B CA    1 
ATOM   7991  C  C     . ARG B 2  9    ? 183.157 223.122 91.204  1.00 69.00  ?  9    ARG B C     1 
ATOM   7992  O  O     . ARG B 2  9    ? 182.910 222.039 90.667  1.00 69.00  ?  9    ARG B O     1 
ATOM   7993  C  CB    . ARG B 2  9    ? 182.592 224.478 93.227  1.00 69.00  ?  9    ARG B CB    1 
ATOM   7994  C  CG    . ARG B 2  9    ? 181.756 225.609 93.803  1.00 69.00  ?  9    ARG B CG    1 
ATOM   7995  C  CD    . ARG B 2  9    ? 182.352 226.158 95.079  1.00 69.00  ?  9    ARG B CD    1 
ATOM   7996  N  NE    . ARG B 2  9    ? 181.601 227.310 95.558  1.00 69.00  ?  9    ARG B NE    1 
ATOM   7997  C  CZ    . ARG B 2  9    ? 180.557 227.237 96.373  1.00 69.00  ?  9    ARG B CZ    1 
ATOM   7998  N  NH1   . ARG B 2  9    ? 180.131 226.061 96.811  1.00 69.00  1  9    ARG B NH1   1 
ATOM   7999  N  NH2   . ARG B 2  9    ? 179.938 228.345 96.752  1.00 69.00  ?  9    ARG B NH2   1 
ATOM   8000  N  N     . ALA B 2  10   ? 184.364 223.678 91.174  1.00 61.20  ?  10   ALA B N     1 
ATOM   8001  C  CA    . ALA B 2  10   ? 185.513 223.013 90.576  1.00 61.20  ?  10   ALA B CA    1 
ATOM   8002  C  C     . ALA B 2  10   ? 186.363 222.343 91.646  1.00 61.20  ?  10   ALA B C     1 
ATOM   8003  O  O     . ALA B 2  10   ? 186.339 222.724 92.818  1.00 61.20  ?  10   ALA B O     1 
ATOM   8004  C  CB    . ALA B 2  10   ? 186.362 224.008 89.786  1.00 61.20  ?  10   ALA B CB    1 
ATOM   8005  N  N     . HIS B 2  11   ? 187.131 221.343 91.227  1.00 55.76  ?  11   HIS B N     1 
ATOM   8006  C  CA    . HIS B 2  11   ? 187.894 220.494 92.134  1.00 55.76  ?  11   HIS B CA    1 
ATOM   8007  C  C     . HIS B 2  11   ? 189.380 220.789 91.973  1.00 55.76  ?  11   HIS B C     1 
ATOM   8008  O  O     . HIS B 2  11   ? 189.922 220.686 90.868  1.00 55.76  ?  11   HIS B O     1 
ATOM   8009  C  CB    . HIS B 2  11   ? 187.593 219.022 91.865  1.00 55.76  ?  11   HIS B CB    1 
ATOM   8010  C  CG    . HIS B 2  11   ? 186.170 218.647 92.132  1.00 55.76  ?  11   HIS B CG    1 
ATOM   8011  N  ND1   . HIS B 2  11   ? 185.443 217.830 91.294  1.00 55.76  ?  11   HIS B ND1   1 
ATOM   8012  C  CD2   . HIS B 2  11   ? 185.336 218.981 93.145  1.00 55.76  ?  11   HIS B CD2   1 
ATOM   8013  C  CE1   . HIS B 2  11   ? 184.225 217.672 91.781  1.00 55.76  ?  11   HIS B CE1   1 
ATOM   8014  N  NE2   . HIS B 2  11   ? 184.136 218.361 92.904  1.00 55.76  ?  11   HIS B NE2   1 
ATOM   8015  N  N     . THR B 2  12   ? 190.033 221.136 93.080  1.00 47.78  ?  12   THR B N     1 
ATOM   8016  C  CA    . THR B 2  12   ? 191.387 221.658 93.052  1.00 47.78  ?  12   THR B CA    1 
ATOM   8017  C  C     . THR B 2  12   ? 192.421 220.743 93.685  1.00 47.78  ?  12   THR B C     1 
ATOM   8018  O  O     . THR B 2  12   ? 193.612 221.060 93.624  1.00 47.78  ?  12   THR B O     1 
ATOM   8019  C  CB    . THR B 2  12   ? 191.460 223.007 93.786  1.00 47.78  ?  12   THR B CB    1 
ATOM   8020  O  OG1   . THR B 2  12   ? 191.305 222.790 95.192  1.00 47.78  ?  12   THR B OG1   1 
ATOM   8021  C  CG2   . THR B 2  12   ? 190.344 223.929 93.331  1.00 47.78  ?  12   THR B CG2   1 
ATOM   8022  N  N     . LEU B 2  13   ? 192.019 219.628 94.282  1.00 38.59  ?  13   LEU B N     1 
ATOM   8023  C  CA    . LEU B 2  13   ? 192.860 219.019 95.300  1.00 38.59  ?  13   LEU B CA    1 
ATOM   8024  C  C     . LEU B 2  13   ? 193.698 217.856 94.796  1.00 38.59  ?  13   LEU B C     1 
ATOM   8025  O  O     . LEU B 2  13   ? 194.514 217.331 95.557  1.00 38.59  ?  13   LEU B O     1 
ATOM   8026  C  CB    . LEU B 2  13   ? 191.982 218.576 96.464  1.00 38.59  ?  13   LEU B CB    1 
ATOM   8027  C  CG    . LEU B 2  13   ? 192.507 218.677 97.883  1.00 38.59  ?  13   LEU B CG    1 
ATOM   8028  C  CD1   . LEU B 2  13   ? 193.230 219.977 98.067  1.00 38.59  ?  13   LEU B CD1   1 
ATOM   8029  C  CD2   . LEU B 2  13   ? 191.299 218.670 98.774  1.00 38.59  ?  13   LEU B CD2   1 
ATOM   8030  N  N     . LEU B 2  14   ? 193.528 217.434 93.549  1.00 44.26  ?  14   LEU B N     1 
ATOM   8031  C  CA    . LEU B 2  14   ? 194.485 216.508 92.945  1.00 44.26  ?  14   LEU B CA    1 
ATOM   8032  C  C     . LEU B 2  14   ? 195.515 217.262 92.106  1.00 44.26  ?  14   LEU B C     1 
ATOM   8033  O  O     . LEU B 2  14   ? 195.693 217.009 90.915  1.00 44.26  ?  14   LEU B O     1 
ATOM   8034  C  CB    . LEU B 2  14   ? 193.748 215.458 92.121  1.00 44.26  ?  14   LEU B CB    1 
ATOM   8035  C  CG    . LEU B 2  14   ? 193.093 214.330 92.933  1.00 44.26  ?  14   LEU B CG    1 
ATOM   8036  C  CD1   . LEU B 2  14   ? 192.418 213.314 92.033  1.00 44.26  ?  14   LEU B CD1   1 
ATOM   8037  C  CD2   . LEU B 2  14   ? 194.101 213.644 93.837  1.00 44.26  ?  14   LEU B CD2   1 
ATOM   8038  N  N     . SER B 2  15   ? 196.219 218.195 92.744  1.00 48.29  ?  15   SER B N     1 
ATOM   8039  C  CA    . SER B 2  15   ? 197.063 219.166 92.060  1.00 48.29  ?  15   SER B CA    1 
ATOM   8040  C  C     . SER B 2  15   ? 198.283 219.463 92.919  1.00 48.29  ?  15   SER B C     1 
ATOM   8041  O  O     . SER B 2  15   ? 198.230 219.280 94.138  1.00 48.29  ?  15   SER B O     1 
ATOM   8042  C  CB    . SER B 2  15   ? 196.284 220.459 91.782  1.00 48.29  ?  15   SER B CB    1 
ATOM   8043  O  OG    . SER B 2  15   ? 195.179 220.207 90.940  1.00 48.29  ?  15   SER B OG    1 
ATOM   8044  N  N     . PRO B 2  16   ? 199.390 219.902 92.321  1.00 53.97  ?  16   PRO B N     1 
ATOM   8045  C  CA    . PRO B 2  16   ? 200.543 220.392 93.110  1.00 53.97  ?  16   PRO B CA    1 
ATOM   8046  C  C     . PRO B 2  16   ? 200.190 221.654 93.887  1.00 53.97  ?  16   PRO B C     1 
ATOM   8047  O  O     . PRO B 2  16   ? 199.147 222.269 93.614  1.00 53.97  ?  16   PRO B O     1 
ATOM   8048  C  CB    . PRO B 2  16   ? 201.601 220.666 92.025  1.00 53.97  ?  16   PRO B CB    1 
ATOM   8049  C  CG    . PRO B 2  16   ? 201.256 219.725 90.941  1.00 53.97  ?  16   PRO B CG    1 
ATOM   8050  C  CD    . PRO B 2  16   ? 199.758 219.693 90.909  1.00 53.97  ?  16   PRO B CD    1 
ATOM   8051  N  N     . PRO B 2  17   ? 201.010 222.057 94.873  1.00 60.77  ?  17   PRO B N     1 
ATOM   8052  C  CA    . PRO B 2  17   ? 200.654 223.193 95.744  1.00 60.77  ?  17   PRO B CA    1 
ATOM   8053  C  C     . PRO B 2  17   ? 200.436 224.511 95.014  1.00 60.77  ?  17   PRO B C     1 
ATOM   8054  O  O     . PRO B 2  17   ? 200.869 224.731 93.883  1.00 60.77  ?  17   PRO B O     1 
ATOM   8055  C  CB    . PRO B 2  17   ? 201.853 223.296 96.685  1.00 60.77  ?  17   PRO B CB    1 
ATOM   8056  C  CG    . PRO B 2  17   ? 202.322 221.922 96.816  1.00 60.77  ?  17   PRO B CG    1 
ATOM   8057  C  CD    . PRO B 2  17   ? 202.072 221.241 95.497  1.00 60.77  ?  17   PRO B CD    1 
ATOM   8058  N  N     . SER B 2  18   ? 199.724 225.400 95.702  1.00 71.84  ?  18   SER B N     1 
ATOM   8059  C  CA    . SER B 2  18   ? 199.268 226.657 95.139  1.00 71.84  ?  18   SER B CA    1 
ATOM   8060  C  C     . SER B 2  18   ? 199.625 227.797 96.073  1.00 71.84  ?  18   SER B C     1 
ATOM   8061  O  O     . SER B 2  18   ? 200.146 227.596 97.174  1.00 71.84  ?  18   SER B O     1 
ATOM   8062  C  CB    . SER B 2  18   ? 197.758 226.655 94.896  1.00 71.84  ?  18   SER B CB    1 
ATOM   8063  O  OG    . SER B 2  18   ? 197.292 227.978 94.717  1.00 71.84  ?  18   SER B OG    1 
ATOM   8064  N  N     . ALA B 2  19   ? 199.326 229.013 95.621  1.00 75.93  ?  19   ALA B N     1 
ATOM   8065  C  CA    . ALA B 2  19   ? 199.626 230.182 96.430  1.00 75.93  ?  19   ALA B CA    1 
ATOM   8066  C  C     . ALA B 2  19   ? 198.607 230.357 97.545  1.00 75.93  ?  19   ALA B C     1 
ATOM   8067  O  O     . ALA B 2  19   ? 198.979 230.516 98.711  1.00 75.93  ?  19   ALA B O     1 
ATOM   8068  C  CB    . ALA B 2  19   ? 199.675 231.427 95.548  1.00 75.93  ?  19   ALA B CB    1 
ATOM   8069  N  N     . ASN B 2  20   ? 197.323 230.314 97.208  1.00 68.54  ?  20   ASN B N     1 
ATOM   8070  C  CA    . ASN B 2  20   ? 196.251 230.479 98.174  1.00 68.54  ?  20   ASN B CA    1 
ATOM   8071  C  C     . ASN B 2  20   ? 195.369 229.241 98.200  1.00 68.54  ?  20   ASN B C     1 
ATOM   8072  O  O     . ASN B 2  20   ? 195.262 228.517 97.205  1.00 68.54  ?  20   ASN B O     1 
ATOM   8073  C  CB    . ASN B 2  20   ? 195.406 231.715 97.850  1.00 68.54  ?  20   ASN B CB    1 
ATOM   8074  C  CG    . ASN B 2  20   ? 194.670 231.589 96.528  1.00 68.54  ?  20   ASN B CG    1 
ATOM   8075  O  OD1   . ASN B 2  20   ? 193.565 231.046 96.463  1.00 68.54  ?  20   ASN B OD1   1 
ATOM   8076  N  ND2   . ASN B 2  20   ? 195.285 232.088 95.464  1.00 68.54  ?  20   ASN B ND2   1 
ATOM   8077  N  N     . ASN B 2  21   ? 194.747 229.006 99.348  1.00 53.26  ?  21   ASN B N     1 
ATOM   8078  C  CA    . ASN B 2  21   ? 193.650 228.064 99.489  1.00 53.26  ?  21   ASN B CA    1 
ATOM   8079  C  C     . ASN B 2  21   ? 192.512 228.793 100.183 1.00 53.26  ?  21   ASN B C     1 
ATOM   8080  O  O     . ASN B 2  21   ? 192.748 229.626 101.062 1.00 53.26  ?  21   ASN B O     1 
ATOM   8081  C  CB    . ASN B 2  21   ? 194.056 226.829 100.282 1.00 53.26  ?  21   ASN B CB    1 
ATOM   8082  C  CG    . ASN B 2  21   ? 195.403 226.292 99.871  1.00 53.26  ?  21   ASN B CG    1 
ATOM   8083  O  OD1   . ASN B 2  21   ? 195.556 225.727 98.790  1.00 53.26  ?  21   ASN B OD1   1 
ATOM   8084  N  ND2   . ASN B 2  21   ? 196.394 226.465 100.735 1.00 53.26  ?  21   ASN B ND2   1 
ATOM   8085  N  N     . ALA B 2  22   ? 191.285 228.490 99.772  1.00 41.53  ?  22   ALA B N     1 
ATOM   8086  C  CA    . ALA B 2  22   ? 190.127 229.247 100.219 1.00 41.53  ?  22   ALA B CA    1 
ATOM   8087  C  C     . ALA B 2  22   ? 189.792 228.955 101.680 1.00 41.53  ?  22   ALA B C     1 
ATOM   8088  O  O     . ALA B 2  22   ? 190.056 227.869 102.204 1.00 41.53  ?  22   ALA B O     1 
ATOM   8089  C  CB    . ALA B 2  22   ? 188.914 228.931 99.345  1.00 41.53  ?  22   ALA B CB    1 
ATOM   8090  N  N     . THR B 2  23   ? 189.210 229.957 102.337 1.00 35.22  ?  23   THR B N     1 
ATOM   8091  C  CA    . THR B 2  23   ? 188.621 229.828 103.660 1.00 35.22  ?  23   THR B CA    1 
ATOM   8092  C  C     . THR B 2  23   ? 187.203 230.377 103.614 1.00 35.22  ?  23   THR B C     1 
ATOM   8093  O  O     . THR B 2  23   ? 186.770 230.951 102.614 1.00 35.22  ?  23   THR B O     1 
ATOM   8094  C  CB    . THR B 2  23   ? 189.429 230.563 104.733 1.00 35.22  ?  23   THR B CB    1 
ATOM   8095  O  OG1   . THR B 2  23   ? 189.545 231.943 104.374 1.00 35.22  ?  23   THR B OG1   1 
ATOM   8096  C  CG2   . THR B 2  23   ? 190.817 229.941 104.900 1.00 35.22  ?  23   THR B CG2   1 
ATOM   8097  N  N     . PHE B 2  24   ? 186.468 230.181 104.707 1.00 33.25  ?  24   PHE B N     1 
ATOM   8098  C  CA    . PHE B 2  24   ? 185.043 230.476 104.754 1.00 33.25  ?  24   PHE B CA    1 
ATOM   8099  C  C     . PHE B 2  24   ? 184.696 231.044 106.122 1.00 33.25  ?  24   PHE B C     1 
ATOM   8100  O  O     . PHE B 2  24   ? 185.574 231.422 106.895 1.00 33.25  ?  24   PHE B O     1 
ATOM   8101  C  CB    . PHE B 2  24   ? 184.202 229.226 104.446 1.00 33.25  ?  24   PHE B CB    1 
ATOM   8102  C  CG    . PHE B 2  24   ? 184.554 228.573 103.137 1.00 33.25  ?  24   PHE B CG    1 
ATOM   8103  C  CD1   . PHE B 2  24   ? 184.124 229.116 101.939 1.00 33.25  ?  24   PHE B CD1   1 
ATOM   8104  C  CD2   . PHE B 2  24   ? 185.358 227.450 103.102 1.00 33.25  ?  24   PHE B CD2   1 
ATOM   8105  C  CE1   . PHE B 2  24   ? 184.470 228.537 100.735 1.00 33.25  ?  24   PHE B CE1   1 
ATOM   8106  C  CE2   . PHE B 2  24   ? 185.703 226.871 101.899 1.00 33.25  ?  24   PHE B CE2   1 
ATOM   8107  C  CZ    . PHE B 2  24   ? 185.256 227.416 100.715 1.00 33.25  ?  24   PHE B CZ    1 
ATOM   8108  N  N     . ALA B 2  25   ? 183.403 231.145 106.402 1.00 26.53  ?  25   ALA B N     1 
ATOM   8109  C  CA    . ALA B 2  25   ? 182.946 231.579 107.711 1.00 26.53  ?  25   ALA B CA    1 
ATOM   8110  C  C     . ALA B 2  25   ? 181.673 230.842 108.102 1.00 26.53  ?  25   ALA B C     1 
ATOM   8111  O  O     . ALA B 2  25   ? 180.843 230.499 107.256 1.00 26.53  ?  25   ALA B O     1 
ATOM   8112  C  CB    . ALA B 2  25   ? 182.707 233.091 107.749 1.00 26.53  ?  25   ALA B CB    1 
ATOM   8113  N  N     . ARG B 2  26   ? 181.524 230.615 109.405 1.00 23.88  ?  26   ARG B N     1 
ATOM   8114  C  CA    . ARG B 2  26   ? 180.347 229.944 109.941 1.00 23.88  ?  26   ARG B CA    1 
ATOM   8115  C  C     . ARG B 2  26   ? 179.155 230.891 109.903 1.00 23.88  ?  26   ARG B C     1 
ATOM   8116  O  O     . ARG B 2  26   ? 179.281 232.081 110.198 1.00 23.88  ?  26   ARG B O     1 
ATOM   8117  C  CB    . ARG B 2  26   ? 180.626 229.459 111.371 1.00 23.88  ?  26   ARG B CB    1 
ATOM   8118  C  CG    . ARG B 2  26   ? 179.506 228.683 112.077 1.00 23.88  ?  26   ARG B CG    1 
ATOM   8119  C  CD    . ARG B 2  26   ? 179.324 227.291 111.515 1.00 23.88  ?  26   ARG B CD    1 
ATOM   8120  N  NE    . ARG B 2  26   ? 180.422 226.397 111.835 1.00 23.88  ?  26   ARG B NE    1 
ATOM   8121  C  CZ    . ARG B 2  26   ? 180.636 225.248 111.214 1.00 23.88  ?  26   ARG B CZ    1 
ATOM   8122  N  NH1   . ARG B 2  26   ? 179.819 224.863 110.255 1.00 23.88  1  26   ARG B NH1   1 
ATOM   8123  N  NH2   . ARG B 2  26   ? 181.650 224.477 111.554 1.00 23.88  ?  26   ARG B NH2   1 
ATOM   8124  N  N     . VAL B 2  27   ? 177.999 230.363 109.521 1.00 24.31  ?  27   VAL B N     1 
ATOM   8125  C  CA    . VAL B 2  27   ? 176.808 231.180 109.328 1.00 24.31  ?  27   VAL B CA    1 
ATOM   8126  C  C     . VAL B 2  27   ? 176.241 231.589 110.685 1.00 24.31  ?  27   VAL B C     1 
ATOM   8127  O  O     . VAL B 2  27   ? 176.344 230.831 111.660 1.00 24.31  ?  27   VAL B O     1 
ATOM   8128  C  CB    . VAL B 2  27   ? 175.780 230.451 108.444 1.00 24.31  ?  27   VAL B CB    1 
ATOM   8129  C  CG1   . VAL B 2  27   ? 176.417 230.080 107.129 1.00 24.31  ?  27   VAL B CG1   1 
ATOM   8130  C  CG2   . VAL B 2  27   ? 175.238 229.206 109.101 1.00 24.31  ?  27   VAL B CG2   1 
ATOM   8131  N  N     . PRO B 2  28   ? 175.696 232.794 110.814 1.00 28.64  ?  28   PRO B N     1 
ATOM   8132  C  CA    . PRO B 2  28   ? 175.219 233.262 112.118 1.00 28.64  ?  28   PRO B CA    1 
ATOM   8133  C  C     . PRO B 2  28   ? 173.909 232.608 112.542 1.00 28.64  ?  28   PRO B C     1 
ATOM   8134  O  O     . PRO B 2  28   ? 173.101 232.160 111.727 1.00 28.64  ?  28   PRO B O     1 
ATOM   8135  C  CB    . PRO B 2  28   ? 175.030 234.769 111.905 1.00 28.64  ?  28   PRO B CB    1 
ATOM   8136  C  CG    . PRO B 2  28   ? 175.826 235.094 110.697 1.00 28.64  ?  28   PRO B CG    1 
ATOM   8137  C  CD    . PRO B 2  28   ? 175.756 233.888 109.833 1.00 28.64  ?  28   PRO B CD    1 
ATOM   8138  N  N     . VAL B 2  29   ? 173.709 232.596 113.859 1.00 30.90  ?  29   VAL B N     1 
ATOM   8139  C  CA    . VAL B 2  29   ? 172.654 231.853 114.547 1.00 30.90  ?  29   VAL B CA    1 
ATOM   8140  C  C     . VAL B 2  29   ? 171.791 232.930 115.211 1.00 30.90  ?  29   VAL B C     1 
ATOM   8141  O  O     . VAL B 2  29   ? 171.532 232.908 116.420 1.00 30.90  ?  29   VAL B O     1 
ATOM   8142  C  CB    . VAL B 2  29   ? 173.245 230.806 115.523 1.00 30.90  ?  29   VAL B CB    1 
ATOM   8143  C  CG1   . VAL B 2  29   ? 172.187 229.866 116.121 1.00 30.90  ?  29   VAL B CG1   1 
ATOM   8144  C  CG2   . VAL B 2  29   ? 174.314 229.980 114.842 1.00 30.90  ?  29   VAL B CG2   1 
ATOM   8145  N  N     . ALA B 2  30   ? 171.455 233.970 114.443 1.00 37.17  ?  30   ALA B N     1 
ATOM   8146  C  CA    . ALA B 2  30   ? 170.902 235.234 114.938 1.00 37.17  ?  30   ALA B CA    1 
ATOM   8147  C  C     . ALA B 2  30   ? 169.518 235.138 115.603 1.00 37.17  ?  30   ALA B C     1 
ATOM   8148  O  O     . ALA B 2  30   ? 168.972 236.193 115.946 1.00 37.17  ?  30   ALA B O     1 
ATOM   8149  C  CB    . ALA B 2  30   ? 170.835 236.244 113.794 1.00 37.17  ?  30   ALA B CB    1 
ATOM   8150  N  N     . THR B 2  31   ? 168.918 233.960 115.786 1.00 29.09  ?  31   THR B N     1 
ATOM   8151  C  CA    . THR B 2  31   ? 167.754 233.814 116.660 1.00 29.09  ?  31   THR B CA    1 
ATOM   8152  C  C     . THR B 2  31   ? 167.783 232.433 117.304 1.00 29.09  ?  31   THR B C     1 
ATOM   8153  O  O     . THR B 2  31   ? 167.972 231.425 116.616 1.00 29.09  ?  31   THR B O     1 
ATOM   8154  C  CB    . THR B 2  31   ? 166.443 234.026 115.898 1.00 29.09  ?  31   THR B CB    1 
ATOM   8155  O  OG1   . THR B 2  31   ? 166.469 235.292 115.231 1.00 29.09  ?  31   THR B OG1   1 
ATOM   8156  C  CG2   . THR B 2  31   ? 165.271 234.037 116.858 1.00 29.09  ?  31   THR B CG2   1 
ATOM   8157  N  N     . TYR B 2  32   ? 167.600 232.395 118.622 1.00 22.45  ?  32   TYR B N     1 
ATOM   8158  C  CA    . TYR B 2  32   ? 167.514 231.163 119.390 1.00 22.45  ?  32   TYR B CA    1 
ATOM   8159  C  C     . TYR B 2  32   ? 166.788 231.490 120.683 1.00 22.45  ?  32   TYR B C     1 
ATOM   8160  O  O     . TYR B 2  32   ? 166.948 232.584 121.223 1.00 22.45  ?  32   TYR B O     1 
ATOM   8161  C  CB    . TYR B 2  32   ? 168.902 230.574 119.675 1.00 22.45  ?  32   TYR B CB    1 
ATOM   8162  C  CG    . TYR B 2  32   ? 168.916 229.311 120.503 1.00 22.45  ?  32   TYR B CG    1 
ATOM   8163  C  CD1   . TYR B 2  32   ? 168.767 228.069 119.909 1.00 22.45  ?  32   TYR B CD1   1 
ATOM   8164  C  CD2   . TYR B 2  32   ? 169.103 229.360 121.879 1.00 22.45  ?  32   TYR B CD2   1 
ATOM   8165  C  CE1   . TYR B 2  32   ? 168.782 226.918 120.662 1.00 22.45  ?  32   TYR B CE1   1 
ATOM   8166  C  CE2   . TYR B 2  32   ? 169.121 228.213 122.634 1.00 22.45  ?  32   TYR B CE2   1 
ATOM   8167  C  CZ    . TYR B 2  32   ? 168.965 226.997 122.021 1.00 22.45  ?  32   TYR B CZ    1 
ATOM   8168  O  OH    . TYR B 2  32   ? 168.984 225.854 122.774 1.00 22.45  ?  32   TYR B OH    1 
ATOM   8169  N  N     . THR B 2  33   ? 165.987 230.547 121.167 1.00 23.11  ?  33   THR B N     1 
ATOM   8170  C  CA    . THR B 2  33   ? 165.240 230.737 122.407 1.00 23.11  ?  33   THR B CA    1 
ATOM   8171  C  C     . THR B 2  33   ? 164.945 229.379 123.017 1.00 23.11  ?  33   THR B C     1 
ATOM   8172  O  O     . THR B 2  33   ? 164.259 228.563 122.403 1.00 23.11  ?  33   THR B O     1 
ATOM   8173  C  CB    . THR B 2  33   ? 163.943 231.499 122.165 1.00 23.11  ?  33   THR B CB    1 
ATOM   8174  O  OG1   . THR B 2  33   ? 164.246 232.841 121.775 1.00 23.11  ?  33   THR B OG1   1 
ATOM   8175  C  CG2   . THR B 2  33   ? 163.113 231.532 123.422 1.00 23.11  ?  33   THR B CG2   1 
ATOM   8176  N  N     . ASN B 2  34   ? 165.465 229.139 124.213 1.00 24.64  ?  34   ASN B N     1 
ATOM   8177  C  CA    . ASN B 2  34   ? 165.124 227.934 124.949 1.00 24.64  ?  34   ASN B CA    1 
ATOM   8178  C  C     . ASN B 2  34   ? 163.815 228.155 125.691 1.00 24.64  ?  34   ASN B C     1 
ATOM   8179  O  O     . ASN B 2  34   ? 163.651 229.143 126.411 1.00 24.64  ?  34   ASN B O     1 
ATOM   8180  C  CB    . ASN B 2  34   ? 166.240 227.560 125.923 1.00 24.64  ?  34   ASN B CB    1 
ATOM   8181  C  CG    . ASN B 2  34   ? 166.241 226.089 126.272 1.00 24.64  ?  34   ASN B CG    1 
ATOM   8182  O  OD1   . ASN B 2  34   ? 165.276 225.385 126.018 1.00 24.64  ?  34   ASN B OD1   1 
ATOM   8183  N  ND2   . ASN B 2  34   ? 167.323 225.620 126.852 1.00 24.64  ?  34   ASN B ND2   1 
ATOM   8184  N  N     . SER B 2  35   ? 162.877 227.239 125.501 1.00 26.84  ?  35   SER B N     1 
ATOM   8185  C  CA    . SER B 2  35   ? 161.565 227.310 126.124 1.00 26.84  ?  35   SER B CA    1 
ATOM   8186  C  C     . SER B 2  35   ? 161.233 225.982 126.771 1.00 26.84  ?  35   SER B C     1 
ATOM   8187  O  O     . SER B 2  35   ? 160.109 225.489 126.681 1.00 26.84  ?  35   SER B O     1 
ATOM   8188  C  CB    . SER B 2  35   ? 160.501 227.701 125.109 1.00 26.84  ?  35   SER B CB    1 
ATOM   8189  O  OG    . SER B 2  35   ? 160.692 226.988 123.903 1.00 26.84  ?  35   SER B OG    1 
ATOM   8190  N  N     . SER B 2  36   ? 162.223 225.377 127.418 1.00 23.42  ?  36   SER B N     1 
ATOM   8191  C  CA    . SER B 2  36   ? 162.057 224.133 128.157 1.00 23.42  ?  36   SER B CA    1 
ATOM   8192  C  C     . SER B 2  36   ? 162.045 224.371 129.653 1.00 23.42  ?  36   SER B C     1 
ATOM   8193  O  O     . SER B 2  36   ? 162.593 223.592 130.420 1.00 23.42  ?  36   SER B O     1 
ATOM   8194  C  CB    . SER B 2  36   ? 163.141 223.142 127.767 1.00 23.42  ?  36   SER B CB    1 
ATOM   8195  O  OG    . SER B 2  36   ? 164.411 223.610 128.131 1.00 23.42  ?  36   SER B OG    1 
ATOM   8196  N  N     . GLN B 2  37   ? 161.426 225.446 130.084 1.00 28.04  ?  37   GLN B N     1 
ATOM   8197  C  CA    . GLN B 2  37   ? 161.379 225.827 131.490 1.00 28.04  ?  37   GLN B CA    1 
ATOM   8198  C  C     . GLN B 2  37   ? 160.493 224.947 132.380 1.00 28.04  ?  37   GLN B C     1 
ATOM   8199  O  O     . GLN B 2  37   ? 160.839 224.788 133.554 1.00 28.04  ?  37   GLN B O     1 
ATOM   8200  C  CB    . GLN B 2  37   ? 160.955 227.291 131.609 1.00 28.04  ?  37   GLN B CB    1 
ATOM   8201  C  CG    . GLN B 2  37   ? 161.710 228.195 130.667 1.00 28.04  ?  37   GLN B CG    1 
ATOM   8202  C  CD    . GLN B 2  37   ? 161.387 229.658 130.848 1.00 28.04  ?  37   GLN B CD    1 
ATOM   8203  O  OE1   . GLN B 2  37   ? 160.561 230.032 131.677 1.00 28.04  ?  37   GLN B OE1   1 
ATOM   8204  N  NE2   . GLN B 2  37   ? 162.045 230.501 130.071 1.00 28.04  ?  37   GLN B NE2   1 
ATOM   8205  N  N     . PRO B 2  38   ? 159.362 224.375 131.928 1.00 25.68  ?  38   PRO B N     1 
ATOM   8206  C  CA    . PRO B 2  38   ? 158.668 223.389 132.779 1.00 25.68  ?  38   PRO B CA    1 
ATOM   8207  C  C     . PRO B 2  38   ? 159.424 222.103 133.067 1.00 25.68  ?  38   PRO B C     1 
ATOM   8208  O  O     . PRO B 2  38   ? 158.942 221.312 133.878 1.00 25.68  ?  38   PRO B O     1 
ATOM   8209  C  CB    . PRO B 2  38   ? 157.388 223.083 131.985 1.00 25.68  ?  38   PRO B CB    1 
ATOM   8210  C  CG    . PRO B 2  38   ? 157.581 223.701 130.661 1.00 25.68  ?  38   PRO B CG    1 
ATOM   8211  C  CD    . PRO B 2  38   ? 158.387 224.889 130.944 1.00 25.68  ?  38   PRO B CD    1 
ATOM   8212  N  N     . PHE B 2  39   ? 160.568 221.838 132.455 1.00 21.52  ?  39   PHE B N     1 
ATOM   8213  C  CA    . PHE B 2  39   ? 161.331 220.646 132.774 1.00 21.52  ?  39   PHE B CA    1 
ATOM   8214  C  C     . PHE B 2  39   ? 162.525 220.922 133.675 1.00 21.52  ?  39   PHE B C     1 
ATOM   8215  O  O     . PHE B 2  39   ? 163.098 219.976 134.221 1.00 21.52  ?  39   PHE B O     1 
ATOM   8216  C  CB    . PHE B 2  39   ? 161.792 219.963 131.485 1.00 21.52  ?  39   PHE B CB    1 
ATOM   8217  C  CG    . PHE B 2  39   ? 160.737 219.921 130.430 1.00 21.52  ?  39   PHE B CG    1 
ATOM   8218  C  CD1   . PHE B 2  39   ? 159.547 219.248 130.653 1.00 21.52  ?  39   PHE B CD1   1 
ATOM   8219  C  CD2   . PHE B 2  39   ? 160.913 220.578 129.225 1.00 21.52  ?  39   PHE B CD2   1 
ATOM   8220  C  CE1   . PHE B 2  39   ? 158.562 219.217 129.688 1.00 21.52  ?  39   PHE B CE1   1 
ATOM   8221  C  CE2   . PHE B 2  39   ? 159.928 220.551 128.257 1.00 21.52  ?  39   PHE B CE2   1 
ATOM   8222  C  CZ    . PHE B 2  39   ? 158.755 219.872 128.488 1.00 21.52  ?  39   PHE B CZ    1 
ATOM   8223  N  N     . ARG B 2  40   ? 162.897 222.184 133.856 1.00 29.94  ?  40   ARG B N     1 
ATOM   8224  C  CA    . ARG B 2  40   ? 163.973 222.557 134.761 1.00 29.94  ?  40   ARG B CA    1 
ATOM   8225  C  C     . ARG B 2  40   ? 163.401 222.747 136.163 1.00 29.94  ?  40   ARG B C     1 
ATOM   8226  O  O     . ARG B 2  40   ? 162.601 223.660 136.392 1.00 29.94  ?  40   ARG B O     1 
ATOM   8227  C  CB    . ARG B 2  40   ? 164.654 223.823 134.257 1.00 29.94  ?  40   ARG B CB    1 
ATOM   8228  C  CG    . ARG B 2  40   ? 165.855 224.264 135.052 1.00 29.94  ?  40   ARG B CG    1 
ATOM   8229  C  CD    . ARG B 2  40   ? 166.846 223.141 135.238 1.00 29.94  ?  40   ARG B CD    1 
ATOM   8230  N  NE    . ARG B 2  40   ? 168.021 223.599 135.963 1.00 29.94  ?  40   ARG B NE    1 
ATOM   8231  C  CZ    . ARG B 2  40   ? 168.597 222.929 136.948 1.00 29.94  ?  40   ARG B CZ    1 
ATOM   8232  N  NH1   . ARG B 2  40   ? 168.097 221.773 137.351 1.00 29.94  1  40   ARG B NH1   1 
ATOM   8233  N  NH2   . ARG B 2  40   ? 169.663 223.429 137.541 1.00 29.94  ?  40   ARG B NH2   1 
ATOM   8234  N  N     . LEU B 2  41   ? 163.813 221.888 137.096 1.00 29.81  ?  41   LEU B N     1 
ATOM   8235  C  CA    . LEU B 2  41   ? 163.175 221.748 138.402 1.00 29.81  ?  41   LEU B CA    1 
ATOM   8236  C  C     . LEU B 2  41   ? 164.069 222.352 139.477 1.00 29.81  ?  41   LEU B C     1 
ATOM   8237  O  O     . LEU B 2  41   ? 165.113 221.783 139.815 1.00 29.81  ?  41   LEU B O     1 
ATOM   8238  C  CB    . LEU B 2  41   ? 162.888 220.277 138.692 1.00 29.81  ?  41   LEU B CB    1 
ATOM   8239  C  CG    . LEU B 2  41   ? 161.645 219.695 138.022 1.00 29.81  ?  41   LEU B CG    1 
ATOM   8240  C  CD1   . LEU B 2  41   ? 161.556 218.204 138.251 1.00 29.81  ?  41   LEU B CD1   1 
ATOM   8241  C  CD2   . LEU B 2  41   ? 160.412 220.395 138.532 1.00 29.81  ?  41   LEU B CD2   1 
ATOM   8242  N  N     . GLY B 2  42   ? 163.641 223.482 140.035 1.00 34.05  ?  42   GLY B N     1 
ATOM   8243  C  CA    . GLY B 2  42   ? 164.460 224.232 140.966 1.00 34.05  ?  42   GLY B CA    1 
ATOM   8244  C  C     . GLY B 2  42   ? 164.309 223.870 142.431 1.00 34.05  ?  42   GLY B C     1 
ATOM   8245  O  O     . GLY B 2  42   ? 165.278 223.947 143.189 1.00 34.05  ?  42   GLY B O     1 
ATOM   8246  N  N     . GLU B 2  43   ? 163.107 223.465 142.844 1.00 43.54  ?  43   GLU B N     1 
ATOM   8247  C  CA    . GLU B 2  43   ? 162.817 223.180 144.246 1.00 43.54  ?  43   GLU B CA    1 
ATOM   8248  C  C     . GLU B 2  43   ? 163.051 221.709 144.609 1.00 43.54  ?  43   GLU B C     1 
ATOM   8249  O  O     . GLU B 2  43   ? 163.843 221.425 145.513 1.00 43.54  ?  43   GLU B O     1 
ATOM   8250  C  CB    . GLU B 2  43   ? 161.380 223.613 144.588 1.00 43.54  ?  43   GLU B CB    1 
ATOM   8251  C  CG    . GLU B 2  43   ? 160.314 223.383 143.494 1.00 43.54  ?  43   GLU B CG    1 
ATOM   8252  C  CD    . GLU B 2  43   ? 160.152 224.552 142.530 1.00 43.54  ?  43   GLU B CD    1 
ATOM   8253  O  OE1   . GLU B 2  43   ? 159.037 224.734 141.997 1.00 43.54  ?  43   GLU B OE1   1 
ATOM   8254  O  OE2   . GLU B 2  43   ? 161.135 225.286 142.298 1.00 43.54  -1 43   GLU B OE2   1 
ATOM   8255  N  N     . ARG B 2  44   ? 162.373 220.785 143.919 1.00 36.54  ?  44   ARG B N     1 
ATOM   8256  C  CA    . ARG B 2  44   ? 162.579 219.331 143.988 1.00 36.54  ?  44   ARG B CA    1 
ATOM   8257  C  C     . ARG B 2  44   ? 162.357 218.791 145.407 1.00 36.54  ?  44   ARG B C     1 
ATOM   8258  O  O     . ARG B 2  44   ? 163.263 218.323 146.096 1.00 36.54  ?  44   ARG B O     1 
ATOM   8259  C  CB    . ARG B 2  44   ? 163.958 218.955 143.426 1.00 36.54  ?  44   ARG B CB    1 
ATOM   8260  C  CG    . ARG B 2  44   ? 164.194 217.466 143.176 1.00 36.54  ?  44   ARG B CG    1 
ATOM   8261  C  CD    . ARG B 2  44   ? 165.273 217.249 142.129 1.00 36.54  ?  44   ARG B CD    1 
ATOM   8262  N  NE    . ARG B 2  44   ? 164.684 216.768 140.888 1.00 36.54  ?  44   ARG B NE    1 
ATOM   8263  C  CZ    . ARG B 2  44   ? 164.776 215.514 140.462 1.00 36.54  ?  44   ARG B CZ    1 
ATOM   8264  N  NH1   . ARG B 2  44   ? 164.188 215.151 139.331 1.00 36.54  1  44   ARG B NH1   1 
ATOM   8265  N  NH2   . ARG B 2  44   ? 165.465 214.625 141.165 1.00 36.54  ?  44   ARG B NH2   1 
ATOM   8266  N  N     . SER B 2  45   ? 161.107 218.897 145.836 1.00 37.43  ?  45   SER B N     1 
ATOM   8267  C  CA    . SER B 2  45   ? 160.628 218.258 147.057 1.00 37.43  ?  45   SER B CA    1 
ATOM   8268  C  C     . SER B 2  45   ? 159.946 216.949 146.685 1.00 37.43  ?  45   SER B C     1 
ATOM   8269  O  O     . SER B 2  45   ? 158.985 216.940 145.914 1.00 37.43  ?  45   SER B O     1 
ATOM   8270  C  CB    . SER B 2  45   ? 159.664 219.168 147.811 1.00 37.43  ?  45   SER B CB    1 
ATOM   8271  O  OG    . SER B 2  45   ? 159.507 218.752 149.154 1.00 37.43  ?  45   SER B OG    1 
ATOM   8272  N  N     . PHE B 2  46   ? 160.433 215.849 147.238 1.00 40.62  ?  46   PHE B N     1 
ATOM   8273  C  CA    . PHE B 2  46   ? 159.704 214.587 147.221 1.00 40.62  ?  46   PHE B CA    1 
ATOM   8274  C  C     . PHE B 2  46   ? 158.687 214.618 148.362 1.00 40.62  ?  46   PHE B C     1 
ATOM   8275  O  O     . PHE B 2  46   ? 158.229 215.686 148.782 1.00 40.62  ?  46   PHE B O     1 
ATOM   8276  C  CB    . PHE B 2  46   ? 160.651 213.398 147.296 1.00 40.62  ?  46   PHE B CB    1 
ATOM   8277  C  CG    . PHE B 2  46   ? 161.341 213.104 146.003 1.00 40.62  ?  46   PHE B CG    1 
ATOM   8278  C  CD1   . PHE B 2  46   ? 162.339 213.941 145.527 1.00 40.62  ?  46   PHE B CD1   1 
ATOM   8279  C  CD2   . PHE B 2  46   ? 160.992 211.999 145.253 1.00 40.62  ?  46   PHE B CD2   1 
ATOM   8280  C  CE1   . PHE B 2  46   ? 162.966 213.681 144.336 1.00 40.62  ?  46   PHE B CE1   1 
ATOM   8281  C  CE2   . PHE B 2  46   ? 161.624 211.732 144.060 1.00 40.62  ?  46   PHE B CE2   1 
ATOM   8282  C  CZ    . PHE B 2  46   ? 162.606 212.581 143.606 1.00 40.62  ?  46   PHE B CZ    1 
ATOM   8283  N  N     . SER B 2  47   ? 158.249 213.434 148.786 1.00 33.03  ?  47   SER B N     1 
ATOM   8284  C  CA    . SER B 2  47   ? 157.295 213.226 149.882 1.00 33.03  ?  47   SER B CA    1 
ATOM   8285  C  C     . SER B 2  47   ? 155.893 213.681 149.502 1.00 33.03  ?  47   SER B C     1 
ATOM   8286  O  O     . SER B 2  47   ? 155.190 214.300 150.294 1.00 33.03  ?  47   SER B O     1 
ATOM   8287  C  CB    . SER B 2  47   ? 157.726 213.871 151.201 1.00 33.03  ?  47   SER B CB    1 
ATOM   8288  O  OG    . SER B 2  47   ? 157.412 215.254 151.175 1.00 33.03  ?  47   SER B OG    1 
ATOM   8289  N  N     . ARG B 2  48   ? 155.491 213.362 148.284 1.00 40.62  ?  48   ARG B N     1 
ATOM   8290  C  CA    . ARG B 2  48   ? 154.101 213.302 147.890 1.00 40.62  ?  48   ARG B CA    1 
ATOM   8291  C  C     . ARG B 2  48   ? 153.808 211.905 147.382 1.00 40.62  ?  48   ARG B C     1 
ATOM   8292  O  O     . ARG B 2  48   ? 154.663 211.021 147.389 1.00 40.62  ?  48   ARG B O     1 
ATOM   8293  C  CB    . ARG B 2  48   ? 153.780 214.350 146.835 1.00 40.62  ?  48   ARG B CB    1 
ATOM   8294  C  CG    . ARG B 2  48   ? 153.488 215.686 147.419 1.00 40.62  ?  48   ARG B CG    1 
ATOM   8295  C  CD    . ARG B 2  48   ? 153.441 216.756 146.366 1.00 40.62  ?  48   ARG B CD    1 
ATOM   8296  N  NE    . ARG B 2  48   ? 154.750 217.345 146.139 1.00 40.62  ?  48   ARG B NE    1 
ATOM   8297  C  CZ    . ARG B 2  48   ? 155.257 218.339 146.856 1.00 40.62  ?  48   ARG B CZ    1 
ATOM   8298  N  NH1   . ARG B 2  48   ? 156.460 218.806 146.566 1.00 40.62  1  48   ARG B NH1   1 
ATOM   8299  N  NH2   . ARG B 2  48   ? 154.569 218.866 147.855 1.00 40.62  ?  48   ARG B NH2   1 
ATOM   8300  N  N     . GLN B 2  49   ? 152.580 211.706 146.947 1.00 41.93  ?  49   GLN B N     1 
ATOM   8301  C  CA    . GLN B 2  49   ? 152.136 210.438 146.401 1.00 41.93  ?  49   GLN B CA    1 
ATOM   8302  C  C     . GLN B 2  49   ? 151.624 210.643 144.985 1.00 41.93  ?  49   GLN B C     1 
ATOM   8303  O  O     . GLN B 2  49   ? 151.269 211.752 144.591 1.00 41.93  ?  49   GLN B O     1 
ATOM   8304  C  CB    . GLN B 2  49   ? 151.090 209.820 147.327 1.00 41.93  ?  49   GLN B CB    1 
ATOM   8305  C  CG    . GLN B 2  49   ? 150.000 210.778 147.781 1.00 41.93  ?  49   GLN B CG    1 
ATOM   8306  C  CD    . GLN B 2  49   ? 149.159 210.188 148.899 1.00 41.93  ?  49   GLN B CD    1 
ATOM   8307  O  OE1   . GLN B 2  49   ? 149.319 209.029 149.268 1.00 41.93  ?  49   GLN B OE1   1 
ATOM   8308  N  NE2   . GLN B 2  49   ? 148.277 210.998 149.461 1.00 41.93  ?  49   GLN B NE2   1 
ATOM   8309  N  N     . TYR B 2  50   ? 151.600 209.561 144.211 1.00 40.62  ?  50   TYR B N     1 
ATOM   8310  C  CA    . TYR B 2  50   ? 151.397 209.635 142.769 1.00 40.62  ?  50   TYR B CA    1 
ATOM   8311  C  C     . TYR B 2  50   ? 149.949 209.826 142.358 1.00 40.62  ?  50   TYR B C     1 
ATOM   8312  O  O     . TYR B 2  50   ? 149.636 209.655 141.183 1.00 40.62  ?  50   TYR B O     1 
ATOM   8313  C  CB    . TYR B 2  50   ? 151.932 208.377 142.096 1.00 40.62  ?  50   TYR B CB    1 
ATOM   8314  C  CG    . TYR B 2  50   ? 153.403 208.404 141.819 1.00 40.62  ?  50   TYR B CG    1 
ATOM   8315  C  CD1   . TYR B 2  50   ? 154.038 209.585 141.493 1.00 40.62  ?  50   TYR B CD1   1 
ATOM   8316  C  CD2   . TYR B 2  50   ? 154.157 207.248 141.885 1.00 40.62  ?  50   TYR B CD2   1 
ATOM   8317  C  CE1   . TYR B 2  50   ? 155.369 209.615 141.241 1.00 40.62  ?  50   TYR B CE1   1 
ATOM   8318  C  CE2   . TYR B 2  50   ? 155.490 207.270 141.641 1.00 40.62  ?  50   TYR B CE2   1 
ATOM   8319  C  CZ    . TYR B 2  50   ? 156.090 208.455 141.316 1.00 40.62  ?  50   TYR B CZ    1 
ATOM   8320  O  OH    . TYR B 2  50   ? 157.427 208.492 141.061 1.00 40.62  ?  50   TYR B OH    1 
ATOM   8321  N  N     . ALA B 2  51   ? 149.059 210.166 143.270 1.00 40.62  ?  51   ALA B N     1 
ATOM   8322  C  CA    . ALA B 2  51   ? 147.668 210.351 142.928 1.00 40.62  ?  51   ALA B CA    1 
ATOM   8323  C  C     . ALA B 2  51   ? 147.339 211.765 142.516 1.00 40.62  ?  51   ALA B C     1 
ATOM   8324  O  O     . ALA B 2  51   ? 146.263 211.988 141.971 1.00 40.62  ?  51   ALA B O     1 
ATOM   8325  C  CB    . ALA B 2  51   ? 146.790 209.957 144.104 1.00 40.62  ?  51   ALA B CB    1 
ATOM   8326  N  N     . HIS B 2  52   ? 148.215 212.730 142.768 1.00 40.62  ?  52   HIS B N     1 
ATOM   8327  C  CA    . HIS B 2  52   ? 147.954 214.090 142.319 1.00 40.62  ?  52   HIS B CA    1 
ATOM   8328  C  C     . HIS B 2  52   ? 148.149 214.257 140.819 1.00 40.62  ?  52   HIS B C     1 
ATOM   8329  O  O     . HIS B 2  52   ? 147.615 215.200 140.237 1.00 40.62  ?  52   HIS B O     1 
ATOM   8330  C  CB    . HIS B 2  52   ? 148.861 215.075 143.051 1.00 40.62  ?  52   HIS B CB    1 
ATOM   8331  C  CG    . HIS B 2  52   ? 148.634 215.146 144.527 1.00 40.62  ?  52   HIS B CG    1 
ATOM   8332  N  ND1   . HIS B 2  52   ? 147.733 216.013 145.103 1.00 40.62  ?  52   HIS B ND1   1 
ATOM   8333  C  CD2   . HIS B 2  52   ? 149.227 214.488 145.549 1.00 40.62  ?  52   HIS B CD2   1 
ATOM   8334  C  CE1   . HIS B 2  52   ? 147.768 215.872 146.413 1.00 40.62  ?  52   HIS B CE1   1 
ATOM   8335  N  NE2   . HIS B 2  52   ? 148.662 214.950 146.708 1.00 40.62  ?  52   HIS B NE2   1 
ATOM   8336  N  N     . ILE B 2  53   ? 148.883 213.355 140.185 1.00 40.62  ?  53   ILE B N     1 
ATOM   8337  C  CA    . ILE B 2  53   ? 149.192 213.462 138.767 1.00 40.62  ?  53   ILE B CA    1 
ATOM   8338  C  C     . ILE B 2  53   ? 148.037 212.976 137.890 1.00 40.62  ?  53   ILE B C     1 
ATOM   8339  O  O     . ILE B 2  53   ? 147.668 213.664 136.930 1.00 40.62  ?  53   ILE B O     1 
ATOM   8340  C  CB    . ILE B 2  53   ? 150.493 212.695 138.473 1.00 40.62  ?  53   ILE B CB    1 
ATOM   8341  C  CG1   . ILE B 2  53   ? 151.648 213.299 139.259 1.00 40.62  ?  53   ILE B CG1   1 
ATOM   8342  C  CG2   . ILE B 2  53   ? 150.880 212.816 137.043 1.00 40.62  ?  53   ILE B CG2   1 
ATOM   8343  C  CD1   . ILE B 2  53   ? 152.059 212.565 140.550 1.00 40.62  ?  53   ILE B CD1   1 
ATOM   8344  N  N     . TYR B 2  54   ? 147.437 211.827 138.220 1.00 40.62  ?  54   TYR B N     1 
ATOM   8345  C  CA    . TYR B 2  54   ? 146.307 211.295 137.463 1.00 40.62  ?  54   TYR B CA    1 
ATOM   8346  C  C     . TYR B 2  54   ? 145.088 212.204 137.518 1.00 40.62  ?  54   TYR B C     1 
ATOM   8347  O  O     . TYR B 2  54   ? 144.380 212.350 136.515 1.00 40.62  ?  54   TYR B O     1 
ATOM   8348  C  CB    . TYR B 2  54   ? 145.928 209.926 137.990 1.00 40.62  ?  54   TYR B CB    1 
ATOM   8349  C  CG    . TYR B 2  54   ? 146.932 208.873 137.710 1.00 40.62  ?  54   TYR B CG    1 
ATOM   8350  C  CD1   . TYR B 2  54   ? 146.962 208.231 136.493 1.00 40.62  ?  54   TYR B CD1   1 
ATOM   8351  C  CD2   . TYR B 2  54   ? 147.851 208.503 138.668 1.00 40.62  ?  54   TYR B CD2   1 
ATOM   8352  C  CE1   . TYR B 2  54   ? 147.883 207.259 136.232 1.00 40.62  ?  54   TYR B CE1   1 
ATOM   8353  C  CE2   . TYR B 2  54   ? 148.770 207.527 138.423 1.00 40.62  ?  54   TYR B CE2   1 
ATOM   8354  C  CZ    . TYR B 2  54   ? 148.781 206.910 137.201 1.00 40.62  ?  54   TYR B CZ    1 
ATOM   8355  O  OH    . TYR B 2  54   ? 149.695 205.932 136.942 1.00 40.62  ?  54   TYR B OH    1 
ATOM   8356  N  N     . ALA B 2  55   ? 144.849 212.833 138.664 1.00 40.62  ?  55   ALA B N     1 
ATOM   8357  C  CA    . ALA B 2  55   ? 143.690 213.696 138.824 1.00 40.62  ?  55   ALA B CA    1 
ATOM   8358  C  C     . ALA B 2  55   ? 143.794 214.939 137.954 1.00 40.62  ?  55   ALA B C     1 
ATOM   8359  O  O     . ALA B 2  55   ? 142.828 215.308 137.279 1.00 40.62  ?  55   ALA B O     1 
ATOM   8360  C  CB    . ALA B 2  55   ? 143.535 214.072 140.295 1.00 40.62  ?  55   ALA B CB    1 
ATOM   8361  N  N     . THR B 2  56   ? 144.965 215.577 137.917 1.00 39.46  ?  56   THR B N     1 
ATOM   8362  C  CA    . THR B 2  56   ? 145.114 216.766 137.086 1.00 39.46  ?  56   THR B CA    1 
ATOM   8363  C  C     . THR B 2  56   ? 145.200 216.401 135.605 1.00 39.46  ?  56   THR B C     1 
ATOM   8364  O  O     . THR B 2  56   ? 144.742 217.176 134.758 1.00 39.46  ?  56   THR B O     1 
ATOM   8365  C  CB    . THR B 2  56   ? 146.330 217.569 137.553 1.00 39.46  ?  56   THR B CB    1 
ATOM   8366  O  OG1   . THR B 2  56   ? 146.196 217.829 138.948 1.00 39.46  ?  56   THR B OG1   1 
ATOM   8367  C  CG2   . THR B 2  56   ? 146.403 218.909 136.870 1.00 39.46  ?  56   THR B CG2   1 
ATOM   8368  N  N     . ARG B 2  57   ? 145.692 215.199 135.282 1.00 40.62  ?  57   ARG B N     1 
ATOM   8369  C  CA    . ARG B 2  57   ? 145.641 214.717 133.902 1.00 40.62  ?  57   ARG B CA    1 
ATOM   8370  C  C     . ARG B 2  57   ? 144.207 214.586 133.395 1.00 40.62  ?  57   ARG B C     1 
ATOM   8371  O  O     . ARG B 2  57   ? 143.887 215.059 132.301 1.00 40.62  ?  57   ARG B O     1 
ATOM   8372  C  CB    . ARG B 2  57   ? 146.357 213.382 133.787 1.00 40.62  ?  57   ARG B CB    1 
ATOM   8373  C  CG    . ARG B 2  57   ? 146.638 212.995 132.379 1.00 40.62  ?  57   ARG B CG    1 
ATOM   8374  C  CD    . ARG B 2  57   ? 147.436 211.741 132.330 1.00 40.62  ?  57   ARG B CD    1 
ATOM   8375  N  NE    . ARG B 2  57   ? 148.720 211.917 132.985 1.00 40.62  ?  57   ARG B NE    1 
ATOM   8376  C  CZ    . ARG B 2  57   ? 149.601 210.942 133.155 1.00 40.62  ?  57   ARG B CZ    1 
ATOM   8377  N  NH1   . ARG B 2  57   ? 149.333 209.720 132.727 1.00 40.62  1  57   ARG B NH1   1 
ATOM   8378  N  NH2   . ARG B 2  57   ? 150.742 211.195 133.767 1.00 40.62  ?  57   ARG B NH2   1 
ATOM   8379  N  N     . LEU B 2  58   ? 143.322 213.977 134.192 1.00 41.15  ?  58   LEU B N     1 
ATOM   8380  C  CA    . LEU B 2  58   ? 141.917 213.857 133.787 1.00 41.15  ?  58   LEU B CA    1 
ATOM   8381  C  C     . LEU B 2  58   ? 141.222 215.208 133.714 1.00 41.15  ?  58   LEU B C     1 
ATOM   8382  O  O     . LEU B 2  58   ? 140.478 215.477 132.763 1.00 41.15  ?  58   LEU B O     1 
ATOM   8383  C  CB    . LEU B 2  58   ? 141.147 212.947 134.736 1.00 41.15  ?  58   LEU B CB    1 
ATOM   8384  C  CG    . LEU B 2  58   ? 140.854 211.519 134.301 1.00 41.15  ?  58   LEU B CG    1 
ATOM   8385  C  CD1   . LEU B 2  58   ? 139.873 210.905 135.260 1.00 41.15  ?  58   LEU B CD1   1 
ATOM   8386  C  CD2   . LEU B 2  58   ? 140.272 211.523 132.919 1.00 41.15  ?  58   LEU B CD2   1 
ATOM   8387  N  N     . ILE B 2  59   ? 141.445 216.064 134.711 1.00 40.62  ?  59   ILE B N     1 
ATOM   8388  C  CA    . ILE B 2  59   ? 140.771 217.358 134.754 1.00 40.62  ?  59   ILE B CA    1 
ATOM   8389  C  C     . ILE B 2  59   ? 141.207 218.250 133.594 1.00 40.62  ?  59   ILE B C     1 
ATOM   8390  O  O     . ILE B 2  59   ? 140.391 218.987 133.026 1.00 40.62  ?  59   ILE B O     1 
ATOM   8391  C  CB    . ILE B 2  59   ? 141.017 218.007 136.134 1.00 40.62  ?  59   ILE B CB    1 
ATOM   8392  C  CG1   . ILE B 2  59   ? 140.235 217.255 137.204 1.00 40.62  ?  59   ILE B CG1   1 
ATOM   8393  C  CG2   . ILE B 2  59   ? 140.618 219.467 136.179 1.00 40.62  ?  59   ILE B CG2   1 
ATOM   8394  C  CD1   . ILE B 2  59   ? 140.677 217.561 138.600 1.00 40.62  ?  59   ILE B CD1   1 
ATOM   8395  N  N     . GLN B 2  60   ? 142.460 218.142 133.161 1.00 31.16  ?  60   GLN B N     1 
ATOM   8396  C  CA    . GLN B 2  60   ? 142.886 218.950 132.027 1.00 31.16  ?  60   GLN B CA    1 
ATOM   8397  C  C     . GLN B 2  60   ? 142.476 218.333 130.693 1.00 31.16  ?  60   GLN B C     1 
ATOM   8398  O  O     . GLN B 2  60   ? 142.097 219.061 129.773 1.00 31.16  ?  60   GLN B O     1 
ATOM   8399  C  CB    . GLN B 2  60   ? 144.394 219.166 132.088 1.00 31.16  ?  60   GLN B CB    1 
ATOM   8400  C  CG    . GLN B 2  60   ? 144.930 220.139 131.066 1.00 31.16  ?  60   GLN B CG    1 
ATOM   8401  C  CD    . GLN B 2  60   ? 146.297 220.662 131.434 1.00 31.16  ?  60   GLN B CD    1 
ATOM   8402  O  OE1   . GLN B 2  60   ? 146.740 220.533 132.577 1.00 31.16  ?  60   GLN B OE1   1 
ATOM   8403  N  NE2   . GLN B 2  60   ? 146.982 221.248 130.460 1.00 31.16  ?  60   GLN B NE2   1 
ATOM   8404  N  N     . MET B 2  61   ? 142.522 217.005 130.561 1.00 40.62  ?  61   MET B N     1 
ATOM   8405  C  CA    . MET B 2  61   ? 142.217 216.362 129.289 1.00 40.62  ?  61   MET B CA    1 
ATOM   8406  C  C     . MET B 2  61   ? 140.729 216.164 129.019 1.00 40.62  ?  61   MET B C     1 
ATOM   8407  O  O     . MET B 2  61   ? 140.391 215.675 127.940 1.00 40.62  ?  61   MET B O     1 
ATOM   8408  C  CB    . MET B 2  61   ? 142.897 215.000 129.210 1.00 40.62  ?  61   MET B CB    1 
ATOM   8409  C  CG    . MET B 2  61   ? 144.373 215.065 128.890 1.00 40.62  ?  61   MET B CG    1 
ATOM   8410  S  SD    . MET B 2  61   ? 144.659 215.770 127.273 1.00 40.62  ?  61   MET B SD    1 
ATOM   8411  C  CE    . MET B 2  61   ? 144.228 214.376 126.263 1.00 40.62  ?  61   MET B CE    1 
ATOM   8412  N  N     . ARG B 2  62   ? 139.833 216.483 129.960 1.00 28.47  ?  62   ARG B N     1 
ATOM   8413  C  CA    . ARG B 2  62   ? 138.419 216.179 129.730 1.00 28.47  ?  62   ARG B CA    1 
ATOM   8414  C  C     . ARG B 2  62   ? 137.733 217.054 128.671 1.00 28.47  ?  62   ARG B C     1 
ATOM   8415  O  O     . ARG B 2  62   ? 137.018 216.482 127.823 1.00 28.47  ?  62   ARG B O     1 
ATOM   8416  C  CB    . ARG B 2  62   ? 137.675 216.189 131.070 1.00 28.47  ?  62   ARG B CB    1 
ATOM   8417  C  CG    . ARG B 2  62   ? 136.249 215.689 131.024 1.00 28.47  ?  62   ARG B CG    1 
ATOM   8418  C  CD    . ARG B 2  62   ? 135.552 215.906 132.361 1.00 28.47  ?  62   ARG B CD    1 
ATOM   8419  N  NE    . ARG B 2  62   ? 135.815 214.820 133.302 1.00 28.47  ?  62   ARG B NE    1 
ATOM   8420  C  CZ    . ARG B 2  62   ? 136.348 214.984 134.509 1.00 28.47  ?  62   ARG B CZ    1 
ATOM   8421  N  NH1   . ARG B 2  62   ? 136.683 216.194 134.932 1.00 28.47  1  62   ARG B NH1   1 
ATOM   8422  N  NH2   . ARG B 2  62   ? 136.549 213.935 135.291 1.00 28.47  ?  62   ARG B NH2   1 
ATOM   8423  N  N     . PRO B 2  63   ? 137.862 218.402 128.651 1.00 26.99  ?  63   PRO B N     1 
ATOM   8424  C  CA    . PRO B 2  63   ? 137.140 219.173 127.619 1.00 26.99  ?  63   PRO B CA    1 
ATOM   8425  C  C     . PRO B 2  63   ? 137.562 218.905 126.182 1.00 26.99  ?  63   PRO B C     1 
ATOM   8426  O  O     . PRO B 2  63   ? 136.715 219.035 125.289 1.00 26.99  ?  63   PRO B O     1 
ATOM   8427  C  CB    . PRO B 2  63   ? 137.426 220.627 128.004 1.00 26.99  ?  63   PRO B CB    1 
ATOM   8428  C  CG    . PRO B 2  63   ? 137.669 220.585 129.399 1.00 26.99  ?  63   PRO B CG    1 
ATOM   8429  C  CD    . PRO B 2  63   ? 138.434 219.347 129.631 1.00 26.99  ?  63   PRO B CD    1 
ATOM   8430  N  N     . PHE B 2  64   ? 138.822 218.525 125.939 1.00 28.90  ?  64   PHE B N     1 
ATOM   8431  C  CA    . PHE B 2  64   ? 139.245 218.147 124.592 1.00 28.90  ?  64   PHE B CA    1 
ATOM   8432  C  C     . PHE B 2  64   ? 138.465 216.941 124.099 1.00 28.90  ?  64   PHE B C     1 
ATOM   8433  O  O     . PHE B 2  64   ? 137.994 216.917 122.958 1.00 28.90  ?  64   PHE B O     1 
ATOM   8434  C  CB    . PHE B 2  64   ? 140.745 217.820 124.536 1.00 28.90  ?  64   PHE B CB    1 
ATOM   8435  C  CG    . PHE B 2  64   ? 141.647 218.853 125.149 1.00 28.90  ?  64   PHE B CG    1 
ATOM   8436  C  CD1   . PHE B 2  64   ? 141.362 220.208 125.077 1.00 28.90  ?  64   PHE B CD1   1 
ATOM   8437  C  CD2   . PHE B 2  64   ? 142.808 218.458 125.775 1.00 28.90  ?  64   PHE B CD2   1 
ATOM   8438  C  CE1   . PHE B 2  64   ? 142.205 221.137 125.643 1.00 28.90  ?  64   PHE B CE1   1 
ATOM   8439  C  CE2   . PHE B 2  64   ? 143.653 219.384 126.338 1.00 28.90  ?  64   PHE B CE2   1 
ATOM   8440  C  CZ    . PHE B 2  64   ? 143.347 220.725 126.272 1.00 28.90  ?  64   PHE B CZ    1 
ATOM   8441  N  N     . LEU B 2  65   ? 138.272 215.952 124.960 1.00 24.70  ?  65   LEU B N     1 
ATOM   8442  C  CA    . LEU B 2  65   ? 137.589 214.744 124.536 1.00 24.70  ?  65   LEU B CA    1 
ATOM   8443  C  C     . LEU B 2  65   ? 136.087 214.937 124.428 1.00 24.70  ?  65   LEU B C     1 
ATOM   8444  O  O     . LEU B 2  65   ? 135.462 214.321 123.558 1.00 24.70  ?  65   LEU B O     1 
ATOM   8445  C  CB    . LEU B 2  65   ? 137.909 213.616 125.490 1.00 24.70  ?  65   LEU B CB    1 
ATOM   8446  C  CG    . LEU B 2  65   ? 139.294 213.107 125.176 1.00 24.70  ?  65   LEU B CG    1 
ATOM   8447  C  CD1   . LEU B 2  65   ? 139.812 212.364 126.352 1.00 24.70  ?  65   LEU B CD1   1 
ATOM   8448  C  CD2   . LEU B 2  65   ? 139.195 212.200 124.005 1.00 24.70  ?  65   LEU B CD2   1 
ATOM   8449  N  N     . GLU B 2  66   ? 135.498 215.791 125.267 1.00 30.75  ?  66   GLU B N     1 
ATOM   8450  C  CA    . GLU B 2  66   ? 134.087 216.127 125.077 1.00 30.75  ?  66   GLU B CA    1 
ATOM   8451  C  C     . GLU B 2  66   ? 133.864 216.848 123.754 1.00 30.75  ?  66   GLU B C     1 
ATOM   8452  O  O     . GLU B 2  66   ? 132.954 216.496 122.986 1.00 30.75  ?  66   GLU B O     1 
ATOM   8453  C  CB    . GLU B 2  66   ? 133.583 216.986 126.234 1.00 30.75  ?  66   GLU B CB    1 
ATOM   8454  C  CG    . GLU B 2  66   ? 133.199 216.188 127.464 1.00 30.75  ?  66   GLU B CG    1 
ATOM   8455  C  CD    . GLU B 2  66   ? 132.939 217.059 128.674 1.00 30.75  ?  66   GLU B CD    1 
ATOM   8456  O  OE1   . GLU B 2  66   ? 133.514 218.164 128.756 1.00 30.75  ?  66   GLU B OE1   1 
ATOM   8457  O  OE2   . GLU B 2  66   ? 132.156 216.638 129.547 1.00 30.75  -1 66   GLU B OE2   1 
ATOM   8458  N  N     . ASN B 2  67   ? 134.717 217.829 123.453 1.00 28.29  ?  67   ASN B N     1 
ATOM   8459  C  CA    . ASN B 2  67   ? 134.586 218.605 122.231 1.00 28.29  ?  67   ASN B CA    1 
ATOM   8460  C  C     . ASN B 2  67   ? 134.905 217.797 120.985 1.00 28.29  ?  67   ASN B C     1 
ATOM   8461  O  O     . ASN B 2  67   ? 134.457 218.163 119.900 1.00 28.29  ?  67   ASN B O     1 
ATOM   8462  C  CB    . ASN B 2  67   ? 135.500 219.823 122.312 1.00 28.29  ?  67   ASN B CB    1 
ATOM   8463  C  CG    . ASN B 2  67   ? 135.070 220.926 121.403 1.00 28.29  ?  67   ASN B CG    1 
ATOM   8464  O  OD1   . ASN B 2  67   ? 133.979 220.894 120.847 1.00 28.29  ?  67   ASN B OD1   1 
ATOM   8465  N  ND2   . ASN B 2  67   ? 135.926 221.919 121.241 1.00 28.29  ?  67   ASN B ND2   1 
ATOM   8466  N  N     . ARG B 2  68   ? 135.668 216.720 121.101 1.00 27.27  ?  68   ARG B N     1 
ATOM   8467  C  CA    . ARG B 2  68   ? 135.851 215.877 119.929 1.00 27.27  ?  68   ARG B CA    1 
ATOM   8468  C  C     . ARG B 2  68   ? 134.765 214.827 119.777 1.00 27.27  ?  68   ARG B C     1 
ATOM   8469  O  O     . ARG B 2  68   ? 134.416 214.479 118.643 1.00 27.27  ?  68   ARG B O     1 
ATOM   8470  C  CB    . ARG B 2  68   ? 137.215 215.195 119.964 1.00 27.27  ?  68   ARG B CB    1 
ATOM   8471  C  CG    . ARG B 2  68   ? 138.376 216.150 119.839 1.00 27.27  ?  68   ARG B CG    1 
ATOM   8472  C  CD    . ARG B 2  68   ? 138.582 216.713 118.454 1.00 27.27  ?  68   ARG B CD    1 
ATOM   8473  N  NE    . ARG B 2  68   ? 139.915 217.295 118.360 1.00 27.27  ?  68   ARG B NE    1 
ATOM   8474  C  CZ    . ARG B 2  68   ? 140.378 217.978 117.320 1.00 27.27  ?  68   ARG B CZ    1 
ATOM   8475  N  NH1   . ARG B 2  68   ? 139.615 218.180 116.257 1.00 27.27  1  68   ARG B NH1   1 
ATOM   8476  N  NH2   . ARG B 2  68   ? 141.613 218.460 117.346 1.00 27.27  ?  68   ARG B NH2   1 
ATOM   8477  N  N     . ALA B 2  69   ? 134.204 214.312 120.872 1.00 29.67  ?  69   ALA B N     1 
ATOM   8478  C  CA    . ALA B 2  69   ? 133.121 213.345 120.737 1.00 29.67  ?  69   ALA B CA    1 
ATOM   8479  C  C     . ALA B 2  69   ? 131.825 213.980 120.246 1.00 29.67  ?  69   ALA B C     1 
ATOM   8480  O  O     . ALA B 2  69   ? 131.025 213.284 119.605 1.00 29.67  ?  69   ALA B O     1 
ATOM   8481  C  CB    . ALA B 2  69   ? 132.879 212.624 122.061 1.00 29.67  ?  69   ALA B CB    1 
ATOM   8482  N  N     . GLN B 2  70   ? 131.614 215.274 120.519 1.00 38.93  ?  70   GLN B N     1 
ATOM   8483  C  CA    . GLN B 2  70   ? 130.489 215.998 119.927 1.00 38.93  ?  70   GLN B CA    1 
ATOM   8484  C  C     . GLN B 2  70   ? 130.541 215.968 118.403 1.00 38.93  ?  70   GLN B C     1 
ATOM   8485  O  O     . GLN B 2  70   ? 129.607 215.509 117.743 1.00 38.93  ?  70   GLN B O     1 
ATOM   8486  C  CB    . GLN B 2  70   ? 130.469 217.446 120.410 1.00 38.93  ?  70   GLN B CB    1 
ATOM   8487  C  CG    . GLN B 2  70   ? 130.072 217.639 121.849 1.00 38.93  ?  70   GLN B CG    1 
ATOM   8488  C  CD    . GLN B 2  70   ? 129.524 219.027 122.123 1.00 38.93  ?  70   GLN B CD    1 
ATOM   8489  O  OE1   . GLN B 2  70   ? 129.105 219.335 123.238 1.00 38.93  ?  70   GLN B OE1   1 
ATOM   8490  N  NE2   . GLN B 2  70   ? 129.524 219.874 121.102 1.00 38.93  ?  70   GLN B NE2   1 
ATOM   8491  N  N     . GLN B 2  71   ? 131.636 216.444 117.827 1.00 35.36  ?  71   GLN B N     1 
ATOM   8492  C  CA    . GLN B 2  71   ? 131.740 216.509 116.379 1.00 35.36  ?  71   GLN B CA    1 
ATOM   8493  C  C     . GLN B 2  71   ? 132.172 215.192 115.753 1.00 35.36  ?  71   GLN B C     1 
ATOM   8494  O  O     . GLN B 2  71   ? 132.327 215.130 114.532 1.00 35.36  ?  71   GLN B O     1 
ATOM   8495  C  CB    . GLN B 2  71   ? 132.710 217.618 115.977 1.00 35.36  ?  71   GLN B CB    1 
ATOM   8496  C  CG    . GLN B 2  71   ? 134.155 217.300 116.243 1.00 35.36  ?  71   GLN B CG    1 
ATOM   8497  C  CD    . GLN B 2  71   ? 135.042 218.513 116.135 1.00 35.36  ?  71   GLN B CD    1 
ATOM   8498  O  OE1   . GLN B 2  71   ? 134.719 219.579 116.648 1.00 35.36  ?  71   GLN B OE1   1 
ATOM   8499  N  NE2   . GLN B 2  71   ? 136.173 218.356 115.467 1.00 35.36  ?  71   GLN B NE2   1 
ATOM   8500  N  N     . HIS B 2  72   ? 132.381 214.143 116.538 1.00 34.79  ?  72   HIS B N     1 
ATOM   8501  C  CA    . HIS B 2  72   ? 132.690 212.856 115.950 1.00 34.79  ?  72   HIS B CA    1 
ATOM   8502  C  C     . HIS B 2  72   ? 131.519 211.884 116.016 1.00 34.79  ?  72   HIS B C     1 
ATOM   8503  O  O     . HIS B 2  72   ? 131.509 210.910 115.258 1.00 34.79  ?  72   HIS B O     1 
ATOM   8504  C  CB    . HIS B 2  72   ? 133.926 212.267 116.643 1.00 34.79  ?  72   HIS B CB    1 
ATOM   8505  C  CG    . HIS B 2  72   ? 134.691 211.281 115.818 1.00 34.79  ?  72   HIS B CG    1 
ATOM   8506  N  ND1   . HIS B 2  72   ? 135.744 210.554 116.325 1.00 34.79  ?  72   HIS B ND1   1 
ATOM   8507  C  CD2   . HIS B 2  72   ? 134.580 210.923 114.518 1.00 34.79  ?  72   HIS B CD2   1 
ATOM   8508  C  CE1   . HIS B 2  72   ? 136.237 209.776 115.381 1.00 34.79  ?  72   HIS B CE1   1 
ATOM   8509  N  NE2   . HIS B 2  72   ? 135.549 209.979 114.274 1.00 34.79  ?  72   HIS B NE2   1 
ATOM   8510  N  N     . TRP B 2  73   ? 130.532 212.128 116.897 1.00 33.22  ?  73   TRP B N     1 
ATOM   8511  C  CA    . TRP B 2  73   ? 129.352 211.272 117.001 1.00 33.22  ?  73   TRP B CA    1 
ATOM   8512  C  C     . TRP B 2  73   ? 128.034 212.035 116.954 1.00 33.22  ?  73   TRP B C     1 
ATOM   8513  O  O     . TRP B 2  73   ? 126.978 211.429 117.158 1.00 33.22  ?  73   TRP B O     1 
ATOM   8514  C  CB    . TRP B 2  73   ? 129.390 210.447 118.288 1.00 33.22  ?  73   TRP B CB    1 
ATOM   8515  C  CG    . TRP B 2  73   ? 130.387 209.369 118.259 1.00 33.22  ?  73   TRP B CG    1 
ATOM   8516  C  CD1   . TRP B 2  73   ? 130.607 208.496 117.246 1.00 33.22  ?  73   TRP B CD1   1 
ATOM   8517  C  CD2   . TRP B 2  73   ? 131.319 209.040 119.290 1.00 33.22  ?  73   TRP B CD2   1 
ATOM   8518  N  NE1   . TRP B 2  73   ? 131.622 207.642 117.576 1.00 33.22  ?  73   TRP B NE1   1 
ATOM   8519  C  CE2   . TRP B 2  73   ? 132.072 207.950 118.831 1.00 33.22  ?  73   TRP B CE2   1 
ATOM   8520  C  CE3   . TRP B 2  73   ? 131.586 209.556 120.559 1.00 33.22  ?  73   TRP B CE3   1 
ATOM   8521  C  CZ2   . TRP B 2  73   ? 133.077 207.367 119.594 1.00 33.22  ?  73   TRP B CZ2   1 
ATOM   8522  C  CZ3   . TRP B 2  73   ? 132.579 208.980 121.308 1.00 33.22  ?  73   TRP B CZ3   1 
ATOM   8523  C  CH2   . TRP B 2  73   ? 133.315 207.897 120.824 1.00 33.22  ?  73   TRP B CH2   1 
ATOM   8524  N  N     . GLY B 2  74   ? 128.052 213.335 116.705 1.00 45.61  ?  74   GLY B N     1 
ATOM   8525  C  CA    . GLY B 2  74   ? 126.809 214.069 116.632 1.00 45.61  ?  74   GLY B CA    1 
ATOM   8526  C  C     . GLY B 2  74   ? 126.509 214.846 117.890 1.00 45.61  ?  74   GLY B C     1 
ATOM   8527  O  O     . GLY B 2  74   ? 126.734 214.355 118.997 1.00 45.61  ?  74   GLY B O     1 
ATOM   8528  N  N     . SER B 2  75   ? 125.980 216.060 117.732 1.00 56.28  ?  75   SER B N     1 
ATOM   8529  C  CA    . SER B 2  75   ? 125.714 216.972 118.837 1.00 56.28  ?  75   SER B CA    1 
ATOM   8530  C  C     . SER B 2  75   ? 124.479 216.601 119.646 1.00 56.28  ?  75   SER B C     1 
ATOM   8531  O  O     . SER B 2  75   ? 124.150 217.315 120.598 1.00 56.28  ?  75   SER B O     1 
ATOM   8532  C  CB    . SER B 2  75   ? 125.570 218.402 118.313 1.00 56.28  ?  75   SER B CB    1 
ATOM   8533  O  OG    . SER B 2  75   ? 125.326 219.318 119.368 1.00 56.28  ?  75   SER B OG    1 
ATOM   8534  N  N     . GLY B 2  76   ? 123.789 215.514 119.303 1.00 58.73  ?  76   GLY B N     1 
ATOM   8535  C  CA    . GLY B 2  76   ? 122.801 214.924 120.184 1.00 58.73  ?  76   GLY B CA    1 
ATOM   8536  C  C     . GLY B 2  76   ? 123.499 214.107 121.248 1.00 58.73  ?  76   GLY B C     1 
ATOM   8537  O  O     . GLY B 2  76   ? 123.498 212.872 121.209 1.00 58.73  ?  76   GLY B O     1 
ATOM   8538  N  N     . VAL B 2  77   ? 124.101 214.795 122.208 1.00 62.12  ?  77   VAL B N     1 
ATOM   8539  C  CA    . VAL B 2  77   ? 125.159 214.212 123.021 1.00 62.12  ?  77   VAL B CA    1 
ATOM   8540  C  C     . VAL B 2  77   ? 124.580 213.426 124.185 1.00 62.12  ?  77   VAL B C     1 
ATOM   8541  O  O     . VAL B 2  77   ? 123.517 213.744 124.728 1.00 62.12  ?  77   VAL B O     1 
ATOM   8542  C  CB    . VAL B 2  77   ? 126.116 215.311 123.510 1.00 62.12  ?  77   VAL B CB    1 
ATOM   8543  C  CG1   . VAL B 2  77   ? 126.958 215.783 122.359 1.00 62.12  ?  77   VAL B CG1   1 
ATOM   8544  C  CG2   . VAL B 2  77   ? 125.339 216.468 124.121 1.00 62.12  ?  77   VAL B CG2   1 
ATOM   8545  N  N     . GLY B 2  78   ? 125.299 212.376 124.559 1.00 55.32  ?  78   GLY B N     1 
ATOM   8546  C  CA    . GLY B 2  78   ? 124.926 211.526 125.664 1.00 55.32  ?  78   GLY B CA    1 
ATOM   8547  C  C     . GLY B 2  78   ? 126.071 211.290 126.621 1.00 55.32  ?  78   GLY B C     1 
ATOM   8548  O  O     . GLY B 2  78   ? 126.232 210.172 127.111 1.00 55.32  ?  78   GLY B O     1 
ATOM   8549  N  N     . VAL B 2  79   ? 126.890 212.308 126.870 1.00 52.30  ?  79   VAL B N     1 
ATOM   8550  C  CA    . VAL B 2  79   ? 128.054 212.142 127.735 1.00 52.30  ?  79   VAL B CA    1 
ATOM   8551  C  C     . VAL B 2  79   ? 127.597 212.082 129.185 1.00 52.30  ?  79   VAL B C     1 
ATOM   8552  O  O     . VAL B 2  79   ? 126.774 212.892 129.627 1.00 52.30  ?  79   VAL B O     1 
ATOM   8553  C  CB    . VAL B 2  79   ? 129.081 213.261 127.508 1.00 52.30  ?  79   VAL B CB    1 
ATOM   8554  C  CG1   . VAL B 2  79   ? 129.855 212.989 126.232 1.00 52.30  ?  79   VAL B CG1   1 
ATOM   8555  C  CG2   . VAL B 2  79   ? 128.405 214.639 127.446 1.00 52.30  ?  79   VAL B CG2   1 
ATOM   8556  N  N     . LYS B 2  80   ? 128.104 211.095 129.923 1.00 53.83  ?  80   LYS B N     1 
ATOM   8557  C  CA    . LYS B 2  80   ? 127.604 210.818 131.260 1.00 53.83  ?  80   LYS B CA    1 
ATOM   8558  C  C     . LYS B 2  80   ? 128.700 210.260 132.151 1.00 53.83  ?  80   LYS B C     1 
ATOM   8559  O  O     . LYS B 2  80   ? 129.611 209.573 131.686 1.00 53.83  ?  80   LYS B O     1 
ATOM   8560  C  CB    . LYS B 2  80   ? 126.430 209.835 131.220 1.00 53.83  ?  80   LYS B CB    1 
ATOM   8561  C  CG    . LYS B 2  80   ? 125.072 210.512 131.204 1.00 53.83  ?  80   LYS B CG    1 
ATOM   8562  C  CD    . LYS B 2  80   ? 123.955 209.501 131.118 1.00 53.83  ?  80   LYS B CD    1 
ATOM   8563  C  CE    . LYS B 2  80   ? 122.677 210.152 130.635 1.00 53.83  ?  80   LYS B CE    1 
ATOM   8564  N  NZ    . LYS B 2  80   ? 122.914 210.907 129.381 1.00 53.83  1  80   LYS B NZ    1 
ATOM   8565  N  N     . LYS B 2  81   ? 128.587 210.566 133.439 1.00 54.97  ?  81   LYS B N     1 
ATOM   8566  C  CA    . LYS B 2  81   ? 129.476 210.063 134.473 1.00 54.97  ?  81   LYS B CA    1 
ATOM   8567  C  C     . LYS B 2  81   ? 129.273 208.551 134.627 1.00 54.97  ?  81   LYS B C     1 
ATOM   8568  O  O     . LYS B 2  81   ? 128.248 207.995 134.231 1.00 54.97  ?  81   LYS B O     1 
ATOM   8569  C  CB    . LYS B 2  81   ? 129.204 210.853 135.763 1.00 54.97  ?  81   LYS B CB    1 
ATOM   8570  C  CG    . LYS B 2  81   ? 129.951 210.511 137.046 1.00 54.97  ?  81   LYS B CG    1 
ATOM   8571  C  CD    . LYS B 2  81   ? 131.457 210.458 136.914 1.00 54.97  ?  81   LYS B CD    1 
ATOM   8572  C  CE    . LYS B 2  81   ? 132.053 209.878 138.194 1.00 54.97  ?  81   LYS B CE    1 
ATOM   8573  N  NZ    . LYS B 2  81   ? 133.178 208.953 137.940 1.00 54.97  1  81   LYS B NZ    1 
ATOM   8574  N  N     . LEU B 2  82   ? 130.287 207.873 135.165 1.00 48.05  ?  82   LEU B N     1 
ATOM   8575  C  CA    . LEU B 2  82   ? 130.281 206.416 135.210 1.00 48.05  ?  82   LEU B CA    1 
ATOM   8576  C  C     . LEU B 2  82   ? 129.279 205.858 136.217 1.00 48.05  ?  82   LEU B C     1 
ATOM   8577  O  O     . LEU B 2  82   ? 128.905 204.686 136.114 1.00 48.05  ?  82   LEU B O     1 
ATOM   8578  C  CB    . LEU B 2  82   ? 131.701 205.922 135.505 1.00 48.05  ?  82   LEU B CB    1 
ATOM   8579  C  CG    . LEU B 2  82   ? 132.056 204.443 135.366 1.00 48.05  ?  82   LEU B CG    1 
ATOM   8580  C  CD1   . LEU B 2  82   ? 131.739 203.983 133.969 1.00 48.05  ?  82   LEU B CD1   1 
ATOM   8581  C  CD2   . LEU B 2  82   ? 133.520 204.224 135.646 1.00 48.05  ?  82   LEU B CD2   1 
ATOM   8582  N  N     . CYS B 2  83   ? 128.799 206.667 137.165 1.00 57.49  ?  83   CYS B N     1 
ATOM   8583  C  CA    . CYS B 2  83   ? 127.840 206.171 138.144 1.00 57.49  ?  83   CYS B CA    1 
ATOM   8584  C  C     . CYS B 2  83   ? 126.387 206.376 137.736 1.00 57.49  ?  83   CYS B C     1 
ATOM   8585  O  O     . CYS B 2  83   ? 125.516 205.657 138.236 1.00 57.49  ?  83   CYS B O     1 
ATOM   8586  C  CB    . CYS B 2  83   ? 128.062 206.830 139.513 1.00 57.49  ?  83   CYS B CB    1 
ATOM   8587  S  SG    . CYS B 2  83   ? 128.174 208.628 139.535 1.00 57.49  ?  83   CYS B SG    1 
ATOM   8588  N  N     . GLU B 2  84   ? 126.103 207.324 136.847 1.00 58.19  ?  84   GLU B N     1 
ATOM   8589  C  CA    . GLU B 2  84   ? 124.739 207.655 136.467 1.00 58.19  ?  84   GLU B CA    1 
ATOM   8590  C  C     . GLU B 2  84   ? 124.250 206.864 135.259 1.00 58.19  ?  84   GLU B C     1 
ATOM   8591  O  O     . GLU B 2  84   ? 123.317 207.296 134.578 1.00 58.19  ?  84   GLU B O     1 
ATOM   8592  C  CB    . GLU B 2  84   ? 124.625 209.157 136.218 1.00 58.19  ?  84   GLU B CB    1 
ATOM   8593  C  CG    . GLU B 2  84   ? 125.533 209.680 135.133 1.00 58.19  ?  84   GLU B CG    1 
ATOM   8594  C  CD    . GLU B 2  84   ? 125.483 211.189 135.021 1.00 58.19  ?  84   GLU B CD    1 
ATOM   8595  O  OE1   . GLU B 2  84   ? 124.742 211.820 135.804 1.00 58.19  ?  84   GLU B OE1   1 
ATOM   8596  O  OE2   . GLU B 2  84   ? 126.188 211.750 134.160 1.00 58.19  -1 84   GLU B OE2   1 
ATOM   8597  N  N     . LEU B 2  85   ? 124.837 205.706 134.998 1.00 48.23  ?  85   LEU B N     1 
ATOM   8598  C  CA    . LEU B 2  85   ? 124.438 204.905 133.857 1.00 48.23  ?  85   LEU B CA    1 
ATOM   8599  C  C     . LEU B 2  85   ? 123.327 203.942 134.241 1.00 48.23  ?  85   LEU B C     1 
ATOM   8600  O  O     . LEU B 2  85   ? 123.387 203.280 135.281 1.00 48.23  ?  85   LEU B O     1 
ATOM   8601  C  CB    . LEU B 2  85   ? 125.635 204.136 133.307 1.00 48.23  ?  85   LEU B CB    1 
ATOM   8602  C  CG    . LEU B 2  85   ? 126.803 205.013 132.875 1.00 48.23  ?  85   LEU B CG    1 
ATOM   8603  C  CD1   . LEU B 2  85   ? 127.927 204.195 132.297 1.00 48.23  ?  85   LEU B CD1   1 
ATOM   8604  C  CD2   . LEU B 2  85   ? 126.335 206.051 131.884 1.00 48.23  ?  85   LEU B CD2   1 
ATOM   8605  N  N     . GLN B 2  86   ? 122.331 203.872 133.408 1.00 51.20  ?  86   GLN B N     1 
ATOM   8606  C  CA    . GLN B 2  86   ? 121.189 202.981 133.433 1.00 51.20  ?  86   GLN B CA    1 
ATOM   8607  C  C     . GLN B 2  86   ? 121.461 201.777 132.546 1.00 51.20  ?  86   GLN B C     1 
ATOM   8608  O  O     . GLN B 2  86   ? 122.230 201.880 131.588 1.00 51.20  ?  86   GLN B O     1 
ATOM   8609  C  CB    . GLN B 2  86   ? 119.935 203.718 132.957 1.00 51.20  ?  86   GLN B CB    1 
ATOM   8610  C  CG    . GLN B 2  86   ? 119.664 204.994 133.738 1.00 51.20  ?  86   GLN B CG    1 
ATOM   8611  C  CD    . GLN B 2  86   ? 118.785 205.959 132.977 1.00 51.20  ?  86   GLN B CD    1 
ATOM   8612  O  OE1   . GLN B 2  86   ? 117.638 205.649 132.652 1.00 51.20  ?  86   GLN B OE1   1 
ATOM   8613  N  NE2   . GLN B 2  86   ? 119.320 207.137 132.678 1.00 51.20  ?  86   GLN B NE2   1 
ATOM   8614  N  N     . PRO B 2  87   ? 120.887 200.613 132.862 1.00 47.22  ?  87   PRO B N     1 
ATOM   8615  C  CA    . PRO B 2  87   ? 121.173 199.409 132.067 1.00 47.22  ?  87   PRO B CA    1 
ATOM   8616  C  C     . PRO B 2  87   ? 120.644 199.519 130.643 1.00 47.22  ?  87   PRO B C     1 
ATOM   8617  O  O     . PRO B 2  87   ? 119.499 199.921 130.419 1.00 47.22  ?  87   PRO B O     1 
ATOM   8618  C  CB    . PRO B 2  87   ? 120.461 198.297 132.844 1.00 47.22  ?  87   PRO B CB    1 
ATOM   8619  C  CG    . PRO B 2  87   ? 120.322 198.814 134.213 1.00 47.22  ?  87   PRO B CG    1 
ATOM   8620  C  CD    . PRO B 2  87   ? 120.146 200.289 134.093 1.00 47.22  ?  87   PRO B CD    1 
ATOM   8621  N  N     . GLU B 2  88   ? 121.516 199.171 129.689 1.00 50.72  ?  88   GLU B N     1 
ATOM   8622  C  CA    . GLU B 2  88   ? 121.250 199.128 128.248 1.00 50.72  ?  88   GLU B CA    1 
ATOM   8623  C  C     . GLU B 2  88   ? 120.710 200.463 127.719 1.00 50.72  ?  88   GLU B C     1 
ATOM   8624  O  O     . GLU B 2  88   ? 119.550 200.597 127.341 1.00 50.72  ?  88   GLU B O     1 
ATOM   8625  C  CB    . GLU B 2  88   ? 120.330 197.954 127.899 1.00 50.72  ?  88   GLU B CB    1 
ATOM   8626  C  CG    . GLU B 2  88   ? 120.948 196.592 128.202 1.00 50.72  ?  88   GLU B CG    1 
ATOM   8627  C  CD    . GLU B 2  88   ? 121.809 196.044 127.059 1.00 50.72  ?  88   GLU B CD    1 
ATOM   8628  O  OE1   . GLU B 2  88   ? 122.621 196.798 126.472 1.00 50.72  ?  88   GLU B OE1   1 
ATOM   8629  O  OE2   . GLU B 2  88   ? 121.674 194.840 126.743 1.00 50.72  -1 88   GLU B OE2   1 
ATOM   8630  N  N     . GLU B 2  89   ? 121.590 201.461 127.744 1.00 43.33  ?  89   GLU B N     1 
ATOM   8631  C  CA    . GLU B 2  89   ? 121.286 202.792 127.235 1.00 43.33  ?  89   GLU B CA    1 
ATOM   8632  C  C     . GLU B 2  89   ? 122.540 203.373 126.589 1.00 43.33  ?  89   GLU B C     1 
ATOM   8633  O  O     . GLU B 2  89   ? 123.648 203.184 127.096 1.00 43.33  ?  89   GLU B O     1 
ATOM   8634  C  CB    . GLU B 2  89   ? 120.758 203.685 128.367 1.00 43.33  ?  89   GLU B CB    1 
ATOM   8635  C  CG    . GLU B 2  89   ? 120.151 205.008 127.947 1.00 43.33  ?  89   GLU B CG    1 
ATOM   8636  C  CD    . GLU B 2  89   ? 121.148 206.148 127.966 1.00 43.33  ?  89   GLU B CD    1 
ATOM   8637  O  OE1   . GLU B 2  89   ? 122.090 206.103 128.785 1.00 43.33  ?  89   GLU B OE1   1 
ATOM   8638  O  OE2   . GLU B 2  89   ? 120.987 207.096 127.171 1.00 43.33  -1 89   GLU B OE2   1 
ATOM   8639  N  N     . LYS B 2  90   ? 122.364 204.060 125.460 1.00 37.68  ?  90   LYS B N     1 
ATOM   8640  C  CA    . LYS B 2  90   ? 123.481 204.511 124.632 1.00 37.68  ?  90   LYS B CA    1 
ATOM   8641  C  C     . LYS B 2  90   ? 124.090 205.787 125.198 1.00 37.68  ?  90   LYS B C     1 
ATOM   8642  O  O     . LYS B 2  90   ? 123.409 206.811 125.304 1.00 37.68  ?  90   LYS B O     1 
ATOM   8643  C  CB    . LYS B 2  90   ? 123.016 204.756 123.201 1.00 37.68  ?  90   LYS B CB    1 
ATOM   8644  C  CG    . LYS B 2  90   ? 122.790 203.496 122.409 1.00 37.68  ?  90   LYS B CG    1 
ATOM   8645  C  CD    . LYS B 2  90   ? 124.050 202.669 122.335 1.00 37.68  ?  90   LYS B CD    1 
ATOM   8646  C  CE    . LYS B 2  90   ? 123.721 201.206 122.170 1.00 37.68  ?  90   LYS B CE    1 
ATOM   8647  N  NZ    . LYS B 2  90   ? 124.894 200.369 122.525 1.00 37.68  1  90   LYS B NZ    1 
ATOM   8648  N  N     . CYS B 2  91   ? 125.380 205.743 125.526 1.00 38.44  ?  91   CYS B N     1 
ATOM   8649  C  CA    . CYS B 2  91   ? 126.022 206.898 126.134 1.00 38.44  ?  91   CYS B CA    1 
ATOM   8650  C  C     . CYS B 2  91   ? 127.498 206.923 125.769 1.00 38.44  ?  91   CYS B C     1 
ATOM   8651  O  O     . CYS B 2  91   ? 128.046 205.962 125.220 1.00 38.44  ?  91   CYS B O     1 
ATOM   8652  C  CB    . CYS B 2  91   ? 125.832 206.884 127.649 1.00 38.44  ?  91   CYS B CB    1 
ATOM   8653  S  SG    . CYS B 2  91   ? 126.012 205.238 128.355 1.00 38.44  ?  91   CYS B SG    1 
ATOM   8654  N  N     . CYS B 2  92   ? 128.138 208.048 126.097 1.00 39.28  ?  92   CYS B N     1 
ATOM   8655  C  CA    . CYS B 2  92   ? 129.566 208.267 125.892 1.00 39.28  ?  92   CYS B CA    1 
ATOM   8656  C  C     . CYS B 2  92   ? 130.250 208.528 127.230 1.00 39.28  ?  92   CYS B C     1 
ATOM   8657  O  O     . CYS B 2  92   ? 129.782 209.350 128.020 1.00 39.28  ?  92   CYS B O     1 
ATOM   8658  C  CB    . CYS B 2  92   ? 129.802 209.441 124.942 1.00 39.28  ?  92   CYS B CB    1 
ATOM   8659  S  SG    . CYS B 2  92   ? 131.517 209.948 124.831 1.00 39.28  ?  92   CYS B SG    1 
ATOM   8660  N  N     . VAL B 2  93   ? 131.362 207.832 127.473 1.00 31.89  ?  93   VAL B N     1 
ATOM   8661  C  CA    . VAL B 2  93   ? 132.101 207.894 128.733 1.00 31.89  ?  93   VAL B CA    1 
ATOM   8662  C  C     . VAL B 2  93   ? 133.526 208.362 128.455 1.00 31.89  ?  93   VAL B C     1 
ATOM   8663  O  O     . VAL B 2  93   ? 134.153 207.907 127.498 1.00 31.89  ?  93   VAL B O     1 
ATOM   8664  C  CB    . VAL B 2  93   ? 132.136 206.525 129.449 1.00 31.89  ?  93   VAL B CB    1 
ATOM   8665  C  CG1   . VAL B 2  93   ? 132.421 206.712 130.926 1.00 31.89  ?  93   VAL B CG1   1 
ATOM   8666  C  CG2   . VAL B 2  93   ? 130.861 205.749 129.240 1.00 31.89  ?  93   VAL B CG2   1 
ATOM   8667  N  N     . VAL B 2  94   ? 134.043 209.250 129.301 1.00 26.30  ?  94   VAL B N     1 
ATOM   8668  C  CA    . VAL B 2  94   ? 135.401 209.783 129.181 1.00 26.30  ?  94   VAL B CA    1 
ATOM   8669  C  C     . VAL B 2  94   ? 136.195 209.367 130.414 1.00 26.30  ?  94   VAL B C     1 
ATOM   8670  O  O     . VAL B 2  94   ? 135.866 209.783 131.531 1.00 26.30  ?  94   VAL B O     1 
ATOM   8671  C  CB    . VAL B 2  94   ? 135.394 211.312 129.041 1.00 26.30  ?  94   VAL B CB    1 
ATOM   8672  C  CG1   . VAL B 2  94   ? 136.811 211.846 128.998 1.00 26.30  ?  94   VAL B CG1   1 
ATOM   8673  C  CG2   . VAL B 2  94   ? 134.615 211.731 127.821 1.00 26.30  ?  94   VAL B CG2   1 
ATOM   8674  N  N     . GLY B 2  95   ? 137.247 208.573 130.225 1.00 25.07  ?  95   GLY B N     1 
ATOM   8675  C  CA    . GLY B 2  95   ? 137.974 208.013 131.356 1.00 25.07  ?  95   GLY B CA    1 
ATOM   8676  C  C     . GLY B 2  95   ? 139.430 207.701 131.088 1.00 25.07  ?  95   GLY B C     1 
ATOM   8677  O  O     . GLY B 2  95   ? 139.983 208.114 130.067 1.00 25.07  ?  95   GLY B O     1 
ATOM   8678  N  N     . THR B 2  96   ? 140.056 206.953 132.006 1.00 23.57  ?  96   THR B N     1 
ATOM   8679  C  CA    . THR B 2  96   ? 141.468 206.601 131.927 1.00 23.57  ?  96   THR B CA    1 
ATOM   8680  C  C     . THR B 2  96   ? 141.608 205.087 131.866 1.00 23.57  ?  96   THR B C     1 
ATOM   8681  O  O     . THR B 2  96   ? 140.953 204.367 132.618 1.00 23.57  ?  96   THR B O     1 
ATOM   8682  C  CB    . THR B 2  96   ? 142.243 207.160 133.137 1.00 23.57  ?  96   THR B CB    1 
ATOM   8683  O  OG1   . THR B 2  96   ? 142.093 208.577 133.192 1.00 23.57  ?  96   THR B OG1   1 
ATOM   8684  C  CG2   . THR B 2  96   ? 143.725 206.841 133.068 1.00 23.57  ?  96   THR B CG2   1 
ATOM   8685  N  N     . LEU B 2  97   ? 142.449 204.600 130.966 1.00 25.11  ?  97   LEU B N     1 
ATOM   8686  C  CA    . LEU B 2  97   ? 142.634 203.166 130.875 1.00 25.11  ?  97   LEU B CA    1 
ATOM   8687  C  C     . LEU B 2  97   ? 143.487 202.653 132.022 1.00 25.11  ?  97   LEU B C     1 
ATOM   8688  O  O     . LEU B 2  97   ? 144.254 203.384 132.645 1.00 25.11  ?  97   LEU B O     1 
ATOM   8689  C  CB    . LEU B 2  97   ? 143.291 202.775 129.554 1.00 25.11  ?  97   LEU B CB    1 
ATOM   8690  C  CG    . LEU B 2  97   ? 142.437 202.223 128.410 1.00 25.11  ?  97   LEU B CG    1 
ATOM   8691  C  CD1   . LEU B 2  97   ? 143.335 201.659 127.338 1.00 25.11  ?  97   LEU B CD1   1 
ATOM   8692  C  CD2   . LEU B 2  97   ? 141.476 201.168 128.899 1.00 25.11  ?  97   LEU B CD2   1 
ATOM   8693  N  N     . PHE B 2  98   ? 143.329 201.367 132.299 1.00 40.62  ?  98   PHE B N     1 
ATOM   8694  C  CA    . PHE B 2  98   ? 144.269 200.620 133.112 1.00 40.62  ?  98   PHE B CA    1 
ATOM   8695  C  C     . PHE B 2  98   ? 144.302 199.220 132.531 1.00 40.62  ?  98   PHE B C     1 
ATOM   8696  O  O     . PHE B 2  98   ? 143.272 198.549 132.478 1.00 40.62  ?  98   PHE B O     1 
ATOM   8697  C  CB    . PHE B 2  98   ? 143.865 200.611 134.590 1.00 40.62  ?  98   PHE B CB    1 
ATOM   8698  C  CG    . PHE B 2  98   ? 144.674 199.667 135.440 1.00 40.62  ?  98   PHE B CG    1 
ATOM   8699  C  CD1   . PHE B 2  98   ? 145.909 200.045 135.929 1.00 40.62  ?  98   PHE B CD1   1 
ATOM   8700  C  CD2   . PHE B 2  98   ? 144.197 198.400 135.757 1.00 40.62  ?  98   PHE B CD2   1 
ATOM   8701  C  CE1   . PHE B 2  98   ? 146.655 199.185 136.695 1.00 40.62  ?  98   PHE B CE1   1 
ATOM   8702  C  CE2   . PHE B 2  98   ? 144.942 197.537 136.522 1.00 40.62  ?  98   PHE B CE2   1 
ATOM   8703  C  CZ    . PHE B 2  98   ? 146.171 197.931 136.994 1.00 40.62  ?  98   PHE B CZ    1 
ATOM   8704  N  N     . LYS B 2  99   ? 145.464 198.794 132.073 1.00 41.78  ?  99   LYS B N     1 
ATOM   8705  C  CA    . LYS B 2  99   ? 145.618 197.468 131.512 1.00 41.78  ?  99   LYS B CA    1 
ATOM   8706  C  C     . LYS B 2  99   ? 146.078 196.525 132.610 1.00 41.78  ?  99   LYS B C     1 
ATOM   8707  O  O     . LYS B 2  99   ? 147.076 196.789 133.280 1.00 41.78  ?  99   LYS B O     1 
ATOM   8708  C  CB    . LYS B 2  99   ? 146.617 197.498 130.362 1.00 41.78  ?  99   LYS B CB    1 
ATOM   8709  C  CG    . LYS B 2  99   ? 146.613 196.293 129.482 1.00 41.78  ?  99   LYS B CG    1 
ATOM   8710  C  CD    . LYS B 2  99   ? 147.637 196.451 128.389 1.00 41.78  ?  99   LYS B CD    1 
ATOM   8711  C  CE    . LYS B 2  99   ? 147.574 195.295 127.424 1.00 41.78  ?  99   LYS B CE    1 
ATOM   8712  N  NZ    . LYS B 2  99   ? 148.464 195.463 126.252 1.00 41.78  1  99   LYS B NZ    1 
ATOM   8713  N  N     . ALA B 2  100  ? 145.347 195.437 132.805 1.00 29.33  ?  100  ALA B N     1 
ATOM   8714  C  CA    . ALA B 2  100  ? 145.598 194.517 133.912 1.00 29.33  ?  100  ALA B CA    1 
ATOM   8715  C  C     . ALA B 2  100  ? 146.387 193.331 133.383 1.00 29.33  ?  100  ALA B C     1 
ATOM   8716  O  O     . ALA B 2  100  ? 145.836 192.271 133.098 1.00 29.33  ?  100  ALA B O     1 
ATOM   8717  C  CB    . ALA B 2  100  ? 144.291 194.079 134.555 1.00 29.33  ?  100  ALA B CB    1 
ATOM   8718  N  N     . MET B 2  101  ? 147.680 193.505 133.272 1.00 32.96  ?  101  MET B N     1 
ATOM   8719  C  CA    . MET B 2  101  ? 148.459 192.425 132.710 1.00 32.96  ?  101  MET B CA    1 
ATOM   8720  C  C     . MET B 2  101  ? 149.191 191.647 133.788 1.00 32.96  ?  101  MET B C     1 
ATOM   8721  O  O     . MET B 2  101  ? 149.858 192.242 134.641 1.00 32.96  ?  101  MET B O     1 
ATOM   8722  C  CB    . MET B 2  101  ? 149.483 192.947 131.699 1.00 32.96  ?  101  MET B CB    1 
ATOM   8723  C  CG    . MET B 2  101  ? 150.029 194.323 132.004 1.00 32.96  ?  101  MET B CG    1 
ATOM   8724  S  SD    . MET B 2  101  ? 151.477 194.693 131.013 1.00 32.96  ?  101  MET B SD    1 
ATOM   8725  C  CE    . MET B 2  101  ? 150.837 194.479 129.367 1.00 32.96  ?  101  MET B CE    1 
ATOM   8726  N  N     . PRO B 2  102  ? 149.072 190.324 133.788 1.00 34.67  ?  102  PRO B N     1 
ATOM   8727  C  CA    . PRO B 2  102  ? 150.083 189.489 134.435 1.00 34.67  ?  102  PRO B CA    1 
ATOM   8728  C  C     . PRO B 2  102  ? 151.332 189.451 133.565 1.00 34.67  ?  102  PRO B C     1 
ATOM   8729  O  O     . PRO B 2  102  ? 151.332 189.927 132.425 1.00 34.67  ?  102  PRO B O     1 
ATOM   8730  C  CB    . PRO B 2  102  ? 149.419 188.117 134.518 1.00 34.67  ?  102  PRO B CB    1 
ATOM   8731  C  CG    . PRO B 2  102  ? 148.462 188.116 133.402 1.00 34.67  ?  102  PRO B CG    1 
ATOM   8732  C  CD    . PRO B 2  102  ? 147.962 189.521 133.259 1.00 34.67  ?  102  PRO B CD    1 
ATOM   8733  N  N     . LEU B 2  103  ? 152.395 188.893 134.146 1.00 30.82  ?  103  LEU B N     1 
ATOM   8734  C  CA    . LEU B 2  103  ? 153.792 188.796 133.698 1.00 30.82  ?  103  LEU B CA    1 
ATOM   8735  C  C     . LEU B 2  103  ? 154.524 190.136 133.845 1.00 30.82  ?  103  LEU B C     1 
ATOM   8736  O  O     . LEU B 2  103  ? 155.741 190.174 133.650 1.00 30.82  ?  103  LEU B O     1 
ATOM   8737  C  CB    . LEU B 2  103  ? 153.946 188.262 132.260 1.00 30.82  ?  103  LEU B CB    1 
ATOM   8738  C  CG    . LEU B 2  103  ? 155.204 187.488 131.892 1.00 30.82  ?  103  LEU B CG    1 
ATOM   8739  C  CD1   . LEU B 2  103  ? 155.328 186.323 132.844 1.00 30.82  ?  103  LEU B CD1   1 
ATOM   8740  C  CD2   . LEU B 2  103  ? 155.140 187.006 130.456 1.00 30.82  ?  103  LEU B CD2   1 
ATOM   8741  N  N     . GLN B 2  104  ? 153.835 191.236 134.229 1.00 29.06  ?  104  GLN B N     1 
ATOM   8742  C  CA    . GLN B 2  104  ? 154.505 192.463 134.635 1.00 29.06  ?  104  GLN B CA    1 
ATOM   8743  C  C     . GLN B 2  104  ? 155.113 192.268 136.007 1.00 29.06  ?  104  GLN B C     1 
ATOM   8744  O  O     . GLN B 2  104  ? 154.390 191.888 136.938 1.00 29.06  ?  104  GLN B O     1 
ATOM   8745  C  CB    . GLN B 2  104  ? 153.538 193.637 134.676 1.00 29.06  ?  104  GLN B CB    1 
ATOM   8746  C  CG    . GLN B 2  104  ? 154.168 194.898 135.216 1.00 29.06  ?  104  GLN B CG    1 
ATOM   8747  C  CD    . GLN B 2  104  ? 153.228 196.071 135.231 1.00 29.06  ?  104  GLN B CD    1 
ATOM   8748  O  OE1   . GLN B 2  104  ? 152.105 195.991 134.751 1.00 29.06  ?  104  GLN B OE1   1 
ATOM   8749  N  NE2   . GLN B 2  104  ? 153.671 197.168 135.827 1.00 29.06  ?  104  GLN B NE2   1 
ATOM   8750  N  N     . PRO B 2  105  ? 156.413 192.504 136.183 1.00 30.68  ?  105  PRO B N     1 
ATOM   8751  C  CA    . PRO B 2  105  ? 157.062 192.139 137.446 1.00 30.68  ?  105  PRO B CA    1 
ATOM   8752  C  C     . PRO B 2  105  ? 156.696 193.076 138.586 1.00 30.68  ?  105  PRO B C     1 
ATOM   8753  O  O     . PRO B 2  105  ? 156.575 194.290 138.412 1.00 30.68  ?  105  PRO B O     1 
ATOM   8754  C  CB    . PRO B 2  105  ? 158.554 192.228 137.111 1.00 30.68  ?  105  PRO B CB    1 
ATOM   8755  C  CG    . PRO B 2  105  ? 158.633 193.177 135.990 1.00 30.68  ?  105  PRO B CG    1 
ATOM   8756  C  CD    . PRO B 2  105  ? 157.376 193.021 135.196 1.00 30.68  ?  105  PRO B CD    1 
ATOM   8757  N  N     . SER B 2  106  ? 156.487 192.480 139.756 1.00 28.64  ?  106  SER B N     1 
ATOM   8758  C  CA    . SER B 2  106  ? 156.285 193.195 141.005 1.00 28.64  ?  106  SER B CA    1 
ATOM   8759  C  C     . SER B 2  106  ? 157.554 193.073 141.832 1.00 28.64  ?  106  SER B C     1 
ATOM   8760  O  O     . SER B 2  106  ? 158.491 192.371 141.449 1.00 28.64  ?  106  SER B O     1 
ATOM   8761  C  CB    . SER B 2  106  ? 155.080 192.648 141.782 1.00 28.64  ?  106  SER B CB    1 
ATOM   8762  O  OG    . SER B 2  106  ? 154.589 193.604 142.704 1.00 28.64  ?  106  SER B OG    1 
ATOM   8763  N  N     . ILE B 2  107  ? 157.570 193.756 142.976 1.00 31.59  ?  107  ILE B N     1 
ATOM   8764  C  CA    . ILE B 2  107  ? 158.816 193.958 143.711 1.00 31.59  ?  107  ILE B CA    1 
ATOM   8765  C  C     . ILE B 2  107  ? 159.271 192.658 144.368 1.00 31.59  ?  107  ILE B C     1 
ATOM   8766  O  O     . ILE B 2  107  ? 160.470 192.364 144.446 1.00 31.59  ?  107  ILE B O     1 
ATOM   8767  C  CB    . ILE B 2  107  ? 158.644 195.077 144.746 1.00 31.59  ?  107  ILE B CB    1 
ATOM   8768  C  CG1   . ILE B 2  107  ? 158.041 196.300 144.087 1.00 31.59  ?  107  ILE B CG1   1 
ATOM   8769  C  CG2   . ILE B 2  107  ? 159.989 195.501 145.302 1.00 31.59  ?  107  ILE B CG2   1 
ATOM   8770  C  CD1   . ILE B 2  107  ? 157.532 197.240 145.082 1.00 31.59  ?  107  ILE B CD1   1 
ATOM   8771  N  N     . LEU B 2  108  ? 158.318 191.846 144.813 1.00 25.08  ?  108  LEU B N     1 
ATOM   8772  C  CA    . LEU B 2  108  ? 158.637 190.583 145.471 1.00 25.08  ?  108  LEU B CA    1 
ATOM   8773  C  C     . LEU B 2  108  ? 157.440 189.647 145.399 1.00 25.08  ?  108  LEU B C     1 
ATOM   8774  O  O     . LEU B 2  108  ? 156.345 190.064 145.037 1.00 25.08  ?  108  LEU B O     1 
ATOM   8775  C  CB    . LEU B 2  108  ? 159.049 190.835 146.930 1.00 25.08  ?  108  LEU B CB    1 
ATOM   8776  C  CG    . LEU B 2  108  ? 160.084 189.973 147.658 1.00 25.08  ?  108  LEU B CG    1 
ATOM   8777  C  CD1   . LEU B 2  108  ? 161.389 189.896 146.899 1.00 25.08  ?  108  LEU B CD1   1 
ATOM   8778  C  CD2   . LEU B 2  108  ? 160.306 190.576 149.034 1.00 25.08  ?  108  LEU B CD2   1 
ATOM   8779  N  N     . SER B 2  124  ? 162.826 191.762 124.165 1.00 37.41  ?  124  SER B N     1 
ATOM   8780  C  CA    . SER B 2  124  ? 161.890 191.113 125.071 1.00 37.41  ?  124  SER B CA    1 
ATOM   8781  C  C     . SER B 2  124  ? 160.658 191.978 125.261 1.00 37.41  ?  124  SER B C     1 
ATOM   8782  O  O     . SER B 2  124  ? 160.760 193.126 125.672 1.00 37.41  ?  124  SER B O     1 
ATOM   8783  C  CB    . SER B 2  124  ? 162.529 190.842 126.432 1.00 37.41  ?  124  SER B CB    1 
ATOM   8784  O  OG    . SER B 2  124  ? 162.681 192.054 127.154 1.00 37.41  ?  124  SER B OG    1 
ATOM   8785  N  N     . LYS B 2  125  ? 159.497 191.411 124.964 1.00 30.54  ?  125  LYS B N     1 
ATOM   8786  C  CA    . LYS B 2  125  ? 158.210 192.037 125.209 1.00 30.54  ?  125  LYS B CA    1 
ATOM   8787  C  C     . LYS B 2  125  ? 157.538 191.370 126.401 1.00 30.54  ?  125  LYS B C     1 
ATOM   8788  O  O     . LYS B 2  125  ? 157.919 190.279 126.830 1.00 30.54  ?  125  LYS B O     1 
ATOM   8789  C  CB    . LYS B 2  125  ? 157.324 191.951 123.963 1.00 30.54  ?  125  LYS B CB    1 
ATOM   8790  C  CG    . LYS B 2  125  ? 157.758 192.854 122.826 1.00 30.54  ?  125  LYS B CG    1 
ATOM   8791  C  CD    . LYS B 2  125  ? 156.808 192.768 121.655 1.00 30.54  ?  125  LYS B CD    1 
ATOM   8792  C  CE    . LYS B 2  125  ? 156.765 194.065 120.877 1.00 30.54  ?  125  LYS B CE    1 
ATOM   8793  N  NZ    . LYS B 2  125  ? 156.067 195.145 121.611 1.00 30.54  1  125  LYS B NZ    1 
ATOM   8794  N  N     . TYR B 2  126  ? 156.517 192.034 126.938 1.00 34.59  ?  126  TYR B N     1 
ATOM   8795  C  CA    . TYR B 2  126  ? 155.821 191.539 128.118 1.00 34.59  ?  126  TYR B CA    1 
ATOM   8796  C  C     . TYR B 2  126  ? 154.324 191.357 127.902 1.00 34.59  ?  126  TYR B C     1 
ATOM   8797  O  O     . TYR B 2  126  ? 153.595 191.140 128.876 1.00 34.59  ?  126  TYR B O     1 
ATOM   8798  C  CB    . TYR B 2  126  ? 156.073 192.473 129.306 1.00 34.59  ?  126  TYR B CB    1 
ATOM   8799  C  CG    . TYR B 2  126  ? 157.378 192.198 130.018 1.00 34.59  ?  126  TYR B CG    1 
ATOM   8800  C  CD1   . TYR B 2  126  ? 157.525 191.083 130.838 1.00 34.59  ?  126  TYR B CD1   1 
ATOM   8801  C  CD2   . TYR B 2  126  ? 158.469 193.044 129.864 1.00 34.59  ?  126  TYR B CD2   1 
ATOM   8802  C  CE1   . TYR B 2  126  ? 158.711 190.820 131.482 1.00 34.59  ?  126  TYR B CE1   1 
ATOM   8803  C  CE2   . TYR B 2  126  ? 159.664 192.789 130.507 1.00 34.59  ?  126  TYR B CE2   1 
ATOM   8804  C  CZ    . TYR B 2  126  ? 159.778 191.675 131.312 1.00 34.59  ?  126  TYR B CZ    1 
ATOM   8805  O  OH    . TYR B 2  126  ? 160.961 191.416 131.957 1.00 34.59  ?  126  TYR B OH    1 
ATOM   8806  N  N     . ILE B 2  127  ? 153.840 191.430 126.666 1.00 40.09  ?  127  ILE B N     1 
ATOM   8807  C  CA    . ILE B 2  127  ? 152.423 191.217 126.391 1.00 40.09  ?  127  ILE B CA    1 
ATOM   8808  C  C     . ILE B 2  127  ? 152.107 189.730 126.482 1.00 40.09  ?  127  ILE B C     1 
ATOM   8809  O  O     . ILE B 2  127  ? 152.914 188.870 126.104 1.00 40.09  ?  127  ILE B O     1 
ATOM   8810  C  CB    . ILE B 2  127  ? 152.038 191.799 125.017 1.00 40.09  ?  127  ILE B CB    1 
ATOM   8811  C  CG1   . ILE B 2  127  ? 152.895 191.205 123.897 1.00 40.09  ?  127  ILE B CG1   1 
ATOM   8812  C  CG2   . ILE B 2  127  ? 152.199 193.285 125.027 1.00 40.09  ?  127  ILE B CG2   1 
ATOM   8813  C  CD1   . ILE B 2  127  ? 152.275 191.310 122.532 1.00 40.09  ?  127  ILE B CD1   1 
ATOM   8814  N  N     . HIS B 2  128  ? 150.931 189.419 127.017 1.00 61.39  ?  128  HIS B N     1 
ATOM   8815  C  CA    . HIS B 2  128  ? 150.477 188.053 127.192 1.00 61.39  ?  128  HIS B CA    1 
ATOM   8816  C  C     . HIS B 2  128  ? 149.133 187.872 126.490 1.00 61.39  ?  128  HIS B C     1 
ATOM   8817  O  O     . HIS B 2  128  ? 148.374 188.840 126.358 1.00 61.39  ?  128  HIS B O     1 
ATOM   8818  C  CB    . HIS B 2  128  ? 150.358 187.720 128.686 1.00 61.39  ?  128  HIS B CB    1 
ATOM   8819  C  CG    . HIS B 2  128  ? 149.983 186.299 128.969 1.00 61.39  ?  128  HIS B CG    1 
ATOM   8820  N  ND1   . HIS B 2  128  ? 150.826 185.241 128.712 1.00 61.39  ?  128  HIS B ND1   1 
ATOM   8821  C  CD2   . HIS B 2  128  ? 148.850 185.763 129.479 1.00 61.39  ?  128  HIS B CD2   1 
ATOM   8822  C  CE1   . HIS B 2  128  ? 150.225 184.112 129.043 1.00 61.39  ?  128  HIS B CE1   1 
ATOM   8823  N  NE2   . HIS B 2  128  ? 149.027 184.402 129.515 1.00 61.39  ?  128  HIS B NE2   1 
ATOM   8824  N  N     . PRO B 2  129  ? 148.840 186.662 125.982 1.00 69.86  ?  129  PRO B N     1 
ATOM   8825  C  CA    . PRO B 2  129  ? 147.570 186.423 125.267 1.00 69.86  ?  129  PRO B CA    1 
ATOM   8826  C  C     . PRO B 2  129  ? 146.285 186.720 126.033 1.00 69.86  ?  129  PRO B C     1 
ATOM   8827  O  O     . PRO B 2  129  ? 145.254 186.946 125.391 1.00 69.86  ?  129  PRO B O     1 
ATOM   8828  C  CB    . PRO B 2  129  ? 147.663 184.934 124.921 1.00 69.86  ?  129  PRO B CB    1 
ATOM   8829  C  CG    . PRO B 2  129  ? 149.105 184.725 124.668 1.00 69.86  ?  129  PRO B CG    1 
ATOM   8830  C  CD    . PRO B 2  129  ? 149.855 185.667 125.581 1.00 69.86  ?  129  PRO B CD    1 
ATOM   8831  N  N     . ASP B 2  130  ? 146.285 186.735 127.359 1.00 66.58  ?  130  ASP B N     1 
ATOM   8832  C  CA    . ASP B 2  130  ? 145.123 187.220 128.086 1.00 66.58  ?  130  ASP B CA    1 
ATOM   8833  C  C     . ASP B 2  130  ? 145.541 188.356 129.008 1.00 66.58  ?  130  ASP B C     1 
ATOM   8834  O  O     . ASP B 2  130  ? 146.528 188.239 129.745 1.00 66.58  ?  130  ASP B O     1 
ATOM   8835  C  CB    . ASP B 2  130  ? 144.405 186.092 128.846 1.00 66.58  ?  130  ASP B CB    1 
ATOM   8836  C  CG    . ASP B 2  130  ? 145.171 185.584 130.035 1.00 66.58  ?  130  ASP B CG    1 
ATOM   8837  O  OD1   . ASP B 2  130  ? 144.982 186.139 131.137 1.00 66.58  ?  130  ASP B OD1   1 
ATOM   8838  O  OD2   . ASP B 2  130  ? 145.947 184.624 129.875 1.00 66.58  -1 130  ASP B OD2   1 
ATOM   8839  N  N     . ASP B 2  131  ? 144.808 189.465 128.910 1.00 52.41  ?  131  ASP B N     1 
ATOM   8840  C  CA    . ASP B 2  131  ? 144.962 190.665 129.721 1.00 52.41  ?  131  ASP B CA    1 
ATOM   8841  C  C     . ASP B 2  131  ? 143.774 191.567 129.443 1.00 52.41  ?  131  ASP B C     1 
ATOM   8842  O  O     . ASP B 2  131  ? 143.316 191.685 128.308 1.00 52.41  ?  131  ASP B O     1 
ATOM   8843  C  CB    . ASP B 2  131  ? 146.294 191.384 129.453 1.00 52.41  ?  131  ASP B CB    1 
ATOM   8844  C  CG    . ASP B 2  131  ? 146.629 191.469 127.975 1.00 52.41  ?  131  ASP B CG    1 
ATOM   8845  O  OD1   . ASP B 2  131  ? 145.847 190.946 127.150 1.00 52.41  ?  131  ASP B OD1   1 
ATOM   8846  O  OD2   . ASP B 2  131  ? 147.704 192.021 127.649 1.00 52.41  -1 131  ASP B OD2   1 
ATOM   8847  N  N     . GLU B 2  132  ? 143.276 192.192 130.496 1.00 42.37  ?  132  GLU B N     1 
ATOM   8848  C  CA    . GLU B 2  132  ? 142.021 192.919 130.443 1.00 42.37  ?  132  GLU B CA    1 
ATOM   8849  C  C     . GLU B 2  132  ? 142.281 194.415 130.374 1.00 42.37  ?  132  GLU B C     1 
ATOM   8850  O  O     . GLU B 2  132  ? 143.345 194.891 130.767 1.00 42.37  ?  132  GLU B O     1 
ATOM   8851  C  CB    . GLU B 2  132  ? 141.162 192.587 131.668 1.00 42.37  ?  132  GLU B CB    1 
ATOM   8852  C  CG    . GLU B 2  132  ? 140.759 191.133 131.731 1.00 42.37  ?  132  GLU B CG    1 
ATOM   8853  C  CD    . GLU B 2  132  ? 139.907 190.791 132.941 1.00 42.37  ?  132  GLU B CD    1 
ATOM   8854  O  OE1   . GLU B 2  132  ? 140.471 190.576 134.033 1.00 42.37  ?  132  GLU B OE1   1 
ATOM   8855  O  OE2   . GLU B 2  132  ? 138.670 190.731 132.798 1.00 42.37  -1 132  GLU B OE2   1 
ATOM   8856  N  N     . LEU B 2  133  ? 141.306 195.152 129.868 1.00 27.34  ?  133  LEU B N     1 
ATOM   8857  C  CA    . LEU B 2  133  ? 141.315 196.600 129.953 1.00 27.34  ?  133  LEU B CA    1 
ATOM   8858  C  C     . LEU B 2  133  ? 140.236 197.029 130.935 1.00 27.34  ?  133  LEU B C     1 
ATOM   8859  O  O     . LEU B 2  133  ? 139.199 196.382 131.052 1.00 27.34  ?  133  LEU B O     1 
ATOM   8860  C  CB    . LEU B 2  133  ? 141.070 197.249 128.590 1.00 27.34  ?  133  LEU B CB    1 
ATOM   8861  C  CG    . LEU B 2  133  ? 142.208 197.365 127.566 1.00 27.34  ?  133  LEU B CG    1 
ATOM   8862  C  CD1   . LEU B 2  133  ? 143.435 198.022 128.170 1.00 27.34  ?  133  LEU B CD1   1 
ATOM   8863  C  CD2   . LEU B 2  133  ? 142.582 196.059 126.903 1.00 27.34  ?  133  LEU B CD2   1 
ATOM   8864  N  N     . VAL B 2  134  ? 140.490 198.105 131.669 1.00 25.38  ?  134  VAL B N     1 
ATOM   8865  C  CA    . VAL B 2  134  ? 139.540 198.612 132.652 1.00 25.38  ?  134  VAL B CA    1 
ATOM   8866  C  C     . VAL B 2  134  ? 139.446 200.114 132.469 1.00 25.38  ?  134  VAL B C     1 
ATOM   8867  O  O     . VAL B 2  134  ? 140.467 200.802 132.471 1.00 25.38  ?  134  VAL B O     1 
ATOM   8868  C  CB    . VAL B 2  134  ? 139.966 198.283 134.098 1.00 25.38  ?  134  VAL B CB    1 
ATOM   8869  C  CG1   . VAL B 2  134  ? 139.097 199.005 135.076 1.00 25.38  ?  134  VAL B CG1   1 
ATOM   8870  C  CG2   . VAL B 2  134  ? 139.916 196.799 134.372 1.00 25.38  ?  134  VAL B CG2   1 
ATOM   8871  N  N     . LEU B 2  135  ? 138.237 200.630 132.300 1.00 23.17  ?  135  LEU B N     1 
ATOM   8872  C  CA    . LEU B 2  135  ? 138.046 202.069 132.242 1.00 23.17  ?  135  LEU B CA    1 
ATOM   8873  C  C     . LEU B 2  135  ? 137.808 202.562 133.656 1.00 23.17  ?  135  LEU B C     1 
ATOM   8874  O  O     . LEU B 2  135  ? 136.937 202.047 134.356 1.00 23.17  ?  135  LEU B O     1 
ATOM   8875  C  CB    . LEU B 2  135  ? 136.882 202.450 131.335 1.00 23.17  ?  135  LEU B CB    1 
ATOM   8876  C  CG    . LEU B 2  135  ? 136.764 203.956 131.128 1.00 23.17  ?  135  LEU B CG    1 
ATOM   8877  C  CD1   . LEU B 2  135  ? 137.922 204.446 130.311 1.00 23.17  ?  135  LEU B CD1   1 
ATOM   8878  C  CD2   . LEU B 2  135  ? 135.479 204.317 130.446 1.00 23.17  ?  135  LEU B CD2   1 
ATOM   8879  N  N     . GLU B 2  136  ? 138.577 203.558 134.071 1.00 28.98  ?  136  GLU B N     1 
ATOM   8880  C  CA    . GLU B 2  136  ? 138.581 204.019 135.445 1.00 28.98  ?  136  GLU B CA    1 
ATOM   8881  C  C     . GLU B 2  136  ? 138.355 205.520 135.459 1.00 28.98  ?  136  GLU B C     1 
ATOM   8882  O  O     . GLU B 2  136  ? 138.896 206.247 134.627 1.00 28.98  ?  136  GLU B O     1 
ATOM   8883  C  CB    . GLU B 2  136  ? 139.905 203.648 136.132 1.00 28.98  ?  136  GLU B CB    1 
ATOM   8884  C  CG    . GLU B 2  136  ? 140.040 204.192 137.537 1.00 28.98  ?  136  GLU B CG    1 
ATOM   8885  C  CD    . GLU B 2  136  ? 141.051 203.476 138.399 1.00 28.98  ?  136  GLU B CD    1 
ATOM   8886  O  OE1   . GLU B 2  136  ? 141.572 202.422 137.988 1.00 28.98  ?  136  GLU B OE1   1 
ATOM   8887  O  OE2   . GLU B 2  136  ? 141.317 203.981 139.507 1.00 28.98  -1 136  GLU B OE2   1 
ATOM   8888  N  N     . ASP B 2  137  ? 137.521 205.966 136.366 1.00 31.97  ?  137  ASP B N     1 
ATOM   8889  C  CA    . ASP B 2  137  ? 137.375 207.363 136.703 1.00 31.97  ?  137  ASP B CA    1 
ATOM   8890  C  C     . ASP B 2  137  ? 137.774 207.544 138.166 1.00 31.97  ?  137  ASP B C     1 
ATOM   8891  O  O     . ASP B 2  137  ? 138.301 206.630 138.804 1.00 31.97  ?  137  ASP B O     1 
ATOM   8892  C  CB    . ASP B 2  137  ? 135.951 207.813 136.410 1.00 31.97  ?  137  ASP B CB    1 
ATOM   8893  C  CG    . ASP B 2  137  ? 135.855 209.289 136.158 1.00 31.97  ?  137  ASP B CG    1 
ATOM   8894  O  OD1   . ASP B 2  137  ? 136.551 210.040 136.870 1.00 31.97  ?  137  ASP B OD1   1 
ATOM   8895  O  OD2   . ASP B 2  137  ? 135.092 209.701 135.261 1.00 31.97  -1 137  ASP B OD2   1 
ATOM   8896  N  N     . GLU B 2  138  ? 137.530 208.739 138.695 1.00 33.75  ?  138  GLU B N     1 
ATOM   8897  C  CA    . GLU B 2  138  ? 137.974 209.071 140.040 1.00 33.75  ?  138  GLU B CA    1 
ATOM   8898  C  C     . GLU B 2  138  ? 137.249 208.269 141.117 1.00 33.75  ?  138  GLU B C     1 
ATOM   8899  O  O     . GLU B 2  138  ? 137.834 207.999 142.170 1.00 33.75  ?  138  GLU B O     1 
ATOM   8900  C  CB    . GLU B 2  138  ? 137.816 210.570 140.263 1.00 33.75  ?  138  GLU B CB    1 
ATOM   8901  C  CG    . GLU B 2  138  ? 136.418 211.082 140.079 1.00 33.75  ?  138  GLU B CG    1 
ATOM   8902  C  CD    . GLU B 2  138  ? 136.345 212.580 140.148 1.00 33.75  ?  138  GLU B CD    1 
ATOM   8903  O  OE1   . GLU B 2  138  ? 137.399 213.216 140.323 1.00 33.75  ?  138  GLU B OE1   1 
ATOM   8904  O  OE2   . GLU B 2  138  ? 135.233 213.129 140.015 1.00 33.75  -1 138  GLU B OE2   1 
ATOM   8905  N  N     . LEU B 2  139  ? 136.007 207.848 140.870 1.00 29.47  ?  139  LEU B N     1 
ATOM   8906  C  CA    . LEU B 2  139  ? 135.214 207.184 141.898 1.00 29.47  ?  139  LEU B CA    1 
ATOM   8907  C  C     . LEU B 2  139  ? 135.169 205.667 141.764 1.00 29.47  ?  139  LEU B C     1 
ATOM   8908  O  O     . LEU B 2  139  ? 135.257 204.977 142.779 1.00 29.47  ?  139  LEU B O     1 
ATOM   8909  C  CB    . LEU B 2  139  ? 133.791 207.745 141.909 1.00 29.47  ?  139  LEU B CB    1 
ATOM   8910  C  CG    . LEU B 2  139  ? 133.716 209.202 142.361 1.00 29.47  ?  139  LEU B CG    1 
ATOM   8911  C  CD1   . LEU B 2  139  ? 132.298 209.743 142.247 1.00 29.47  ?  139  LEU B CD1   1 
ATOM   8912  C  CD2   . LEU B 2  139  ? 134.229 209.348 143.774 1.00 29.47  ?  139  LEU B CD2   1 
ATOM   8913  N  N     . GLN B 2  140  ? 135.023 205.116 140.559 1.00 29.46  ?  140  GLN B N     1 
ATOM   8914  C  CA    . GLN B 2  140  ? 134.976 203.667 140.408 1.00 29.46  ?  140  GLN B CA    1 
ATOM   8915  C  C     . GLN B 2  140  ? 135.468 203.255 139.028 1.00 29.46  ?  140  GLN B C     1 
ATOM   8916  O  O     . GLN B 2  140  ? 135.801 204.088 138.190 1.00 29.46  ?  140  GLN B O     1 
ATOM   8917  C  CB    . GLN B 2  140  ? 133.568 203.127 140.648 1.00 29.46  ?  140  GLN B CB    1 
ATOM   8918  C  CG    . GLN B 2  140  ? 132.565 203.500 139.597 1.00 29.46  ?  140  GLN B CG    1 
ATOM   8919  C  CD    . GLN B 2  140  ? 131.535 204.465 140.107 1.00 29.46  ?  140  GLN B CD    1 
ATOM   8920  O  OE1   . GLN B 2  140  ? 131.805 205.271 140.988 1.00 29.46  ?  140  GLN B OE1   1 
ATOM   8921  N  NE2   . GLN B 2  140  ? 130.332 204.361 139.584 1.00 29.46  ?  140  GLN B NE2   1 
ATOM   8922  N  N     . ARG B 2  141  ? 135.479 201.945 138.802 1.00 30.73  ?  141  ARG B N     1 
ATOM   8923  C  CA    . ARG B 2  141  ? 136.001 201.325 137.596 1.00 30.73  ?  141  ARG B CA    1 
ATOM   8924  C  C     . ARG B 2  141  ? 134.883 200.588 136.875 1.00 30.73  ?  141  ARG B C     1 
ATOM   8925  O  O     . ARG B 2  141  ? 133.768 200.488 137.388 1.00 30.73  ?  141  ARG B O     1 
ATOM   8926  C  CB    . ARG B 2  141  ? 137.116 200.332 137.932 1.00 30.73  ?  141  ARG B CB    1 
ATOM   8927  C  CG    . ARG B 2  141  ? 138.258 200.942 138.696 1.00 30.73  ?  141  ARG B CG    1 
ATOM   8928  C  CD    . ARG B 2  141  ? 139.457 200.043 138.737 1.00 30.73  ?  141  ARG B CD    1 
ATOM   8929  N  NE    . ARG B 2  141  ? 139.259 198.923 139.638 1.00 30.73  ?  141  ARG B NE    1 
ATOM   8930  C  CZ    . ARG B 2  141  ? 139.329 197.653 139.266 1.00 30.73  ?  141  ARG B CZ    1 
ATOM   8931  N  NH1   . ARG B 2  141  ? 139.592 197.352 138.007 1.00 30.73  1  141  ARG B NH1   1 
ATOM   8932  N  NH2   . ARG B 2  141  ? 139.138 196.684 140.149 1.00 30.73  ?  141  ARG B NH2   1 
ATOM   8933  N  N     . ILE B 2  142  ? 135.193 200.077 135.675 1.00 27.96  ?  142  ILE B N     1 
ATOM   8934  C  CA    . ILE B 2  142  ? 134.339 199.127 134.964 1.00 27.96  ?  142  ILE B CA    1 
ATOM   8935  C  C     . ILE B 2  142  ? 135.177 198.357 133.947 1.00 27.96  ?  142  ILE B C     1 
ATOM   8936  O  O     . ILE B 2  142  ? 136.166 198.865 133.408 1.00 27.96  ?  142  ILE B O     1 
ATOM   8937  C  CB    . ILE B 2  142  ? 133.110 199.809 134.300 1.00 27.96  ?  142  ILE B CB    1 
ATOM   8938  C  CG1   . ILE B 2  142  ? 131.996 198.793 134.046 1.00 27.96  ?  142  ILE B CG1   1 
ATOM   8939  C  CG2   . ILE B 2  142  ? 133.468 200.581 133.047 1.00 27.96  ?  142  ILE B CG2   1 
ATOM   8940  C  CD1   . ILE B 2  142  ? 130.681 199.412 133.707 1.00 27.96  ?  142  ILE B CD1   1 
ATOM   8941  N  N     . LYS B 2  143  ? 134.819 197.094 133.739 1.00 26.04  ?  143  LYS B N     1 
ATOM   8942  C  CA    . LYS B 2  143  ? 135.488 196.279 132.742 1.00 26.04  ?  143  LYS B CA    1 
ATOM   8943  C  C     . LYS B 2  143  ? 134.980 196.629 131.351 1.00 26.04  ?  143  LYS B C     1 
ATOM   8944  O  O     . LYS B 2  143  ? 133.958 197.292 131.184 1.00 26.04  ?  143  LYS B O     1 
ATOM   8945  C  CB    . LYS B 2  143  ? 135.275 194.798 133.018 1.00 26.04  ?  143  LYS B CB    1 
ATOM   8946  C  CG    . LYS B 2  143  ? 135.904 194.326 134.302 1.00 26.04  ?  143  LYS B CG    1 
ATOM   8947  C  CD    . LYS B 2  143  ? 136.671 193.049 134.073 1.00 26.04  ?  143  LYS B CD    1 
ATOM   8948  C  CE    . LYS B 2  143  ? 137.590 192.753 135.236 1.00 26.04  ?  143  LYS B CE    1 
ATOM   8949  N  NZ    . LYS B 2  143  ? 138.368 193.960 135.616 1.00 26.04  1  143  LYS B NZ    1 
ATOM   8950  N  N     . LEU B 2  144  ? 135.706 196.165 130.340 1.00 26.69  ?  144  LEU B N     1 
ATOM   8951  C  CA    . LEU B 2  144  ? 135.436 196.556 128.967 1.00 26.69  ?  144  LEU B CA    1 
ATOM   8952  C  C     . LEU B 2  144  ? 135.640 195.363 128.054 1.00 26.69  ?  144  LEU B C     1 
ATOM   8953  O  O     . LEU B 2  144  ? 136.677 194.703 128.126 1.00 26.69  ?  144  LEU B O     1 
ATOM   8954  C  CB    . LEU B 2  144  ? 136.351 197.701 128.512 1.00 26.69  ?  144  LEU B CB    1 
ATOM   8955  C  CG    . LEU B 2  144  ? 136.259 199.134 129.050 1.00 26.69  ?  144  LEU B CG    1 
ATOM   8956  C  CD1   . LEU B 2  144  ? 137.124 200.043 128.222 1.00 26.69  ?  144  LEU B CD1   1 
ATOM   8957  C  CD2   . LEU B 2  144  ? 134.863 199.652 129.046 1.00 26.69  ?  144  LEU B CD2   1 
ATOM   8958  N  N     . LYS B 2  145  ? 134.661 195.094 127.196 1.00 34.55  ?  145  LYS B N     1 
ATOM   8959  C  CA    . LYS B 2  145  ? 134.847 194.157 126.097 1.00 34.55  ?  145  LYS B CA    1 
ATOM   8960  C  C     . LYS B 2  145  ? 134.006 194.622 124.917 1.00 34.55  ?  145  LYS B C     1 
ATOM   8961  O  O     . LYS B 2  145  ? 133.190 195.537 125.026 1.00 34.55  ?  145  LYS B O     1 
ATOM   8962  C  CB    . LYS B 2  145  ? 134.504 192.715 126.495 1.00 34.55  ?  145  LYS B CB    1 
ATOM   8963  C  CG    . LYS B 2  145  ? 133.033 192.447 126.658 1.00 34.55  ?  145  LYS B CG    1 
ATOM   8964  C  CD    . LYS B 2  145  ? 132.777 191.018 127.080 1.00 34.55  ?  145  LYS B CD    1 
ATOM   8965  C  CE    . LYS B 2  145  ? 131.291 190.749 127.188 1.00 34.55  ?  145  LYS B CE    1 
ATOM   8966  N  NZ    . LYS B 2  145  ? 131.015 189.449 127.854 1.00 34.55  1  145  LYS B NZ    1 
ATOM   8967  N  N     . GLY B 2  146  ? 134.238 193.995 123.773 1.00 36.95  ?  146  GLY B N     1 
ATOM   8968  C  CA    . GLY B 2  146  ? 133.596 194.412 122.546 1.00 36.95  ?  146  GLY B CA    1 
ATOM   8969  C  C     . GLY B 2  146  ? 134.584 194.589 121.416 1.00 36.95  ?  146  GLY B C     1 
ATOM   8970  O  O     . GLY B 2  146  ? 135.513 193.793 121.266 1.00 36.95  ?  146  GLY B O     1 
ATOM   8971  N  N     . THR B 2  147  ? 134.400 195.632 120.616 1.00 40.85  ?  147  THR B N     1 
ATOM   8972  C  CA    . THR B 2  147  ? 135.276 195.913 119.483 1.00 40.85  ?  147  THR B CA    1 
ATOM   8973  C  C     . THR B 2  147  ? 136.304 196.945 119.930 1.00 40.85  ?  147  THR B C     1 
ATOM   8974  O  O     . THR B 2  147  ? 136.095 198.152 119.812 1.00 40.85  ?  147  THR B O     1 
ATOM   8975  C  CB    . THR B 2  147  ? 134.481 196.393 118.279 1.00 40.85  ?  147  THR B CB    1 
ATOM   8976  O  OG1   . THR B 2  147  ? 133.615 197.466 118.668 1.00 40.85  ?  147  THR B OG1   1 
ATOM   8977  C  CG2   . THR B 2  147  ? 133.661 195.243 117.696 1.00 40.85  ?  147  THR B CG2   1 
ATOM   8978  N  N     . ILE B 2  148  ? 137.424 196.449 120.447 1.00 38.06  ?  148  ILE B N     1 
ATOM   8979  C  CA    . ILE B 2  148  ? 138.514 197.286 120.924 1.00 38.06  ?  148  ILE B CA    1 
ATOM   8980  C  C     . ILE B 2  148  ? 139.782 196.445 120.859 1.00 38.06  ?  148  ILE B C     1 
ATOM   8981  O  O     . ILE B 2  148  ? 139.730 195.211 120.902 1.00 38.06  ?  148  ILE B O     1 
ATOM   8982  C  CB    . ILE B 2  148  ? 138.211 197.827 122.343 1.00 38.06  ?  148  ILE B CB    1 
ATOM   8983  C  CG1   . ILE B 2  148  ? 139.069 199.051 122.655 1.00 38.06  ?  148  ILE B CG1   1 
ATOM   8984  C  CG2   . ILE B 2  148  ? 138.380 196.745 123.399 1.00 38.06  ?  148  ILE B CG2   1 
ATOM   8985  C  CD1   . ILE B 2  148  ? 138.521 199.909 123.770 1.00 38.06  ?  148  ILE B CD1   1 
ATOM   8986  N  N     . ASP B 2  149  ? 140.919 197.106 120.677 1.00 42.87  ?  149  ASP B N     1 
ATOM   8987  C  CA    . ASP B 2  149  ? 142.187 196.406 120.532 1.00 42.87  ?  149  ASP B CA    1 
ATOM   8988  C  C     . ASP B 2  149  ? 142.768 196.127 121.910 1.00 42.87  ?  149  ASP B C     1 
ATOM   8989  O  O     . ASP B 2  149  ? 142.827 197.017 122.763 1.00 42.87  ?  149  ASP B O     1 
ATOM   8990  C  CB    . ASP B 2  149  ? 143.168 197.213 119.686 1.00 42.87  ?  149  ASP B CB    1 
ATOM   8991  C  CG    . ASP B 2  149  ? 144.039 196.333 118.812 1.00 42.87  ?  149  ASP B CG    1 
ATOM   8992  O  OD1   . ASP B 2  149  ? 144.225 195.149 119.158 1.00 42.87  ?  149  ASP B OD1   1 
ATOM   8993  O  OD2   . ASP B 2  149  ? 144.540 196.823 117.779 1.00 42.87  -1 149  ASP B OD2   1 
ATOM   8994  N  N     . VAL B 2  150  ? 143.189 194.886 122.129 1.00 39.39  ?  150  VAL B N     1 
ATOM   8995  C  CA    . VAL B 2  150  ? 143.564 194.496 123.479 1.00 39.39  ?  150  VAL B CA    1 
ATOM   8996  C  C     . VAL B 2  150  ? 145.051 194.732 123.726 1.00 39.39  ?  150  VAL B C     1 
ATOM   8997  O  O     . VAL B 2  150  ? 145.459 194.971 124.864 1.00 39.39  ?  150  VAL B O     1 
ATOM   8998  C  CB    . VAL B 2  150  ? 143.134 193.036 123.732 1.00 39.39  ?  150  VAL B CB    1 
ATOM   8999  C  CG1   . VAL B 2  150  ? 144.042 192.036 123.028 1.00 39.39  ?  150  VAL B CG1   1 
ATOM   9000  C  CG2   . VAL B 2  150  ? 143.055 192.740 125.214 1.00 39.39  ?  150  VAL B CG2   1 
ATOM   9001  N  N     . SER B 2  151  ? 145.873 194.724 122.677 1.00 35.33  ?  151  SER B N     1 
ATOM   9002  C  CA    . SER B 2  151  ? 147.314 194.735 122.828 1.00 35.33  ?  151  SER B CA    1 
ATOM   9003  C  C     . SER B 2  151  ? 147.980 195.944 122.203 1.00 35.33  ?  151  SER B C     1 
ATOM   9004  O  O     . SER B 2  151  ? 149.190 196.105 122.368 1.00 35.33  ?  151  SER B O     1 
ATOM   9005  C  CB    . SER B 2  151  ? 147.922 193.462 122.227 1.00 35.33  ?  151  SER B CB    1 
ATOM   9006  O  OG    . SER B 2  151  ? 147.289 193.130 121.005 1.00 35.33  ?  151  SER B OG    1 
ATOM   9007  N  N     . LYS B 2  152  ? 147.242 196.786 121.495 1.00 30.62  ?  152  LYS B N     1 
ATOM   9008  C  CA    . LYS B 2  152  ? 147.799 198.025 120.983 1.00 30.62  ?  152  LYS B CA    1 
ATOM   9009  C  C     . LYS B 2  152  ? 147.788 199.140 122.017 1.00 30.62  ?  152  LYS B C     1 
ATOM   9010  O  O     . LYS B 2  152  ? 148.558 200.096 121.891 1.00 30.62  ?  152  LYS B O     1 
ATOM   9011  C  CB    . LYS B 2  152  ? 147.022 198.460 119.746 1.00 30.62  ?  152  LYS B CB    1 
ATOM   9012  C  CG    . LYS B 2  152  ? 147.760 199.393 118.816 1.00 30.62  ?  152  LYS B CG    1 
ATOM   9013  C  CD    . LYS B 2  152  ? 146.833 200.489 118.340 1.00 30.62  ?  152  LYS B CD    1 
ATOM   9014  C  CE    . LYS B 2  152  ? 147.509 201.412 117.343 1.00 30.62  ?  152  LYS B CE    1 
ATOM   9015  N  NZ    . LYS B 2  152  ? 146.774 202.699 117.208 1.00 30.62  1  152  LYS B NZ    1 
ATOM   9016  N  N     . LEU B 2  153  ? 146.952 199.042 123.041 1.00 27.08  ?  153  LEU B N     1 
ATOM   9017  C  CA    . LEU B 2  153  ? 146.778 200.129 123.989 1.00 27.08  ?  153  LEU B CA    1 
ATOM   9018  C  C     . LEU B 2  153  ? 147.490 199.820 125.304 1.00 27.08  ?  153  LEU B C     1 
ATOM   9019  O  O     . LEU B 2  153  ? 147.724 198.661 125.651 1.00 27.08  ?  153  LEU B O     1 
ATOM   9020  C  CB    . LEU B 2  153  ? 145.296 200.409 124.232 1.00 27.08  ?  153  LEU B CB    1 
ATOM   9021  C  CG    . LEU B 2  153  ? 144.574 201.121 123.082 1.00 27.08  ?  153  LEU B CG    1 
ATOM   9022  C  CD1   . LEU B 2  153  ? 143.881 200.133 122.163 1.00 27.08  ?  153  LEU B CD1   1 
ATOM   9023  C  CD2   . LEU B 2  153  ? 143.590 202.153 123.592 1.00 27.08  ?  153  LEU B CD2   1 
ATOM   9024  N  N     . VAL B 2  154  ? 147.854 200.886 126.020 1.00 25.31  ?  154  VAL B N     1 
ATOM   9025  C  CA    . VAL B 2  154  ? 148.698 200.818 127.205 1.00 25.31  ?  154  VAL B CA    1 
ATOM   9026  C  C     . VAL B 2  154  ? 147.999 201.561 128.335 1.00 25.31  ?  154  VAL B C     1 
ATOM   9027  O  O     . VAL B 2  154  ? 147.119 202.391 128.112 1.00 25.31  ?  154  VAL B O     1 
ATOM   9028  C  CB    . VAL B 2  154  ? 150.110 201.412 126.961 1.00 25.31  ?  154  VAL B CB    1 
ATOM   9029  C  CG1   . VAL B 2  154  ? 150.854 200.645 125.904 1.00 25.31  ?  154  VAL B CG1   1 
ATOM   9030  C  CG2   . VAL B 2  154  ? 150.011 202.872 126.547 1.00 25.31  ?  154  VAL B CG2   1 
ATOM   9031  N  N     . THR B 2  155  ? 148.399 201.247 129.562 1.00 25.11  ?  155  THR B N     1 
ATOM   9032  C  CA    . THR B 2  155  ? 147.824 201.907 130.725 1.00 25.11  ?  155  THR B CA    1 
ATOM   9033  C  C     . THR B 2  155  ? 148.280 203.356 130.835 1.00 25.11  ?  155  THR B C     1 
ATOM   9034  O  O     . THR B 2  155  ? 149.472 203.658 130.777 1.00 25.11  ?  155  THR B O     1 
ATOM   9035  C  CB    . THR B 2  155  ? 148.161 201.125 131.994 1.00 25.11  ?  155  THR B CB    1 
ATOM   9036  O  OG1   . THR B 2  155  ? 147.893 201.927 133.148 1.00 25.11  ?  155  THR B OG1   1 
ATOM   9037  C  CG2   . THR B 2  155  ? 149.574 200.623 131.998 1.00 25.11  ?  155  THR B CG2   1 
ATOM   9038  N  N     . GLY B 2  156  ? 147.313 204.259 130.967 1.00 30.27  ?  156  GLY B N     1 
ATOM   9039  C  CA    . GLY B 2  156  ? 147.574 205.681 131.105 1.00 30.27  ?  156  GLY B CA    1 
ATOM   9040  C  C     . GLY B 2  156  ? 146.990 206.559 130.012 1.00 30.27  ?  156  GLY B C     1 
ATOM   9041  O  O     . GLY B 2  156  ? 147.129 207.784 130.101 1.00 30.27  ?  156  GLY B O     1 
ATOM   9042  N  N     . THR B 2  157  ? 146.339 206.013 128.986 1.00 24.87  ?  157  THR B N     1 
ATOM   9043  C  CA    . THR B 2  157  ? 145.737 206.810 127.924 1.00 24.87  ?  157  THR B CA    1 
ATOM   9044  C  C     . THR B 2  157  ? 144.343 207.263 128.336 1.00 24.87  ?  157  THR B C     1 
ATOM   9045  O  O     . THR B 2  157  ? 143.569 206.484 128.892 1.00 24.87  ?  157  THR B O     1 
ATOM   9046  C  CB    . THR B 2  157  ? 145.656 205.997 126.630 1.00 24.87  ?  157  THR B CB    1 
ATOM   9047  O  OG1   . THR B 2  157  ? 146.868 205.261 126.446 1.00 24.87  ?  157  THR B OG1   1 
ATOM   9048  C  CG2   . THR B 2  157  ? 145.435 206.894 125.431 1.00 24.87  ?  157  THR B CG2   1 
ATOM   9049  N  N     . VAL B 2  158  ? 144.025 208.525 128.068 1.00 25.67  ?  158  VAL B N     1 
ATOM   9050  C  CA    . VAL B 2  158  ? 142.705 209.076 128.359 1.00 25.67  ?  158  VAL B CA    1 
ATOM   9051  C  C     . VAL B 2  158  ? 141.917 209.200 127.054 1.00 25.67  ?  158  VAL B C     1 
ATOM   9052  O  O     . VAL B 2  158  ? 142.444 209.673 126.041 1.00 25.67  ?  158  VAL B O     1 
ATOM   9053  C  CB    . VAL B 2  158  ? 142.819 210.406 129.136 1.00 25.67  ?  158  VAL B CB    1 
ATOM   9054  C  CG1   . VAL B 2  158  ? 143.702 211.370 128.461 1.00 25.67  ?  158  VAL B CG1   1 
ATOM   9055  C  CG2   . VAL B 2  158  ? 141.480 211.033 129.355 1.00 25.67  ?  158  VAL B CG2   1 
ATOM   9056  N  N     . LEU B 2  159  ? 140.678 208.703 127.055 1.00 21.08  ?  159  LEU B N     1 
ATOM   9057  C  CA    . LEU B 2  159  ? 139.907 208.553 125.826 1.00 21.08  ?  159  LEU B CA    1 
ATOM   9058  C  C     . LEU B 2  159  ? 138.417 208.602 126.122 1.00 21.08  ?  159  LEU B C     1 
ATOM   9059  O  O     . LEU B 2  159  ? 137.980 208.443 127.270 1.00 21.08  ?  159  LEU B O     1 
ATOM   9060  C  CB    . LEU B 2  159  ? 140.242 207.242 125.103 1.00 21.08  ?  159  LEU B CB    1 
ATOM   9061  C  CG    . LEU B 2  159  ? 139.597 205.919 125.521 1.00 21.08  ?  159  LEU B CG    1 
ATOM   9062  C  CD1   . LEU B 2  159  ? 139.892 204.870 124.488 1.00 21.08  ?  159  LEU B CD1   1 
ATOM   9063  C  CD2   . LEU B 2  159  ? 140.070 205.427 126.870 1.00 21.08  ?  159  LEU B CD2   1 
ATOM   9064  N  N     . ALA B 2  160  ? 137.637 208.831 125.057 1.00 21.69  ?  160  ALA B N     1 
ATOM   9065  C  CA    . ALA B 2  160  ? 136.181 208.786 125.093 1.00 21.69  ?  160  ALA B CA    1 
ATOM   9066  C  C     . ALA B 2  160  ? 135.696 207.525 124.390 1.00 21.69  ?  160  ALA B C     1 
ATOM   9067  O  O     . ALA B 2  160  ? 136.355 207.020 123.479 1.00 21.69  ?  160  ALA B O     1 
ATOM   9068  C  CB    . ALA B 2  160  ? 135.575 210.023 124.439 1.00 21.69  ?  160  ALA B CB    1 
ATOM   9069  N  N     . VAL B 2  161  ? 134.533 207.022 124.800 1.00 24.69  ?  161  VAL B N     1 
ATOM   9070  C  CA    . VAL B 2  161  ? 134.074 205.713 124.350 1.00 24.69  ?  161  VAL B CA    1 
ATOM   9071  C  C     . VAL B 2  161  ? 132.543 205.709 124.282 1.00 24.69  ?  161  VAL B C     1 
ATOM   9072  O  O     . VAL B 2  161  ? 131.878 206.493 124.959 1.00 24.69  ?  161  VAL B O     1 
ATOM   9073  C  CB    . VAL B 2  161  ? 134.657 204.621 125.282 1.00 24.69  ?  161  VAL B CB    1 
ATOM   9074  C  CG1   . VAL B 2  161  ? 133.946 204.573 126.609 1.00 24.69  ?  161  VAL B CG1   1 
ATOM   9075  C  CG2   . VAL B 2  161  ? 134.693 203.297 124.626 1.00 24.69  ?  161  VAL B CG2   1 
ATOM   9076  N  N     . PHE B 2  162  ? 131.988 204.827 123.440 1.00 34.36  ?  162  PHE B N     1 
ATOM   9077  C  CA    . PHE B 2  162  ? 130.563 204.809 123.111 1.00 34.36  ?  162  PHE B CA    1 
ATOM   9078  C  C     . PHE B 2  162  ? 129.963 203.432 123.360 1.00 34.36  ?  162  PHE B C     1 
ATOM   9079  O  O     . PHE B 2  162  ? 130.460 202.438 122.822 1.00 34.36  ?  162  PHE B O     1 
ATOM   9080  C  CB    . PHE B 2  162  ? 130.382 205.181 121.643 1.00 34.36  ?  162  PHE B CB    1 
ATOM   9081  C  CG    . PHE B 2  162  ? 128.982 205.532 121.266 1.00 34.36  ?  162  PHE B CG    1 
ATOM   9082  C  CD1   . PHE B 2  162  ? 128.215 206.356 122.066 1.00 34.36  ?  162  PHE B CD1   1 
ATOM   9083  C  CD2   . PHE B 2  162  ? 128.439 205.059 120.088 1.00 34.36  ?  162  PHE B CD2   1 
ATOM   9084  C  CE1   . PHE B 2  162  ? 126.925 206.681 121.708 1.00 34.36  ?  162  PHE B CE1   1 
ATOM   9085  C  CE2   . PHE B 2  162  ? 127.149 205.376 119.732 1.00 34.36  ?  162  PHE B CE2   1 
ATOM   9086  C  CZ    . PHE B 2  162  ? 126.397 206.189 120.545 1.00 34.36  ?  162  PHE B CZ    1 
ATOM   9087  N  N     . GLY B 2  163  ? 128.883 203.365 124.141 1.00 36.45  ?  163  GLY B N     1 
ATOM   9088  C  CA    . GLY B 2  163  ? 128.246 202.069 124.351 1.00 36.45  ?  163  GLY B CA    1 
ATOM   9089  C  C     . GLY B 2  163  ? 127.225 202.067 125.472 1.00 36.45  ?  163  GLY B C     1 
ATOM   9090  O  O     . GLY B 2  163  ? 126.593 203.091 125.763 1.00 36.45  ?  163  GLY B O     1 
ATOM   9091  N  N     . SER B 2  164  ? 127.078 200.894 126.101 1.00 38.79  ?  164  SER B N     1 
ATOM   9092  C  CA    . SER B 2  164  ? 125.983 200.606 127.018 1.00 38.79  ?  164  SER B CA    1 
ATOM   9093  C  C     . SER B 2  164  ? 126.432 199.660 128.122 1.00 38.79  ?  164  SER B C     1 
ATOM   9094  O  O     . SER B 2  164  ? 127.287 198.801 127.909 1.00 38.79  ?  164  SER B O     1 
ATOM   9095  C  CB    . SER B 2  164  ? 124.798 199.966 126.281 1.00 38.79  ?  164  SER B CB    1 
ATOM   9096  O  OG    . SER B 2  164  ? 124.170 200.877 125.398 1.00 38.79  ?  164  SER B OG    1 
ATOM   9097  N  N     . VAL B 2  165  ? 125.823 199.806 129.299 1.00 42.52  ?  165  VAL B N     1 
ATOM   9098  C  CA    . VAL B 2  165  ? 126.063 198.899 130.419 1.00 42.52  ?  165  VAL B CA    1 
ATOM   9099  C  C     . VAL B 2  165  ? 125.183 197.673 130.258 1.00 42.52  ?  165  VAL B C     1 
ATOM   9100  O  O     . VAL B 2  165  ? 123.954 197.781 130.208 1.00 42.52  ?  165  VAL B O     1 
ATOM   9101  C  CB    . VAL B 2  165  ? 125.783 199.584 131.763 1.00 42.52  ?  165  VAL B CB    1 
ATOM   9102  C  CG1   . VAL B 2  165  ? 126.062 198.631 132.906 1.00 42.52  ?  165  VAL B CG1   1 
ATOM   9103  C  CG2   . VAL B 2  165  ? 126.624 200.796 131.904 1.00 42.52  ?  165  VAL B CG2   1 
ATOM   9104  N  N     . ARG B 2  166  ? 125.805 196.509 130.214 1.00 64.15  ?  166  ARG B N     1 
ATOM   9105  C  CA    . ARG B 2  166  ? 125.102 195.257 130.025 1.00 64.15  ?  166  ARG B CA    1 
ATOM   9106  C  C     . ARG B 2  166  ? 124.711 194.674 131.381 1.00 64.15  ?  166  ARG B C     1 
ATOM   9107  O  O     . ARG B 2  166  ? 124.732 195.359 132.406 1.00 64.15  ?  166  ARG B O     1 
ATOM   9108  C  CB    . ARG B 2  166  ? 125.957 194.307 129.193 1.00 64.15  ?  166  ARG B CB    1 
ATOM   9109  C  CG    . ARG B 2  166  ? 125.624 194.373 127.717 1.00 64.15  ?  166  ARG B CG    1 
ATOM   9110  C  CD    . ARG B 2  166  ? 126.152 193.176 126.946 1.00 64.15  ?  166  ARG B CD    1 
ATOM   9111  N  NE    . ARG B 2  166  ? 125.806 191.895 127.557 1.00 64.15  ?  166  ARG B NE    1 
ATOM   9112  C  CZ    . ARG B 2  166  ? 125.869 190.725 126.923 1.00 64.15  ?  166  ARG B CZ    1 
ATOM   9113  N  NH1   . ARG B 2  166  ? 126.262 190.674 125.658 1.00 64.15  1  166  ARG B NH1   1 
ATOM   9114  N  NH2   . ARG B 2  166  ? 125.537 189.608 127.554 1.00 64.15  ?  166  ARG B NH2   1 
ATOM   9115  N  N     . ASP B 2  167  ? 124.311 193.407 131.389 1.00 82.86  ?  167  ASP B N     1 
ATOM   9116  C  CA    . ASP B 2  167  ? 123.698 192.800 132.563 1.00 82.86  ?  167  ASP B CA    1 
ATOM   9117  C  C     . ASP B 2  167  ? 124.699 192.231 133.552 1.00 82.86  ?  167  ASP B C     1 
ATOM   9118  O  O     . ASP B 2  167  ? 124.381 192.142 134.742 1.00 82.86  ?  167  ASP B O     1 
ATOM   9119  C  CB    . ASP B 2  167  ? 122.744 191.683 132.138 1.00 82.86  ?  167  ASP B CB    1 
ATOM   9120  C  CG    . ASP B 2  167  ? 121.765 192.129 131.089 1.00 82.86  ?  167  ASP B CG    1 
ATOM   9121  O  OD1   . ASP B 2  167  ? 122.203 192.520 129.989 1.00 82.86  ?  167  ASP B OD1   1 
ATOM   9122  O  OD2   . ASP B 2  167  ? 120.554 192.099 131.370 1.00 82.86  -1 167  ASP B OD2   1 
ATOM   9123  N  N     . ASP B 2  168  ? 125.883 191.830 133.101 1.00 78.17  ?  168  ASP B N     1 
ATOM   9124  C  CA    . ASP B 2  168  ? 126.898 191.272 133.981 1.00 78.17  ?  168  ASP B CA    1 
ATOM   9125  C  C     . ASP B 2  168  ? 127.807 192.335 134.580 1.00 78.17  ?  168  ASP B C     1 
ATOM   9126  O  O     . ASP B 2  168  ? 128.890 192.003 135.070 1.00 78.17  ?  168  ASP B O     1 
ATOM   9127  C  CB    . ASP B 2  168  ? 127.741 190.236 133.233 1.00 78.17  ?  168  ASP B CB    1 
ATOM   9128  C  CG    . ASP B 2  168  ? 128.139 190.695 131.851 1.00 78.17  ?  168  ASP B CG    1 
ATOM   9129  O  OD1   . ASP B 2  168  ? 127.693 191.779 131.425 1.00 78.17  ?  168  ASP B OD1   1 
ATOM   9130  O  OD2   . ASP B 2  168  ? 128.899 189.968 131.184 1.00 78.17  -1 168  ASP B OD2   1 
ATOM   9131  N  N     . GLY B 2  169  ? 127.398 193.602 134.547 1.00 64.04  ?  169  GLY B N     1 
ATOM   9132  C  CA    . GLY B 2  169  ? 128.201 194.691 135.044 1.00 64.04  ?  169  GLY B CA    1 
ATOM   9133  C  C     . GLY B 2  169  ? 129.249 195.207 134.082 1.00 64.04  ?  169  GLY B C     1 
ATOM   9134  O  O     . GLY B 2  169  ? 129.820 196.272 134.334 1.00 64.04  ?  169  GLY B O     1 
ATOM   9135  N  N     . LYS B 2  170  ? 129.521 194.492 132.991 1.00 46.47  ?  170  LYS B N     1 
ATOM   9136  C  CA    . LYS B 2  170  ? 130.518 194.920 132.026 1.00 46.47  ?  170  LYS B CA    1 
ATOM   9137  C  C     . LYS B 2  170  ? 129.934 195.964 131.083 1.00 46.47  ?  170  LYS B C     1 
ATOM   9138  O  O     . LYS B 2  170  ? 128.776 196.371 131.187 1.00 46.47  ?  170  LYS B O     1 
ATOM   9139  C  CB    . LYS B 2  170  ? 131.055 193.738 131.232 1.00 46.47  ?  170  LYS B CB    1 
ATOM   9140  C  CG    . LYS B 2  170  ? 131.888 192.765 132.013 1.00 46.47  ?  170  LYS B CG    1 
ATOM   9141  C  CD    . LYS B 2  170  ? 132.985 192.214 131.128 1.00 46.47  ?  170  LYS B CD    1 
ATOM   9142  C  CE    . LYS B 2  170  ? 133.496 190.874 131.613 1.00 46.47  ?  170  LYS B CE    1 
ATOM   9143  N  NZ    . LYS B 2  170  ? 133.628 190.817 133.092 1.00 46.47  1  170  LYS B NZ    1 
ATOM   9144  N  N     . PHE B 2  171  ? 130.752 196.379 130.133 1.00 40.62  ?  171  PHE B N     1 
ATOM   9145  C  CA    . PHE B 2  171  ? 130.465 197.482 129.238 1.00 40.62  ?  171  PHE B CA    1 
ATOM   9146  C  C     . PHE B 2  171  ? 130.783 197.020 127.825 1.00 40.62  ?  171  PHE B C     1 
ATOM   9147  O  O     . PHE B 2  171  ? 131.809 196.374 127.595 1.00 40.62  ?  171  PHE B O     1 
ATOM   9148  C  CB    . PHE B 2  171  ? 131.296 198.711 129.643 1.00 40.62  ?  171  PHE B CB    1 
ATOM   9149  C  CG    . PHE B 2  171  ? 130.846 200.007 129.039 1.00 40.62  ?  171  PHE B CG    1 
ATOM   9150  C  CD1   . PHE B 2  171  ? 131.204 200.354 127.758 1.00 40.62  ?  171  PHE B CD1   1 
ATOM   9151  C  CD2   . PHE B 2  171  ? 130.115 200.903 129.781 1.00 40.62  ?  171  PHE B CD2   1 
ATOM   9152  C  CE1   . PHE B 2  171  ? 130.807 201.543 127.218 1.00 40.62  ?  171  PHE B CE1   1 
ATOM   9153  C  CE2   . PHE B 2  171  ? 129.717 202.097 129.238 1.00 40.62  ?  171  PHE B CE2   1 
ATOM   9154  C  CZ    . PHE B 2  171  ? 130.065 202.412 127.956 1.00 40.62  ?  171  PHE B CZ    1 
ATOM   9155  N  N     . LEU B 2  172  ? 129.896 197.327 126.886 1.00 37.94  ?  172  LEU B N     1 
ATOM   9156  C  CA    . LEU B 2  172  ? 130.040 196.904 125.498 1.00 37.94  ?  172  LEU B CA    1 
ATOM   9157  C  C     . LEU B 2  172  ? 130.369 198.122 124.651 1.00 37.94  ?  172  LEU B C     1 
ATOM   9158  O  O     . LEU B 2  172  ? 129.621 199.102 124.654 1.00 37.94  ?  172  LEU B O     1 
ATOM   9159  C  CB    . LEU B 2  172  ? 128.770 196.231 124.993 1.00 37.94  ?  172  LEU B CB    1 
ATOM   9160  C  CG    . LEU B 2  172  ? 128.835 195.745 123.546 1.00 37.94  ?  172  LEU B CG    1 
ATOM   9161  C  CD1   . LEU B 2  172  ? 129.393 194.335 123.460 1.00 37.94  ?  172  LEU B CD1   1 
ATOM   9162  C  CD2   . LEU B 2  172  ? 127.473 195.849 122.887 1.00 37.94  ?  172  LEU B CD2   1 
ATOM   9163  N  N     . VAL B 2  173  ? 131.477 198.052 123.923 1.00 35.85  ?  173  VAL B N     1 
ATOM   9164  C  CA    . VAL B 2  173  ? 132.059 199.204 123.251 1.00 35.85  ?  173  VAL B CA    1 
ATOM   9165  C  C     . VAL B 2  173  ? 131.810 199.075 121.754 1.00 35.85  ?  173  VAL B C     1 
ATOM   9166  O  O     . VAL B 2  173  ? 132.075 198.023 121.159 1.00 35.85  ?  173  VAL B O     1 
ATOM   9167  C  CB    . VAL B 2  173  ? 133.563 199.310 123.564 1.00 35.85  ?  173  VAL B CB    1 
ATOM   9168  C  CG1   . VAL B 2  173  ? 134.273 200.237 122.604 1.00 35.85  ?  173  VAL B CG1   1 
ATOM   9169  C  CG2   . VAL B 2  173  ? 133.780 199.755 124.996 1.00 35.85  ?  173  VAL B CG2   1 
ATOM   9170  N  N     . GLU B 2  174  ? 131.291 200.137 121.146 1.00 39.40  ?  174  GLU B N     1 
ATOM   9171  C  CA    . GLU B 2  174  ? 131.141 200.201 119.699 1.00 39.40  ?  174  GLU B CA    1 
ATOM   9172  C  C     . GLU B 2  174  ? 132.287 200.946 119.032 1.00 39.40  ?  174  GLU B C     1 
ATOM   9173  O  O     . GLU B 2  174  ? 132.943 200.396 118.143 1.00 39.40  ?  174  GLU B O     1 
ATOM   9174  C  CB    . GLU B 2  174  ? 129.802 200.852 119.353 1.00 39.40  ?  174  GLU B CB    1 
ATOM   9175  C  CG    . GLU B 2  174  ? 128.634 200.029 119.833 1.00 39.40  ?  174  GLU B CG    1 
ATOM   9176  C  CD    . GLU B 2  174  ? 127.410 200.861 120.091 1.00 39.40  ?  174  GLU B CD    1 
ATOM   9177  O  OE1   . GLU B 2  174  ? 127.493 202.087 119.940 1.00 39.40  ?  174  GLU B OE1   1 
ATOM   9178  O  OE2   . GLU B 2  174  ? 126.367 200.285 120.455 1.00 39.40  -1 174  GLU B OE2   1 
ATOM   9179  N  N     . ASP B 2  175  ? 132.554 202.182 119.449 1.00 34.78  ?  175  ASP B N     1 
ATOM   9180  C  CA    . ASP B 2  175  ? 133.708 202.911 118.952 1.00 34.78  ?  175  ASP B CA    1 
ATOM   9181  C  C     . ASP B 2  175  ? 134.166 203.930 119.989 1.00 34.78  ?  175  ASP B C     1 
ATOM   9182  O  O     . ASP B 2  175  ? 133.421 204.313 120.895 1.00 34.78  ?  175  ASP B O     1 
ATOM   9183  C  CB    . ASP B 2  175  ? 133.401 203.596 117.625 1.00 34.78  ?  175  ASP B CB    1 
ATOM   9184  C  CG    . ASP B 2  175  ? 132.213 204.502 117.717 1.00 34.78  ?  175  ASP B CG    1 
ATOM   9185  O  OD1   . ASP B 2  175  ? 131.346 204.252 118.575 1.00 34.78  ?  175  ASP B OD1   1 
ATOM   9186  O  OD2   . ASP B 2  175  ? 132.152 205.469 116.936 1.00 34.78  -1 175  ASP B OD2   1 
ATOM   9187  N  N     . TYR B 2  176  ? 135.406 204.388 119.808 1.00 25.60  ?  176  TYR B N     1 
ATOM   9188  C  CA    . TYR B 2  176  ? 136.146 205.158 120.795 1.00 25.60  ?  176  TYR B CA    1 
ATOM   9189  C  C     . TYR B 2  176  ? 137.059 206.139 120.082 1.00 25.60  ?  176  TYR B C     1 
ATOM   9190  O  O     . TYR B 2  176  ? 137.518 205.872 118.975 1.00 25.60  ?  176  TYR B O     1 
ATOM   9191  C  CB    . TYR B 2  176  ? 136.978 204.244 121.688 1.00 25.60  ?  176  TYR B CB    1 
ATOM   9192  C  CG    . TYR B 2  176  ? 137.931 203.336 120.953 1.00 25.60  ?  176  TYR B CG    1 
ATOM   9193  C  CD1   . TYR B 2  176  ? 137.528 202.085 120.521 1.00 25.60  ?  176  TYR B CD1   1 
ATOM   9194  C  CD2   . TYR B 2  176  ? 139.249 203.710 120.726 1.00 25.60  ?  176  TYR B CD2   1 
ATOM   9195  C  CE1   . TYR B 2  176  ? 138.398 201.238 119.859 1.00 25.60  ?  176  TYR B CE1   1 
ATOM   9196  C  CE2   . TYR B 2  176  ? 140.123 202.878 120.064 1.00 25.60  ?  176  TYR B CE2   1 
ATOM   9197  C  CZ    . TYR B 2  176  ? 139.693 201.642 119.638 1.00 25.60  ?  176  TYR B CZ    1 
ATOM   9198  O  OH    . TYR B 2  176  ? 140.564 200.809 118.980 1.00 25.60  ?  176  TYR B OH    1 
ATOM   9199  N  N     . CYS B 2  177  ? 137.349 207.259 120.736 1.00 22.57  ?  177  CYS B N     1 
ATOM   9200  C  CA    . CYS B 2  177  ? 138.178 208.280 120.113 1.00 22.57  ?  177  CYS B CA    1 
ATOM   9201  C  C     . CYS B 2  177  ? 139.183 208.861 121.105 1.00 22.57  ?  177  CYS B C     1 
ATOM   9202  O  O     . CYS B 2  177  ? 138.892 209.041 122.296 1.00 22.57  ?  177  CYS B O     1 
ATOM   9203  C  CB    . CYS B 2  177  ? 137.313 209.389 119.485 1.00 22.57  ?  177  CYS B CB    1 
ATOM   9204  S  SG    . CYS B 2  177  ? 136.640 210.653 120.570 1.00 22.57  ?  177  CYS B SG    1 
ATOM   9205  N  N     . PHE B 2  178  ? 140.339 209.217 120.539 1.00 22.95  ?  178  PHE B N     1 
ATOM   9206  C  CA    . PHE B 2  178  ? 141.480 209.852 121.208 1.00 22.95  ?  178  PHE B CA    1 
ATOM   9207  C  C     . PHE B 2  178  ? 141.424 211.385 121.114 1.00 22.95  ?  178  PHE B C     1 
ATOM   9208  O  O     . PHE B 2  178  ? 140.635 211.937 120.353 1.00 22.95  ?  178  PHE B O     1 
ATOM   9209  C  CB    . PHE B 2  178  ? 142.793 209.352 120.610 1.00 22.95  ?  178  PHE B CB    1 
ATOM   9210  C  CG    . PHE B 2  178  ? 143.046 207.891 120.833 1.00 22.95  ?  178  PHE B CG    1 
ATOM   9211  C  CD1   . PHE B 2  178  ? 142.889 207.332 122.089 1.00 22.95  ?  178  PHE B CD1   1 
ATOM   9212  C  CD2   . PHE B 2  178  ? 143.442 207.076 119.788 1.00 22.95  ?  178  PHE B CD2   1 
ATOM   9213  C  CE1   . PHE B 2  178  ? 143.123 205.988 122.298 1.00 22.95  ?  178  PHE B CE1   1 
ATOM   9214  C  CE2   . PHE B 2  178  ? 143.677 205.731 119.990 1.00 22.95  ?  178  PHE B CE2   1 
ATOM   9215  C  CZ    . PHE B 2  178  ? 143.517 205.185 121.247 1.00 22.95  ?  178  PHE B CZ    1 
ATOM   9216  N  N     . ALA B 2  179  ? 142.264 212.059 121.898 1.00 17.84  ?  179  ALA B N     1 
ATOM   9217  C  CA    . ALA B 2  179  ? 142.332 213.530 121.957 1.00 17.84  ?  179  ALA B CA    1 
ATOM   9218  C  C     . ALA B 2  179  ? 142.754 214.322 120.698 1.00 17.84  ?  179  ALA B C     1 
ATOM   9219  O  O     . ALA B 2  179  ? 142.231 215.420 120.480 1.00 17.84  ?  179  ALA B O     1 
ATOM   9220  C  CB    . ALA B 2  179  ? 143.177 213.963 123.148 1.00 17.84  ?  179  ALA B CB    1 
ATOM   9221  N  N     . ASP B 2  180  ? 143.746 213.801 119.963 1.00 24.16  ?  180  ASP B N     1 
ATOM   9222  C  CA    . ASP B 2  180  ? 144.326 214.361 118.705 1.00 24.16  ?  180  ASP B CA    1 
ATOM   9223  C  C     . ASP B 2  180  ? 145.338 215.532 118.816 1.00 24.16  ?  180  ASP B C     1 
ATOM   9224  O  O     . ASP B 2  180  ? 145.702 215.951 119.913 1.00 24.16  ?  180  ASP B O     1 
ATOM   9225  C  CB    . ASP B 2  180  ? 143.293 214.587 117.581 1.00 24.16  ?  180  ASP B CB    1 
ATOM   9226  C  CG    . ASP B 2  180  ? 143.709 213.950 116.271 1.00 24.16  ?  180  ASP B CG    1 
ATOM   9227  O  OD1   . ASP B 2  180  ? 143.781 212.705 116.209 1.00 24.16  ?  180  ASP B OD1   1 
ATOM   9228  O  OD2   . ASP B 2  180  ? 143.960 214.694 115.300 1.00 24.16  -1 180  ASP B OD2   1 
ATOM   9229  N  N     . LEU B 2  181  ? 145.764 216.050 117.662 1.00 23.26  ?  181  LEU B N     1 
ATOM   9230  C  CA    . LEU B 2  181  ? 146.757 217.117 117.564 1.00 23.26  ?  181  LEU B CA    1 
ATOM   9231  C  C     . LEU B 2  181  ? 146.238 218.462 118.081 1.00 23.26  ?  181  LEU B C     1 
ATOM   9232  O  O     . LEU B 2  181  ? 145.051 218.775 118.010 1.00 23.26  ?  181  LEU B O     1 
ATOM   9233  C  CB    . LEU B 2  181  ? 147.212 217.295 116.117 1.00 23.26  ?  181  LEU B CB    1 
ATOM   9234  C  CG    . LEU B 2  181  ? 147.824 216.149 115.325 1.00 23.26  ?  181  LEU B CG    1 
ATOM   9235  C  CD1   . LEU B 2  181  ? 148.530 216.704 114.125 1.00 23.26  ?  181  LEU B CD1   1 
ATOM   9236  C  CD2   . LEU B 2  181  ? 148.782 215.377 116.155 1.00 23.26  ?  181  LEU B CD2   1 
ATOM   9237  N  N     . ALA B 2  182  ? 147.161 219.248 118.602 1.00 28.90  ?  182  ALA B N     1 
ATOM   9238  C  CA    . ALA B 2  182  ? 146.923 220.578 119.140 1.00 28.90  ?  182  ALA B CA    1 
ATOM   9239  C  C     . ALA B 2  182  ? 147.123 221.611 118.043 1.00 28.90  ?  182  ALA B C     1 
ATOM   9240  O  O     . ALA B 2  182  ? 147.612 221.277 116.965 1.00 28.90  ?  182  ALA B O     1 
ATOM   9241  C  CB    . ALA B 2  182  ? 147.874 220.802 120.315 1.00 28.90  ?  182  ALA B CB    1 
ATOM   9242  N  N     . PRO B 2  183  ? 146.714 222.870 118.247 1.00 31.53  ?  183  PRO B N     1 
ATOM   9243  C  CA    . PRO B 2  183  ? 146.941 223.890 117.212 1.00 31.53  ?  183  PRO B CA    1 
ATOM   9244  C  C     . PRO B 2  183  ? 148.411 224.193 116.954 1.00 31.53  ?  183  PRO B C     1 
ATOM   9245  O  O     . PRO B 2  183  ? 149.288 223.913 117.769 1.00 31.53  ?  183  PRO B O     1 
ATOM   9246  C  CB    . PRO B 2  183  ? 146.216 225.127 117.761 1.00 31.53  ?  183  PRO B CB    1 
ATOM   9247  C  CG    . PRO B 2  183  ? 145.837 224.786 119.170 1.00 31.53  ?  183  PRO B CG    1 
ATOM   9248  C  CD    . PRO B 2  183  ? 145.661 223.320 119.172 1.00 31.53  ?  183  PRO B CD    1 
ATOM   9249  N  N     . GLN B 2  184  ? 148.664 224.781 115.782 1.00 37.27  ?  184  GLN B N     1 
ATOM   9250  C  CA    . GLN B 2  184  ? 150.014 225.006 115.271 1.00 37.27  ?  184  GLN B CA    1 
ATOM   9251  C  C     . GLN B 2  184  ? 150.020 226.280 114.452 1.00 37.27  ?  184  GLN B C     1 
ATOM   9252  O  O     . GLN B 2  184  ? 149.355 226.345 113.416 1.00 37.27  ?  184  GLN B O     1 
ATOM   9253  C  CB    . GLN B 2  184  ? 150.468 223.838 114.410 1.00 37.27  ?  184  GLN B CB    1 
ATOM   9254  C  CG    . GLN B 2  184  ? 151.826 223.981 113.768 1.00 37.27  ?  184  GLN B CG    1 
ATOM   9255  C  CD    . GLN B 2  184  ? 152.175 222.768 112.921 1.00 37.27  ?  184  GLN B CD    1 
ATOM   9256  O  OE1   . GLN B 2  184  ? 151.871 221.641 113.284 1.00 37.27  ?  184  GLN B OE1   1 
ATOM   9257  N  NE2   . GLN B 2  184  ? 152.800 222.998 111.784 1.00 37.27  ?  184  GLN B NE2   1 
ATOM   9258  N  N     . LYS B 2  185  ? 150.761 227.273 114.906 1.00 48.71  ?  185  LYS B N     1 
ATOM   9259  C  CA    . LYS B 2  185  ? 150.924 228.507 114.158 1.00 48.71  ?  185  LYS B CA    1 
ATOM   9260  C  C     . LYS B 2  185  ? 151.966 228.313 113.058 1.00 48.71  ?  185  LYS B C     1 
ATOM   9261  O  O     . LYS B 2  185  ? 152.873 227.491 113.195 1.00 48.71  ?  185  LYS B O     1 
ATOM   9262  C  CB    . LYS B 2  185  ? 151.345 229.636 115.091 1.00 48.71  ?  185  LYS B CB    1 
ATOM   9263  C  CG    . LYS B 2  185  ? 150.419 229.821 116.280 1.00 48.71  ?  185  LYS B CG    1 
ATOM   9264  C  CD    . LYS B 2  185  ? 150.934 230.872 117.236 1.00 48.71  ?  185  LYS B CD    1 
ATOM   9265  C  CE    . LYS B 2  185  ? 152.399 230.646 117.587 1.00 48.71  ?  185  LYS B CE    1 
ATOM   9266  N  NZ    . LYS B 2  185  ? 152.987 231.754 118.385 1.00 48.71  1  185  LYS B NZ    1 
ATOM   9267  N  N     . PRO B 2  186  ? 151.849 229.030 111.945 1.00 61.12  ?  186  PRO B N     1 
ATOM   9268  C  CA    . PRO B 2  186  ? 152.801 228.828 110.850 1.00 61.12  ?  186  PRO B CA    1 
ATOM   9269  C  C     . PRO B 2  186  ? 154.097 229.585 111.079 1.00 61.12  ?  186  PRO B C     1 
ATOM   9270  O  O     . PRO B 2  186  ? 154.136 230.625 111.740 1.00 61.12  ?  186  PRO B O     1 
ATOM   9271  C  CB    . PRO B 2  186  ? 152.052 229.370 109.626 1.00 61.12  ?  186  PRO B CB    1 
ATOM   9272  C  CG    . PRO B 2  186  ? 150.628 229.561 110.077 1.00 61.12  ?  186  PRO B CG    1 
ATOM   9273  C  CD    . PRO B 2  186  ? 150.735 229.889 111.522 1.00 61.12  ?  186  PRO B CD    1 
ATOM   9274  N  N     . ALA B 2  187  ? 155.168 229.042 110.518 1.00 72.32  ?  187  ALA B N     1 
ATOM   9275  C  CA    . ALA B 2  187  ? 156.545 229.508 110.598 1.00 72.32  ?  187  ALA B CA    1 
ATOM   9276  C  C     . ALA B 2  187  ? 156.864 230.443 109.436 1.00 72.32  ?  187  ALA B C     1 
ATOM   9277  O  O     . ALA B 2  187  ? 156.292 230.310 108.351 1.00 72.32  ?  187  ALA B O     1 
ATOM   9278  C  CB    . ALA B 2  187  ? 157.508 228.323 110.573 1.00 72.32  ?  187  ALA B CB    1 
ATOM   9279  N  N     . PRO B 2  188  ? 157.768 231.407 109.634 1.00 75.30  ?  188  PRO B N     1 
ATOM   9280  C  CA    . PRO B 2  188  ? 158.190 232.241 108.510 1.00 75.30  ?  188  PRO B CA    1 
ATOM   9281  C  C     . PRO B 2  188  ? 159.103 231.472 107.579 1.00 75.30  ?  188  PRO B C     1 
ATOM   9282  O  O     . PRO B 2  188  ? 159.871 230.595 108.018 1.00 75.30  ?  188  PRO B O     1 
ATOM   9283  C  CB    . PRO B 2  188  ? 158.932 233.404 109.193 1.00 75.30  ?  188  PRO B CB    1 
ATOM   9284  C  CG    . PRO B 2  188  ? 159.377 232.853 110.493 1.00 75.30  ?  188  PRO B CG    1 
ATOM   9285  C  CD    . PRO B 2  188  ? 158.303 231.901 110.915 1.00 75.30  ?  188  PRO B CD    1 
ATOM   9286  N  N     . PRO B 2  189  ? 159.058 231.752 106.277 1.00 73.38  ?  189  PRO B N     1 
ATOM   9287  C  CA    . PRO B 2  189  ? 159.979 231.095 105.345 1.00 73.38  ?  189  PRO B CA    1 
ATOM   9288  C  C     . PRO B 2  189  ? 161.360 231.728 105.377 1.00 73.38  ?  189  PRO B C     1 
ATOM   9289  O  O     . PRO B 2  189  ? 161.538 232.882 105.776 1.00 73.38  ?  189  PRO B O     1 
ATOM   9290  C  CB    . PRO B 2  189  ? 159.311 231.304 103.984 1.00 73.38  ?  189  PRO B CB    1 
ATOM   9291  C  CG    . PRO B 2  189  ? 158.569 232.577 104.146 1.00 73.38  ?  189  PRO B CG    1 
ATOM   9292  C  CD    . PRO B 2  189  ? 158.108 232.635 105.578 1.00 73.38  ?  189  PRO B CD    1 
ATOM   9293  N  N     . LEU B 2  190  ? 162.348 230.945 104.950 1.00 66.02  ?  190  LEU B N     1 
ATOM   9294  C  CA    . LEU B 2  190  ? 163.750 231.318 105.058 1.00 66.02  ?  190  LEU B CA    1 
ATOM   9295  C  C     . LEU B 2  190  ? 164.295 231.707 103.689 1.00 66.02  ?  190  LEU B C     1 
ATOM   9296  O  O     . LEU B 2  190  ? 163.688 231.395 102.661 1.00 66.02  ?  190  LEU B O     1 
ATOM   9297  C  CB    . LEU B 2  190  ? 164.570 230.190 105.678 1.00 66.02  ?  190  LEU B CB    1 
ATOM   9298  C  CG    . LEU B 2  190  ? 164.206 229.928 107.145 1.00 66.02  ?  190  LEU B CG    1 
ATOM   9299  C  CD1   . LEU B 2  190  ? 165.163 228.962 107.795 1.00 66.02  ?  190  LEU B CD1   1 
ATOM   9300  C  CD2   . LEU B 2  190  ? 164.163 231.239 107.950 1.00 66.02  ?  190  LEU B CD2   1 
ATOM   9301  N  N     . ASP B 2  191  ? 165.393 232.464 103.687 1.00 70.56  ?  191  ASP B N     1 
ATOM   9302  C  CA    . ASP B 2  191  ? 166.004 232.941 102.446 1.00 70.56  ?  191  ASP B CA    1 
ATOM   9303  C  C     . ASP B 2  191  ? 167.066 231.977 101.912 1.00 70.56  ?  191  ASP B C     1 
ATOM   9304  O  O     . ASP B 2  191  ? 166.960 231.487 100.787 1.00 70.56  ?  191  ASP B O     1 
ATOM   9305  C  CB    . ASP B 2  191  ? 166.568 234.351 102.660 1.00 70.56  ?  191  ASP B CB    1 
ATOM   9306  C  CG    . ASP B 2  191  ? 167.373 234.487 103.944 1.00 70.56  ?  191  ASP B CG    1 
ATOM   9307  O  OD1   . ASP B 2  191  ? 167.613 233.469 104.622 1.00 70.56  ?  191  ASP B OD1   1 
ATOM   9308  O  OD2   . ASP B 2  191  ? 167.801 235.609 104.262 1.00 70.56  -1 191  ASP B OD2   1 
ATOM   9309  N  N     . THR B 2  192  ? 168.103 231.712 102.697 1.00 67.35  ?  192  THR B N     1 
ATOM   9310  C  CA    . THR B 2  192  ? 169.139 230.752 102.342 1.00 67.35  ?  192  THR B CA    1 
ATOM   9311  C  C     . THR B 2  192  ? 169.053 229.562 103.285 1.00 67.35  ?  192  THR B C     1 
ATOM   9312  O  O     . THR B 2  192  ? 168.843 229.737 104.486 1.00 67.35  ?  192  THR B O     1 
ATOM   9313  C  CB    . THR B 2  192  ? 170.530 231.384 102.396 1.00 67.35  ?  192  THR B CB    1 
ATOM   9314  O  OG1   . THR B 2  192  ? 170.483 232.690 101.808 1.00 67.35  ?  192  THR B OG1   1 
ATOM   9315  C  CG2   . THR B 2  192  ? 171.548 230.539 101.631 1.00 67.35  ?  192  THR B CG2   1 
ATOM   9316  N  N     . ASP B 2  193  ? 169.220 228.364 102.737 1.00 53.44  ?  193  ASP B N     1 
ATOM   9317  C  CA    . ASP B 2  193  ? 169.004 227.145 103.504 1.00 53.44  ?  193  ASP B CA    1 
ATOM   9318  C  C     . ASP B 2  193  ? 170.092 226.943 104.560 1.00 53.44  ?  193  ASP B C     1 
ATOM   9319  O  O     . ASP B 2  193  ? 171.287 226.979 104.254 1.00 53.44  ?  193  ASP B O     1 
ATOM   9320  C  CB    . ASP B 2  193  ? 168.923 225.947 102.561 1.00 53.44  ?  193  ASP B CB    1 
ATOM   9321  C  CG    . ASP B 2  193  ? 170.066 225.897 101.573 1.00 53.44  ?  193  ASP B CG    1 
ATOM   9322  O  OD1   . ASP B 2  193  ? 170.763 226.916 101.418 1.00 53.44  ?  193  ASP B OD1   1 
ATOM   9323  O  OD2   . ASP B 2  193  ? 170.293 224.826 100.978 1.00 53.44  -1 193  ASP B OD2   1 
ATOM   9324  N  N     . ARG B 2  194  ? 169.669 226.764 105.809 1.00 38.91  ?  194  ARG B N     1 
ATOM   9325  C  CA    . ARG B 2  194  ? 170.536 226.377 106.910 1.00 38.91  ?  194  ARG B CA    1 
ATOM   9326  C  C     . ARG B 2  194  ? 170.222 224.950 107.328 1.00 38.91  ?  194  ARG B C     1 
ATOM   9327  O  O     . ARG B 2  194  ? 169.070 224.521 107.301 1.00 38.91  ?  194  ARG B O     1 
ATOM   9328  C  CB    . ARG B 2  194  ? 170.351 227.317 108.099 1.00 38.91  ?  194  ARG B CB    1 
ATOM   9329  C  CG    . ARG B 2  194  ? 169.934 228.706 107.696 1.00 38.91  ?  194  ARG B CG    1 
ATOM   9330  C  CD    . ARG B 2  194  ? 170.342 229.737 108.724 1.00 38.91  ?  194  ARG B CD    1 
ATOM   9331  N  NE    . ARG B 2  194  ? 169.659 230.999 108.479 1.00 38.91  ?  194  ARG B NE    1 
ATOM   9332  C  CZ    . ARG B 2  194  ? 169.890 232.125 109.144 1.00 38.91  ?  194  ARG B CZ    1 
ATOM   9333  N  NH1   . ARG B 2  194  ? 170.794 232.153 110.110 1.00 38.91  1  194  ARG B NH1   1 
ATOM   9334  N  NH2   . ARG B 2  194  ? 169.211 233.221 108.842 1.00 38.91  ?  194  ARG B NH2   1 
ATOM   9335  N  N     . PHE B 2  195  ? 171.248 224.214 107.716 1.00 31.61  ?  195  PHE B N     1 
ATOM   9336  C  CA    . PHE B 2  195  ? 171.103 222.817 108.078 1.00 31.61  ?  195  PHE B CA    1 
ATOM   9337  C  C     . PHE B 2  195  ? 171.313 222.636 109.573 1.00 31.61  ?  195  PHE B C     1 
ATOM   9338  O  O     . PHE B 2  195  ? 171.885 223.494 110.246 1.00 31.61  ?  195  PHE B O     1 
ATOM   9339  C  CB    . PHE B 2  195  ? 172.094 221.945 107.319 1.00 31.61  ?  195  PHE B CB    1 
ATOM   9340  C  CG    . PHE B 2  195  ? 171.798 221.812 105.856 1.00 31.61  ?  195  PHE B CG    1 
ATOM   9341  C  CD1   . PHE B 2  195  ? 172.198 222.789 104.959 1.00 31.61  ?  195  PHE B CD1   1 
ATOM   9342  C  CD2   . PHE B 2  195  ? 171.142 220.691 105.371 1.00 31.61  ?  195  PHE B CD2   1 
ATOM   9343  C  CE1   . PHE B 2  195  ? 171.935 222.655 103.619 1.00 31.61  ?  195  PHE B CE1   1 
ATOM   9344  C  CE2   . PHE B 2  195  ? 170.875 220.557 104.026 1.00 31.61  ?  195  PHE B CE2   1 
ATOM   9345  C  CZ    . PHE B 2  195  ? 171.272 221.537 103.153 1.00 31.61  ?  195  PHE B CZ    1 
ATOM   9346  N  N     . VAL B 2  196  ? 170.845 221.497 110.080 1.00 27.86  ?  196  VAL B N     1 
ATOM   9347  C  CA    . VAL B 2  196  ? 171.010 221.111 111.479 1.00 27.86  ?  196  VAL B CA    1 
ATOM   9348  C  C     . VAL B 2  196  ? 171.361 219.630 111.513 1.00 27.86  ?  196  VAL B C     1 
ATOM   9349  O  O     . VAL B 2  196  ? 170.707 218.819 110.854 1.00 27.86  ?  196  VAL B O     1 
ATOM   9350  C  CB    . VAL B 2  196  ? 169.737 221.414 112.307 1.00 27.86  ?  196  VAL B CB    1 
ATOM   9351  C  CG1   . VAL B 2  196  ? 169.655 220.560 113.555 1.00 27.86  ?  196  VAL B CG1   1 
ATOM   9352  C  CG2   . VAL B 2  196  ? 169.669 222.887 112.699 1.00 27.86  ?  196  VAL B CG2   1 
ATOM   9353  N  N     . LEU B 2  197  ? 172.400 219.276 112.265 1.00 29.09  ?  197  LEU B N     1 
ATOM   9354  C  CA    . LEU B 2  197  ? 172.868 217.899 112.365 1.00 29.09  ?  197  LEU B CA    1 
ATOM   9355  C  C     . LEU B 2  197  ? 172.397 217.261 113.668 1.00 29.09  ?  197  LEU B C     1 
ATOM   9356  O  O     . LEU B 2  197  ? 172.452 217.886 114.730 1.00 29.09  ?  197  LEU B O     1 
ATOM   9357  C  CB    . LEU B 2  197  ? 174.395 217.844 112.276 1.00 29.09  ?  197  LEU B CB    1 
ATOM   9358  C  CG    . LEU B 2  197  ? 175.020 216.449 112.250 1.00 29.09  ?  197  LEU B CG    1 
ATOM   9359  C  CD1   . LEU B 2  197  ? 175.059 215.914 110.845 1.00 29.09  ?  197  LEU B CD1   1 
ATOM   9360  C  CD2   . LEU B 2  197  ? 176.411 216.473 112.846 1.00 29.09  ?  197  LEU B CD2   1 
ATOM   9361  N  N     . LEU B 2  198  ? 171.939 216.009 113.583 1.00 22.65  ?  198  LEU B N     1 
ATOM   9362  C  CA    . LEU B 2  198  ? 171.445 215.259 114.730 1.00 22.65  ?  198  LEU B CA    1 
ATOM   9363  C  C     . LEU B 2  198  ? 172.187 213.937 114.829 1.00 22.65  ?  198  LEU B C     1 
ATOM   9364  O  O     . LEU B 2  198  ? 172.244 213.182 113.853 1.00 22.65  ?  198  LEU B O     1 
ATOM   9365  C  CB    . LEU B 2  198  ? 169.944 215.001 114.622 1.00 22.65  ?  198  LEU B CB    1 
ATOM   9366  C  CG    . LEU B 2  198  ? 168.977 216.119 114.988 1.00 22.65  ?  198  LEU B CG    1 
ATOM   9367  C  CD1   . LEU B 2  198  ? 167.763 216.036 114.101 1.00 22.65  ?  198  LEU B CD1   1 
ATOM   9368  C  CD2   . LEU B 2  198  ? 168.562 216.005 116.433 1.00 22.65  ?  198  LEU B CD2   1 
ATOM   9369  N  N     . VAL B 2  199  ? 172.772 213.683 116.003 1.00 25.22  ?  199  VAL B N     1 
ATOM   9370  C  CA    . VAL B 2  199  ? 173.546 212.486 116.314 1.00 25.22  ?  199  VAL B CA    1 
ATOM   9371  C  C     . VAL B 2  199  ? 173.017 211.960 117.641 1.00 25.22  ?  199  VAL B C     1 
ATOM   9372  O  O     . VAL B 2  199  ? 172.505 212.722 118.466 1.00 25.22  ?  199  VAL B O     1 
ATOM   9373  C  CB    . VAL B 2  199  ? 175.080 212.769 116.432 1.00 25.22  ?  199  VAL B CB    1 
ATOM   9374  C  CG1   . VAL B 2  199  ? 175.908 211.500 116.329 1.00 25.22  ?  199  VAL B CG1   1 
ATOM   9375  C  CG2   . VAL B 2  199  ? 175.566 213.815 115.455 1.00 25.22  ?  199  VAL B CG2   1 
ATOM   9376  N  N     . SER B 2  200  ? 173.151 210.659 117.863 1.00 40.62  ?  200  SER B N     1 
ATOM   9377  C  CA    . SER B 2  200  ? 172.829 210.090 119.159 1.00 40.62  ?  200  SER B CA    1 
ATOM   9378  C  C     . SER B 2  200  ? 173.675 208.854 119.400 1.00 40.62  ?  200  SER B C     1 
ATOM   9379  O  O     . SER B 2  200  ? 173.994 208.117 118.471 1.00 40.62  ?  200  SER B O     1 
ATOM   9380  C  CB    . SER B 2  200  ? 171.354 209.719 119.254 1.00 40.62  ?  200  SER B CB    1 
ATOM   9381  O  OG    . SER B 2  200  ? 170.537 210.869 119.215 1.00 40.62  ?  200  SER B OG    1 
ATOM   9382  N  N     . GLY B 2  201  ? 174.026 208.641 120.662 1.00 29.99  ?  201  GLY B N     1 
ATOM   9383  C  CA    . GLY B 2  201  ? 174.596 207.385 121.102 1.00 29.99  ?  201  GLY B CA    1 
ATOM   9384  C  C     . GLY B 2  201  ? 175.983 207.045 120.599 1.00 29.99  ?  201  GLY B C     1 
ATOM   9385  O  O     . GLY B 2  201  ? 176.156 206.026 119.924 1.00 29.99  ?  201  GLY B O     1 
ATOM   9386  N  N     . LEU B 2  202  ? 176.977 207.874 120.933 1.00 30.27  ?  202  LEU B N     1 
ATOM   9387  C  CA    . LEU B 2  202  ? 178.350 207.613 120.511 1.00 30.27  ?  202  LEU B CA    1 
ATOM   9388  C  C     . LEU B 2  202  ? 178.914 206.369 121.177 1.00 30.27  ?  202  LEU B C     1 
ATOM   9389  O  O     . LEU B 2  202  ? 179.660 205.609 120.554 1.00 30.27  ?  202  LEU B O     1 
ATOM   9390  C  CB    . LEU B 2  202  ? 179.226 208.818 120.825 1.00 30.27  ?  202  LEU B CB    1 
ATOM   9391  C  CG    . LEU B 2  202  ? 178.784 210.107 120.150 1.00 30.27  ?  202  LEU B CG    1 
ATOM   9392  C  CD1   . LEU B 2  202  ? 179.183 211.310 120.974 1.00 30.27  ?  202  LEU B CD1   1 
ATOM   9393  C  CD2   . LEU B 2  202  ? 179.382 210.178 118.767 1.00 30.27  ?  202  LEU B CD2   1 
ATOM   9394  N  N     . GLY B 2  203  ? 178.573 206.144 122.437 1.00 39.52  ?  203  GLY B N     1 
ATOM   9395  C  CA    . GLY B 2  203  ? 178.983 204.936 123.116 1.00 39.52  ?  203  GLY B CA    1 
ATOM   9396  C  C     . GLY B 2  203  ? 180.441 204.918 123.513 1.00 39.52  ?  203  GLY B C     1 
ATOM   9397  O  O     . GLY B 2  203  ? 181.129 203.915 123.315 1.00 39.52  ?  203  GLY B O     1 
ATOM   9398  N  N     . LEU B 2  204  ? 180.924 206.022 124.077 1.00 42.62  ?  204  LEU B N     1 
ATOM   9399  C  CA    . LEU B 2  204  ? 182.319 206.130 124.486 1.00 42.62  ?  204  LEU B CA    1 
ATOM   9400  C  C     . LEU B 2  204  ? 182.531 205.358 125.780 1.00 42.62  ?  204  LEU B C     1 
ATOM   9401  O  O     . LEU B 2  204  ? 182.004 205.738 126.830 1.00 42.62  ?  204  LEU B O     1 
ATOM   9402  C  CB    . LEU B 2  204  ? 182.707 207.594 124.659 1.00 42.62  ?  204  LEU B CB    1 
ATOM   9403  C  CG    . LEU B 2  204  ? 182.495 208.463 123.420 1.00 42.62  ?  204  LEU B CG    1 
ATOM   9404  C  CD1   . LEU B 2  204  ? 182.286 209.917 123.806 1.00 42.62  ?  204  LEU B CD1   1 
ATOM   9405  C  CD2   . LEU B 2  204  ? 183.656 208.317 122.451 1.00 42.62  ?  204  LEU B CD2   1 
ATOM   9406  N  N     . GLY B 2  205  ? 183.310 204.285 125.705 1.00 50.53  ?  205  GLY B N     1 
ATOM   9407  C  CA    . GLY B 2  205  ? 183.506 203.397 126.830 1.00 50.53  ?  205  GLY B CA    1 
ATOM   9408  C  C     . GLY B 2  205  ? 183.540 201.954 126.381 1.00 50.53  ?  205  GLY B C     1 
ATOM   9409  O  O     . GLY B 2  205  ? 184.032 201.078 127.098 1.00 50.53  ?  205  GLY B O     1 
ATOM   9410  N  N     . GLY B 2  206  ? 183.016 201.702 125.185 1.00 66.68  ?  206  GLY B N     1 
ATOM   9411  C  CA    . GLY B 2  206  ? 183.014 200.377 124.595 1.00 66.68  ?  206  GLY B CA    1 
ATOM   9412  C  C     . GLY B 2  206  ? 182.126 200.309 123.370 1.00 66.68  ?  206  GLY B C     1 
ATOM   9413  O  O     . GLY B 2  206  ? 181.090 200.979 123.321 1.00 66.68  ?  206  GLY B O     1 
ATOM   9414  N  N     . GLY B 2  207  ? 182.497 199.499 122.378 1.00 80.36  ?  207  GLY B N     1 
ATOM   9415  C  CA    . GLY B 2  207  ? 181.691 199.405 121.175 1.00 80.36  ?  207  GLY B CA    1 
ATOM   9416  C  C     . GLY B 2  207  ? 182.420 199.430 119.843 1.00 80.36  ?  207  GLY B C     1 
ATOM   9417  O  O     . GLY B 2  207  ? 181.777 199.567 118.797 1.00 80.36  ?  207  GLY B O     1 
ATOM   9418  N  N     . GLY B 2  208  ? 183.748 199.312 119.855 1.00 78.89  ?  208  GLY B N     1 
ATOM   9419  C  CA    . GLY B 2  208  ? 184.495 199.081 118.631 1.00 78.89  ?  208  GLY B CA    1 
ATOM   9420  C  C     . GLY B 2  208  ? 185.605 200.088 118.398 1.00 78.89  ?  208  GLY B C     1 
ATOM   9421  O  O     . GLY B 2  208  ? 185.871 200.987 119.202 1.00 78.89  ?  208  GLY B O     1 
ATOM   9422  N  N     . GLY B 2  209  ? 186.273 199.901 117.262 1.00 64.76  ?  209  GLY B N     1 
ATOM   9423  C  CA    . GLY B 2  209  ? 187.322 200.796 116.817 1.00 64.76  ?  209  GLY B CA    1 
ATOM   9424  C  C     . GLY B 2  209  ? 186.955 201.461 115.508 1.00 64.76  ?  209  GLY B C     1 
ATOM   9425  O  O     . GLY B 2  209  ? 187.467 202.532 115.173 1.00 64.76  ?  209  GLY B O     1 
ATOM   9426  N  N     . GLU B 2  210  ? 186.064 200.816 114.753 1.00 58.45  ?  210  GLU B N     1 
ATOM   9427  C  CA    . GLU B 2  210  ? 185.470 201.466 113.592 1.00 58.45  ?  210  GLU B CA    1 
ATOM   9428  C  C     . GLU B 2  210  ? 184.565 202.616 114.014 1.00 58.45  ?  210  GLU B C     1 
ATOM   9429  O  O     . GLU B 2  210  ? 184.385 203.578 113.258 1.00 58.45  ?  210  GLU B O     1 
ATOM   9430  C  CB    . GLU B 2  210  ? 184.685 200.446 112.770 1.00 58.45  ?  210  GLU B CB    1 
ATOM   9431  C  CG    . GLU B 2  210  ? 185.440 199.834 111.594 1.00 58.45  ?  210  GLU B CG    1 
ATOM   9432  C  CD    . GLU B 2  210  ? 185.449 200.719 110.358 1.00 58.45  ?  210  GLU B CD    1 
ATOM   9433  O  OE1   . GLU B 2  210  ? 186.093 200.336 109.365 1.00 58.45  ?  210  GLU B OE1   1 
ATOM   9434  O  OE2   . GLU B 2  210  ? 184.813 201.792 110.376 1.00 58.45  -1 210  GLU B OE2   1 
ATOM   9435  N  N     . SER B 2  211  ? 183.997 202.532 115.219 1.00 51.78  ?  211  SER B N     1 
ATOM   9436  C  CA    . SER B 2  211  ? 183.267 203.656 115.782 1.00 51.78  ?  211  SER B CA    1 
ATOM   9437  C  C     . SER B 2  211  ? 184.199 204.819 116.095 1.00 51.78  ?  211  SER B C     1 
ATOM   9438  O  O     . SER B 2  211  ? 183.793 205.984 116.015 1.00 51.78  ?  211  SER B O     1 
ATOM   9439  C  CB    . SER B 2  211  ? 182.521 203.210 117.035 1.00 51.78  ?  211  SER B CB    1 
ATOM   9440  O  OG    . SER B 2  211  ? 183.349 202.380 117.823 1.00 51.78  ?  211  SER B OG    1 
ATOM   9441  N  N     . LEU B 2  212  ? 185.468 204.523 116.411 1.00 48.86  ?  212  LEU B N     1 
ATOM   9442  C  CA    . LEU B 2  212  ? 186.431 205.585 116.696 1.00 48.86  ?  212  LEU B CA    1 
ATOM   9443  C  C     . LEU B 2  212  ? 186.780 206.373 115.440 1.00 48.86  ?  212  LEU B C     1 
ATOM   9444  O  O     . LEU B 2  212  ? 186.731 207.609 115.444 1.00 48.86  ?  212  LEU B O     1 
ATOM   9445  C  CB    . LEU B 2  212  ? 187.695 205.000 117.314 1.00 48.86  ?  212  LEU B CB    1 
ATOM   9446  C  CG    . LEU B 2  212  ? 187.595 204.287 118.655 1.00 48.86  ?  212  LEU B CG    1 
ATOM   9447  C  CD1   . LEU B 2  212  ? 188.902 203.569 118.941 1.00 48.86  ?  212  LEU B CD1   1 
ATOM   9448  C  CD2   . LEU B 2  212  ? 187.266 205.267 119.764 1.00 48.86  ?  212  LEU B CD2   1 
ATOM   9449  N  N     . LEU B 2  213  ? 187.118 205.677 114.353 1.00 39.81  ?  213  LEU B N     1 
ATOM   9450  C  CA    . LEU B 2  213  ? 187.374 206.355 113.088 1.00 39.81  ?  213  LEU B CA    1 
ATOM   9451  C  C     . LEU B 2  213  ? 186.109 206.988 112.519 1.00 39.81  ?  213  LEU B C     1 
ATOM   9452  O  O     . LEU B 2  213  ? 186.191 208.028 111.861 1.00 39.81  ?  213  LEU B O     1 
ATOM   9453  C  CB    . LEU B 2  213  ? 187.995 205.381 112.088 1.00 39.81  ?  213  LEU B CB    1 
ATOM   9454  C  CG    . LEU B 2  213  ? 188.673 205.958 110.844 1.00 39.81  ?  213  LEU B CG    1 
ATOM   9455  C  CD1   . LEU B 2  213  ? 189.918 206.707 111.207 1.00 39.81  ?  213  LEU B CD1   1 
ATOM   9456  C  CD2   . LEU B 2  213  ? 189.011 204.860 109.879 1.00 39.81  ?  213  LEU B CD2   1 
ATOM   9457  N  N     . GLY B 2  214  ? 184.937 206.409 112.791 1.00 37.49  ?  214  GLY B N     1 
ATOM   9458  C  CA    . GLY B 2  214  ? 183.695 207.053 112.392 1.00 37.49  ?  214  GLY B CA    1 
ATOM   9459  C  C     . GLY B 2  214  ? 183.445 208.360 113.120 1.00 37.49  ?  214  GLY B C     1 
ATOM   9460  O  O     . GLY B 2  214  ? 183.052 209.357 112.503 1.00 37.49  ?  214  GLY B O     1 
ATOM   9461  N  N     . THR B 2  215  ? 183.711 208.387 114.430 1.00 37.20  ?  215  THR B N     1 
ATOM   9462  C  CA    . THR B 2  215  ? 183.556 209.622 115.195 1.00 37.20  ?  215  THR B CA    1 
ATOM   9463  C  C     . THR B 2  215  ? 184.575 210.668 114.759 1.00 37.20  ?  215  THR B C     1 
ATOM   9464  O  O     . THR B 2  215  ? 184.258 211.866 114.672 1.00 37.20  ?  215  THR B O     1 
ATOM   9465  C  CB    . THR B 2  215  ? 183.703 209.332 116.686 1.00 37.20  ?  215  THR B CB    1 
ATOM   9466  O  OG1   . THR B 2  215  ? 183.127 208.057 116.983 1.00 37.20  ?  215  THR B OG1   1 
ATOM   9467  C  CG2   . THR B 2  215  ? 182.989 210.388 117.501 1.00 37.20  ?  215  THR B CG2   1 
ATOM   9468  N  N     . GLN B 2  216  ? 185.796 210.215 114.436 1.00 38.83  ?  216  GLN B N     1 
ATOM   9469  C  CA    . GLN B 2  216  ? 186.843 211.120 113.968 1.00 38.83  ?  216  GLN B CA    1 
ATOM   9470  C  C     . GLN B 2  216  ? 186.498 211.723 112.612 1.00 38.83  ?  216  GLN B C     1 
ATOM   9471  O  O     . GLN B 2  216  ? 186.655 212.934 112.410 1.00 38.83  ?  216  GLN B O     1 
ATOM   9472  C  CB    . GLN B 2  216  ? 188.180 210.385 113.899 1.00 38.83  ?  216  GLN B CB    1 
ATOM   9473  C  CG    . GLN B 2  216  ? 189.338 211.275 113.469 1.00 38.83  ?  216  GLN B CG    1 
ATOM   9474  C  CD    . GLN B 2  216  ? 190.531 210.493 112.969 1.00 38.83  ?  216  GLN B CD    1 
ATOM   9475  O  OE1   . GLN B 2  216  ? 190.642 209.295 113.205 1.00 38.83  ?  216  GLN B OE1   1 
ATOM   9476  N  NE2   . GLN B 2  216  ? 191.427 211.168 112.269 1.00 38.83  ?  216  GLN B NE2   1 
ATOM   9477  N  N     . LEU B 2  217  ? 186.000 210.905 111.680 1.00 34.56  ?  217  LEU B N     1 
ATOM   9478  C  CA    . LEU B 2  217  ? 185.615 211.417 110.370 1.00 34.56  ?  217  LEU B CA    1 
ATOM   9479  C  C     . LEU B 2  217  ? 184.406 212.343 110.456 1.00 34.56  ?  217  LEU B C     1 
ATOM   9480  O  O     . LEU B 2  217  ? 184.345 213.337 109.720 1.00 34.56  ?  217  LEU B O     1 
ATOM   9481  C  CB    . LEU B 2  217  ? 185.350 210.255 109.410 1.00 34.56  ?  217  LEU B CB    1 
ATOM   9482  C  CG    . LEU B 2  217  ? 186.594 209.541 108.862 1.00 34.56  ?  217  LEU B CG    1 
ATOM   9483  C  CD1   . LEU B 2  217  ? 186.226 208.401 107.930 1.00 34.56  ?  217  LEU B CD1   1 
ATOM   9484  C  CD2   . LEU B 2  217  ? 187.515 210.506 108.159 1.00 34.56  ?  217  LEU B CD2   1 
ATOM   9485  N  N     . LEU B 2  218  ? 183.475 212.077 111.381 1.00 36.62  ?  218  LEU B N     1 
ATOM   9486  C  CA    . LEU B 2  218  ? 182.319 212.959 111.556 1.00 36.62  ?  218  LEU B CA    1 
ATOM   9487  C  C     . LEU B 2  218  ? 182.730 214.338 112.075 1.00 36.62  ?  218  LEU B C     1 
ATOM   9488  O  O     . LEU B 2  218  ? 182.316 215.372 111.518 1.00 36.62  ?  218  LEU B O     1 
ATOM   9489  C  CB    . LEU B 2  218  ? 181.305 212.303 112.493 1.00 36.62  ?  218  LEU B CB    1 
ATOM   9490  C  CG    . LEU B 2  218  ? 180.226 213.169 113.152 1.00 36.62  ?  218  LEU B CG    1 
ATOM   9491  C  CD1   . LEU B 2  218  ? 179.225 213.700 112.145 1.00 36.62  ?  218  LEU B CD1   1 
ATOM   9492  C  CD2   . LEU B 2  218  ? 179.512 212.391 114.235 1.00 36.62  ?  218  LEU B CD2   1 
ATOM   9493  N  N     . VAL B 2  219  ? 183.560 214.379 113.127 1.00 37.17  ?  219  VAL B N     1 
ATOM   9494  C  CA    . VAL B 2  219  ? 183.972 215.682 113.658 1.00 37.17  ?  219  VAL B CA    1 
ATOM   9495  C  C     . VAL B 2  219  ? 184.916 216.395 112.682 1.00 37.17  ?  219  VAL B C     1 
ATOM   9496  O  O     . VAL B 2  219  ? 184.900 217.631 112.588 1.00 37.17  ?  219  VAL B O     1 
ATOM   9497  C  CB    . VAL B 2  219  ? 184.579 215.530 115.073 1.00 37.17  ?  219  VAL B CB    1 
ATOM   9498  C  CG1   . VAL B 2  219  ? 185.877 214.732 115.068 1.00 37.17  ?  219  VAL B CG1   1 
ATOM   9499  C  CG2   . VAL B 2  219  ? 184.772 216.888 115.747 1.00 37.17  ?  219  VAL B CG2   1 
ATOM   9500  N  N     . ASP B 2  220  ? 185.679 215.636 111.882 1.00 35.23  ?  220  ASP B N     1 
ATOM   9501  C  CA    . ASP B 2  220  ? 186.572 216.240 110.903 1.00 35.23  ?  220  ASP B CA    1 
ATOM   9502  C  C     . ASP B 2  220  ? 185.798 216.854 109.745 1.00 35.23  ?  220  ASP B C     1 
ATOM   9503  O  O     . ASP B 2  220  ? 186.229 217.862 109.181 1.00 35.23  ?  220  ASP B O     1 
ATOM   9504  C  CB    . ASP B 2  220  ? 187.551 215.186 110.385 1.00 35.23  ?  220  ASP B CB    1 
ATOM   9505  C  CG    . ASP B 2  220  ? 188.970 215.702 110.284 1.00 35.23  ?  220  ASP B CG    1 
ATOM   9506  O  OD1   . ASP B 2  220  ? 189.412 216.398 111.220 1.00 35.23  ?  220  ASP B OD1   1 
ATOM   9507  O  OD2   . ASP B 2  220  ? 189.645 215.415 109.275 1.00 35.23  -1 220  ASP B OD2   1 
ATOM   9508  N  N     . VAL B 2  221  ? 184.651 216.274 109.388 1.00 33.40  ?  221  VAL B N     1 
ATOM   9509  C  CA    . VAL B 2  221  ? 183.827 216.858 108.335 1.00 33.40  ?  221  VAL B CA    1 
ATOM   9510  C  C     . VAL B 2  221  ? 183.131 218.116 108.837 1.00 33.40  ?  221  VAL B C     1 
ATOM   9511  O  O     . VAL B 2  221  ? 183.137 219.153 108.164 1.00 33.40  ?  221  VAL B O     1 
ATOM   9512  C  CB    . VAL B 2  221  ? 182.820 215.820 107.806 1.00 33.40  ?  221  VAL B CB    1 
ATOM   9513  C  CG1   . VAL B 2  221  ? 181.662 216.489 107.079 1.00 33.40  ?  221  VAL B CG1   1 
ATOM   9514  C  CG2   . VAL B 2  221  ? 183.517 214.849 106.878 1.00 33.40  ?  221  VAL B CG2   1 
ATOM   9515  N  N     . VAL B 2  222  ? 182.538 218.059 110.035 1.00 29.35  ?  222  VAL B N     1 
ATOM   9516  C  CA    . VAL B 2  222  ? 181.761 219.211 110.490 1.00 29.35  ?  222  VAL B CA    1 
ATOM   9517  C  C     . VAL B 2  222  ? 182.657 220.376 110.919 1.00 29.35  ?  222  VAL B C     1 
ATOM   9518  O  O     . VAL B 2  222  ? 182.259 221.544 110.797 1.00 29.35  ?  222  VAL B O     1 
ATOM   9519  C  CB    . VAL B 2  222  ? 180.796 218.749 111.603 1.00 29.35  ?  222  VAL B CB    1 
ATOM   9520  C  CG1   . VAL B 2  222  ? 179.911 219.877 112.120 1.00 29.35  ?  222  VAL B CG1   1 
ATOM   9521  C  CG2   . VAL B 2  222  ? 179.926 217.625 111.093 1.00 29.35  ?  222  VAL B CG2   1 
ATOM   9522  N  N     . THR B 2  223  ? 183.890 220.113 111.355 1.00 29.95  ?  223  THR B N     1 
ATOM   9523  C  CA    . THR B 2  223  ? 184.739 221.223 111.785 1.00 29.95  ?  223  THR B CA    1 
ATOM   9524  C  C     . THR B 2  223  ? 185.419 221.936 110.627 1.00 29.95  ?  223  THR B C     1 
ATOM   9525  O  O     . THR B 2  223  ? 185.793 223.102 110.778 1.00 29.95  ?  223  THR B O     1 
ATOM   9526  C  CB    . THR B 2  223  ? 185.790 220.746 112.781 1.00 29.95  ?  223  THR B CB    1 
ATOM   9527  O  OG1   . THR B 2  223  ? 186.326 219.495 112.352 1.00 29.95  ?  223  THR B OG1   1 
ATOM   9528  C  CG2   . THR B 2  223  ? 185.165 220.587 114.140 1.00 29.95  ?  223  THR B CG2   1 
ATOM   9529  N  N     . GLY B 2  224  ? 185.579 221.281 109.487 1.00 30.20  ?  224  GLY B N     1 
ATOM   9530  C  CA    . GLY B 2  224  ? 186.111 221.958 108.325 1.00 30.20  ?  224  GLY B CA    1 
ATOM   9531  C  C     . GLY B 2  224  ? 187.531 221.554 108.024 1.00 30.20  ?  224  GLY B C     1 
ATOM   9532  O  O     . GLY B 2  224  ? 188.339 222.363 107.572 1.00 30.20  ?  224  GLY B O     1 
ATOM   9533  N  N     . GLN B 2  225  ? 187.852 220.298 108.283 1.00 34.16  ?  225  GLN B N     1 
ATOM   9534  C  CA    . GLN B 2  225  ? 189.183 219.783 108.040 1.00 34.16  ?  225  GLN B CA    1 
ATOM   9535  C  C     . GLN B 2  225  ? 189.242 218.872 106.836 1.00 34.16  ?  225  GLN B C     1 
ATOM   9536  O  O     . GLN B 2  225  ? 190.337 218.587 106.354 1.00 34.16  ?  225  GLN B O     1 
ATOM   9537  C  CB    . GLN B 2  225  ? 189.675 219.019 109.265 1.00 34.16  ?  225  GLN B CB    1 
ATOM   9538  C  CG    . GLN B 2  225  ? 189.474 219.744 110.561 1.00 34.16  ?  225  GLN B CG    1 
ATOM   9539  C  CD    . GLN B 2  225  ? 190.714 220.441 111.025 1.00 34.16  ?  225  GLN B CD    1 
ATOM   9540  O  OE1   . GLN B 2  225  ? 191.782 219.841 111.079 1.00 34.16  ?  225  GLN B OE1   1 
ATOM   9541  N  NE2   . GLN B 2  225  ? 190.589 221.714 111.366 1.00 34.16  ?  225  GLN B NE2   1 
ATOM   9542  N  N     . LEU B 2  226  ? 188.103 218.413 106.335 1.00 34.62  ?  226  LEU B N     1 
ATOM   9543  C  CA    . LEU B 2  226  ? 188.074 217.306 105.395 1.00 34.62  ?  226  LEU B CA    1 
ATOM   9544  C  C     . LEU B 2  226  ? 187.325 217.697 104.132 1.00 34.62  ?  226  LEU B C     1 
ATOM   9545  O  O     . LEU B 2  226  ? 186.339 218.435 104.177 1.00 34.62  ?  226  LEU B O     1 
ATOM   9546  C  CB    . LEU B 2  226  ? 187.428 216.068 106.025 1.00 34.62  ?  226  LEU B CB    1 
ATOM   9547  C  CG    . LEU B 2  226  ? 187.707 214.726 105.360 1.00 34.62  ?  226  LEU B CG    1 
ATOM   9548  C  CD1   . LEU B 2  226  ? 189.178 214.482 105.342 1.00 34.62  ?  226  LEU B CD1   1 
ATOM   9549  C  CD2   . LEU B 2  226  ? 187.002 213.598 106.074 1.00 34.62  ?  226  LEU B CD2   1 
ATOM   9550  N  N     . GLY B 2  227  ? 187.805 217.186 103.006 1.00 37.75  ?  227  GLY B N     1 
ATOM   9551  C  CA    . GLY B 2  227  ? 187.150 217.365 101.732 1.00 37.75  ?  227  GLY B CA    1 
ATOM   9552  C  C     . GLY B 2  227  ? 187.497 218.683 101.057 1.00 37.75  ?  227  GLY B C     1 
ATOM   9553  O  O     . GLY B 2  227  ? 188.137 219.565 101.628 1.00 37.75  ?  227  GLY B O     1 
ATOM   9554  N  N     . ASP B 2  228  ? 187.012 218.817 99.825  1.00 41.07  ?  228  ASP B N     1 
ATOM   9555  C  CA    . ASP B 2  228  ? 187.337 219.932 98.946  1.00 41.07  ?  228  ASP B CA    1 
ATOM   9556  C  C     . ASP B 2  228  ? 186.544 221.169 99.359  1.00 41.07  ?  228  ASP B C     1 
ATOM   9557  O  O     . ASP B 2  228  ? 185.886 221.209 100.400 1.00 41.07  ?  228  ASP B O     1 
ATOM   9558  C  CB    . ASP B 2  228  ? 187.053 219.531 97.503  1.00 41.07  ?  228  ASP B CB    1 
ATOM   9559  C  CG    . ASP B 2  228  ? 187.898 220.289 96.502  1.00 41.07  ?  228  ASP B CG    1 
ATOM   9560  O  OD1   . ASP B 2  228  ? 189.059 219.914 96.306  1.00 41.07  ?  228  ASP B OD1   1 
ATOM   9561  O  OD2   . ASP B 2  228  ? 187.391 221.267 95.920  1.00 41.07  -1 228  ASP B OD2   1 
ATOM   9562  N  N     . GLU B 2  229  ? 186.595 222.207 98.519  1.00 41.54  ?  229  GLU B N     1 
ATOM   9563  C  CA    . GLU B 2  229  ? 185.820 223.421 98.733  1.00 41.54  ?  229  GLU B CA    1 
ATOM   9564  C  C     . GLU B 2  229  ? 184.319 223.192 98.612  1.00 41.54  ?  229  GLU B C     1 
ATOM   9565  O  O     . GLU B 2  229  ? 183.543 224.005 99.123  1.00 41.54  ?  229  GLU B O     1 
ATOM   9566  C  CB    . GLU B 2  229  ? 186.267 224.499 97.744  1.00 41.54  ?  229  GLU B CB    1 
ATOM   9567  C  CG    . GLU B 2  229  ? 187.592 225.169 98.088  1.00 41.54  ?  229  GLU B CG    1 
ATOM   9568  C  CD    . GLU B 2  229  ? 188.785 224.491 97.439  1.00 41.54  ?  229  GLU B CD    1 
ATOM   9569  O  OE1   . GLU B 2  229  ? 189.642 225.203 96.882  1.00 41.54  ?  229  GLU B OE1   1 
ATOM   9570  O  OE2   . GLU B 2  229  ? 188.874 223.250 97.486  1.00 41.54  -1 229  GLU B OE2   1 
ATOM   9571  N  N     . GLY B 2  230  ? 183.895 222.109 97.955  1.00 39.66  ?  230  GLY B N     1 
ATOM   9572  C  CA    . GLY B 2  230  ? 182.485 221.751 97.980  1.00 39.66  ?  230  GLY B CA    1 
ATOM   9573  C  C     . GLY B 2  230  ? 182.018 221.358 99.370  1.00 39.66  ?  230  GLY B C     1 
ATOM   9574  O  O     . GLY B 2  230  ? 181.077 221.947 99.911  1.00 39.66  ?  230  GLY B O     1 
ATOM   9575  N  N     . GLU B 2  231  ? 182.691 220.372 99.967  1.00 39.10  ?  231  GLU B N     1 
ATOM   9576  C  CA    . GLU B 2  231  ? 182.378 219.933 101.323 1.00 39.10  ?  231  GLU B CA    1 
ATOM   9577  C  C     . GLU B 2  231  ? 182.611 221.036 102.341 1.00 39.10  ?  231  GLU B C     1 
ATOM   9578  O  O     . GLU B 2  231  ? 181.880 221.140 103.328 1.00 39.10  ?  231  GLU B O     1 
ATOM   9579  C  CB    . GLU B 2  231  ? 183.230 218.726 101.681 1.00 39.10  ?  231  GLU B CB    1 
ATOM   9580  C  CG    . GLU B 2  231  ? 183.311 217.681 100.606 1.00 39.10  ?  231  GLU B CG    1 
ATOM   9581  C  CD    . GLU B 2  231  ? 182.483 216.472 100.923 1.00 39.10  ?  231  GLU B CD    1 
ATOM   9582  O  OE1   . GLU B 2  231  ? 182.087 216.335 102.094 1.00 39.10  ?  231  GLU B OE1   1 
ATOM   9583  O  OE2   . GLU B 2  231  ? 182.265 215.639 100.019 1.00 39.10  -1 231  GLU B OE2   1 
ATOM   9584  N  N     . GLN B 2  232  ? 183.626 221.865 102.129 1.00 37.96  ?  232  GLN B N     1 
ATOM   9585  C  CA    . GLN B 2  232  ? 183.910 222.912 103.097 1.00 37.96  ?  232  GLN B CA    1 
ATOM   9586  C  C     . GLN B 2  232  ? 182.941 224.075 102.955 1.00 37.96  ?  232  GLN B C     1 
ATOM   9587  O  O     . GLN B 2  232  ? 182.684 224.793 103.924 1.00 37.96  ?  232  GLN B O     1 
ATOM   9588  C  CB    . GLN B 2  232  ? 185.350 223.380 102.951 1.00 37.96  ?  232  GLN B CB    1 
ATOM   9589  C  CG    . GLN B 2  232  ? 186.352 222.405 103.518 1.00 37.96  ?  232  GLN B CG    1 
ATOM   9590  C  CD    . GLN B 2  232  ? 187.664 222.444 102.791 1.00 37.96  ?  232  GLN B CD    1 
ATOM   9591  O  OE1   . GLN B 2  232  ? 187.760 223.001 101.709 1.00 37.96  ?  232  GLN B OE1   1 
ATOM   9592  N  NE2   . GLN B 2  232  ? 188.691 221.847 103.380 1.00 37.96  ?  232  GLN B NE2   1 
ATOM   9593  N  N     . CYS B 2  233  ? 182.393 224.278 101.759 1.00 41.32  ?  233  CYS B N     1 
ATOM   9594  C  CA    . CYS B 2  233  ? 181.337 225.270 101.610 1.00 41.32  ?  233  CYS B CA    1 
ATOM   9595  C  C     . CYS B 2  233  ? 180.020 224.758 102.161 1.00 41.32  ?  233  CYS B C     1 
ATOM   9596  O  O     . CYS B 2  233  ? 179.201 225.547 102.641 1.00 41.32  ?  233  CYS B O     1 
ATOM   9597  C  CB    . CYS B 2  233  ? 181.175 225.654 100.143 1.00 41.32  ?  233  CYS B CB    1 
ATOM   9598  S  SG    . CYS B 2  233  ? 180.218 227.155 99.874  1.00 41.32  ?  233  CYS B SG    1 
ATOM   9599  N  N     . SER B 2  234  ? 179.796 223.445 102.102 1.00 39.33  ?  234  SER B N     1 
ATOM   9600  C  CA    . SER B 2  234  ? 178.509 222.916 102.524 1.00 39.33  ?  234  SER B CA    1 
ATOM   9601  C  C     . SER B 2  234  ? 178.462 222.615 104.016 1.00 39.33  ?  234  SER B C     1 
ATOM   9602  O  O     . SER B 2  234  ? 177.392 222.706 104.626 1.00