data_6T90
# 
_entry.id   6T90 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6T90         
WWPDB D_1292104688 
EMDB  EMD-10406    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'OCT4-SOX2-SHL+6 nucleosome' 
_pdbx_database_related.db_id          EMD-10406 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6T90 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-25 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Michael, A.K.' 1 ? 
'Kempf, G.'     2 ? 
'Cavadini, S.'  3 ? 
'Bunker, R.D.'  4 ? 
'Thoma, N.H.'   5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            368 
_citation.language                  ? 
_citation.page_first                1460 
_citation.page_last                 1465 
_citation.title                     'Mechanisms of OCT4-SOX2 motif readout on nucleosomes.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.abb0074 
_citation.pdbx_database_id_PubMed   32327602 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Michael, A.K.'   1  ? 
primary 'Grand, R.S.'     2  ? 
primary 'Isbel, L.'       3  ? 
primary 'Cavadini, S.'    4  ? 
primary 'Kozicka, Z.'     5  ? 
primary 'Kempf, G.'       6  ? 
primary 'Bunker, R.D.'    7  ? 
primary 'Schenk, A.D.'    8  ? 
primary 'Graff-Meyer, A.' 9  ? 
primary 'Pathare, G.R.'   10 ? 
primary 'Weiss, J.'       11 ? 
primary 'Matsumoto, S.'   12 ? 
primary 'Burger, L.'      13 ? 
primary 'Schubeler, D.'   14 ? 
primary 'Thoma, N.H.'     15 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6T90 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6T90 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.1'                                                          15719.445 1 ? ? ? ? 
2  polymer     man 'Histone H4'                                                            11676.703 2 ? ? ? ? 
3  polymer     man 'Histone H2A type 1-B/E'                                                14447.825 2 ? ? ? ? 
4  polymer     man 'Histone H2B type 1-J'                                                  14088.336 2 ? ? ? ? 
5  polymer     man 'Histone H3.1'                                                          15491.173 1 ? ? ? ? 
6  polymer     syn 'DNA (146-MER)'                                                         46961.957 1 ? ? ? ? 
7  polymer     syn 'DNA (146-MER)'                                                         45634.125 1 ? ? ? ? 
8  polymer     man 'Green fluorescent protein,POU domain, class 5, transcription factor 1' 70521.289 1 ? ? ? ? 
9  polymer     man 'Transcription factor SOX-2'                                            12718.679 1 ? ? ? ? 
10 non-polymer syn PENTANEDIAL                                                             100.116   9 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 
'Histone H3/a,Histone H3/b,Histone H3/c,Histone H3/d,Histone H3/f,Histone H3/h,Histone H3/i,Histone H3/j,Histone H3/k,Histone H3/l' 
3 'Histone H2A.2,Histone H2A/a,Histone H2A/m' 
4 'Histone H2B.1,Histone H2B.r,H2B/r' 
5 
'Histone H3/a,Histone H3/b,Histone H3/c,Histone H3/d,Histone H3/f,Histone H3/h,Histone H3/i,Histone H3/j,Histone H3/k,Histone H3/l' 
8 'Octamer-binding protein 3,Oct-3,Octamer-binding protein 4,Oct-4,Octamer-binding transcription factor 3,OTF-3' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A   ? 
2 'polypeptide(L)'        no no 
;GSHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA
KRKTVTAMDVVYALKRQGRTLYGFGG
;
;GSHMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHA
KRKTVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT
RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
;GSHMSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKT
RIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
C,G ? 
4 'polypeptide(L)'        no no 
;GSHMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
;
;GSHMPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
;
D,H ? 
5 'polypeptide(L)'        no no 
;GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
;
;GSHMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ
DFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
;
E   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DT)(DT)(DG)(DT)(DT)(DA)(DT)(DG)
(DC)(DA)(DA)(DA)(DT)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)
(DT)(DA)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)
(DT)(DA)(DA)(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)
(DC)(DC)(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)
(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)
(DC)(DC)(DA)(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)
(DT)(DA)(DC)(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DG)(DA)(DT)
;
;ATCCTGGAGACTTTGTTATGCAAATCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGT
CCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGAT
;
I   ? 
7 polydeoxyribonucleotide no no 
;(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DA)(DT)(DT)(DT)(DG)(DC)(DA)(DT)(DA)(DA)(DC)(DA)(DA)(DA)(DG)
(DT)(DC)(DT)(DC)(DC)(DA)(DG)
;
;ACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTA
CGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGATTTGCATAACAAAGTCTCCAG
;
J   ? 
8 'polypeptide(L)'        no no 
;MDWSHPQFEKSAVDENLYFQGGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW
PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNIL
GHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDH
MVLLEFVTAAGITLGMDELYKEAAAKEAAAKMAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGP
GVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKL
EQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVE
EADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
SDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSNLPETGGHHH
HHH
;
;MDWSHPQFEKSAVDENLYFQGGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPW
PTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNIL
GHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDH
MVLLEFVTAAGITLGMDELYKEAAAKEAAAKMAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGP
GVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKL
EQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVE
EADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
SDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSNLPETGGHHH
HHH
;
K   ? 
9 'polypeptide(L)'        no no 
;MDWSHPQFEKSAVDENLYFQGGMSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDE
AKRLRALHMKEHPDYKYRPRRKTKT
;
;MDWSHPQFEKSAVDENLYFQGGMSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDE
AKRLRALHMKEHPDYKYRPRRKTKT
;
L   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   ARG n 
1 7   THR n 
1 8   LYS n 
1 9   GLN n 
1 10  THR n 
1 11  ALA n 
1 12  ARG n 
1 13  LYS n 
1 14  SER n 
1 15  THR n 
1 16  GLY n 
1 17  GLY n 
1 18  LYS n 
1 19  ALA n 
1 20  PRO n 
1 21  ARG n 
1 22  LYS n 
1 23  GLN n 
1 24  LEU n 
1 25  ALA n 
1 26  THR n 
1 27  LYS n 
1 28  ALA n 
1 29  ALA n 
1 30  ARG n 
1 31  LYS n 
1 32  SER n 
1 33  ALA n 
1 34  PRO n 
1 35  ALA n 
1 36  THR n 
1 37  GLY n 
1 38  GLY n 
1 39  VAL n 
1 40  LYS n 
1 41  LYS n 
1 42  PRO n 
1 43  HIS n 
1 44  ARG n 
1 45  TYR n 
1 46  ARG n 
1 47  PRO n 
1 48  GLY n 
1 49  THR n 
1 50  VAL n 
1 51  ALA n 
1 52  LEU n 
1 53  ARG n 
1 54  GLU n 
1 55  ILE n 
1 56  ARG n 
1 57  ARG n 
1 58  TYR n 
1 59  GLN n 
1 60  LYS n 
1 61  SER n 
1 62  THR n 
1 63  GLU n 
1 64  LEU n 
1 65  LEU n 
1 66  ILE n 
1 67  ARG n 
1 68  LYS n 
1 69  LEU n 
1 70  PRO n 
1 71  PHE n 
1 72  GLN n 
1 73  ARG n 
1 74  LEU n 
1 75  VAL n 
1 76  ARG n 
1 77  GLU n 
1 78  ILE n 
1 79  ALA n 
1 80  GLN n 
1 81  ASP n 
1 82  PHE n 
1 83  LYS n 
1 84  THR n 
1 85  ASP n 
1 86  LEU n 
1 87  ARG n 
1 88  PHE n 
1 89  GLN n 
1 90  SER n 
1 91  SER n 
1 92  ALA n 
1 93  VAL n 
1 94  MET n 
1 95  ALA n 
1 96  LEU n 
1 97  GLN n 
1 98  GLU n 
1 99  ALA n 
1 100 CYS n 
1 101 GLU n 
1 102 ALA n 
1 103 TYR n 
1 104 LEU n 
1 105 VAL n 
1 106 GLY n 
1 107 LEU n 
1 108 PHE n 
1 109 GLU n 
1 110 ASP n 
1 111 THR n 
1 112 ASN n 
1 113 LEU n 
1 114 CYS n 
1 115 ALA n 
1 116 ILE n 
1 117 HIS n 
1 118 ALA n 
1 119 LYS n 
1 120 ARG n 
1 121 VAL n 
1 122 THR n 
1 123 ILE n 
1 124 MET n 
1 125 PRO n 
1 126 LYS n 
1 127 ASP n 
1 128 ILE n 
1 129 GLN n 
1 130 LEU n 
1 131 ALA n 
1 132 ARG n 
1 133 ARG n 
1 134 ILE n 
1 135 ARG n 
1 136 GLY n 
1 137 GLU n 
1 138 ARG n 
1 139 ALA n 
2 1   GLY n 
2 2   SER n 
2 3   HIS n 
2 4   MET n 
2 5   SER n 
2 6   GLY n 
2 7   ARG n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  LEU n 
2 15  GLY n 
2 16  LYS n 
2 17  GLY n 
2 18  GLY n 
2 19  ALA n 
2 20  LYS n 
2 21  ARG n 
2 22  HIS n 
2 23  ARG n 
2 24  LYS n 
2 25  VAL n 
2 26  LEU n 
2 27  ARG n 
2 28  ASP n 
2 29  ASN n 
2 30  ILE n 
2 31  GLN n 
2 32  GLY n 
2 33  ILE n 
2 34  THR n 
2 35  LYS n 
2 36  PRO n 
2 37  ALA n 
2 38  ILE n 
2 39  ARG n 
2 40  ARG n 
2 41  LEU n 
2 42  ALA n 
2 43  ARG n 
2 44  ARG n 
2 45  GLY n 
2 46  GLY n 
2 47  VAL n 
2 48  LYS n 
2 49  ARG n 
2 50  ILE n 
2 51  SER n 
2 52  GLY n 
2 53  LEU n 
2 54  ILE n 
2 55  TYR n 
2 56  GLU n 
2 57  GLU n 
2 58  THR n 
2 59  ARG n 
2 60  GLY n 
2 61  VAL n 
2 62  LEU n 
2 63  LYS n 
2 64  VAL n 
2 65  PHE n 
2 66  LEU n 
2 67  GLU n 
2 68  ASN n 
2 69  VAL n 
2 70  ILE n 
2 71  ARG n 
2 72  ASP n 
2 73  ALA n 
2 74  VAL n 
2 75  THR n 
2 76  TYR n 
2 77  THR n 
2 78  GLU n 
2 79  HIS n 
2 80  ALA n 
2 81  LYS n 
2 82  ARG n 
2 83  LYS n 
2 84  THR n 
2 85  VAL n 
2 86  THR n 
2 87  ALA n 
2 88  MET n 
2 89  ASP n 
2 90  VAL n 
2 91  VAL n 
2 92  TYR n 
2 93  ALA n 
2 94  LEU n 
2 95  LYS n 
2 96  ARG n 
2 97  GLN n 
2 98  GLY n 
2 99  ARG n 
2 100 THR n 
2 101 LEU n 
2 102 TYR n 
2 103 GLY n 
2 104 PHE n 
2 105 GLY n 
2 106 GLY n 
3 1   GLY n 
3 2   SER n 
3 3   HIS n 
3 4   MET n 
3 5   SER n 
3 6   GLY n 
3 7   ARG n 
3 8   GLY n 
3 9   LYS n 
3 10  GLN n 
3 11  GLY n 
3 12  GLY n 
3 13  LYS n 
3 14  ALA n 
3 15  ARG n 
3 16  ALA n 
3 17  LYS n 
3 18  ALA n 
3 19  LYS n 
3 20  THR n 
3 21  ARG n 
3 22  SER n 
3 23  SER n 
3 24  ARG n 
3 25  ALA n 
3 26  GLY n 
3 27  LEU n 
3 28  GLN n 
3 29  PHE n 
3 30  PRO n 
3 31  VAL n 
3 32  GLY n 
3 33  ARG n 
3 34  VAL n 
3 35  HIS n 
3 36  ARG n 
3 37  LEU n 
3 38  LEU n 
3 39  ARG n 
3 40  LYS n 
3 41  GLY n 
3 42  ASN n 
3 43  TYR n 
3 44  SER n 
3 45  GLU n 
3 46  ARG n 
3 47  VAL n 
3 48  GLY n 
3 49  ALA n 
3 50  GLY n 
3 51  ALA n 
3 52  PRO n 
3 53  VAL n 
3 54  TYR n 
3 55  LEU n 
3 56  ALA n 
3 57  ALA n 
3 58  VAL n 
3 59  LEU n 
3 60  GLU n 
3 61  TYR n 
3 62  LEU n 
3 63  THR n 
3 64  ALA n 
3 65  GLU n 
3 66  ILE n 
3 67  LEU n 
3 68  GLU n 
3 69  LEU n 
3 70  ALA n 
3 71  GLY n 
3 72  ASN n 
3 73  ALA n 
3 74  ALA n 
3 75  ARG n 
3 76  ASP n 
3 77  ASN n 
3 78  LYS n 
3 79  LYS n 
3 80  THR n 
3 81  ARG n 
3 82  ILE n 
3 83  ILE n 
3 84  PRO n 
3 85  ARG n 
3 86  HIS n 
3 87  LEU n 
3 88  GLN n 
3 89  LEU n 
3 90  ALA n 
3 91  ILE n 
3 92  ARG n 
3 93  ASN n 
3 94  ASP n 
3 95  GLU n 
3 96  GLU n 
3 97  LEU n 
3 98  ASN n 
3 99  LYS n 
3 100 LEU n 
3 101 LEU n 
3 102 GLY n 
3 103 ARG n 
3 104 VAL n 
3 105 THR n 
3 106 ILE n 
3 107 ALA n 
3 108 GLN n 
3 109 GLY n 
3 110 GLY n 
3 111 VAL n 
3 112 LEU n 
3 113 PRO n 
3 114 ASN n 
3 115 ILE n 
3 116 GLN n 
3 117 ALA n 
3 118 VAL n 
3 119 LEU n 
3 120 LEU n 
3 121 PRO n 
3 122 LYS n 
3 123 LYS n 
3 124 THR n 
3 125 GLU n 
3 126 SER n 
3 127 HIS n 
3 128 HIS n 
3 129 LYS n 
3 130 ALA n 
3 131 LYS n 
3 132 GLY n 
3 133 LYS n 
4 1   GLY n 
4 2   SER n 
4 3   HIS n 
4 4   MET n 
4 5   PRO n 
4 6   GLU n 
4 7   PRO n 
4 8   ALA n 
4 9   LYS n 
4 10  SER n 
4 11  ALA n 
4 12  PRO n 
4 13  ALA n 
4 14  PRO n 
4 15  LYS n 
4 16  LYS n 
4 17  GLY n 
4 18  SER n 
4 19  LYS n 
4 20  LYS n 
4 21  ALA n 
4 22  VAL n 
4 23  THR n 
4 24  LYS n 
4 25  ALA n 
4 26  GLN n 
4 27  LYS n 
4 28  LYS n 
4 29  ASP n 
4 30  GLY n 
4 31  LYS n 
4 32  LYS n 
4 33  ARG n 
4 34  LYS n 
4 35  ARG n 
4 36  SER n 
4 37  ARG n 
4 38  LYS n 
4 39  GLU n 
4 40  SER n 
4 41  TYR n 
4 42  SER n 
4 43  ILE n 
4 44  TYR n 
4 45  VAL n 
4 46  TYR n 
4 47  LYS n 
4 48  VAL n 
4 49  LEU n 
4 50  LYS n 
4 51  GLN n 
4 52  VAL n 
4 53  HIS n 
4 54  PRO n 
4 55  ASP n 
4 56  THR n 
4 57  GLY n 
4 58  ILE n 
4 59  SER n 
4 60  SER n 
4 61  LYS n 
4 62  ALA n 
4 63  MET n 
4 64  GLY n 
4 65  ILE n 
4 66  MET n 
4 67  ASN n 
4 68  SER n 
4 69  PHE n 
4 70  VAL n 
4 71  ASN n 
4 72  ASP n 
4 73  ILE n 
4 74  PHE n 
4 75  GLU n 
4 76  ARG n 
4 77  ILE n 
4 78  ALA n 
4 79  GLY n 
4 80  GLU n 
4 81  ALA n 
4 82  SER n 
4 83  ARG n 
4 84  LEU n 
4 85  ALA n 
4 86  HIS n 
4 87  TYR n 
4 88  ASN n 
4 89  LYS n 
4 90  ARG n 
4 91  SER n 
4 92  THR n 
4 93  ILE n 
4 94  THR n 
4 95  SER n 
4 96  ARG n 
4 97  GLU n 
4 98  ILE n 
4 99  GLN n 
4 100 THR n 
4 101 ALA n 
4 102 VAL n 
4 103 ARG n 
4 104 LEU n 
4 105 LEU n 
4 106 LEU n 
4 107 PRO n 
4 108 GLY n 
4 109 GLU n 
4 110 LEU n 
4 111 ALA n 
4 112 LYS n 
4 113 HIS n 
4 114 ALA n 
4 115 VAL n 
4 116 SER n 
4 117 GLU n 
4 118 GLY n 
4 119 THR n 
4 120 LYS n 
4 121 ALA n 
4 122 VAL n 
4 123 THR n 
4 124 LYS n 
4 125 TYR n 
4 126 THR n 
4 127 SER n 
4 128 ALA n 
5 1   GLY n 
5 2   SER n 
5 3   HIS n 
5 4   MET n 
5 5   ALA n 
5 6   ARG n 
5 7   THR n 
5 8   LYS n 
5 9   GLN n 
5 10  THR n 
5 11  ALA n 
5 12  ARG n 
5 13  LYS n 
5 14  SER n 
5 15  THR n 
5 16  GLY n 
5 17  GLY n 
5 18  LYS n 
5 19  ALA n 
5 20  PRO n 
5 21  ARG n 
5 22  LYS n 
5 23  GLN n 
5 24  LEU n 
5 25  ALA n 
5 26  THR n 
5 27  LYS n 
5 28  ALA n 
5 29  ALA n 
5 30  ARG n 
5 31  LYS n 
5 32  SER n 
5 33  ALA n 
5 34  PRO n 
5 35  ALA n 
5 36  THR n 
5 37  GLY n 
5 38  GLY n 
5 39  VAL n 
5 40  LYS n 
5 41  LYS n 
5 42  PRO n 
5 43  HIS n 
5 44  ARG n 
5 45  TYR n 
5 46  ARG n 
5 47  PRO n 
5 48  GLY n 
5 49  THR n 
5 50  VAL n 
5 51  ALA n 
5 52  LEU n 
5 53  ARG n 
5 54  GLU n 
5 55  ILE n 
5 56  ARG n 
5 57  ARG n 
5 58  TYR n 
5 59  GLN n 
5 60  LYS n 
5 61  SER n 
5 62  THR n 
5 63  GLU n 
5 64  LEU n 
5 65  LEU n 
5 66  ILE n 
5 67  ARG n 
5 68  LYS n 
5 69  LEU n 
5 70  PRO n 
5 71  PHE n 
5 72  GLN n 
5 73  ARG n 
5 74  LEU n 
5 75  VAL n 
5 76  ARG n 
5 77  GLU n 
5 78  ILE n 
5 79  ALA n 
5 80  GLN n 
5 81  ASP n 
5 82  PHE n 
5 83  LYS n 
5 84  THR n 
5 85  ASP n 
5 86  LEU n 
5 87  ARG n 
5 88  PHE n 
5 89  GLN n 
5 90  SER n 
5 91  SER n 
5 92  ALA n 
5 93  VAL n 
5 94  MET n 
5 95  ALA n 
5 96  LEU n 
5 97  GLN n 
5 98  GLU n 
5 99  ALA n 
5 100 CYS n 
5 101 GLU n 
5 102 ALA n 
5 103 TYR n 
5 104 LEU n 
5 105 VAL n 
5 106 GLY n 
5 107 LEU n 
5 108 PHE n 
5 109 GLU n 
5 110 ASP n 
5 111 THR n 
5 112 ASN n 
5 113 LEU n 
5 114 CYS n 
5 115 ALA n 
5 116 ILE n 
5 117 HIS n 
5 118 ALA n 
5 119 LYS n 
5 120 ARG n 
5 121 VAL n 
5 122 THR n 
5 123 ILE n 
5 124 MET n 
5 125 PRO n 
5 126 LYS n 
5 127 ASP n 
5 128 ILE n 
5 129 GLN n 
5 130 LEU n 
5 131 ALA n 
5 132 ARG n 
5 133 ARG n 
5 134 ILE n 
5 135 ARG n 
5 136 GLY n 
5 137 GLU n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DC  n 
6 5   DT  n 
6 6   DG  n 
6 7   DG  n 
6 8   DA  n 
6 9   DG  n 
6 10  DA  n 
6 11  DC  n 
6 12  DT  n 
6 13  DT  n 
6 14  DT  n 
6 15  DG  n 
6 16  DT  n 
6 17  DT  n 
6 18  DA  n 
6 19  DT  n 
6 20  DG  n 
6 21  DC  n 
6 22  DA  n 
6 23  DA  n 
6 24  DA  n 
6 25  DT  n 
6 26  DC  n 
6 27  DC  n 
6 28  DG  n 
6 29  DC  n 
6 30  DT  n 
6 31  DC  n 
6 32  DA  n 
6 33  DA  n 
6 34  DT  n 
6 35  DT  n 
6 36  DG  n 
6 37  DG  n 
6 38  DT  n 
6 39  DC  n 
6 40  DG  n 
6 41  DT  n 
6 42  DA  n 
6 43  DG  n 
6 44  DA  n 
6 45  DC  n 
6 46  DA  n 
6 47  DG  n 
6 48  DC  n 
6 49  DT  n 
6 50  DC  n 
6 51  DT  n 
6 52  DA  n 
6 53  DG  n 
6 54  DC  n 
6 55  DA  n 
6 56  DC  n 
6 57  DC  n 
6 58  DG  n 
6 59  DC  n 
6 60  DT  n 
6 61  DT  n 
6 62  DA  n 
6 63  DA  n 
6 64  DA  n 
6 65  DC  n 
6 66  DG  n 
6 67  DC  n 
6 68  DA  n 
6 69  DC  n 
6 70  DG  n 
6 71  DT  n 
6 72  DA  n 
6 73  DC  n 
6 74  DG  n 
6 75  DC  n 
6 76  DG  n 
6 77  DC  n 
6 78  DT  n 
6 79  DG  n 
6 80  DT  n 
6 81  DC  n 
6 82  DC  n 
6 83  DC  n 
6 84  DC  n 
6 85  DC  n 
6 86  DG  n 
6 87  DC  n 
6 88  DG  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DA  n 
6 94  DA  n 
6 95  DC  n 
6 96  DC  n 
6 97  DG  n 
6 98  DC  n 
6 99  DC  n 
6 100 DA  n 
6 101 DA  n 
6 102 DG  n 
6 103 DG  n 
6 104 DG  n 
6 105 DG  n 
6 106 DA  n 
6 107 DT  n 
6 108 DT  n 
6 109 DA  n 
6 110 DC  n 
6 111 DT  n 
6 112 DC  n 
6 113 DC  n 
6 114 DC  n 
6 115 DT  n 
6 116 DA  n 
6 117 DG  n 
6 118 DT  n 
6 119 DC  n 
6 120 DT  n 
6 121 DC  n 
6 122 DC  n 
6 123 DA  n 
6 124 DG  n 
6 125 DG  n 
6 126 DC  n 
6 127 DA  n 
6 128 DC  n 
6 129 DG  n 
6 130 DT  n 
6 131 DG  n 
6 132 DT  n 
6 133 DC  n 
6 134 DA  n 
6 135 DG  n 
6 136 DA  n 
6 137 DT  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DA  n 
6 143 DC  n 
6 144 DA  n 
6 145 DT  n 
6 146 DC  n 
6 147 DC  n 
6 148 DT  n 
6 149 DG  n 
6 150 DT  n 
6 151 DG  n 
6 152 DA  n 
6 153 DT  n 
7 1   DA  n 
7 2   DC  n 
7 3   DA  n 
7 4   DG  n 
7 5   DG  n 
7 6   DA  n 
7 7   DT  n 
7 8   DG  n 
7 9   DT  n 
7 10  DA  n 
7 11  DT  n 
7 12  DA  n 
7 13  DT  n 
7 14  DA  n 
7 15  DT  n 
7 16  DC  n 
7 17  DT  n 
7 18  DG  n 
7 19  DA  n 
7 20  DC  n 
7 21  DA  n 
7 22  DC  n 
7 23  DG  n 
7 24  DT  n 
7 25  DG  n 
7 26  DC  n 
7 27  DC  n 
7 28  DT  n 
7 29  DG  n 
7 30  DG  n 
7 31  DA  n 
7 32  DG  n 
7 33  DA  n 
7 34  DC  n 
7 35  DT  n 
7 36  DA  n 
7 37  DG  n 
7 38  DG  n 
7 39  DG  n 
7 40  DA  n 
7 41  DG  n 
7 42  DT  n 
7 43  DA  n 
7 44  DA  n 
7 45  DT  n 
7 46  DC  n 
7 47  DC  n 
7 48  DC  n 
7 49  DC  n 
7 50  DT  n 
7 51  DT  n 
7 52  DG  n 
7 53  DG  n 
7 54  DC  n 
7 55  DG  n 
7 56  DG  n 
7 57  DT  n 
7 58  DT  n 
7 59  DA  n 
7 60  DA  n 
7 61  DA  n 
7 62  DA  n 
7 63  DC  n 
7 64  DG  n 
7 65  DC  n 
7 66  DG  n 
7 67  DG  n 
7 68  DG  n 
7 69  DG  n 
7 70  DG  n 
7 71  DA  n 
7 72  DC  n 
7 73  DA  n 
7 74  DG  n 
7 75  DC  n 
7 76  DG  n 
7 77  DC  n 
7 78  DG  n 
7 79  DT  n 
7 80  DA  n 
7 81  DC  n 
7 82  DG  n 
7 83  DT  n 
7 84  DG  n 
7 85  DC  n 
7 86  DG  n 
7 87  DT  n 
7 88  DT  n 
7 89  DT  n 
7 90  DA  n 
7 91  DA  n 
7 92  DG  n 
7 93  DC  n 
7 94  DG  n 
7 95  DG  n 
7 96  DT  n 
7 97  DG  n 
7 98  DC  n 
7 99  DT  n 
7 100 DA  n 
7 101 DG  n 
7 102 DA  n 
7 103 DG  n 
7 104 DC  n 
7 105 DT  n 
7 106 DG  n 
7 107 DT  n 
7 108 DC  n 
7 109 DT  n 
7 110 DA  n 
7 111 DC  n 
7 112 DG  n 
7 113 DA  n 
7 114 DC  n 
7 115 DC  n 
7 116 DA  n 
7 117 DA  n 
7 118 DT  n 
7 119 DT  n 
7 120 DG  n 
7 121 DA  n 
7 122 DG  n 
7 123 DC  n 
7 124 DG  n 
7 125 DG  n 
7 126 DA  n 
7 127 DT  n 
7 128 DT  n 
7 129 DT  n 
7 130 DG  n 
7 131 DC  n 
7 132 DA  n 
7 133 DT  n 
7 134 DA  n 
7 135 DA  n 
7 136 DC  n 
7 137 DA  n 
7 138 DA  n 
7 139 DA  n 
7 140 DG  n 
7 141 DT  n 
7 142 DC  n 
7 143 DT  n 
7 144 DC  n 
7 145 DC  n 
7 146 DA  n 
7 147 DG  n 
8 1   MET n 
8 2   ASP n 
8 3   TRP n 
8 4   SER n 
8 5   HIS n 
8 6   PRO n 
8 7   GLN n 
8 8   PHE n 
8 9   GLU n 
8 10  LYS n 
8 11  SER n 
8 12  ALA n 
8 13  VAL n 
8 14  ASP n 
8 15  GLU n 
8 16  ASN n 
8 17  LEU n 
8 18  TYR n 
8 19  PHE n 
8 20  GLN n 
8 21  GLY n 
8 22  GLY n 
8 23  MET n 
8 24  VAL n 
8 25  SER n 
8 26  LYS n 
8 27  GLY n 
8 28  GLU n 
8 29  GLU n 
8 30  LEU n 
8 31  PHE n 
8 32  THR n 
8 33  GLY n 
8 34  VAL n 
8 35  VAL n 
8 36  PRO n 
8 37  ILE n 
8 38  LEU n 
8 39  VAL n 
8 40  GLU n 
8 41  LEU n 
8 42  ASP n 
8 43  GLY n 
8 44  ASP n 
8 45  VAL n 
8 46  ASN n 
8 47  GLY n 
8 48  HIS n 
8 49  LYS n 
8 50  PHE n 
8 51  SER n 
8 52  VAL n 
8 53  SER n 
8 54  GLY n 
8 55  GLU n 
8 56  GLY n 
8 57  GLU n 
8 58  GLY n 
8 59  ASP n 
8 60  ALA n 
8 61  THR n 
8 62  TYR n 
8 63  GLY n 
8 64  LYS n 
8 65  LEU n 
8 66  THR n 
8 67  LEU n 
8 68  LYS n 
8 69  PHE n 
8 70  ILE n 
8 71  CYS n 
8 72  THR n 
8 73  THR n 
8 74  GLY n 
8 75  LYS n 
8 76  LEU n 
8 77  PRO n 
8 78  VAL n 
8 79  PRO n 
8 80  TRP n 
8 81  PRO n 
8 82  THR n 
8 83  LEU n 
8 84  VAL n 
8 85  THR n 
8 86  THR n 
8 87  LEU n 
8 88  THR n 
8 89  TYR n 
8 90  GLY n 
8 91  VAL n 
8 92  GLN n 
8 93  CYS n 
8 94  PHE n 
8 95  SER n 
8 96  ARG n 
8 97  TYR n 
8 98  PRO n 
8 99  ASP n 
8 100 HIS n 
8 101 MET n 
8 102 LYS n 
8 103 GLN n 
8 104 HIS n 
8 105 ASP n 
8 106 PHE n 
8 107 PHE n 
8 108 LYS n 
8 109 SER n 
8 110 ALA n 
8 111 MET n 
8 112 PRO n 
8 113 GLU n 
8 114 GLY n 
8 115 TYR n 
8 116 VAL n 
8 117 GLN n 
8 118 GLU n 
8 119 ARG n 
8 120 THR n 
8 121 ILE n 
8 122 PHE n 
8 123 PHE n 
8 124 LYS n 
8 125 ASP n 
8 126 ASP n 
8 127 GLY n 
8 128 ASN n 
8 129 TYR n 
8 130 LYS n 
8 131 THR n 
8 132 ARG n 
8 133 ALA n 
8 134 GLU n 
8 135 VAL n 
8 136 LYS n 
8 137 PHE n 
8 138 GLU n 
8 139 GLY n 
8 140 ASP n 
8 141 THR n 
8 142 LEU n 
8 143 VAL n 
8 144 ASN n 
8 145 ARG n 
8 146 ILE n 
8 147 GLU n 
8 148 LEU n 
8 149 LYS n 
8 150 GLY n 
8 151 ILE n 
8 152 ASP n 
8 153 PHE n 
8 154 LYS n 
8 155 GLU n 
8 156 ASP n 
8 157 GLY n 
8 158 ASN n 
8 159 ILE n 
8 160 LEU n 
8 161 GLY n 
8 162 HIS n 
8 163 LYS n 
8 164 LEU n 
8 165 GLU n 
8 166 TYR n 
8 167 ASN n 
8 168 TYR n 
8 169 ASN n 
8 170 SER n 
8 171 HIS n 
8 172 ASN n 
8 173 VAL n 
8 174 TYR n 
8 175 ILE n 
8 176 MET n 
8 177 ALA n 
8 178 ASP n 
8 179 LYS n 
8 180 GLN n 
8 181 LYS n 
8 182 ASN n 
8 183 GLY n 
8 184 ILE n 
8 185 LYS n 
8 186 VAL n 
8 187 ASN n 
8 188 PHE n 
8 189 LYS n 
8 190 ILE n 
8 191 ARG n 
8 192 HIS n 
8 193 ASN n 
8 194 ILE n 
8 195 GLU n 
8 196 ASP n 
8 197 GLY n 
8 198 SER n 
8 199 VAL n 
8 200 GLN n 
8 201 LEU n 
8 202 ALA n 
8 203 ASP n 
8 204 HIS n 
8 205 TYR n 
8 206 GLN n 
8 207 GLN n 
8 208 ASN n 
8 209 THR n 
8 210 PRO n 
8 211 ILE n 
8 212 GLY n 
8 213 ASP n 
8 214 GLY n 
8 215 PRO n 
8 216 VAL n 
8 217 LEU n 
8 218 LEU n 
8 219 PRO n 
8 220 ASP n 
8 221 ASN n 
8 222 HIS n 
8 223 TYR n 
8 224 LEU n 
8 225 SER n 
8 226 THR n 
8 227 GLN n 
8 228 SER n 
8 229 LYS n 
8 230 LEU n 
8 231 SER n 
8 232 LYS n 
8 233 ASP n 
8 234 PRO n 
8 235 ASN n 
8 236 GLU n 
8 237 LYS n 
8 238 ARG n 
8 239 ASP n 
8 240 HIS n 
8 241 MET n 
8 242 VAL n 
8 243 LEU n 
8 244 LEU n 
8 245 GLU n 
8 246 PHE n 
8 247 VAL n 
8 248 THR n 
8 249 ALA n 
8 250 ALA n 
8 251 GLY n 
8 252 ILE n 
8 253 THR n 
8 254 LEU n 
8 255 GLY n 
8 256 MET n 
8 257 ASP n 
8 258 GLU n 
8 259 LEU n 
8 260 TYR n 
8 261 LYS n 
8 262 GLU n 
8 263 ALA n 
8 264 ALA n 
8 265 ALA n 
8 266 LYS n 
8 267 GLU n 
8 268 ALA n 
8 269 ALA n 
8 270 ALA n 
8 271 LYS n 
8 272 MET n 
8 273 ALA n 
8 274 GLY n 
8 275 HIS n 
8 276 LEU n 
8 277 ALA n 
8 278 SER n 
8 279 ASP n 
8 280 PHE n 
8 281 ALA n 
8 282 PHE n 
8 283 SER n 
8 284 PRO n 
8 285 PRO n 
8 286 PRO n 
8 287 GLY n 
8 288 GLY n 
8 289 GLY n 
8 290 GLY n 
8 291 ASP n 
8 292 GLY n 
8 293 PRO n 
8 294 GLY n 
8 295 GLY n 
8 296 PRO n 
8 297 GLU n 
8 298 PRO n 
8 299 GLY n 
8 300 TRP n 
8 301 VAL n 
8 302 ASP n 
8 303 PRO n 
8 304 ARG n 
8 305 THR n 
8 306 TRP n 
8 307 LEU n 
8 308 SER n 
8 309 PHE n 
8 310 GLN n 
8 311 GLY n 
8 312 PRO n 
8 313 PRO n 
8 314 GLY n 
8 315 GLY n 
8 316 PRO n 
8 317 GLY n 
8 318 ILE n 
8 319 GLY n 
8 320 PRO n 
8 321 GLY n 
8 322 VAL n 
8 323 GLY n 
8 324 PRO n 
8 325 GLY n 
8 326 SER n 
8 327 GLU n 
8 328 VAL n 
8 329 TRP n 
8 330 GLY n 
8 331 ILE n 
8 332 PRO n 
8 333 PRO n 
8 334 CYS n 
8 335 PRO n 
8 336 PRO n 
8 337 PRO n 
8 338 TYR n 
8 339 GLU n 
8 340 PHE n 
8 341 CYS n 
8 342 GLY n 
8 343 GLY n 
8 344 MET n 
8 345 ALA n 
8 346 TYR n 
8 347 CYS n 
8 348 GLY n 
8 349 PRO n 
8 350 GLN n 
8 351 VAL n 
8 352 GLY n 
8 353 VAL n 
8 354 GLY n 
8 355 LEU n 
8 356 VAL n 
8 357 PRO n 
8 358 GLN n 
8 359 GLY n 
8 360 GLY n 
8 361 LEU n 
8 362 GLU n 
8 363 THR n 
8 364 SER n 
8 365 GLN n 
8 366 PRO n 
8 367 GLU n 
8 368 GLY n 
8 369 GLU n 
8 370 ALA n 
8 371 GLY n 
8 372 VAL n 
8 373 GLY n 
8 374 VAL n 
8 375 GLU n 
8 376 SER n 
8 377 ASN n 
8 378 SER n 
8 379 ASP n 
8 380 GLY n 
8 381 ALA n 
8 382 SER n 
8 383 PRO n 
8 384 GLU n 
8 385 PRO n 
8 386 CYS n 
8 387 THR n 
8 388 VAL n 
8 389 THR n 
8 390 PRO n 
8 391 GLY n 
8 392 ALA n 
8 393 VAL n 
8 394 LYS n 
8 395 LEU n 
8 396 GLU n 
8 397 LYS n 
8 398 GLU n 
8 399 LYS n 
8 400 LEU n 
8 401 GLU n 
8 402 GLN n 
8 403 ASN n 
8 404 PRO n 
8 405 GLU n 
8 406 GLU n 
8 407 SER n 
8 408 GLN n 
8 409 ASP n 
8 410 ILE n 
8 411 LYS n 
8 412 ALA n 
8 413 LEU n 
8 414 GLN n 
8 415 LYS n 
8 416 GLU n 
8 417 LEU n 
8 418 GLU n 
8 419 GLN n 
8 420 PHE n 
8 421 ALA n 
8 422 LYS n 
8 423 LEU n 
8 424 LEU n 
8 425 LYS n 
8 426 GLN n 
8 427 LYS n 
8 428 ARG n 
8 429 ILE n 
8 430 THR n 
8 431 LEU n 
8 432 GLY n 
8 433 TYR n 
8 434 THR n 
8 435 GLN n 
8 436 ALA n 
8 437 ASP n 
8 438 VAL n 
8 439 GLY n 
8 440 LEU n 
8 441 THR n 
8 442 LEU n 
8 443 GLY n 
8 444 VAL n 
8 445 LEU n 
8 446 PHE n 
8 447 GLY n 
8 448 LYS n 
8 449 VAL n 
8 450 PHE n 
8 451 SER n 
8 452 GLN n 
8 453 THR n 
8 454 THR n 
8 455 ILE n 
8 456 CYS n 
8 457 ARG n 
8 458 PHE n 
8 459 GLU n 
8 460 ALA n 
8 461 LEU n 
8 462 GLN n 
8 463 LEU n 
8 464 SER n 
8 465 PHE n 
8 466 LYS n 
8 467 ASN n 
8 468 MET n 
8 469 CYS n 
8 470 LYS n 
8 471 LEU n 
8 472 ARG n 
8 473 PRO n 
8 474 LEU n 
8 475 LEU n 
8 476 GLN n 
8 477 LYS n 
8 478 TRP n 
8 479 VAL n 
8 480 GLU n 
8 481 GLU n 
8 482 ALA n 
8 483 ASP n 
8 484 ASN n 
8 485 ASN n 
8 486 GLU n 
8 487 ASN n 
8 488 LEU n 
8 489 GLN n 
8 490 GLU n 
8 491 ILE n 
8 492 CYS n 
8 493 LYS n 
8 494 ALA n 
8 495 GLU n 
8 496 THR n 
8 497 LEU n 
8 498 VAL n 
8 499 GLN n 
8 500 ALA n 
8 501 ARG n 
8 502 LYS n 
8 503 ARG n 
8 504 LYS n 
8 505 ARG n 
8 506 THR n 
8 507 SER n 
8 508 ILE n 
8 509 GLU n 
8 510 ASN n 
8 511 ARG n 
8 512 VAL n 
8 513 ARG n 
8 514 GLY n 
8 515 ASN n 
8 516 LEU n 
8 517 GLU n 
8 518 ASN n 
8 519 LEU n 
8 520 PHE n 
8 521 LEU n 
8 522 GLN n 
8 523 CYS n 
8 524 PRO n 
8 525 LYS n 
8 526 PRO n 
8 527 THR n 
8 528 LEU n 
8 529 GLN n 
8 530 GLN n 
8 531 ILE n 
8 532 SER n 
8 533 HIS n 
8 534 ILE n 
8 535 ALA n 
8 536 GLN n 
8 537 GLN n 
8 538 LEU n 
8 539 GLY n 
8 540 LEU n 
8 541 GLU n 
8 542 LYS n 
8 543 ASP n 
8 544 VAL n 
8 545 VAL n 
8 546 ARG n 
8 547 VAL n 
8 548 TRP n 
8 549 PHE n 
8 550 CYS n 
8 551 ASN n 
8 552 ARG n 
8 553 ARG n 
8 554 GLN n 
8 555 LYS n 
8 556 GLY n 
8 557 LYS n 
8 558 ARG n 
8 559 SER n 
8 560 SER n 
8 561 SER n 
8 562 ASP n 
8 563 TYR n 
8 564 ALA n 
8 565 GLN n 
8 566 ARG n 
8 567 GLU n 
8 568 ASP n 
8 569 PHE n 
8 570 GLU n 
8 571 ALA n 
8 572 ALA n 
8 573 GLY n 
8 574 SER n 
8 575 PRO n 
8 576 PHE n 
8 577 SER n 
8 578 GLY n 
8 579 GLY n 
8 580 PRO n 
8 581 VAL n 
8 582 SER n 
8 583 PHE n 
8 584 PRO n 
8 585 LEU n 
8 586 ALA n 
8 587 PRO n 
8 588 GLY n 
8 589 PRO n 
8 590 HIS n 
8 591 PHE n 
8 592 GLY n 
8 593 THR n 
8 594 PRO n 
8 595 GLY n 
8 596 TYR n 
8 597 GLY n 
8 598 SER n 
8 599 PRO n 
8 600 HIS n 
8 601 PHE n 
8 602 THR n 
8 603 ALA n 
8 604 LEU n 
8 605 TYR n 
8 606 SER n 
8 607 SER n 
8 608 VAL n 
8 609 PRO n 
8 610 PHE n 
8 611 PRO n 
8 612 GLU n 
8 613 GLY n 
8 614 GLU n 
8 615 ALA n 
8 616 PHE n 
8 617 PRO n 
8 618 PRO n 
8 619 VAL n 
8 620 SER n 
8 621 VAL n 
8 622 THR n 
8 623 THR n 
8 624 LEU n 
8 625 GLY n 
8 626 SER n 
8 627 PRO n 
8 628 MET n 
8 629 HIS n 
8 630 SER n 
8 631 ASN n 
8 632 LEU n 
8 633 PRO n 
8 634 GLU n 
8 635 THR n 
8 636 GLY n 
8 637 GLY n 
8 638 HIS n 
8 639 HIS n 
8 640 HIS n 
8 641 HIS n 
8 642 HIS n 
8 643 HIS n 
9 1   MET n 
9 2   ASP n 
9 3   TRP n 
9 4   SER n 
9 5   HIS n 
9 6   PRO n 
9 7   GLN n 
9 8   PHE n 
9 9   GLU n 
9 10  LYS n 
9 11  SER n 
9 12  ALA n 
9 13  VAL n 
9 14  ASP n 
9 15  GLU n 
9 16  ASN n 
9 17  LEU n 
9 18  TYR n 
9 19  PHE n 
9 20  GLN n 
9 21  GLY n 
9 22  GLY n 
9 23  MET n 
9 24  SER n 
9 25  PRO n 
9 26  ASP n 
9 27  ARG n 
9 28  VAL n 
9 29  LYS n 
9 30  ARG n 
9 31  PRO n 
9 32  MET n 
9 33  ASN n 
9 34  ALA n 
9 35  PHE n 
9 36  MET n 
9 37  VAL n 
9 38  TRP n 
9 39  SER n 
9 40  ARG n 
9 41  GLY n 
9 42  GLN n 
9 43  ARG n 
9 44  ARG n 
9 45  LYS n 
9 46  MET n 
9 47  ALA n 
9 48  GLN n 
9 49  GLU n 
9 50  ASN n 
9 51  PRO n 
9 52  LYS n 
9 53  MET n 
9 54  HIS n 
9 55  ASN n 
9 56  SER n 
9 57  GLU n 
9 58  ILE n 
9 59  SER n 
9 60  LYS n 
9 61  ARG n 
9 62  LEU n 
9 63  GLY n 
9 64  ALA n 
9 65  GLU n 
9 66  TRP n 
9 67  LYS n 
9 68  LEU n 
9 69  LEU n 
9 70  SER n 
9 71  GLU n 
9 72  THR n 
9 73  GLU n 
9 74  LYS n 
9 75  ARG n 
9 76  PRO n 
9 77  PHE n 
9 78  ILE n 
9 79  ASP n 
9 80  GLU n 
9 81  ALA n 
9 82  LYS n 
9 83  ARG n 
9 84  LEU n 
9 85  ARG n 
9 86  ALA n 
9 87  LEU n 
9 88  HIS n 
9 89  MET n 
9 90  LYS n 
9 91  GLU n 
9 92  HIS n 
9 93  PRO n 
9 94  ASP n 
9 95  TYR n 
9 96  LYS n 
9 97  TYR n 
9 98  ARG n 
9 99  PRO n 
9 100 ARG n 
9 101 ARG n 
9 102 LYS n 
9 103 THR n 
9 104 LYS n 
9 105 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   139 Human     ? 
;HIST1H3A, H3FA, HIST1H3B, H3FL, HIST1H3C, H3FC, HIST1H3D, H3FB, HIST1H3E, H3FD, HIST1H3F, H3FI, HIST1H3G, H3FH, HIST1H3H, H3FK, HIST1H3I, H3FF, HIST1H3J, H3FJ
;
? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? ?                
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1   106 Human     ? 
;HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
;
? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? ?                
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1   133 Human     ? 'HIST1H2AB, H2AFM, HIST1H2AE, H2AFA' ? ? ? ? ? ? 'Homo sapiens'      9606 ? ? 
? ? ? ? ? ?                
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1   128 Human     ? 'HIST1H2BJ, H2BFR' ? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1   137 Human     ? 
;H3C1, H3FA, HIST1H3A, H3C2, H3FL, HIST1H3B, H3C3, H3FC HIST1H3C, H3C4, H3FB, HIST1H3D, H3C6, H3FD, HIST1H3E, H3C7, H3FI, HIST1H3F, H3C8, H3FH, HIST1H3G, H3C10, H3FK, HIST1H3H, H3C11, H3FF, HIST1H3I, H3C12, H3FJ, HIST1H3J
;
? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? ?                
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 1 sample 'Biological sequence' 1   261 Jellyfish ? GFP ? ? ? ? ? ? 'Aequorea victoria' 6100 ? ? ? ? ? ? ? 'Cabbage looper' 
'Trichoplusia ni'                           7111   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 2 sample 'Biological sequence' 262 643 Human     ? 'POU5F1, OCT3, OCT4, OTF3' ? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? 
'Cabbage looper' 'Trichoplusia ni'                           7111   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9 1 sample 'Biological sequence' 1   105 Human     ? SOX2 ? ? ? ? ? ? 'Homo sapiens'      9606 ? ? ? ? ? ? ? 'Cabbage looper' 
'Trichoplusia ni'                           7111   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
6 1 sample 1 153 'synthetic construct' ? 32630 ? 
7 1 sample 1 147 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP H31_HUMAN   P68431 ? 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1  
2  UNP H4_HUMAN    P62805 ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1  
3  UNP H2A1B_HUMAN P04908 ? 3 
;MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
;
1  
4  UNP H2B1J_HUMAN P06899 ? 4 
;MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
;
1  
5  UNP H31_HUMAN   P68431 ? 5 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
;
1  
6  PDB 6T90        6T90   ? 6 ? 1  
7  PDB 6T90        6T90   ? 7 ? 1  
8  UNP GFP_AEQVI   P42212 ? 8 
;MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQ
HDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG
IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
;
1  
9  UNP PO5F1_HUMAN Q01860 ? 8 
;MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQV
GVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITL
GYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR
VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHF
GTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
;
1  
10 UNP SOX2_HUMAN  P48431 ? 9 
;SPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKT
KT
;
37 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6T90 A 4   ? 139 ? P68431 1  ? 136 ? 1    136 
2  2  6T90 B 4   ? 106 ? P62805 1  ? 103 ? 1    103 
3  3  6T90 C 4   ? 133 ? P04908 1  ? 130 ? 1    130 
4  4  6T90 D 4   ? 128 ? P06899 1  ? 125 ? 1    125 
5  5  6T90 E 4   ? 137 ? P68431 1  ? 134 ? 1    134 
6  2  6T90 F 4   ? 106 ? P62805 1  ? 103 ? 1    103 
7  3  6T90 G 4   ? 133 ? P04908 1  ? 130 ? 1    130 
8  4  6T90 H 4   ? 128 ? P06899 1  ? 125 ? 1    125 
9  6  6T90 I 1   ? 153 ? 6T90   -2 ? 150 ? -2   150 
10 7  6T90 J 1   ? 147 ? 6T90   1  ? 147 ? 1    147 
11 8  6T90 K 23  ? 261 ? P42212 1  ? 238 ? -248 -10 
12 9  6T90 K 272 ? 631 ? Q01860 1  ? 360 ? 1    360 
13 10 6T90 L 24  ? 105 ? P48431 37 ? 118 ? 37   118 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6T90 GLY A 1   ? UNP P68431 ?   ?   'expression tag'        -2   1  
1  6T90 SER A 2   ? UNP P68431 ?   ?   'expression tag'        -1   2  
1  6T90 HIS A 3   ? UNP P68431 ?   ?   'expression tag'        0    3  
2  6T90 GLY B 1   ? UNP P62805 ?   ?   'expression tag'        -2   4  
2  6T90 SER B 2   ? UNP P62805 ?   ?   'expression tag'        -1   5  
2  6T90 HIS B 3   ? UNP P62805 ?   ?   'expression tag'        0    6  
3  6T90 GLY C 1   ? UNP P04908 ?   ?   'expression tag'        -2   7  
3  6T90 SER C 2   ? UNP P04908 ?   ?   'expression tag'        -1   8  
3  6T90 HIS C 3   ? UNP P04908 ?   ?   'expression tag'        0    9  
4  6T90 GLY D 1   ? UNP P06899 ?   ?   'expression tag'        -2   10 
4  6T90 SER D 2   ? UNP P06899 ?   ?   'expression tag'        -1   11 
4  6T90 HIS D 3   ? UNP P06899 ?   ?   'expression tag'        0    12 
5  6T90 GLY E 1   ? UNP P68431 ?   ?   'expression tag'        -2   13 
5  6T90 SER E 2   ? UNP P68431 ?   ?   'expression tag'        -1   14 
5  6T90 HIS E 3   ? UNP P68431 ?   ?   'expression tag'        0    15 
6  6T90 GLY F 1   ? UNP P62805 ?   ?   'expression tag'        -2   16 
6  6T90 SER F 2   ? UNP P62805 ?   ?   'expression tag'        -1   17 
6  6T90 HIS F 3   ? UNP P62805 ?   ?   'expression tag'        0    18 
7  6T90 GLY G 1   ? UNP P04908 ?   ?   'expression tag'        -2   19 
7  6T90 SER G 2   ? UNP P04908 ?   ?   'expression tag'        -1   20 
7  6T90 HIS G 3   ? UNP P04908 ?   ?   'expression tag'        0    21 
8  6T90 GLY H 1   ? UNP P06899 ?   ?   'expression tag'        -2   22 
8  6T90 SER H 2   ? UNP P06899 ?   ?   'expression tag'        -1   23 
8  6T90 HIS H 3   ? UNP P06899 ?   ?   'expression tag'        0    24 
11 6T90 MET K 1   ? UNP P42212 ?   ?   'initiating methionine' -270 25 
11 6T90 ASP K 2   ? UNP P42212 ?   ?   'expression tag'        -269 26 
11 6T90 TRP K 3   ? UNP P42212 ?   ?   'expression tag'        -268 27 
11 6T90 SER K 4   ? UNP P42212 ?   ?   'expression tag'        -267 28 
11 6T90 HIS K 5   ? UNP P42212 ?   ?   'expression tag'        -266 29 
11 6T90 PRO K 6   ? UNP P42212 ?   ?   'expression tag'        -265 30 
11 6T90 GLN K 7   ? UNP P42212 ?   ?   'expression tag'        -264 31 
11 6T90 PHE K 8   ? UNP P42212 ?   ?   'expression tag'        -263 32 
11 6T90 GLU K 9   ? UNP P42212 ?   ?   'expression tag'        -262 33 
11 6T90 LYS K 10  ? UNP P42212 ?   ?   'expression tag'        -261 34 
11 6T90 SER K 11  ? UNP P42212 ?   ?   'expression tag'        -260 35 
11 6T90 ALA K 12  ? UNP P42212 ?   ?   'expression tag'        -259 36 
11 6T90 VAL K 13  ? UNP P42212 ?   ?   'expression tag'        -258 37 
11 6T90 ASP K 14  ? UNP P42212 ?   ?   'expression tag'        -257 38 
11 6T90 GLU K 15  ? UNP P42212 ?   ?   'expression tag'        -256 39 
11 6T90 ASN K 16  ? UNP P42212 ?   ?   'expression tag'        -255 40 
11 6T90 LEU K 17  ? UNP P42212 ?   ?   'expression tag'        -254 41 
11 6T90 TYR K 18  ? UNP P42212 ?   ?   'expression tag'        -253 42 
11 6T90 PHE K 19  ? UNP P42212 ?   ?   'expression tag'        -252 43 
11 6T90 GLN K 20  ? UNP P42212 ?   ?   'expression tag'        -251 44 
11 6T90 GLY K 21  ? UNP P42212 ?   ?   'expression tag'        -250 45 
11 6T90 GLY K 22  ? UNP P42212 ?   ?   'expression tag'        -249 46 
11 6T90 VAL K 24  ? UNP P42212 ?   ?   insertion               -247 47 
11 6T90 LEU K 87  ? UNP P42212 PHE 64  conflict                -184 48 
11 6T90 THR K 88  ? UNP P42212 SER 65  conflict                -183 49 
11 6T90 LYS K 229 ? UNP P42212 ALA 206 conflict                -42  50 
11 6T90 LEU K 254 ? UNP P42212 HIS 231 conflict                -17  51 
11 6T90 GLU K 262 ? UNP P42212 ?   ?   linker                  -9   52 
11 6T90 ALA K 263 ? UNP P42212 ?   ?   linker                  -8   53 
11 6T90 ALA K 264 ? UNP P42212 ?   ?   linker                  -7   54 
11 6T90 ALA K 265 ? UNP P42212 ?   ?   linker                  -6   55 
11 6T90 LYS K 266 ? UNP P42212 ?   ?   linker                  -5   56 
11 6T90 GLU K 267 ? UNP P42212 ?   ?   linker                  -4   57 
11 6T90 ALA K 268 ? UNP P42212 ?   ?   linker                  -3   58 
11 6T90 ALA K 269 ? UNP P42212 ?   ?   linker                  -2   59 
11 6T90 ALA K 270 ? UNP P42212 ?   ?   linker                  -1   60 
11 6T90 LYS K 271 ? UNP P42212 ?   ?   linker                  0    61 
12 6T90 LEU K 632 ? UNP Q01860 ?   ?   'expression tag'        361  62 
12 6T90 PRO K 633 ? UNP Q01860 ?   ?   'expression tag'        362  63 
12 6T90 GLU K 634 ? UNP Q01860 ?   ?   'expression tag'        363  64 
12 6T90 THR K 635 ? UNP Q01860 ?   ?   'expression tag'        364  65 
12 6T90 GLY K 636 ? UNP Q01860 ?   ?   'expression tag'        365  66 
12 6T90 GLY K 637 ? UNP Q01860 ?   ?   'expression tag'        366  67 
12 6T90 HIS K 638 ? UNP Q01860 ?   ?   'expression tag'        367  68 
12 6T90 HIS K 639 ? UNP Q01860 ?   ?   'expression tag'        368  69 
12 6T90 HIS K 640 ? UNP Q01860 ?   ?   'expression tag'        369  70 
12 6T90 HIS K 641 ? UNP Q01860 ?   ?   'expression tag'        370  71 
12 6T90 HIS K 642 ? UNP Q01860 ?   ?   'expression tag'        371  72 
12 6T90 HIS K 643 ? UNP Q01860 ?   ?   'expression tag'        372  73 
13 6T90 MET L 1   ? UNP P48431 ?   ?   'initiating methionine' 14   74 
13 6T90 ASP L 2   ? UNP P48431 ?   ?   'expression tag'        15   75 
13 6T90 TRP L 3   ? UNP P48431 ?   ?   'expression tag'        16   76 
13 6T90 SER L 4   ? UNP P48431 ?   ?   'expression tag'        17   77 
13 6T90 HIS L 5   ? UNP P48431 ?   ?   'expression tag'        18   78 
13 6T90 PRO L 6   ? UNP P48431 ?   ?   'expression tag'        19   79 
13 6T90 GLN L 7   ? UNP P48431 ?   ?   'expression tag'        20   80 
13 6T90 PHE L 8   ? UNP P48431 ?   ?   'expression tag'        21   81 
13 6T90 GLU L 9   ? UNP P48431 ?   ?   'expression tag'        22   82 
13 6T90 LYS L 10  ? UNP P48431 ?   ?   'expression tag'        23   83 
13 6T90 SER L 11  ? UNP P48431 ?   ?   'expression tag'        24   84 
13 6T90 ALA L 12  ? UNP P48431 ?   ?   'expression tag'        25   85 
13 6T90 VAL L 13  ? UNP P48431 ?   ?   'expression tag'        26   86 
13 6T90 ASP L 14  ? UNP P48431 ?   ?   'expression tag'        27   87 
13 6T90 GLU L 15  ? UNP P48431 ?   ?   'expression tag'        28   88 
13 6T90 ASN L 16  ? UNP P48431 ?   ?   'expression tag'        29   89 
13 6T90 LEU L 17  ? UNP P48431 ?   ?   'expression tag'        30   90 
13 6T90 TYR L 18  ? UNP P48431 ?   ?   'expression tag'        31   91 
13 6T90 PHE L 19  ? UNP P48431 ?   ?   'expression tag'        32   92 
13 6T90 GLN L 20  ? UNP P48431 ?   ?   'expression tag'        33   93 
13 6T90 GLY L 21  ? UNP P48431 ?   ?   'expression tag'        34   94 
13 6T90 GLY L 22  ? UNP P48431 ?   ?   'expression tag'        35   95 
13 6T90 MET L 23  ? UNP P48431 ?   ?   'expression tag'        36   96 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
PTD non-polymer         . PENTANEDIAL                          ? 'C5 H8 O2'        100.116 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6T90 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 6T90 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.008  ? 14163 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.594  ? 20335 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 22.727 ? 7541  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.045  ? 2291  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.021  ? 1707  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6T90 
_struct.title                        'OCT4-SOX2-bound nucleosome - SHL-6' 
_struct.pdbx_descriptor              
;Histone H3.1, Histone H4, Histone H2A type 1-B/E, Histone H2B type 1-J, G protein/GFP fusion protein,POU domain, class 5, transcription factor 1, SRY-box 2/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6T90 
_struct_keywords.text            'nucleosome, OCT4, SOX2, transcription factor, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 2  ? 
G N N 3  ? 
H N N 4  ? 
I N N 6  ? 
J N N 7  ? 
K N N 8  ? 
L N N 9  ? 
M N N 10 ? 
N N N 10 ? 
O N N 10 ? 
P N N 10 ? 
Q N N 10 ? 
R N N 10 ? 
S N N 10 ? 
T N N 10 ? 
U N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 48  ? SER A 61  ? GLY A 45  SER A 58  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 67  ? LYS A 83  ? ARG A 64  LYS A 80  1 ? 17 
HELX_P HELX_P3  AA3 GLN A 89  ? ALA A 118 ? GLN A 86  ALA A 115 1 ? 30 
HELX_P HELX_P4  AA4 MET A 124 ? GLY A 136 ? MET A 121 GLY A 133 1 ? 13 
HELX_P HELX_P5  AA5 ASP B 28  ? ILE B 33  ? ASP B 25  ILE B 30  5 ? 6  
HELX_P HELX_P6  AA6 THR B 34  ? GLY B 45  ? THR B 31  GLY B 42  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 53  ? ALA B 80  ? LEU B 50  ALA B 77  1 ? 28 
HELX_P HELX_P8  AA8 THR B 86  ? ARG B 96  ? THR B 83  ARG B 93  1 ? 11 
HELX_P HELX_P9  AA9 THR C 20  ? ALA C 25  ? THR C 17  ALA C 22  1 ? 6  
HELX_P HELX_P10 AB1 VAL C 31  ? GLY C 41  ? VAL C 28  GLY C 38  1 ? 11 
HELX_P HELX_P11 AB2 ALA C 49  ? ASN C 77  ? ALA C 46  ASN C 74  1 ? 29 
HELX_P HELX_P12 AB3 ILE C 83  ? ASN C 93  ? ILE C 80  ASN C 90  1 ? 11 
HELX_P HELX_P13 AB4 ASP C 94  ? LEU C 101 ? ASP C 91  LEU C 98  1 ? 8  
HELX_P HELX_P14 AB5 GLN C 116 ? LEU C 120 ? GLN C 113 LEU C 117 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 41  ? HIS D 53  ? TYR D 38  HIS D 50  1 ? 13 
HELX_P HELX_P16 AB7 SER D 59  ? ASN D 88  ? SER D 56  ASN D 85  1 ? 30 
HELX_P HELX_P17 AB8 THR D 94  ? LEU D 106 ? THR D 91  LEU D 103 1 ? 13 
HELX_P HELX_P18 AB9 PRO D 107 ? SER D 127 ? PRO D 104 SER D 124 1 ? 21 
HELX_P HELX_P19 AC1 GLY E 48  ? SER E 61  ? GLY E 45  SER E 58  1 ? 14 
HELX_P HELX_P20 AC2 ARG E 67  ? LYS E 83  ? ARG E 64  LYS E 80  1 ? 17 
HELX_P HELX_P21 AC3 GLN E 89  ? ALA E 118 ? GLN E 86  ALA E 115 1 ? 30 
HELX_P HELX_P22 AC4 MET E 124 ? GLY E 136 ? MET E 121 GLY E 133 1 ? 13 
HELX_P HELX_P23 AC5 ASP F 28  ? ILE F 33  ? ASP F 25  ILE F 30  5 ? 6  
HELX_P HELX_P24 AC6 THR F 34  ? GLY F 45  ? THR F 31  GLY F 42  1 ? 12 
HELX_P HELX_P25 AC7 LEU F 53  ? ALA F 80  ? LEU F 50  ALA F 77  1 ? 28 
HELX_P HELX_P26 AC8 THR F 86  ? ARG F 96  ? THR F 83  ARG F 93  1 ? 11 
HELX_P HELX_P27 AC9 THR G 20  ? ALA G 25  ? THR G 17  ALA G 22  1 ? 6  
HELX_P HELX_P28 AD1 VAL G 31  ? LYS G 40  ? VAL G 28  LYS G 37  1 ? 10 
HELX_P HELX_P29 AD2 GLY G 50  ? ASN G 77  ? GLY G 47  ASN G 74  1 ? 28 
HELX_P HELX_P30 AD3 ILE G 83  ? ASN G 93  ? ILE G 80  ASN G 90  1 ? 11 
HELX_P HELX_P31 AD4 ASP G 94  ? LEU G 101 ? ASP G 91  LEU G 98  1 ? 8  
HELX_P HELX_P32 AD5 GLN G 116 ? LEU G 120 ? GLN G 113 LEU G 117 5 ? 5  
HELX_P HELX_P33 AD6 TYR H 41  ? HIS H 53  ? TYR H 38  HIS H 50  1 ? 13 
HELX_P HELX_P34 AD7 SER H 59  ? ASN H 88  ? SER H 56  ASN H 85  1 ? 30 
HELX_P HELX_P35 AD8 THR H 94  ? LEU H 106 ? THR H 91  LEU H 103 1 ? 13 
HELX_P HELX_P36 AD9 PRO H 107 ? SER H 127 ? PRO H 104 SER H 124 1 ? 21 
HELX_P HELX_P37 AE1 ILE K 410 ? LEU K 431 ? ILE K 139 LEU K 160 1 ? 22 
HELX_P HELX_P38 AE2 THR K 434 ? GLY K 447 ? THR K 163 GLY K 176 1 ? 14 
HELX_P HELX_P39 AE3 SER K 451 ? ALA K 460 ? SER K 180 ALA K 189 1 ? 10 
HELX_P HELX_P40 AE4 SER K 464 ? GLU K 481 ? SER K 193 GLU K 210 1 ? 18 
HELX_P HELX_P41 AE5 ASN L 33  ? ASN L 50  ? ASN L 46  ASN L 63  1 ? 18 
HELX_P HELX_P42 AE6 HIS L 54  ? LEU L 68  ? HIS L 67  LEU L 81  1 ? 15 
HELX_P HELX_P43 AE7 SER L 70  ? HIS L 92  ? SER L 83  HIS L 105 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale none ? A LYS 83  NZ ? ? ? 1_555 N PTD .   C5 ? ? A LYS 80  A PTD 202 1_555 ? ? ? ? ? ? ?            1.263 ? 
covale2   covale none ? A LYS 119 NZ ? ? ? 1_555 M PTD .   C1 ? ? A LYS 116 A PTD 201 1_555 ? ? ? ? ? ? ?            1.263 ? 
covale3   covale none ? A LYS 126 NZ ? ? ? 1_555 R PTD .   C1 ? ? A LYS 123 E PTD 202 1_555 ? ? ? ? ? ? ?            1.264 ? 
covale4   covale none ? B LYS 83  NZ ? ? ? 1_555 N PTD .   C1 ? ? B LYS 80  A PTD 202 1_555 ? ? ? ? ? ? ?            1.263 ? 
covale5   covale none ? C LYS 40  NZ ? ? ? 1_555 O PTD .   C1 ? ? C LYS 37  C PTD 201 1_555 ? ? ? ? ? ? ?            1.260 ? 
covale6   covale none ? D LYS 47  NZ ? ? ? 1_555 P PTD .   C5 ? ? D LYS 44  D PTD 201 1_555 ? ? ? ? ? ? ?            1.264 ? 
covale7   covale none ? D LYS 50  NZ ? ? ? 1_555 P PTD .   C1 ? ? D LYS 47  D PTD 201 1_555 ? ? ? ? ? ? ?            1.263 ? 
covale8   covale none ? D LYS 89  NZ ? ? ? 1_555 S PTD .   C5 ? ? D LYS 86  G PTD 201 1_555 ? ? ? ? ? ? ?            1.270 ? 
covale9   covale none ? E LYS 83  NZ ? ? ? 1_555 Q PTD .   C1 ? ? E LYS 80  E PTD 201 1_555 ? ? ? ? ? ? ?            1.260 ? 
covale10  covale none ? E LYS 119 NZ ? ? ? 1_555 R PTD .   C5 ? ? E LYS 116 E PTD 202 1_555 ? ? ? ? ? ? ?            1.260 ? 
covale11  covale none ? E LYS 126 NZ ? ? ? 1_555 M PTD .   C5 ? ? E LYS 123 A PTD 201 1_555 ? ? ? ? ? ? ?            1.266 ? 
covale12  covale none ? F LYS 83  NZ ? ? ? 1_555 Q PTD .   C5 ? ? F LYS 80  E PTD 201 1_555 ? ? ? ? ? ? ?            1.263 ? 
covale13  covale none ? G LYS 40  NZ ? ? ? 1_555 S PTD .   C1 ? ? G LYS 37  G PTD 201 1_555 ? ? ? ? ? ? ?            1.264 ? 
covale14  covale none ? H LYS 47  NZ ? ? ? 1_555 T PTD .   C5 ? ? H LYS 44  H PTD 201 1_555 ? ? ? ? ? ? ?            1.265 ? 
covale15  covale none ? H LYS 50  NZ ? ? ? 1_555 T PTD .   C1 ? ? H LYS 47  H PTD 201 1_555 ? ? ? ? ? ? ?            1.261 ? 
covale16  covale none ? H LYS 89  NZ ? ? ? 1_555 O PTD .   C5 ? ? H LYS 86  C PTD 201 1_555 ? ? ? ? ? ? ?            1.266 ? 
covale17  covale none ? K LYS 422 NZ ? ? ? 1_555 U PTD .   C5 ? ? K LYS 151 K PTD 401 1_555 ? ? ? ? ? ? ?            1.267 ? 
covale18  covale none ? L LYS 96  NZ ? ? ? 1_555 U PTD .   C1 ? ? L LYS 109 K PTD 401 1_555 ? ? ? ? ? ? ?            1.269 ? 
hydrog1   hydrog ?    ? I DG  6   N1 ? ? ? 1_555 J DC  145 N3 ? ? I DG  3   J DC  145 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ?    ? I DG  6   N2 ? ? ? 1_555 J DC  145 O2 ? ? I DG  3   J DC  145 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ?    ? I DG  6   O6 ? ? ? 1_555 J DC  145 N4 ? ? I DG  3   J DC  145 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ?    ? I DG  7   N1 ? ? ? 1_555 J DC  144 N3 ? ? I DG  4   J DC  144 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ?    ? I DG  7   N2 ? ? ? 1_555 J DC  144 O2 ? ? I DG  4   J DC  144 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ?    ? I DG  7   O6 ? ? ? 1_555 J DC  144 N4 ? ? I DG  4   J DC  144 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ?    ? I DA  8   N1 ? ? ? 1_555 J DT  143 N3 ? ? I DA  5   J DT  143 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ?    ? I DA  8   N6 ? ? ? 1_555 J DT  143 O4 ? ? I DA  5   J DT  143 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ?    ? I DG  9   N1 ? ? ? 1_555 J DC  142 N3 ? ? I DG  6   J DC  142 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ?    ? I DG  9   N2 ? ? ? 1_555 J DC  142 O2 ? ? I DG  6   J DC  142 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ?    ? I DG  9   O6 ? ? ? 1_555 J DC  142 N4 ? ? I DG  6   J DC  142 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ?    ? I DA  10  N1 ? ? ? 1_555 J DT  141 N3 ? ? I DA  7   J DT  141 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ?    ? I DA  10  N6 ? ? ? 1_555 J DT  141 O4 ? ? I DA  7   J DT  141 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ?    ? I DC  11  N3 ? ? ? 1_555 J DG  140 N1 ? ? I DC  8   J DG  140 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ?    ? I DC  11  N4 ? ? ? 1_555 J DG  140 O6 ? ? I DC  8   J DG  140 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ?    ? I DC  11  O2 ? ? ? 1_555 J DG  140 N2 ? ? I DC  8   J DG  140 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ?    ? I DT  12  N3 ? ? ? 1_555 J DA  139 N1 ? ? I DT  9   J DA  139 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ?    ? I DT  12  O4 ? ? ? 1_555 J DA  139 N6 ? ? I DT  9   J DA  139 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ?    ? I DT  13  N3 ? ? ? 1_555 J DA  138 N1 ? ? I DT  10  J DA  138 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ?    ? I DT  13  O4 ? ? ? 1_555 J DA  138 N6 ? ? I DT  10  J DA  138 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ?    ? I DT  14  N3 ? ? ? 1_555 J DA  137 N1 ? ? I DT  11  J DA  137 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ?    ? I DT  14  O4 ? ? ? 1_555 J DA  137 N6 ? ? I DT  11  J DA  137 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ?    ? I DG  15  N1 ? ? ? 1_555 J DC  136 N3 ? ? I DG  12  J DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ?    ? I DG  15  N2 ? ? ? 1_555 J DC  136 O2 ? ? I DG  12  J DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ?    ? I DG  15  O6 ? ? ? 1_555 J DC  136 N4 ? ? I DG  12  J DC  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ?    ? I DT  16  N3 ? ? ? 1_555 J DA  135 N1 ? ? I DT  13  J DA  135 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ?    ? I DT  16  O4 ? ? ? 1_555 J DA  135 N6 ? ? I DT  13  J DA  135 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ?    ? I DT  17  N3 ? ? ? 1_555 J DA  134 N1 ? ? I DT  14  J DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ?    ? I DT  17  O4 ? ? ? 1_555 J DA  134 N6 ? ? I DT  14  J DA  134 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ?    ? I DA  18  N1 ? ? ? 1_555 J DT  133 N3 ? ? I DA  15  J DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ?    ? I DA  18  N6 ? ? ? 1_555 J DT  133 O4 ? ? I DA  15  J DT  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ?    ? I DT  19  N3 ? ? ? 1_555 J DA  132 N1 ? ? I DT  16  J DA  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ?    ? I DT  19  O4 ? ? ? 1_555 J DA  132 N6 ? ? I DT  16  J DA  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ?    ? I DG  20  N1 ? ? ? 1_555 J DC  131 N3 ? ? I DG  17  J DC  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ?    ? I DG  20  N2 ? ? ? 1_555 J DC  131 O2 ? ? I DG  17  J DC  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ?    ? I DG  20  O6 ? ? ? 1_555 J DC  131 N4 ? ? I DG  17  J DC  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ?    ? I DC  21  N3 ? ? ? 1_555 J DG  130 N1 ? ? I DC  18  J DG  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ?    ? I DC  21  N4 ? ? ? 1_555 J DG  130 O6 ? ? I DC  18  J DG  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ?    ? I DC  21  O2 ? ? ? 1_555 J DG  130 N2 ? ? I DC  18  J DG  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ?    ? I DA  22  N1 ? ? ? 1_555 J DT  129 N3 ? ? I DA  19  J DT  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ?    ? I DA  22  N6 ? ? ? 1_555 J DT  129 O4 ? ? I DA  19  J DT  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ?    ? I DA  23  N1 ? ? ? 1_555 J DT  128 N3 ? ? I DA  20  J DT  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ?    ? I DA  23  N6 ? ? ? 1_555 J DT  128 O4 ? ? I DA  20  J DT  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ?    ? I DA  24  N1 ? ? ? 1_555 J DT  127 N3 ? ? I DA  21  J DT  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ?    ? I DA  24  N6 ? ? ? 1_555 J DT  127 O4 ? ? I DA  21  J DT  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ?    ? I DT  25  N3 ? ? ? 1_555 J DA  126 N1 ? ? I DT  22  J DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ?    ? I DT  25  O4 ? ? ? 1_555 J DA  126 N6 ? ? I DT  22  J DA  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ?    ? I DC  26  N3 ? ? ? 1_555 J DG  125 N1 ? ? I DC  23  J DG  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ?    ? I DC  26  N4 ? ? ? 1_555 J DG  125 O6 ? ? I DC  23  J DG  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ?    ? I DC  26  O2 ? ? ? 1_555 J DG  125 N2 ? ? I DC  23  J DG  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ?    ? I DC  27  N3 ? ? ? 1_555 J DG  124 N1 ? ? I DC  24  J DG  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ?    ? I DC  27  N4 ? ? ? 1_555 J DG  124 O6 ? ? I DC  24  J DG  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ?    ? I DC  27  O2 ? ? ? 1_555 J DG  124 N2 ? ? I DC  24  J DG  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ?    ? I DG  28  N1 ? ? ? 1_555 J DC  123 N3 ? ? I DG  25  J DC  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ?    ? I DG  28  N2 ? ? ? 1_555 J DC  123 O2 ? ? I DG  25  J DC  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ?    ? I DG  28  O6 ? ? ? 1_555 J DC  123 N4 ? ? I DG  25  J DC  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ?    ? I DC  29  N3 ? ? ? 1_555 J DG  122 N1 ? ? I DC  26  J DG  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ?    ? I DC  29  N4 ? ? ? 1_555 J DG  122 O6 ? ? I DC  26  J DG  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ?    ? I DC  29  O2 ? ? ? 1_555 J DG  122 N2 ? ? I DC  26  J DG  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ?    ? I DT  30  N3 ? ? ? 1_555 J DA  121 N1 ? ? I DT  27  J DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ?    ? I DT  30  O4 ? ? ? 1_555 J DA  121 N6 ? ? I DT  27  J DA  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ?    ? I DC  31  N3 ? ? ? 1_555 J DG  120 N1 ? ? I DC  28  J DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ?    ? I DC  31  N4 ? ? ? 1_555 J DG  120 O6 ? ? I DC  28  J DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ?    ? I DC  31  O2 ? ? ? 1_555 J DG  120 N2 ? ? I DC  28  J DG  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ?    ? I DA  32  N1 ? ? ? 1_555 J DT  119 N3 ? ? I DA  29  J DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ?    ? I DA  32  N6 ? ? ? 1_555 J DT  119 O4 ? ? I DA  29  J DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ?    ? I DA  33  N1 ? ? ? 1_555 J DT  118 N3 ? ? I DA  30  J DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ?    ? I DA  33  N6 ? ? ? 1_555 J DT  118 O4 ? ? I DA  30  J DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ?    ? I DT  34  N3 ? ? ? 1_555 J DA  117 N1 ? ? I DT  31  J DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ?    ? I DT  34  O4 ? ? ? 1_555 J DA  117 N6 ? ? I DT  31  J DA  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ?    ? I DT  35  N3 ? ? ? 1_555 J DA  116 N1 ? ? I DT  32  J DA  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ?    ? I DT  35  O4 ? ? ? 1_555 J DA  116 N6 ? ? I DT  32  J DA  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ?    ? I DG  36  N1 ? ? ? 1_555 J DC  115 N3 ? ? I DG  33  J DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ?    ? I DG  36  N2 ? ? ? 1_555 J DC  115 O2 ? ? I DG  33  J DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ?    ? I DG  36  O6 ? ? ? 1_555 J DC  115 N4 ? ? I DG  33  J DC  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ?    ? I DG  37  N1 ? ? ? 1_555 J DC  114 N3 ? ? I DG  34  J DC  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ?    ? I DG  37  N2 ? ? ? 1_555 J DC  114 O2 ? ? I DG  34  J DC  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ?    ? I DG  37  O6 ? ? ? 1_555 J DC  114 N4 ? ? I DG  34  J DC  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ?    ? I DT  38  N3 ? ? ? 1_555 J DA  113 N1 ? ? I DT  35  J DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ?    ? I DT  38  O4 ? ? ? 1_555 J DA  113 N6 ? ? I DT  35  J DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ?    ? I DC  39  N3 ? ? ? 1_555 J DG  112 N1 ? ? I DC  36  J DG  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ?    ? I DC  39  N4 ? ? ? 1_555 J DG  112 O6 ? ? I DC  36  J DG  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ?    ? I DC  39  O2 ? ? ? 1_555 J DG  112 N2 ? ? I DC  36  J DG  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ?    ? I DG  40  N1 ? ? ? 1_555 J DC  111 N3 ? ? I DG  37  J DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ?    ? I DG  40  N2 ? ? ? 1_555 J DC  111 O2 ? ? I DG  37  J DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ?    ? I DG  40  O6 ? ? ? 1_555 J DC  111 N4 ? ? I DG  37  J DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ?    ? I DT  41  N3 ? ? ? 1_555 J DA  110 N1 ? ? I DT  38  J DA  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ?    ? I DT  41  O4 ? ? ? 1_555 J DA  110 N6 ? ? I DT  38  J DA  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ?    ? I DA  42  N1 ? ? ? 1_555 J DT  109 N3 ? ? I DA  39  J DT  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ?    ? I DA  42  N6 ? ? ? 1_555 J DT  109 O4 ? ? I DA  39  J DT  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ?    ? I DG  43  N1 ? ? ? 1_555 J DC  108 N3 ? ? I DG  40  J DC  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ?    ? I DG  43  N2 ? ? ? 1_555 J DC  108 O2 ? ? I DG  40  J DC  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ?    ? I DG  43  O6 ? ? ? 1_555 J DC  108 N4 ? ? I DG  40  J DC  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ?    ? I DA  44  N1 ? ? ? 1_555 J DT  107 N3 ? ? I DA  41  J DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ?    ? I DA  44  N6 ? ? ? 1_555 J DT  107 O4 ? ? I DA  41  J DT  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ?    ? I DC  45  N3 ? ? ? 1_555 J DG  106 N1 ? ? I DC  42  J DG  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ?    ? I DC  45  N4 ? ? ? 1_555 J DG  106 O6 ? ? I DC  42  J DG  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ?    ? I DC  45  O2 ? ? ? 1_555 J DG  106 N2 ? ? I DC  42  J DG  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ?    ? I DA  46  N1 ? ? ? 1_555 J DT  105 N3 ? ? I DA  43  J DT  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ?    ? I DA  46  N6 ? ? ? 1_555 J DT  105 O4 ? ? I DA  43  J DT  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ?    ? I DG  47  N1 ? ? ? 1_555 J DC  104 N3 ? ? I DG  44  J DC  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ?    ? I DG  47  N2 ? ? ? 1_555 J DC  104 O2 ? ? I DG  44  J DC  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ?    ? I DG  47  O6 ? ? ? 1_555 J DC  104 N4 ? ? I DG  44  J DC  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ?    ? I DC  48  N3 ? ? ? 1_555 J DG  103 N1 ? ? I DC  45  J DG  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ?    ? I DC  48  N4 ? ? ? 1_555 J DG  103 O6 ? ? I DC  45  J DG  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ?    ? I DC  48  O2 ? ? ? 1_555 J DG  103 N2 ? ? I DC  45  J DG  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ?    ? I DT  49  N3 ? ? ? 1_555 J DA  102 N1 ? ? I DT  46  J DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ?    ? I DT  49  O4 ? ? ? 1_555 J DA  102 N6 ? ? I DT  46  J DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ?    ? I DC  50  N3 ? ? ? 1_555 J DG  101 N1 ? ? I DC  47  J DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ?    ? I DC  50  N4 ? ? ? 1_555 J DG  101 O6 ? ? I DC  47  J DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ?    ? I DC  50  O2 ? ? ? 1_555 J DG  101 N2 ? ? I DC  47  J DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ?    ? I DT  51  N3 ? ? ? 1_555 J DA  100 N1 ? ? I DT  48  J DA  100 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ?    ? I DT  51  O4 ? ? ? 1_555 J DA  100 N6 ? ? I DT  48  J DA  100 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ?    ? I DA  52  N1 ? ? ? 1_555 J DT  99  N3 ? ? I DA  49  J DT  99  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ?    ? I DA  52  N6 ? ? ? 1_555 J DT  99  O4 ? ? I DA  49  J DT  99  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ?    ? I DG  53  N1 ? ? ? 1_555 J DC  98  N3 ? ? I DG  50  J DC  98  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ?    ? I DG  53  N2 ? ? ? 1_555 J DC  98  O2 ? ? I DG  50  J DC  98  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ?    ? I DG  53  O6 ? ? ? 1_555 J DC  98  N4 ? ? I DG  50  J DC  98  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ?    ? I DC  54  N3 ? ? ? 1_555 J DG  97  N1 ? ? I DC  51  J DG  97  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ?    ? I DC  54  N4 ? ? ? 1_555 J DG  97  O6 ? ? I DC  51  J DG  97  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ?    ? I DC  54  O2 ? ? ? 1_555 J DG  97  N2 ? ? I DC  51  J DG  97  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ?    ? I DA  55  N1 ? ? ? 1_555 J DT  96  N3 ? ? I DA  52  J DT  96  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ?    ? I DA  55  N6 ? ? ? 1_555 J DT  96  O4 ? ? I DA  52  J DT  96  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ?    ? I DC  56  N3 ? ? ? 1_555 J DG  95  N1 ? ? I DC  53  J DG  95  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ?    ? I DC  56  N4 ? ? ? 1_555 J DG  95  O6 ? ? I DC  53  J DG  95  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ?    ? I DC  56  O2 ? ? ? 1_555 J DG  95  N2 ? ? I DC  53  J DG  95  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ?    ? I DC  57  N3 ? ? ? 1_555 J DG  94  N1 ? ? I DC  54  J DG  94  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ?    ? I DC  57  N4 ? ? ? 1_555 J DG  94  O6 ? ? I DC  54  J DG  94  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ?    ? I DC  57  O2 ? ? ? 1_555 J DG  94  N2 ? ? I DC  54  J DG  94  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ?    ? I DG  58  N1 ? ? ? 1_555 J DC  93  N3 ? ? I DG  55  J DC  93  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ?    ? I DG  58  N2 ? ? ? 1_555 J DC  93  O2 ? ? I DG  55  J DC  93  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ?    ? I DG  58  O6 ? ? ? 1_555 J DC  93  N4 ? ? I DG  55  J DC  93  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ?    ? I DC  59  N3 ? ? ? 1_555 J DG  92  N1 ? ? I DC  56  J DG  92  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ?    ? I DC  59  N4 ? ? ? 1_555 J DG  92  O6 ? ? I DC  56  J DG  92  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ?    ? I DC  59  O2 ? ? ? 1_555 J DG  92  N2 ? ? I DC  56  J DG  92  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ?    ? I DT  60  N3 ? ? ? 1_555 J DA  91  N1 ? ? I DT  57  J DA  91  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ?    ? I DT  60  O4 ? ? ? 1_555 J DA  91  N6 ? ? I DT  57  J DA  91  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ?    ? I DT  61  N3 ? ? ? 1_555 J DA  90  N1 ? ? I DT  58  J DA  90  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ?    ? I DT  61  O4 ? ? ? 1_555 J DA  90  N6 ? ? I DT  58  J DA  90  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ?    ? I DA  62  N1 ? ? ? 1_555 J DT  89  N3 ? ? I DA  59  J DT  89  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ?    ? I DA  62  N6 ? ? ? 1_555 J DT  89  O4 ? ? I DA  59  J DT  89  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ?    ? I DA  63  N1 ? ? ? 1_555 J DT  88  N3 ? ? I DA  60  J DT  88  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ?    ? I DA  63  N6 ? ? ? 1_555 J DT  88  O4 ? ? I DA  60  J DT  88  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ?    ? I DA  64  N1 ? ? ? 1_555 J DT  87  N3 ? ? I DA  61  J DT  87  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ?    ? I DA  64  N6 ? ? ? 1_555 J DT  87  O4 ? ? I DA  61  J DT  87  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ?    ? I DC  65  N3 ? ? ? 1_555 J DG  86  N1 ? ? I DC  62  J DG  86  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ?    ? I DC  65  N4 ? ? ? 1_555 J DG  86  O6 ? ? I DC  62  J DG  86  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ?    ? I DC  65  O2 ? ? ? 1_555 J DG  86  N2 ? ? I DC  62  J DG  86  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ?    ? I DG  66  N1 ? ? ? 1_555 J DC  85  N3 ? ? I DG  63  J DC  85  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ?    ? I DG  66  N2 ? ? ? 1_555 J DC  85  O2 ? ? I DG  63  J DC  85  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ?    ? I DG  66  O6 ? ? ? 1_555 J DC  85  N4 ? ? I DG  63  J DC  85  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ?    ? I DC  67  N3 ? ? ? 1_555 J DG  84  N1 ? ? I DC  64  J DG  84  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ?    ? I DC  67  N4 ? ? ? 1_555 J DG  84  O6 ? ? I DC  64  J DG  84  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ?    ? I DC  67  O2 ? ? ? 1_555 J DG  84  N2 ? ? I DC  64  J DG  84  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ?    ? I DA  68  N1 ? ? ? 1_555 J DT  83  N3 ? ? I DA  65  J DT  83  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ?    ? I DA  68  N6 ? ? ? 1_555 J DT  83  O4 ? ? I DA  65  J DT  83  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ?    ? I DC  69  N3 ? ? ? 1_555 J DG  82  N1 ? ? I DC  66  J DG  82  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ?    ? I DC  69  N4 ? ? ? 1_555 J DG  82  O6 ? ? I DC  66  J DG  82  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ?    ? I DC  69  O2 ? ? ? 1_555 J DG  82  N2 ? ? I DC  66  J DG  82  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog160 hydrog ?    ? I DG  70  N1 ? ? ? 1_555 J DC  81  N3 ? ? I DG  67  J DC  81  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ?    ? I DG  70  N2 ? ? ? 1_555 J DC  81  O2 ? ? I DG  67  J DC  81  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ?    ? I DG  70  O6 ? ? ? 1_555 J DC  81  N4 ? ? I DG  67  J DC  81  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ?    ? I DT  71  N3 ? ? ? 1_555 J DA  80  N1 ? ? I DT  68  J DA  80  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ?    ? I DT  71  O4 ? ? ? 1_555 J DA  80  N6 ? ? I DT  68  J DA  80  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog165 hydrog ?    ? I DA  72  N1 ? ? ? 1_555 J DT  79  N3 ? ? I DA  69  J DT  79  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog166 hydrog ?    ? I DA  72  N6 ? ? ? 1_555 J DT  79  O4 ? ? I DA  69  J DT  79  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog167 hydrog ?    ? I DC  73  N3 ? ? ? 1_555 J DG  78  N1 ? ? I DC  70  J DG  78  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog168 hydrog ?    ? I DC  73  N4 ? ? ? 1_555 J DG  78  O6 ? ? I DC  70  J DG  78  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog169 hydrog ?    ? I DC  73  O2 ? ? ? 1_555 J DG  78  N2 ? ? I DC  70  J DG  78  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog170 hydrog ?    ? I DG  74  N1 ? ? ? 1_555 J DC  77  N3 ? ? I DG  71  J DC  77  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog171 hydrog ?    ? I DG  74  N2 ? ? ? 1_555 J DC  77  O2 ? ? I DG  71  J DC  77  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog172 hydrog ?    ? I DG  74  O6 ? ? ? 1_555 J DC  77  N4 ? ? I DG  71  J DC  77  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog173 hydrog ?    ? I DC  75  N3 ? ? ? 1_555 J DG  76  N1 ? ? I DC  72  J DG  76  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog174 hydrog ?    ? I DC  75  N4 ? ? ? 1_555 J DG  76  O6 ? ? I DC  72  J DG  76  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog175 hydrog ?    ? I DC  75  O2 ? ? ? 1_555 J DG  76  N2 ? ? I DC  72  J DG  76  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog176 hydrog ?    ? I DG  76  N1 ? ? ? 1_555 J DC  75  N3 ? ? I DG  73  J DC  75  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog177 hydrog ?    ? I DG  76  N2 ? ? ? 1_555 J DC  75  O2 ? ? I DG  73  J DC  75  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog178 hydrog ?    ? I DG  76  O6 ? ? ? 1_555 J DC  75  N4 ? ? I DG  73  J DC  75  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog179 hydrog ?    ? I DC  77  N3 ? ? ? 1_555 J DG  74  N1 ? ? I DC  74  J DG  74  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog180 hydrog ?    ? I DC  77  N4 ? ? ? 1_555 J DG  74  O6 ? ? I DC  74  J DG  74  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog181 hydrog ?    ? I DC  77  O2 ? ? ? 1_555 J DG  74  N2 ? ? I DC  74  J DG  74  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog182 hydrog ?    ? I DT  78  N3 ? ? ? 1_555 J DA  73  N1 ? ? I DT  75  J DA  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog183 hydrog ?    ? I DT  78  O4 ? ? ? 1_555 J DA  73  N6 ? ? I DT  75  J DA  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog184 hydrog ?    ? I DG  79  N1 ? ? ? 1_555 J DC  72  N3 ? ? I DG  76  J DC  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog185 hydrog ?    ? I DG  79  N2 ? ? ? 1_555 J DC  72  O2 ? ? I DG  76  J DC  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog186 hydrog ?    ? I DG  79  O6 ? ? ? 1_555 J DC  72  N4 ? ? I DG  76  J DC  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog187 hydrog ?    ? I DT  80  N3 ? ? ? 1_555 J DA  71  N1 ? ? I DT  77  J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog188 hydrog ?    ? I DT  80  O4 ? ? ? 1_555 J DA  71  N6 ? ? I DT  77  J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog189 hydrog ?    ? I DC  81  N3 ? ? ? 1_555 J DG  70  N1 ? ? I DC  78  J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog190 hydrog ?    ? I DC  81  N4 ? ? ? 1_555 J DG  70  O6 ? ? I DC  78  J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog191 hydrog ?    ? I DC  81  O2 ? ? ? 1_555 J DG  70  N2 ? ? I DC  78  J DG  70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog192 hydrog ?    ? I DC  82  N3 ? ? ? 1_555 J DG  69  N1 ? ? I DC  79  J DG  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog193 hydrog ?    ? I DC  82  N4 ? ? ? 1_555 J DG  69  O6 ? ? I DC  79  J DG  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog194 hydrog ?    ? I DC  82  O2 ? ? ? 1_555 J DG  69  N2 ? ? I DC  79  J DG  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog195 hydrog ?    ? I DC  83  N3 ? ? ? 1_555 J DG  68  N1 ? ? I DC  80  J DG  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog196 hydrog ?    ? I DC  83  N4 ? ? ? 1_555 J DG  68  O6 ? ? I DC  80  J DG  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog197 hydrog ?    ? I DC  83  O2 ? ? ? 1_555 J DG  68  N2 ? ? I DC  80  J DG  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog198 hydrog ?    ? I DC  84  N3 ? ? ? 1_555 J DG  67  N1 ? ? I DC  81  J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog199 hydrog ?    ? I DC  84  N4 ? ? ? 1_555 J DG  67  O6 ? ? I DC  81  J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog200 hydrog ?    ? I DC  84  O2 ? ? ? 1_555 J DG  67  N2 ? ? I DC  81  J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog201 hydrog ?    ? I DC  85  N3 ? ? ? 1_555 J DG  66  N1 ? ? I DC  82  J DG  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog202 hydrog ?    ? I DC  85  N4 ? ? ? 1_555 J DG  66  O6 ? ? I DC  82  J DG  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog203 hydrog ?    ? I DC  85  O2 ? ? ? 1_555 J DG  66  N2 ? ? I DC  82  J DG  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog204 hydrog ?    ? I DG  86  N1 ? ? ? 1_555 J DC  65  N3 ? ? I DG  83  J DC  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog205 hydrog ?    ? I DG  86  N2 ? ? ? 1_555 J DC  65  O2 ? ? I DG  83  J DC  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog206 hydrog ?    ? I DG  86  O6 ? ? ? 1_555 J DC  65  N4 ? ? I DG  83  J DC  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog207 hydrog ?    ? I DC  87  N3 ? ? ? 1_555 J DG  64  N1 ? ? I DC  84  J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog208 hydrog ?    ? I DC  87  N4 ? ? ? 1_555 J DG  64  O6 ? ? I DC  84  J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog209 hydrog ?    ? I DC  87  O2 ? ? ? 1_555 J DG  64  N2 ? ? I DC  84  J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog210 hydrog ?    ? I DG  88  N1 ? ? ? 1_555 J DC  63  N3 ? ? I DG  85  J DC  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog211 hydrog ?    ? I DG  88  N2 ? ? ? 1_555 J DC  63  O2 ? ? I DG  85  J DC  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog212 hydrog ?    ? I DG  88  O6 ? ? ? 1_555 J DC  63  N4 ? ? I DG  85  J DC  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog213 hydrog ?    ? I DT  89  N3 ? ? ? 1_555 J DA  62  N1 ? ? I DT  86  J DA  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog214 hydrog ?    ? I DT  89  O4 ? ? ? 1_555 J DA  62  N6 ? ? I DT  86  J DA  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog215 hydrog ?    ? I DT  90  N3 ? ? ? 1_555 J DA  61  N1 ? ? I DT  87  J DA  61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog216 hydrog ?    ? I DT  90  O4 ? ? ? 1_555 J DA  61  N6 ? ? I DT  87  J DA  61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog217 hydrog ?    ? I DT  91  N3 ? ? ? 1_555 J DA  60  N1 ? ? I DT  88  J DA  60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog218 hydrog ?    ? I DT  91  O4 ? ? ? 1_555 J DA  60  N6 ? ? I DT  88  J DA  60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog219 hydrog ?    ? I DT  92  N3 ? ? ? 1_555 J DA  59  N1 ? ? I DT  89  J DA  59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog220 hydrog ?    ? I DT  92  O4 ? ? ? 1_555 J DA  59  N6 ? ? I DT  89  J DA  59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog221 hydrog ?    ? I DA  93  N1 ? ? ? 1_555 J DT  58  N3 ? ? I DA  90  J DT  58  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog222 hydrog ?    ? I DA  93  N6 ? ? ? 1_555 J DT  58  O4 ? ? I DA  90  J DT  58  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog223 hydrog ?    ? I DA  94  N1 ? ? ? 1_555 J DT  57  N3 ? ? I DA  91  J DT  57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog224 hydrog ?    ? I DA  94  N6 ? ? ? 1_555 J DT  57  O4 ? ? I DA  91  J DT  57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog225 hydrog ?    ? I DC  95  N3 ? ? ? 1_555 J DG  56  N1 ? ? I DC  92  J DG  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog226 hydrog ?    ? I DC  95  N4 ? ? ? 1_555 J DG  56  O6 ? ? I DC  92  J DG  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog227 hydrog ?    ? I DC  95  O2 ? ? ? 1_555 J DG  56  N2 ? ? I DC  92  J DG  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog228 hydrog ?    ? I DC  96  N3 ? ? ? 1_555 J DG  55  N1 ? ? I DC  93  J DG  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog229 hydrog ?    ? I DC  96  N4 ? ? ? 1_555 J DG  55  O6 ? ? I DC  93  J DG  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog230 hydrog ?    ? I DC  96  O2 ? ? ? 1_555 J DG  55  N2 ? ? I DC  93  J DG  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog231 hydrog ?    ? I DG  97  N1 ? ? ? 1_555 J DC  54  N3 ? ? I DG  94  J DC  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog232 hydrog ?    ? I DG  97  N2 ? ? ? 1_555 J DC  54  O2 ? ? I DG  94  J DC  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog233 hydrog ?    ? I DG  97  O6 ? ? ? 1_555 J DC  54  N4 ? ? I DG  94  J DC  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog234 hydrog ?    ? I DC  98  N3 ? ? ? 1_555 J DG  53  N1 ? ? I DC  95  J DG  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog235 hydrog ?    ? I DC  98  N4 ? ? ? 1_555 J DG  53  O6 ? ? I DC  95  J DG  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog236 hydrog ?    ? I DC  98  O2 ? ? ? 1_555 J DG  53  N2 ? ? I DC  95  J DG  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog237 hydrog ?    ? I DC  99  N3 ? ? ? 1_555 J DG  52  N1 ? ? I DC  96  J DG  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog238 hydrog ?    ? I DC  99  N4 ? ? ? 1_555 J DG  52  O6 ? ? I DC  96  J DG  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog239 hydrog ?    ? I DC  99  O2 ? ? ? 1_555 J DG  52  N2 ? ? I DC  96  J DG  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog240 hydrog ?    ? I DA  100 N1 ? ? ? 1_555 J DT  51  N3 ? ? I DA  97  J DT  51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog241 hydrog ?    ? I DA  100 N6 ? ? ? 1_555 J DT  51  O4 ? ? I DA  97  J DT  51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog242 hydrog ?    ? I DA  101 N1 ? ? ? 1_555 J DT  50  N3 ? ? I DA  98  J DT  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog243 hydrog ?    ? I DA  101 N6 ? ? ? 1_555 J DT  50  O4 ? ? I DA  98  J DT  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog244 hydrog ?    ? I DG  102 N1 ? ? ? 1_555 J DC  49  N3 ? ? I DG  99  J DC  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog245 hydrog ?    ? I DG  102 N2 ? ? ? 1_555 J DC  49  O2 ? ? I DG  99  J DC  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog246 hydrog ?    ? I DG  102 O6 ? ? ? 1_555 J DC  49  N4 ? ? I DG  99  J DC  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog247 hydrog ?    ? I DG  103 N1 ? ? ? 1_555 J DC  48  N3 ? ? I DG  100 J DC  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog248 hydrog ?    ? I DG  103 N2 ? ? ? 1_555 J DC  48  O2 ? ? I DG  100 J DC  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog249 hydrog ?    ? I DG  103 O6 ? ? ? 1_555 J DC  48  N4 ? ? I DG  100 J DC  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog250 hydrog ?    ? I DG  104 N1 ? ? ? 1_555 J DC  47  N3 ? ? I DG  101 J DC  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog251 hydrog ?    ? I DG  104 N2 ? ? ? 1_555 J DC  47  O2 ? ? I DG  101 J DC  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog252 hydrog ?    ? I DG  104 O6 ? ? ? 1_555 J DC  47  N4 ? ? I DG  101 J DC  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog253 hydrog ?    ? I DG  105 N1 ? ? ? 1_555 J DC  46  N3 ? ? I DG  102 J DC  46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog254 hydrog ?    ? I DG  105 N2 ? ? ? 1_555 J DC  46  O2 ? ? I DG  102 J DC  46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog255 hydrog ?    ? I DG  105 O6 ? ? ? 1_555 J DC  46  N4 ? ? I DG  102 J DC  46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog256 hydrog ?    ? I DA  106 N1 ? ? ? 1_555 J DT  45  N3 ? ? I DA  103 J DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog257 hydrog ?    ? I DA  106 N6 ? ? ? 1_555 J DT  45  O4 ? ? I DA  103 J DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog258 hydrog ?    ? I DT  107 N3 ? ? ? 1_555 J DA  44  N1 ? ? I DT  104 J DA  44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog259 hydrog ?    ? I DT  107 O4 ? ? ? 1_555 J DA  44  N6 ? ? I DT  104 J DA  44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog260 hydrog ?    ? I DT  108 N3 ? ? ? 1_555 J DA  43  N1 ? ? I DT  105 J DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog261 hydrog ?    ? I DT  108 O4 ? ? ? 1_555 J DA  43  N6 ? ? I DT  105 J DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog262 hydrog ?    ? I DA  109 N1 ? ? ? 1_555 J DT  42  N3 ? ? I DA  106 J DT  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog263 hydrog ?    ? I DA  109 N6 ? ? ? 1_555 J DT  42  O4 ? ? I DA  106 J DT  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog264 hydrog ?    ? I DC  110 N3 ? ? ? 1_555 J DG  41  N1 ? ? I DC  107 J DG  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog265 hydrog ?    ? I DC  110 N4 ? ? ? 1_555 J DG  41  O6 ? ? I DC  107 J DG  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog266 hydrog ?    ? I DC  110 O2 ? ? ? 1_555 J DG  41  N2 ? ? I DC  107 J DG  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog267 hydrog ?    ? I DT  111 N3 ? ? ? 1_555 J DA  40  N1 ? ? I DT  108 J DA  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog268 hydrog ?    ? I DT  111 O4 ? ? ? 1_555 J DA  40  N6 ? ? I DT  108 J DA  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog269 hydrog ?    ? I DC  112 N3 ? ? ? 1_555 J DG  39  N1 ? ? I DC  109 J DG  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog270 hydrog ?    ? I DC  112 N4 ? ? ? 1_555 J DG  39  O6 ? ? I DC  109 J DG  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog271 hydrog ?    ? I DC  112 O2 ? ? ? 1_555 J DG  39  N2 ? ? I DC  109 J DG  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog272 hydrog ?    ? I DC  113 N3 ? ? ? 1_555 J DG  38  N1 ? ? I DC  110 J DG  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog273 hydrog ?    ? I DC  113 N4 ? ? ? 1_555 J DG  38  O6 ? ? I DC  110 J DG  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog274 hydrog ?    ? I DC  113 O2 ? ? ? 1_555 J DG  38  N2 ? ? I DC  110 J DG  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog275 hydrog ?    ? I DC  114 N3 ? ? ? 1_555 J DG  37  N1 ? ? I DC  111 J DG  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog276 hydrog ?    ? I DC  114 N4 ? ? ? 1_555 J DG  37  O6 ? ? I DC  111 J DG  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog277 hydrog ?    ? I DC  114 O2 ? ? ? 1_555 J DG  37  N2 ? ? I DC  111 J DG  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog278 hydrog ?    ? I DT  115 N3 ? ? ? 1_555 J DA  36  N1 ? ? I DT  112 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog279 hydrog ?    ? I DT  115 O4 ? ? ? 1_555 J DA  36  N6 ? ? I DT  112 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog280 hydrog ?    ? I DA  116 N1 ? ? ? 1_555 J DT  35  N3 ? ? I DA  113 J DT  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog281 hydrog ?    ? I DA  116 N6 ? ? ? 1_555 J DT  35  O4 ? ? I DA  113 J DT  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog282 hydrog ?    ? I DG  117 N1 ? ? ? 1_555 J DC  34  N3 ? ? I DG  114 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog283 hydrog ?    ? I DG  117 N2 ? ? ? 1_555 J DC  34  O2 ? ? I DG  114 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog284 hydrog ?    ? I DG  117 O6 ? ? ? 1_555 J DC  34  N4 ? ? I DG  114 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog285 hydrog ?    ? I DT  118 N3 ? ? ? 1_555 J DA  33  N1 ? ? I DT  115 J DA  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog286 hydrog ?    ? I DT  118 O4 ? ? ? 1_555 J DA  33  N6 ? ? I DT  115 J DA  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog287 hydrog ?    ? I DC  119 N3 ? ? ? 1_555 J DG  32  N1 ? ? I DC  116 J DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog288 hydrog ?    ? I DC  119 N4 ? ? ? 1_555 J DG  32  O6 ? ? I DC  116 J DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog289 hydrog ?    ? I DC  119 O2 ? ? ? 1_555 J DG  32  N2 ? ? I DC  116 J DG  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog290 hydrog ?    ? I DT  120 N3 ? ? ? 1_555 J DA  31  N1 ? ? I DT  117 J DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog291 hydrog ?    ? I DT  120 O4 ? ? ? 1_555 J DA  31  N6 ? ? I DT  117 J DA  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog292 hydrog ?    ? I DC  121 N3 ? ? ? 1_555 J DG  30  N1 ? ? I DC  118 J DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog293 hydrog ?    ? I DC  121 N4 ? ? ? 1_555 J DG  30  O6 ? ? I DC  118 J DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog294 hydrog ?    ? I DC  121 O2 ? ? ? 1_555 J DG  30  N2 ? ? I DC  118 J DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog295 hydrog ?    ? I DC  122 N3 ? ? ? 1_555 J DG  29  N1 ? ? I DC  119 J DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog296 hydrog ?    ? I DC  122 N4 ? ? ? 1_555 J DG  29  O6 ? ? I DC  119 J DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog297 hydrog ?    ? I DC  122 O2 ? ? ? 1_555 J DG  29  N2 ? ? I DC  119 J DG  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog298 hydrog ?    ? I DA  123 N1 ? ? ? 1_555 J DT  28  N3 ? ? I DA  120 J DT  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog299 hydrog ?    ? I DA  123 N6 ? ? ? 1_555 J DT  28  O4 ? ? I DA  120 J DT  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog300 hydrog ?    ? I DG  124 N1 ? ? ? 1_555 J DC  27  N3 ? ? I DG  121 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog301 hydrog ?    ? I DG  124 N2 ? ? ? 1_555 J DC  27  O2 ? ? I DG  121 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog302 hydrog ?    ? I DG  124 O6 ? ? ? 1_555 J DC  27  N4 ? ? I DG  121 J DC  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog303 hydrog ?    ? I DG  125 N1 ? ? ? 1_555 J DC  26  N3 ? ? I DG  122 J DC  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog304 hydrog ?    ? I DG  125 N2 ? ? ? 1_555 J DC  26  O2 ? ? I DG  122 J DC  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog305 hydrog ?    ? I DG  125 O6 ? ? ? 1_555 J DC  26  N4 ? ? I DG  122 J DC  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog306 hydrog ?    ? I DC  126 N3 ? ? ? 1_555 J DG  25  N1 ? ? I DC  123 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog307 hydrog ?    ? I DC  126 N4 ? ? ? 1_555 J DG  25  O6 ? ? I DC  123 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog308 hydrog ?    ? I DC  126 O2 ? ? ? 1_555 J DG  25  N2 ? ? I DC  123 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog309 hydrog ?    ? I DA  127 N1 ? ? ? 1_555 J DT  24  N3 ? ? I DA  124 J DT  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog310 hydrog ?    ? I DA  127 N6 ? ? ? 1_555 J DT  24  O4 ? ? I DA  124 J DT  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog311 hydrog ?    ? I DC  128 N3 ? ? ? 1_555 J DG  23  N1 ? ? I DC  125 J DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog312 hydrog ?    ? I DC  128 N4 ? ? ? 1_555 J DG  23  O6 ? ? I DC  125 J DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog313 hydrog ?    ? I DC  128 O2 ? ? ? 1_555 J DG  23  N2 ? ? I DC  125 J DG  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog314 hydrog ?    ? I DG  129 N1 ? ? ? 1_555 J DC  22  N3 ? ? I DG  126 J DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog315 hydrog ?    ? I DG  129 N2 ? ? ? 1_555 J DC  22  O2 ? ? I DG  126 J DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog316 hydrog ?    ? I DG  129 O6 ? ? ? 1_555 J DC  22  N4 ? ? I DG  126 J DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog317 hydrog ?    ? I DT  130 N3 ? ? ? 1_555 J DA  21  N1 ? ? I DT  127 J DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog318 hydrog ?    ? I DT  130 O4 ? ? ? 1_555 J DA  21  N6 ? ? I DT  127 J DA  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog319 hydrog ?    ? I DG  131 N1 ? ? ? 1_555 J DC  20  N3 ? ? I DG  128 J DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog320 hydrog ?    ? I DG  131 N2 ? ? ? 1_555 J DC  20  O2 ? ? I DG  128 J DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog321 hydrog ?    ? I DG  131 O6 ? ? ? 1_555 J DC  20  N4 ? ? I DG  128 J DC  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog322 hydrog ?    ? I DT  132 N3 ? ? ? 1_555 J DA  19  N1 ? ? I DT  129 J DA  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog323 hydrog ?    ? I DT  132 O4 ? ? ? 1_555 J DA  19  N6 ? ? I DT  129 J DA  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog324 hydrog ?    ? I DC  133 N3 ? ? ? 1_555 J DG  18  N1 ? ? I DC  130 J DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog325 hydrog ?    ? I DC  133 N4 ? ? ? 1_555 J DG  18  O6 ? ? I DC  130 J DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog326 hydrog ?    ? I DC  133 O2 ? ? ? 1_555 J DG  18  N2 ? ? I DC  130 J DG  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog327 hydrog ?    ? I DA  134 N1 ? ? ? 1_555 J DT  17  N3 ? ? I DA  131 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog328 hydrog ?    ? I DA  134 N6 ? ? ? 1_555 J DT  17  O4 ? ? I DA  131 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog329 hydrog ?    ? I DG  135 N1 ? ? ? 1_555 J DC  16  N3 ? ? I DG  132 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog330 hydrog ?    ? I DG  135 N2 ? ? ? 1_555 J DC  16  O2 ? ? I DG  132 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog331 hydrog ?    ? I DG  135 O6 ? ? ? 1_555 J DC  16  N4 ? ? I DG  132 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog332 hydrog ?    ? I DA  136 N1 ? ? ? 1_555 J DT  15  N3 ? ? I DA  133 J DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog333 hydrog ?    ? I DA  136 N6 ? ? ? 1_555 J DT  15  O4 ? ? I DA  133 J DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog334 hydrog ?    ? I DT  137 N3 ? ? ? 1_555 J DA  14  N1 ? ? I DT  134 J DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog335 hydrog ?    ? I DT  137 O4 ? ? ? 1_555 J DA  14  N6 ? ? I DT  134 J DA  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog336 hydrog ?    ? I DA  138 N1 ? ? ? 1_555 J DT  13  N3 ? ? I DA  135 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog337 hydrog ?    ? I DA  138 N6 ? ? ? 1_555 J DT  13  O4 ? ? I DA  135 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog338 hydrog ?    ? I DT  139 N3 ? ? ? 1_555 J DA  12  N1 ? ? I DT  136 J DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog339 hydrog ?    ? I DT  139 O4 ? ? ? 1_555 J DA  12  N6 ? ? I DT  136 J DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog340 hydrog ?    ? I DA  140 N1 ? ? ? 1_555 J DT  11  N3 ? ? I DA  137 J DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog341 hydrog ?    ? I DA  140 N6 ? ? ? 1_555 J DT  11  O4 ? ? I DA  137 J DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog342 hydrog ?    ? I DT  141 N3 ? ? ? 1_555 J DA  10  N1 ? ? I DT  138 J DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog343 hydrog ?    ? I DT  141 O4 ? ? ? 1_555 J DA  10  N6 ? ? I DT  138 J DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog344 hydrog ?    ? I DA  142 N1 ? ? ? 1_555 J DT  9   N3 ? ? I DA  139 J DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog345 hydrog ?    ? I DA  142 N6 ? ? ? 1_555 J DT  9   O4 ? ? I DA  139 J DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog346 hydrog ?    ? I DC  143 N3 ? ? ? 1_555 J DG  8   N1 ? ? I DC  140 J DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog347 hydrog ?    ? I DC  143 N4 ? ? ? 1_555 J DG  8   O6 ? ? I DC  140 J DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog348 hydrog ?    ? I DC  143 O2 ? ? ? 1_555 J DG  8   N2 ? ? I DC  140 J DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog349 hydrog ?    ? I DA  144 N1 ? ? ? 1_555 J DT  7   N3 ? ? I DA  141 J DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog350 hydrog ?    ? I DA  144 N6 ? ? ? 1_555 J DT  7   O4 ? ? I DA  141 J DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog351 hydrog ?    ? I DT  145 N3 ? ? ? 1_555 J DA  6   N1 ? ? I DT  142 J DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog352 hydrog ?    ? I DT  145 O4 ? ? ? 1_555 J DA  6   N6 ? ? I DT  142 J DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog353 hydrog ?    ? I DC  146 N3 ? ? ? 1_555 J DG  5   N1 ? ? I DC  143 J DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog354 hydrog ?    ? I DC  146 N4 ? ? ? 1_555 J DG  5   O6 ? ? I DC  143 J DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog355 hydrog ?    ? I DC  146 O2 ? ? ? 1_555 J DG  5   N2 ? ? I DC  143 J DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 87  ? PHE A 88  ? ARG A 84  PHE A 85  
AA1 2 THR B 84  ? VAL B 85  ? THR B 81  VAL B 82  
AA2 1 THR A 122 ? ILE A 123 ? THR A 119 ILE A 120 
AA2 2 ARG B 49  ? ILE B 50  ? ARG B 46  ILE B 47  
AA3 1 LEU B 101 ? TYR B 102 ? LEU B 98  TYR B 99  
AA3 2 THR G 105 ? ILE G 106 ? THR G 102 ILE G 103 
AA4 1 ARG C 46  ? VAL C 47  ? ARG C 43  VAL C 44  
AA4 2 THR D 92  ? ILE D 93  ? THR D 89  ILE D 90  
AA5 1 ARG C 81  ? ILE C 82  ? ARG C 78  ILE C 79  
AA5 2 GLY D 57  ? ILE D 58  ? GLY D 54  ILE D 55  
AA6 1 THR C 105 ? ILE C 106 ? THR C 102 ILE C 103 
AA6 2 LEU F 101 ? TYR F 102 ? LEU F 98  TYR F 99  
AA7 1 ARG E 87  ? PHE E 88  ? ARG E 84  PHE E 85  
AA7 2 THR F 84  ? VAL F 85  ? THR F 81  VAL F 82  
AA8 1 THR E 122 ? ILE E 123 ? THR E 119 ILE E 120 
AA8 2 ARG F 49  ? ILE F 50  ? ARG F 46  ILE F 47  
AA9 1 ARG G 46  ? VAL G 47  ? ARG G 43  VAL G 44  
AA9 2 THR H 92  ? ILE H 93  ? THR H 89  ILE H 90  
AB1 1 ARG G 81  ? ILE G 82  ? ARG G 78  ILE G 79  
AB1 2 GLY H 57  ? ILE H 58  ? GLY H 54  ILE H 55  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 87  ? N ARG A 84  O VAL B 85  ? O VAL B 82  
AA2 1 2 N ILE A 123 ? N ILE A 120 O ARG B 49  ? O ARG B 46  
AA3 1 2 N TYR B 102 ? N TYR B 99  O THR G 105 ? O THR G 102 
AA4 1 2 N ARG C 46  ? N ARG C 43  O ILE D 93  ? O ILE D 90  
AA5 1 2 N ILE C 82  ? N ILE C 79  O GLY D 57  ? O GLY D 54  
AA6 1 2 N THR C 105 ? N THR C 102 O TYR F 102 ? O TYR F 99  
AA7 1 2 N ARG E 87  ? N ARG E 84  O VAL F 85  ? O VAL F 82  
AA8 1 2 N ILE E 123 ? N ILE E 120 O ARG F 49  ? O ARG F 46  
AA9 1 2 N ARG G 46  ? N ARG G 43  O ILE H 93  ? O ILE H 90  
AB1 1 2 N ILE G 82  ? N ILE G 79  O GLY H 57  ? O GLY H 54  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PTD 201 ? 2 'binding site for residue PTD A 201'                  
AC2 Software A PTD 202 ? 2 'binding site for residue PTD A 202'                  
AC3 Software C PTD 201 ? 2 'binding site for residue PTD C 201'                  
AC4 Software D PTD 201 ? 2 'binding site for residue PTD D 201'                  
AC5 Software E PTD 201 ? 2 'binding site for residue PTD E 201'                  
AC6 Software E PTD 202 ? 2 'binding site for residue PTD E 202'                  
AC7 Software G PTD 201 ? 2 'binding site for residue PTD G 201'                  
AC8 Software H PTD 201 ? 2 'binding site for residue PTD H 201'                  
AC9 Software K PTD 401 ? 5 'binding site for Di-peptide PTD K 401 and LYS L 109' 
AD1 Software K PTD 401 ? 9 'binding site for Di-peptide PTD K 401 and LYS K 151' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 LYS A 119 ? LYS A 116 . ? 1_555 ? 
2  AC1 2 LYS E 126 ? LYS E 123 . ? 1_555 ? 
3  AC2 2 LYS A 83  ? LYS A 80  . ? 1_555 ? 
4  AC2 2 LYS B 83  ? LYS B 80  . ? 1_555 ? 
5  AC3 2 LYS C 40  ? LYS C 37  . ? 1_555 ? 
6  AC3 2 LYS H 89  ? LYS H 86  . ? 1_555 ? 
7  AC4 2 LYS D 47  ? LYS D 44  . ? 1_555 ? 
8  AC4 2 LYS D 50  ? LYS D 47  . ? 1_555 ? 
9  AC5 2 LYS E 83  ? LYS E 80  . ? 1_555 ? 
10 AC5 2 LYS F 83  ? LYS F 80  . ? 1_555 ? 
11 AC6 2 LYS A 126 ? LYS A 123 . ? 1_555 ? 
12 AC6 2 LYS E 119 ? LYS E 116 . ? 1_555 ? 
13 AC7 2 LYS D 89  ? LYS D 86  . ? 1_555 ? 
14 AC7 2 LYS G 40  ? LYS G 37  . ? 1_555 ? 
15 AC8 2 LYS H 47  ? LYS H 44  . ? 1_555 ? 
16 AC8 2 LYS H 50  ? LYS H 47  . ? 1_555 ? 
17 AC9 5 LYS K 422 ? LYS K 151 . ? 1_555 ? 
18 AC9 5 ASP L 94  ? ASP L 107 . ? 1_555 ? 
19 AC9 5 TYR L 95  ? TYR L 108 . ? 1_555 ? 
20 AC9 5 TYR L 97  ? TYR L 110 . ? 1_555 ? 
21 AC9 5 ARG L 98  ? ARG L 111 . ? 1_555 ? 
22 AD1 9 GLU K 418 ? GLU K 147 . ? 1_555 ? 
23 AD1 9 GLN K 419 ? GLN K 148 . ? 1_555 ? 
24 AD1 9 PHE K 420 ? PHE K 149 . ? 1_555 ? 
25 AD1 9 ALA K 421 ? ALA K 150 . ? 1_555 ? 
26 AD1 9 LEU K 423 ? LEU K 152 . ? 1_555 ? 
27 AD1 9 LEU K 424 ? LEU K 153 . ? 1_555 ? 
28 AD1 9 LYS K 425 ? LYS K 154 . ? 1_555 ? 
29 AD1 9 GLN K 426 ? GLN K 155 . ? 1_555 ? 
30 AD1 9 LYS L 96  ? LYS L 109 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6T90 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ARG A 1  44  ? 114.535 139.571 149.469 1.00 305.34 ? 41  ARG A N     1 
ATOM   2     C CA    . ARG A 1  44  ? 113.894 138.961 148.319 1.00 261.16 ? 41  ARG A CA    1 
ATOM   3     C C     . ARG A 1  44  ? 114.909 138.804 147.209 1.00 273.53 ? 41  ARG A C     1 
ATOM   4     O O     . ARG A 1  44  ? 115.783 139.654 147.067 1.00 300.05 ? 41  ARG A O     1 
ATOM   5     C CB    . ARG A 1  44  ? 112.755 139.833 147.816 1.00 238.08 ? 41  ARG A CB    1 
ATOM   6     C CG    . ARG A 1  44  ? 111.611 140.038 148.786 1.00 260.76 ? 41  ARG A CG    1 
ATOM   7     C CD    . ARG A 1  44  ? 110.560 140.926 148.223 1.00 246.11 ? 41  ARG A CD    1 
ATOM   8     N NE    . ARG A 1  44  ? 109.970 140.367 147.023 1.00 206.50 ? 41  ARG A NE    1 
ATOM   9     C CZ    . ARG A 1  44  ? 109.001 139.436 146.997 1.00 143.37 ? 41  ARG A CZ    1 
ATOM   10    N NH1   . ARG A 1  44  ? 108.523 138.950 148.117 1.00 137.75 ? 41  ARG A NH1   1 
ATOM   11    N NH2   . ARG A 1  44  ? 108.551 138.999 145.844 1.00 108.02 ? 41  ARG A NH2   1 
ATOM   12    N N     . TYR A 1  45  ? 114.764 137.775 146.388 1.00 242.80 ? 42  TYR A N     1 
ATOM   13    C CA    . TYR A 1  45  ? 115.614 137.621 145.215 1.00 252.21 ? 42  TYR A CA    1 
ATOM   14    C C     . TYR A 1  45  ? 115.001 138.361 144.039 1.00 231.25 ? 42  TYR A C     1 
ATOM   15    O O     . TYR A 1  45  ? 113.787 138.577 144.004 1.00 199.38 ? 42  TYR A O     1 
ATOM   16    C CB    . TYR A 1  45  ? 115.839 136.155 144.857 1.00 240.18 ? 42  TYR A CB    1 
ATOM   17    C CG    . TYR A 1  45  ? 116.723 135.395 145.824 1.00 266.23 ? 42  TYR A CG    1 
ATOM   18    C CD1   . TYR A 1  45  ? 116.161 134.577 146.769 1.00 266.36 ? 42  TYR A CD1   1 
ATOM   19    C CD2   . TYR A 1  45  ? 118.100 135.524 145.762 1.00 293.28 ? 42  TYR A CD2   1 
ATOM   20    C CE1   . TYR A 1  45  ? 116.954 133.881 147.651 1.00 322.65 ? 42  TYR A CE1   1 
ATOM   21    C CE2   . TYR A 1  45  ? 118.900 134.829 146.644 1.00 319.88 ? 42  TYR A CE2   1 
ATOM   22    C CZ    . TYR A 1  45  ? 118.323 134.004 147.591 1.00 338.30 ? 42  TYR A CZ    1 
ATOM   23    O OH    . TYR A 1  45  ? 119.110 133.302 148.479 1.00 393.40 ? 42  TYR A OH    1 
ATOM   24    N N     . ARG A 1  46  ? 115.830 138.806 143.100 1.00 235.69 ? 43  ARG A N     1 
ATOM   25    C CA    . ARG A 1  46  ? 115.299 139.449 141.919 1.00 217.83 ? 43  ARG A CA    1 
ATOM   26    C C     . ARG A 1  46  ? 114.677 138.375 141.041 1.00 196.27 ? 43  ARG A C     1 
ATOM   27    O O     . ARG A 1  46  ? 115.123 137.221 141.096 1.00 186.46 ? 43  ARG A O     1 
ATOM   28    C CB    . ARG A 1  46  ? 116.395 140.140 141.135 1.00 230.79 ? 43  ARG A CB    1 
ATOM   29    C CG    . ARG A 1  46  ? 117.006 141.284 141.821 1.00 258.26 ? 43  ARG A CG    1 
ATOM   30    C CD    . ARG A 1  46  ? 118.062 141.910 141.025 1.00 282.86 ? 43  ARG A CD    1 
ATOM   31    N NE    . ARG A 1  46  ? 118.666 142.999 141.769 0.00 306.80 ? 43  ARG A NE    1 
ATOM   32    C CZ    . ARG A 1  46  ? 119.662 143.802 141.347 0.00 278.31 ? 43  ARG A CZ    1 
ATOM   33    N NH1   . ARG A 1  46  ? 120.198 143.657 140.145 0.00 251.66 ? 43  ARG A NH1   1 
ATOM   34    N NH2   . ARG A 1  46  ? 120.089 144.748 142.170 0.00 311.84 ? 43  ARG A NH2   1 
ATOM   35    N N     . PRO A 1  47  ? 113.655 138.685 140.239 1.00 186.83 ? 44  PRO A N     1 
ATOM   36    C CA    . PRO A 1  47  ? 113.100 137.769 139.289 1.00 165.81 ? 44  PRO A CA    1 
ATOM   37    C C     . PRO A 1  47  ? 114.203 137.270 138.389 1.00 165.68 ? 44  PRO A C     1 
ATOM   38    O O     . PRO A 1  47  ? 115.003 138.061 137.883 1.00 175.02 ? 44  PRO A O     1 
ATOM   39    C CB    . PRO A 1  47  ? 112.101 138.638 138.533 1.00 160.41 ? 44  PRO A CB    1 
ATOM   40    C CG    . PRO A 1  47  ? 111.705 139.697 139.530 1.00 167.98 ? 44  PRO A CG    1 
ATOM   41    C CD    . PRO A 1  47  ? 112.962 139.980 140.317 1.00 177.57 ? 44  PRO A CD    1 
ATOM   42    N N     . GLY A 1  48  ? 114.211 135.970 138.159 1.00 149.80 ? 45  GLY A N     1 
ATOM   43    C CA    . GLY A 1  48  ? 115.180 135.292 137.316 1.00 139.18 ? 45  GLY A CA    1 
ATOM   44    C C     . GLY A 1  48  ? 116.258 134.568 138.125 1.00 127.07 ? 45  GLY A C     1 
ATOM   45    O O     . GLY A 1  48  ? 116.840 133.590 137.644 1.00 117.73 ? 45  GLY A O     1 
ATOM   46    N N     . THR A 1  49  ? 116.492 134.965 139.379 1.00 140.86 ? 46  THR A N     1 
ATOM   47    C CA    . THR A 1  49  ? 117.496 134.252 140.159 1.00 131.59 ? 46  THR A CA    1 
ATOM   48    C C     . THR A 1  49  ? 117.005 132.869 140.489 1.00 119.97 ? 46  THR A C     1 
ATOM   49    O O     . THR A 1  49  ? 117.759 131.892 140.427 1.00 115.68 ? 46  THR A O     1 
ATOM   50    C CB    . THR A 1  49  ? 117.891 135.014 141.423 1.00 177.45 ? 46  THR A CB    1 
ATOM   51    O OG1   . THR A 1  49  ? 118.488 136.262 141.031 1.00 210.29 ? 46  THR A OG1   1 
ATOM   52    C CG2   . THR A 1  49  ? 118.898 134.195 142.271 1.00 220.15 ? 46  THR A CG2   1 
ATOM   53    N N     . VAL A 1  50  ? 115.743 132.778 140.857 1.00 111.80 ? 47  VAL A N     1 
ATOM   54    C CA    . VAL A 1  50  ? 115.184 131.501 141.202 1.00 103.39 ? 47  VAL A CA    1 
ATOM   55    C C     . VAL A 1  50  ? 115.026 130.667 139.954 1.00 93.57  ? 47  VAL A C     1 
ATOM   56    O O     . VAL A 1  50  ? 115.354 129.485 139.957 1.00 86.40  ? 47  VAL A O     1 
ATOM   57    C CB    . VAL A 1  50  ? 113.879 131.657 141.955 1.00 101.38 ? 47  VAL A CB    1 
ATOM   58    C CG1   . VAL A 1  50  ? 113.217 130.295 142.163 1.00 94.70  ? 47  VAL A CG1   1 
ATOM   59    C CG2   . VAL A 1  50  ? 114.184 132.327 143.299 1.00 118.10 ? 47  VAL A CG2   1 
ATOM   60    N N     . ALA A 1  51  ? 114.534 131.256 138.870 1.00 94.48  ? 48  ALA A N     1 
ATOM   61    C CA    . ALA A 1  51  ? 114.377 130.469 137.667 1.00 76.52  ? 48  ALA A CA    1 
ATOM   62    C C     . ALA A 1  51  ? 115.690 129.868 137.219 1.00 70.64  ? 48  ALA A C     1 
ATOM   63    O O     . ALA A 1  51  ? 115.712 128.700 136.840 1.00 66.48  ? 48  ALA A O     1 
ATOM   64    C CB    . ALA A 1  51  ? 113.821 131.308 136.545 1.00 67.04  ? 48  ALA A CB    1 
ATOM   65    N N     . LEU A 1  52  ? 116.799 130.591 137.310 1.00 78.20  ? 49  LEU A N     1 
ATOM   66    C CA    . LEU A 1  52  ? 118.031 129.954 136.901 1.00 73.20  ? 49  LEU A CA    1 
ATOM   67    C C     . LEU A 1  52  ? 118.414 128.831 137.849 1.00 73.09  ? 49  LEU A C     1 
ATOM   68    O O     . LEU A 1  52  ? 118.917 127.792 137.404 1.00 68.98  ? 49  LEU A O     1 
ATOM   69    C CB    . LEU A 1  52  ? 119.135 130.978 136.761 1.00 75.86  ? 49  LEU A CB    1 
ATOM   70    C CG    . LEU A 1  52  ? 118.978 131.950 135.567 1.00 74.08  ? 49  LEU A CG    1 
ATOM   71    C CD1   . LEU A 1  52  ? 119.984 133.037 135.695 1.00 71.01  ? 49  LEU A CD1   1 
ATOM   72    C CD2   . LEU A 1  52  ? 119.199 131.210 134.203 1.00 65.80  ? 49  LEU A CD2   1 
ATOM   73    N N     . ARG A 1  53  ? 118.132 129.029 139.133 1.00 79.55  ? 50  ARG A N     1 
ATOM   74    C CA    . ARG A 1  53  ? 118.429 127.978 140.129 1.00 75.75  ? 50  ARG A CA    1 
ATOM   75    C C     . ARG A 1  53  ? 117.662 126.722 139.729 1.00 64.75  ? 50  ARG A C     1 
ATOM   76    O O     . ARG A 1  53  ? 118.277 125.663 139.630 1.00 64.11  ? 50  ARG A O     1 
ATOM   77    C CB    . ARG A 1  53  ? 117.939 128.415 141.507 1.00 89.76  ? 50  ARG A CB    1 
ATOM   78    C CG    . ARG A 1  53  ? 119.014 129.086 142.344 1.00 112.12 ? 50  ARG A CG    1 
ATOM   79    C CD    . ARG A 1  53  ? 118.800 128.842 143.822 1.00 146.24 ? 50  ARG A CD    1 
ATOM   80    N NE    . ARG A 1  53  ? 118.104 129.969 144.416 1.00 181.33 ? 50  ARG A NE    1 
ATOM   81    C CZ    . ARG A 1  53  ? 117.065 129.864 145.229 1.00 274.92 ? 50  ARG A CZ    1 
ATOM   82    N NH1   . ARG A 1  53  ? 116.598 128.673 145.554 1.00 303.24 ? 50  ARG A NH1   1 
ATOM   83    N NH2   . ARG A 1  53  ? 116.499 130.951 145.716 1.00 306.68 ? 50  ARG A NH2   1 
ATOM   84    N N     . GLU A 1  54  ? 116.372 126.867 139.451 1.00 61.66  ? 51  GLU A N     1 
ATOM   85    C CA    . GLU A 1  54  ? 115.555 125.726 139.142 1.00 50.22  ? 51  GLU A CA    1 
ATOM   86    C C     . GLU A 1  54  ? 115.994 125.077 137.860 1.00 45.22  ? 51  GLU A C     1 
ATOM   87    O O     . GLU A 1  54  ? 116.081 123.854 137.782 1.00 44.88  ? 51  GLU A O     1 
ATOM   88    C CB    . GLU A 1  54  ? 114.093 126.063 139.036 1.00 55.44  ? 51  GLU A CB    1 
ATOM   89    C CG    . GLU A 1  54  ? 113.416 126.380 140.338 1.00 62.48  ? 51  GLU A CG    1 
ATOM   90    C CD    . GLU A 1  54  ? 111.922 126.469 140.168 1.00 70.78  ? 51  GLU A CD    1 
ATOM   91    O OE1   . GLU A 1  54  ? 111.470 126.243 139.067 1.00 60.04  ? 51  GLU A OE1   1 
ATOM   92    O OE2   . GLU A 1  54  ? 111.239 126.734 141.118 1.00 92.61  ? 51  GLU A OE2   1 
ATOM   93    N N     . ILE A 1  55  ? 116.406 125.856 136.874 1.00 45.76  ? 52  ILE A N     1 
ATOM   94    C CA    . ILE A 1  55  ? 116.814 125.217 135.650 1.00 37.17  ? 52  ILE A CA    1 
ATOM   95    C C     . ILE A 1  55  ? 117.976 124.291 135.941 1.00 39.24  ? 52  ILE A C     1 
ATOM   96    O O     . ILE A 1  55  ? 117.979 123.156 135.469 1.00 42.32  ? 52  ILE A O     1 
ATOM   97    C CB    . ILE A 1  55  ? 117.164 126.227 134.541 1.00 37.59  ? 52  ILE A CB    1 
ATOM   98    C CG1   . ILE A 1  55  ? 115.879 126.946 134.092 1.00 33.81  ? 52  ILE A CG1   1 
ATOM   99    C CG2   . ILE A 1  55  ? 117.799 125.483 133.358 1.00 33.41  ? 52  ILE A CG2   1 
ATOM   100   C CD1   . ILE A 1  55  ? 116.072 128.182 133.228 1.00 35.37  ? 52  ILE A CD1   1 
ATOM   101   N N     . ARG A 1  56  ? 118.959 124.720 136.722 1.00 44.80  ? 53  ARG A N     1 
ATOM   102   C CA    . ARG A 1  56  ? 120.049 123.794 136.997 1.00 43.65  ? 53  ARG A CA    1 
ATOM   103   C C     . ARG A 1  56  ? 119.607 122.563 137.768 1.00 40.90  ? 53  ARG A C     1 
ATOM   104   O O     . ARG A 1  56  ? 120.055 121.446 137.489 1.00 46.13  ? 53  ARG A O     1 
ATOM   105   C CB    . ARG A 1  56  ? 121.120 124.450 137.808 1.00 56.19  ? 53  ARG A CB    1 
ATOM   106   C CG    . ARG A 1  56  ? 121.880 125.466 137.086 1.00 69.64  ? 53  ARG A CG    1 
ATOM   107   C CD    . ARG A 1  56  ? 122.972 125.990 137.886 1.00 87.55  ? 53  ARG A CD    1 
ATOM   108   N NE    . ARG A 1  56  ? 123.687 127.039 137.182 1.00 101.99 ? 53  ARG A NE    1 
ATOM   109   C CZ    . ARG A 1  56  ? 123.434 128.364 137.273 1.00 108.35 ? 53  ARG A CZ    1 
ATOM   110   N NH1   . ARG A 1  56  ? 122.469 128.823 138.041 1.00 99.72  ? 53  ARG A NH1   1 
ATOM   111   N NH2   . ARG A 1  56  ? 124.171 129.214 136.583 1.00 108.68 ? 53  ARG A NH2   1 
ATOM   112   N N     . ARG A 1  57  ? 118.736 122.753 138.743 1.00 40.04  ? 54  ARG A N     1 
ATOM   113   C CA    . ARG A 1  57  ? 118.278 121.651 139.554 1.00 36.03  ? 54  ARG A CA    1 
ATOM   114   C C     . ARG A 1  57  ? 117.517 120.609 138.773 1.00 32.96  ? 54  ARG A C     1 
ATOM   115   O O     . ARG A 1  57  ? 117.723 119.408 138.988 1.00 38.25  ? 54  ARG A O     1 
ATOM   116   C CB    . ARG A 1  57  ? 117.410 122.183 140.650 1.00 44.84  ? 54  ARG A CB    1 
ATOM   117   C CG    . ARG A 1  57  ? 116.869 121.206 141.596 1.00 51.29  ? 54  ARG A CG    1 
ATOM   118   C CD    . ARG A 1  57  ? 116.152 121.897 142.696 1.00 60.67  ? 54  ARG A CD    1 
ATOM   119   N NE    . ARG A 1  57  ? 115.589 120.953 143.632 1.00 73.47  ? 54  ARG A NE    1 
ATOM   120   C CZ    . ARG A 1  57  ? 114.360 120.397 143.545 1.00 76.67  ? 54  ARG A CZ    1 
ATOM   121   N NH1   . ARG A 1  57  ? 113.542 120.715 142.583 1.00 63.66  ? 54  ARG A NH1   1 
ATOM   122   N NH2   . ARG A 1  57  ? 113.976 119.515 144.443 1.00 86.73  ? 54  ARG A NH2   1 
ATOM   123   N N     . TYR A 1  58  ? 116.642 121.044 137.877 1.00 31.76  ? 55  TYR A N     1 
ATOM   124   C CA    . TYR A 1  58  ? 115.873 120.083 137.128 1.00 28.15  ? 55  TYR A CA    1 
ATOM   125   C C     . TYR A 1  58  ? 116.686 119.461 136.039 1.00 28.53  ? 55  TYR A C     1 
ATOM   126   O O     . TYR A 1  58  ? 116.447 118.317 135.681 1.00 38.14  ? 55  TYR A O     1 
ATOM   127   C CB    . TYR A 1  58  ? 114.599 120.686 136.577 1.00 27.27  ? 55  TYR A CB    1 
ATOM   128   C CG    . TYR A 1  58  ? 113.668 120.983 137.660 1.00 28.82  ? 55  TYR A CG    1 
ATOM   129   C CD1   . TYR A 1  58  ? 113.350 122.257 137.946 1.00 34.99  ? 55  TYR A CD1   1 
ATOM   130   C CD2   . TYR A 1  58  ? 113.168 119.976 138.406 1.00 31.12  ? 55  TYR A CD2   1 
ATOM   131   C CE1   . TYR A 1  58  ? 112.527 122.532 138.990 1.00 40.38  ? 55  TYR A CE1   1 
ATOM   132   C CE2   . TYR A 1  58  ? 112.360 120.245 139.441 1.00 35.10  ? 55  TYR A CE2   1 
ATOM   133   C CZ    . TYR A 1  58  ? 112.044 121.521 139.736 1.00 35.66  ? 55  TYR A CZ    1 
ATOM   134   O OH    . TYR A 1  58  ? 111.234 121.793 140.800 1.00 43.57  ? 55  TYR A OH    1 
ATOM   135   N N     . GLN A 1  59  ? 117.648 120.169 135.483 1.00 27.56  ? 56  GLN A N     1 
ATOM   136   C CA    . GLN A 1  59  ? 118.443 119.516 134.480 1.00 25.34  ? 56  GLN A CA    1 
ATOM   137   C C     . GLN A 1  59  ? 119.303 118.421 135.094 1.00 29.64  ? 56  GLN A C     1 
ATOM   138   O O     . GLN A 1  59  ? 119.483 117.376 134.478 1.00 32.94  ? 56  GLN A O     1 
ATOM   139   C CB    . GLN A 1  59  ? 119.257 120.515 133.708 1.00 27.93  ? 56  GLN A CB    1 
ATOM   140   C CG    . GLN A 1  59  ? 118.402 121.355 132.832 1.00 24.84  ? 56  GLN A CG    1 
ATOM   141   C CD    . GLN A 1  59  ? 119.116 122.362 132.089 1.00 31.93  ? 56  GLN A CD    1 
ATOM   142   O OE1   . GLN A 1  59  ? 120.169 122.849 132.495 1.00 39.44  ? 56  GLN A OE1   1 
ATOM   143   N NE2   . GLN A 1  59  ? 118.558 122.688 130.961 1.00 31.40  ? 56  GLN A NE2   1 
ATOM   144   N N     . LYS A 1  60  ? 119.819 118.622 136.311 1.00 32.96  ? 57  LYS A N     1 
ATOM   145   C CA    . LYS A 1  60  ? 120.605 117.564 136.936 1.00 34.33  ? 57  LYS A CA    1 
ATOM   146   C C     . LYS A 1  60  ? 119.824 116.333 137.386 1.00 35.32  ? 57  LYS A C     1 
ATOM   147   O O     . LYS A 1  60  ? 120.336 115.222 137.275 1.00 37.39  ? 57  LYS A O     1 
ATOM   148   C CB    . LYS A 1  60  ? 121.374 118.046 138.146 1.00 42.15  ? 57  LYS A CB    1 
ATOM   149   C CG    . LYS A 1  60  ? 122.539 118.928 137.866 1.00 56.58  ? 57  LYS A CG    1 
ATOM   150   C CD    . LYS A 1  60  ? 123.235 119.315 139.181 1.00 90.08  ? 57  LYS A CD    1 
ATOM   151   C CE    . LYS A 1  60  ? 124.430 120.257 138.962 1.00 145.25 ? 57  LYS A CE    1 
ATOM   152   N NZ    . LYS A 1  60  ? 125.082 120.695 140.267 1.00 217.02 ? 57  LYS A NZ    1 
ATOM   153   N N     . SER A 1  61  ? 118.623 116.482 137.920 1.00 32.02  ? 58  SER A N     1 
ATOM   154   C CA    . SER A 1  61  ? 117.914 115.303 138.403 1.00 32.03  ? 58  SER A CA    1 
ATOM   155   C C     . SER A 1  61  ? 117.262 114.470 137.290 1.00 31.82  ? 58  SER A C     1 
ATOM   156   O O     . SER A 1  61  ? 117.161 114.896 136.139 1.00 30.81  ? 58  SER A O     1 
ATOM   157   C CB    . SER A 1  61  ? 116.907 115.686 139.451 1.00 38.75  ? 58  SER A CB    1 
ATOM   158   O OG    . SER A 1  61  ? 115.833 116.397 138.919 1.00 35.86  ? 58  SER A OG    1 
ATOM   159   N N     . THR A 1  62  ? 116.839 113.240 137.626 1.00 32.09  ? 59  THR A N     1 
ATOM   160   C CA    . THR A 1  62  ? 116.192 112.338 136.670 1.00 28.20  ? 59  THR A CA    1 
ATOM   161   C C     . THR A 1  62  ? 114.748 111.916 136.959 1.00 30.20  ? 59  THR A C     1 
ATOM   162   O O     . THR A 1  62  ? 114.144 111.202 136.156 1.00 28.90  ? 59  THR A O     1 
ATOM   163   C CB    . THR A 1  62  ? 117.007 111.068 136.518 1.00 26.02  ? 59  THR A CB    1 
ATOM   164   O OG1   . THR A 1  62  ? 117.136 110.440 137.794 1.00 26.71  ? 59  THR A OG1   1 
ATOM   165   C CG2   . THR A 1  62  ? 118.356 111.385 135.963 1.00 32.87  ? 59  THR A CG2   1 
ATOM   166   N N     . GLU A 1  63  ? 114.173 112.343 138.069 1.00 31.37  ? 60  GLU A N     1 
ATOM   167   C CA    . GLU A 1  63  ? 112.839 111.911 138.443 1.00 29.15  ? 60  GLU A CA    1 
ATOM   168   C C     . GLU A 1  63  ? 111.752 112.452 137.563 1.00 26.28  ? 60  GLU A C     1 
ATOM   169   O O     . GLU A 1  63  ? 111.934 113.440 136.857 1.00 31.23  ? 60  GLU A O     1 
ATOM   170   C CB    . GLU A 1  63  ? 112.516 112.303 139.870 1.00 34.20  ? 60  GLU A CB    1 
ATOM   171   C CG    . GLU A 1  63  ? 112.338 113.799 140.099 1.00 41.39  ? 60  GLU A CG    1 
ATOM   172   C CD    . GLU A 1  63  ? 113.595 114.444 140.296 1.00 46.96  ? 60  GLU A CD    1 
ATOM   173   O OE1   . GLU A 1  63  ? 114.568 113.731 140.269 1.00 44.65  ? 60  GLU A OE1   1 
ATOM   174   O OE2   . GLU A 1  63  ? 113.663 115.644 140.479 1.00 42.71  ? 60  GLU A OE2   1 
ATOM   175   N N     . LEU A 1  64  ? 110.619 111.774 137.604 1.00 23.77  ? 61  LEU A N     1 
ATOM   176   C CA    . LEU A 1  64  ? 109.429 112.187 136.889 1.00 21.61  ? 61  LEU A CA    1 
ATOM   177   C C     . LEU A 1  64  ? 108.887 113.437 137.561 1.00 25.71  ? 61  LEU A C     1 
ATOM   178   O O     . LEU A 1  64  ? 108.943 113.558 138.784 1.00 30.83  ? 61  LEU A O     1 
ATOM   179   C CB    . LEU A 1  64  ? 108.420 111.044 136.930 1.00 21.80  ? 61  LEU A CB    1 
ATOM   180   C CG    . LEU A 1  64  ? 108.863 109.734 136.207 1.00 23.57  ? 61  LEU A CG    1 
ATOM   181   C CD1   . LEU A 1  64  ? 107.883 108.620 136.499 1.00 12.16  ? 61  LEU A CD1   1 
ATOM   182   C CD2   . LEU A 1  64  ? 108.921 109.961 134.714 1.00 24.21  ? 61  LEU A CD2   1 
ATOM   183   N N     . LEU A 1  65  ? 108.374 114.367 136.766 1.00 19.28  ? 62  LEU A N     1 
ATOM   184   C CA    . LEU A 1  65  ? 107.885 115.632 137.279 1.00 11.52  ? 62  LEU A CA    1 
ATOM   185   C C     . LEU A 1  65  ? 106.377 115.682 137.430 1.00 13.92  ? 62  LEU A C     1 
ATOM   186   O O     . LEU A 1  65  ? 105.844 116.423 138.264 1.00 19.85  ? 62  LEU A O     1 
ATOM   187   C CB    . LEU A 1  65  ? 108.407 116.709 136.360 1.00 7.31   ? 62  LEU A CB    1 
ATOM   188   C CG    . LEU A 1  65  ? 109.953 116.744 136.244 1.00 12.39  ? 62  LEU A CG    1 
ATOM   189   C CD1   . LEU A 1  65  ? 110.331 117.786 135.258 1.00 22.37  ? 62  LEU A CD1   1 
ATOM   190   C CD2   . LEU A 1  65  ? 110.613 117.028 137.591 1.00 23.92  ? 62  LEU A CD2   1 
ATOM   191   N N     . ILE A 1  66  ? 105.682 114.901 136.633 1.00 13.72  ? 63  ILE A N     1 
ATOM   192   C CA    . ILE A 1  66  ? 104.234 114.836 136.704 1.00 11.35  ? 63  ILE A CA    1 
ATOM   193   C C     . ILE A 1  66  ? 103.872 113.867 137.820 1.00 18.43  ? 63  ILE A C     1 
ATOM   194   O O     . ILE A 1  66  ? 104.452 112.791 137.902 1.00 22.13  ? 63  ILE A O     1 
ATOM   195   C CB    . ILE A 1  66  ? 103.620 114.373 135.378 1.00 14.90  ? 63  ILE A CB    1 
ATOM   196   C CG1   . ILE A 1  66  ? 103.919 115.386 134.277 1.00 12.10  ? 63  ILE A CG1   1 
ATOM   197   C CG2   . ILE A 1  66  ? 102.133 114.166 135.548 1.00 20.96  ? 63  ILE A CG2   1 
ATOM   198   C CD1   . ILE A 1  66  ? 103.598 114.898 132.868 1.00 13.23  ? 63  ILE A CD1   1 
ATOM   199   N N     . ARG A 1  67  ? 102.948 114.231 138.696 1.00 19.68  ? 64  ARG A N     1 
ATOM   200   C CA    . ARG A 1  67  ? 102.583 113.336 139.790 1.00 17.14  ? 64  ARG A CA    1 
ATOM   201   C C     . ARG A 1  67  ? 101.967 112.070 139.232 1.00 21.27  ? 64  ARG A C     1 
ATOM   202   O O     . ARG A 1  67  ? 101.193 112.124 138.272 1.00 22.09  ? 64  ARG A O     1 
ATOM   203   C CB    . ARG A 1  67  ? 101.565 113.964 140.685 1.00 21.03  ? 64  ARG A CB    1 
ATOM   204   C CG    . ARG A 1  67  ? 101.909 115.231 141.390 1.00 18.81  ? 64  ARG A CG    1 
ATOM   205   C CD    . ARG A 1  67  ? 102.859 115.083 142.450 1.00 16.90  ? 64  ARG A CD    1 
ATOM   206   N NE    . ARG A 1  67  ? 104.189 115.251 141.978 1.00 28.60  ? 64  ARG A NE    1 
ATOM   207   C CZ    . ARG A 1  67  ? 105.284 115.105 142.714 1.00 29.53  ? 64  ARG A CZ    1 
ATOM   208   N NH1   . ARG A 1  67  ? 105.186 114.775 143.973 1.00 30.65  ? 64  ARG A NH1   1 
ATOM   209   N NH2   . ARG A 1  67  ? 106.466 115.302 142.159 1.00 30.09  ? 64  ARG A NH2   1 
ATOM   210   N N     . LYS A 1  68  ? 102.263 110.934 139.852 1.00 20.01  ? 65  LYS A N     1 
ATOM   211   C CA    . LYS A 1  68  ? 101.791 109.665 139.328 1.00 14.17  ? 65  LYS A CA    1 
ATOM   212   C C     . LYS A 1  68  ? 100.312 109.341 139.371 1.00 17.19  ? 65  LYS A C     1 
ATOM   213   O O     . LYS A 1  68  ? 99.786  108.851 138.371 1.00 20.87  ? 65  LYS A O     1 
ATOM   214   C CB    . LYS A 1  68  ? 102.510 108.568 140.030 1.00 10.88  ? 65  LYS A CB    1 
ATOM   215   C CG    . LYS A 1  68  ? 103.943 108.474 139.676 1.00 11.65  ? 65  LYS A CG    1 
ATOM   216   C CD    . LYS A 1  68  ? 104.610 107.362 140.419 1.00 7.59   ? 65  LYS A CD    1 
ATOM   217   C CE    . LYS A 1  68  ? 106.074 107.269 140.103 1.00 8.03   ? 65  LYS A CE    1 
ATOM   218   N NZ    . LYS A 1  68  ? 106.743 106.197 140.899 1.00 15.10  ? 65  LYS A NZ    1 
ATOM   219   N N     . LEU A 1  69  ? 99.602  109.594 140.458 1.00 16.44  ? 66  LEU A N     1 
ATOM   220   C CA    . LEU A 1  69  ? 98.208  109.203 140.346 1.00 13.07  ? 66  LEU A CA    1 
ATOM   221   C C     . LEU A 1  69  ? 97.422  110.018 139.334 1.00 21.89  ? 66  LEU A C     1 
ATOM   222   O O     . LEU A 1  69  ? 96.560  109.445 138.665 1.00 20.82  ? 66  LEU A O     1 
ATOM   223   C CB    . LEU A 1  69  ? 97.462  109.203 141.668 1.00 16.96  ? 66  LEU A CB    1 
ATOM   224   C CG    . LEU A 1  69  ? 97.825  108.181 142.659 1.00 18.39  ? 66  LEU A CG    1 
ATOM   225   C CD1   . LEU A 1  69  ? 97.092  108.518 143.934 1.00 29.24  ? 66  LEU A CD1   1 
ATOM   226   C CD2   . LEU A 1  69  ? 97.444  106.797 142.184 1.00 2.55   ? 66  LEU A CD2   1 
ATOM   227   N N     . PRO A 1  70  ? 97.536  111.354 139.267 1.00 20.16  ? 67  PRO A N     1 
ATOM   228   C CA    . PRO A 1  70  ? 96.881  112.156 138.283 1.00 19.21  ? 67  PRO A CA    1 
ATOM   229   C C     . PRO A 1  70  ? 97.184  111.692 136.888 1.00 21.54  ? 67  PRO A C     1 
ATOM   230   O O     . PRO A 1  70  ? 96.295  111.641 136.037 1.00 26.87  ? 67  PRO A O     1 
ATOM   231   C CB    . PRO A 1  70  ? 97.460  113.507 138.564 1.00 23.35  ? 67  PRO A CB    1 
ATOM   232   C CG    . PRO A 1  70  ? 97.767  113.466 139.968 1.00 19.70  ? 67  PRO A CG    1 
ATOM   233   C CD    . PRO A 1  70  ? 98.284  112.135 140.207 1.00 19.96  ? 67  PRO A CD    1 
ATOM   234   N N     . PHE A 1  71  ? 98.418  111.247 136.662 1.00 22.20  ? 68  PHE A N     1 
ATOM   235   C CA    . PHE A 1  71  ? 98.753  110.773 135.352 1.00 17.53  ? 68  PHE A CA    1 
ATOM   236   C C     . PHE A 1  71  ? 97.998  109.506 135.066 1.00 20.92  ? 68  PHE A C     1 
ATOM   237   O O     . PHE A 1  71  ? 97.453  109.352 133.976 1.00 21.11  ? 68  PHE A O     1 
ATOM   238   C CB    . PHE A 1  71  ? 100.223 110.566 135.195 1.00 17.51  ? 68  PHE A CB    1 
ATOM   239   C CG    . PHE A 1  71  ? 100.582 110.265 133.832 1.00 13.84  ? 68  PHE A CG    1 
ATOM   240   C CD1   . PHE A 1  71  ? 100.602 111.254 132.903 1.00 11.72  ? 68  PHE A CD1   1 
ATOM   241   C CD2   . PHE A 1  71  ? 100.899 109.027 133.462 1.00 16.00  ? 68  PHE A CD2   1 
ATOM   242   C CE1   . PHE A 1  71  ? 100.938 110.992 131.639 1.00 10.18  ? 68  PHE A CE1   1 
ATOM   243   C CE2   . PHE A 1  71  ? 101.236 108.759 132.188 1.00 12.18  ? 68  PHE A CE2   1 
ATOM   244   C CZ    . PHE A 1  71  ? 101.258 109.740 131.286 1.00 12.69  ? 68  PHE A CZ    1 
ATOM   245   N N     . GLN A 1  72  ? 97.931  108.581 136.017 1.00 19.49  ? 69  GLN A N     1 
ATOM   246   C CA    . GLN A 1  72  ? 97.191  107.374 135.713 1.00 14.16  ? 69  GLN A CA    1 
ATOM   247   C C     . GLN A 1  72  ? 95.758  107.619 135.418 1.00 21.62  ? 69  GLN A C     1 
ATOM   248   O O     . GLN A 1  72  ? 95.196  106.954 134.549 1.00 21.31  ? 69  GLN A O     1 
ATOM   249   C CB    . GLN A 1  72  ? 97.170  106.386 136.825 1.00 11.06  ? 69  GLN A CB    1 
ATOM   250   C CG    . GLN A 1  72  ? 98.370  105.745 137.030 1.00 15.52  ? 69  GLN A CG    1 
ATOM   251   C CD    . GLN A 1  72  ? 98.278  104.819 138.107 1.00 13.51  ? 69  GLN A CD    1 
ATOM   252   O OE1   . GLN A 1  72  ? 97.205  104.300 138.389 1.00 15.92  ? 69  GLN A OE1   1 
ATOM   253   N NE2   . GLN A 1  72  ? 99.391  104.569 138.753 1.00 8.81   ? 69  GLN A NE2   1 
ATOM   254   N N     . ARG A 1  73  ? 95.125  108.532 136.115 1.00 20.60  ? 70  ARG A N     1 
ATOM   255   C CA    . ARG A 1  73  ? 93.743  108.718 135.792 1.00 17.11  ? 70  ARG A CA    1 
ATOM   256   C C     . ARG A 1  73  ? 93.593  109.257 134.402 1.00 22.36  ? 70  ARG A C     1 
ATOM   257   O O     . ARG A 1  73  ? 92.681  108.848 133.694 1.00 26.87  ? 70  ARG A O     1 
ATOM   258   C CB    . ARG A 1  73  ? 93.062  109.581 136.753 1.00 22.25  ? 70  ARG A CB    1 
ATOM   259   C CG    . ARG A 1  73  ? 92.913  108.945 138.045 1.00 26.88  ? 70  ARG A CG    1 
ATOM   260   C CD    . ARG A 1  73  ? 91.976  109.628 138.872 1.00 28.14  ? 70  ARG A CD    1 
ATOM   261   N NE    . ARG A 1  73  ? 92.377  110.927 139.191 1.00 27.30  ? 70  ARG A NE    1 
ATOM   262   C CZ    . ARG A 1  73  ? 93.116  111.267 140.230 1.00 26.65  ? 70  ARG A CZ    1 
ATOM   263   N NH1   . ARG A 1  73  ? 93.536  110.372 141.059 1.00 28.57  ? 70  ARG A NH1   1 
ATOM   264   N NH2   . ARG A 1  73  ? 93.418  112.528 140.416 1.00 31.26  ? 70  ARG A NH2   1 
ATOM   265   N N     . LEU A 1  74  ? 94.492  110.134 133.975 1.00 24.02  ? 71  LEU A N     1 
ATOM   266   C CA    . LEU A 1  74  ? 94.410  110.646 132.627 1.00 19.08  ? 71  LEU A CA    1 
ATOM   267   C C     . LEU A 1  74  ? 94.567  109.522 131.630 1.00 25.25  ? 71  LEU A C     1 
ATOM   268   O O     . LEU A 1  74  ? 93.822  109.450 130.651 1.00 25.33  ? 71  LEU A O     1 
ATOM   269   C CB    . LEU A 1  74  ? 95.487  111.688 132.395 1.00 17.58  ? 71  LEU A CB    1 
ATOM   270   C CG    . LEU A 1  74  ? 95.580  112.288 131.019 1.00 18.90  ? 71  LEU A CG    1 
ATOM   271   C CD1   . LEU A 1  74  ? 94.295  112.967 130.655 1.00 27.47  ? 71  LEU A CD1   1 
ATOM   272   C CD2   . LEU A 1  74  ? 96.732  113.267 131.014 1.00 21.16  ? 71  LEU A CD2   1 
ATOM   273   N N     . VAL A 1  75  ? 95.501  108.612 131.871 1.00 23.08  ? 72  VAL A N     1 
ATOM   274   C CA    . VAL A 1  75  ? 95.682  107.517 130.945 1.00 16.72  ? 72  VAL A CA    1 
ATOM   275   C C     . VAL A 1  75  ? 94.445  106.678 130.858 1.00 19.14  ? 72  VAL A C     1 
ATOM   276   O O     . VAL A 1  75  ? 94.019  106.311 129.766 1.00 23.58  ? 72  VAL A O     1 
ATOM   277   C CB    . VAL A 1  75  ? 96.852  106.643 131.368 1.00 15.26  ? 72  VAL A CB    1 
ATOM   278   C CG1   . VAL A 1  75  ? 96.901  105.390 130.575 1.00 1.73   ? 72  VAL A CG1   1 
ATOM   279   C CG2   . VAL A 1  75  ? 98.105  107.395 131.150 1.00 12.92  ? 72  VAL A CG2   1 
ATOM   280   N N     . ARG A 1  76  ? 93.849  106.370 131.977 1.00 20.33  ? 73  ARG A N     1 
ATOM   281   C CA    . ARG A 1  76  ? 92.664  105.565 131.949 1.00 16.79  ? 73  ARG A CA    1 
ATOM   282   C C     . ARG A 1  76  ? 91.493  106.248 131.314 1.00 22.20  ? 73  ARG A C     1 
ATOM   283   O O     . ARG A 1  76  ? 90.730  105.601 130.608 1.00 25.15  ? 73  ARG A O     1 
ATOM   284   C CB    . ARG A 1  76  ? 92.306  105.195 133.310 1.00 20.10  ? 73  ARG A CB    1 
ATOM   285   C CG    . ARG A 1  76  ? 93.233  104.272 133.870 1.00 23.36  ? 73  ARG A CG    1 
ATOM   286   C CD    . ARG A 1  76  ? 92.929  103.989 135.219 1.00 24.39  ? 73  ARG A CD    1 
ATOM   287   N NE    . ARG A 1  76  ? 93.915  103.187 135.796 1.00 15.53  ? 73  ARG A NE    1 
ATOM   288   C CZ    . ARG A 1  76  ? 93.962  101.898 135.691 1.00 11.61  ? 73  ARG A CZ    1 
ATOM   289   N NH1   . ARG A 1  76  ? 93.055  101.275 135.018 1.00 20.21  ? 73  ARG A NH1   1 
ATOM   290   N NH2   . ARG A 1  76  ? 94.895  101.241 136.259 1.00 14.61  ? 73  ARG A NH2   1 
ATOM   291   N N     . GLU A 1  77  ? 91.327  107.538 131.542 1.00 24.68  ? 74  GLU A N     1 
ATOM   292   C CA    . GLU A 1  77  ? 90.226  108.261 130.949 1.00 21.83  ? 74  GLU A CA    1 
ATOM   293   C C     . GLU A 1  77  ? 90.301  108.155 129.447 1.00 20.07  ? 74  GLU A C     1 
ATOM   294   O O     . GLU A 1  77  ? 89.313  107.862 128.775 1.00 28.11  ? 74  GLU A O     1 
ATOM   295   C CB    . GLU A 1  77  ? 90.322  109.716 131.352 1.00 28.75  ? 74  GLU A CB    1 
ATOM   296   C CG    . GLU A 1  77  ? 89.251  110.630 130.831 0.00 37.62  ? 74  GLU A CG    1 
ATOM   297   C CD    . GLU A 1  77  ? 89.495  112.116 131.225 0.00 45.10  ? 74  GLU A CD    1 
ATOM   298   O OE1   . GLU A 1  77  ? 89.854  112.386 132.357 0.00 39.81  ? 74  GLU A OE1   1 
ATOM   299   O OE2   . GLU A 1  77  ? 89.325  112.971 130.381 0.00 44.58  ? 74  GLU A OE2   1 
ATOM   300   N N     . ILE A 1  78  ? 91.492  108.332 128.909 1.00 22.07  ? 75  ILE A N     1 
ATOM   301   C CA    . ILE A 1  78  ? 91.652  108.252 127.482 1.00 19.35  ? 75  ILE A CA    1 
ATOM   302   C C     . ILE A 1  78  ? 91.390  106.848 126.993 1.00 20.77  ? 75  ILE A C     1 
ATOM   303   O O     . ILE A 1  78  ? 90.690  106.640 126.001 1.00 25.03  ? 75  ILE A O     1 
ATOM   304   C CB    . ILE A 1  78  ? 93.054  108.685 127.084 1.00 16.67  ? 75  ILE A CB    1 
ATOM   305   C CG1   . ILE A 1  78  ? 93.216  110.158 127.368 1.00 18.44  ? 75  ILE A CG1   1 
ATOM   306   C CG2   . ILE A 1  78  ? 93.283  108.366 125.630 1.00 22.21  ? 75  ILE A CG2   1 
ATOM   307   C CD1   . ILE A 1  78  ? 94.631  110.646 127.308 1.00 16.85  ? 75  ILE A CD1   1 
ATOM   308   N N     . ALA A 1  79  ? 91.958  105.870 127.666 1.00 20.45  ? 76  ALA A N     1 
ATOM   309   C CA    . ALA A 1  79  ? 91.786  104.511 127.242 1.00 12.16  ? 76  ALA A CA    1 
ATOM   310   C C     . ALA A 1  79  ? 90.341  104.098 127.254 1.00 15.71  ? 76  ALA A C     1 
ATOM   311   O O     . ALA A 1  79  ? 89.930  103.347 126.380 1.00 21.60  ? 76  ALA A O     1 
ATOM   312   C CB    . ALA A 1  79  ? 92.588  103.618 128.114 1.00 18.04  ? 76  ALA A CB    1 
ATOM   313   N N     . GLN A 1  80  ? 89.567  104.601 128.212 1.00 18.54  ? 77  GLN A N     1 
ATOM   314   C CA    . GLN A 1  80  ? 88.151  104.303 128.359 1.00 18.56  ? 77  GLN A CA    1 
ATOM   315   C C     . GLN A 1  80  ? 87.357  104.724 127.164 1.00 19.88  ? 77  GLN A C     1 
ATOM   316   O O     . GLN A 1  80  ? 86.360  104.091 126.832 1.00 25.35  ? 77  GLN A O     1 
ATOM   317   C CB    . GLN A 1  80  ? 87.592  104.971 129.598 1.00 20.83  ? 77  GLN A CB    1 
ATOM   318   C CG    . GLN A 1  80  ? 86.168  104.704 129.876 1.00 25.25  ? 77  GLN A CG    1 
ATOM   319   C CD    . GLN A 1  80  ? 85.757  105.207 131.270 1.00 33.75  ? 77  GLN A CD    1 
ATOM   320   O OE1   . GLN A 1  80  ? 85.995  106.362 131.697 1.00 37.45  ? 77  GLN A OE1   1 
ATOM   321   N NE2   . GLN A 1  80  ? 85.136  104.284 131.992 1.00 39.61  ? 77  GLN A NE2   1 
ATOM   322   N N     . ASP A 1  81  ? 87.747  105.813 126.527 1.00 23.41  ? 78  ASP A N     1 
ATOM   323   C CA    . ASP A 1  81  ? 87.027  106.225 125.342 1.00 25.37  ? 78  ASP A CA    1 
ATOM   324   C C     . ASP A 1  81  ? 87.269  105.254 124.200 1.00 23.44  ? 78  ASP A C     1 
ATOM   325   O O     . ASP A 1  81  ? 86.391  105.043 123.367 1.00 25.08  ? 78  ASP A O     1 
ATOM   326   C CB    . ASP A 1  81  ? 87.429  107.621 124.888 1.00 31.72  ? 78  ASP A CB    1 
ATOM   327   C CG    . ASP A 1  81  ? 86.889  108.752 125.764 1.00 54.32  ? 78  ASP A CG    1 
ATOM   328   O OD1   . ASP A 1  81  ? 85.976  108.542 126.531 1.00 53.79  ? 78  ASP A OD1   1 
ATOM   329   O OD2   . ASP A 1  81  ? 87.409  109.834 125.644 1.00 59.81  ? 78  ASP A OD2   1 
ATOM   330   N N     . PHE A 1  82  ? 88.453  104.658 124.139 1.00 20.33  ? 79  PHE A N     1 
ATOM   331   C CA    . PHE A 1  82  ? 88.697  103.739 123.040 1.00 17.15  ? 79  PHE A CA    1 
ATOM   332   C C     . PHE A 1  82  ? 88.024  102.405 123.280 1.00 19.01  ? 79  PHE A C     1 
ATOM   333   O O     . PHE A 1  82  ? 87.414  101.837 122.373 1.00 27.56  ? 79  PHE A O     1 
ATOM   334   C CB    . PHE A 1  82  ? 90.184  103.481 122.838 1.00 13.47  ? 79  PHE A CB    1 
ATOM   335   C CG    . PHE A 1  82  ? 90.926  104.647 122.378 1.00 13.04  ? 79  PHE A CG    1 
ATOM   336   C CD1   . PHE A 1  82  ? 91.985  105.091 123.080 1.00 20.84  ? 79  PHE A CD1   1 
ATOM   337   C CD2   . PHE A 1  82  ? 90.561  105.320 121.272 1.00 17.47  ? 79  PHE A CD2   1 
ATOM   338   C CE1   . PHE A 1  82  ? 92.673  106.182 122.686 1.00 20.75  ? 79  PHE A CE1   1 
ATOM   339   C CE2   . PHE A 1  82  ? 91.239  106.420 120.881 1.00 18.21  ? 79  PHE A CE2   1 
ATOM   340   C CZ    . PHE A 1  82  ? 92.298  106.851 121.595 1.00 18.46  ? 79  PHE A CZ    1 
ATOM   341   N N     . LYS A 1  83  ? 88.183  101.875 124.488 1.00 18.74  ? 80  LYS A N     1 
ATOM   342   C CA    . LYS A 1  83  ? 87.623  100.574 124.830 1.00 18.71  ? 80  LYS A CA    1 
ATOM   343   C C     . LYS A 1  83  ? 87.387  100.481 126.331 1.00 20.62  ? 80  LYS A C     1 
ATOM   344   O O     . LYS A 1  83  ? 88.252  100.861 127.119 1.00 23.73  ? 80  LYS A O     1 
ATOM   345   C CB    . LYS A 1  83  ? 88.569  99.464  124.369 1.00 19.63  ? 80  LYS A CB    1 
ATOM   346   C CG    . LYS A 1  83  ? 87.997  98.053  124.416 1.00 25.21  ? 80  LYS A CG    1 
ATOM   347   C CD    . LYS A 1  83  ? 86.948  97.861  123.329 1.00 29.06  ? 80  LYS A CD    1 
ATOM   348   C CE    . LYS A 1  83  ? 86.762  96.392  122.973 1.00 35.92  ? 80  LYS A CE    1 
ATOM   349   N NZ    . LYS A 1  83  ? 86.011  95.642  124.015 1.00 42.18  ? 80  LYS A NZ    1 
ATOM   350   N N     . THR A 1  84  ? 86.235  99.972  126.749 1.00 22.75  ? 81  THR A N     1 
ATOM   351   C CA    . THR A 1  84  ? 85.973  99.859  128.156 1.00 25.13  ? 81  THR A CA    1 
ATOM   352   C C     . THR A 1  84  ? 86.625  98.658  128.774 1.00 25.73  ? 81  THR A C     1 
ATOM   353   O O     . THR A 1  84  ? 87.068  97.737  128.099 1.00 29.16  ? 81  THR A O     1 
ATOM   354   C CB    . THR A 1  84  ? 84.466  99.820  128.419 1.00 30.28  ? 81  THR A CB    1 
ATOM   355   O OG1   . THR A 1  84  ? 83.897  98.667  127.794 1.00 33.84  ? 81  THR A OG1   1 
ATOM   356   C CG2   . THR A 1  84  ? 83.828  101.067 127.848 1.00 33.31  ? 81  THR A CG2   1 
ATOM   357   N N     . ASP A 1  85  ? 86.654  98.662  130.087 1.00 27.55  ? 82  ASP A N     1 
ATOM   358   C CA    . ASP A 1  85  ? 87.161  97.574  130.890 1.00 26.34  ? 82  ASP A CA    1 
ATOM   359   C C     . ASP A 1  85  ? 88.590  97.140  130.598 1.00 23.50  ? 82  ASP A C     1 
ATOM   360   O O     . ASP A 1  85  ? 88.891  95.953  130.617 1.00 25.86  ? 82  ASP A O     1 
ATOM   361   C CB    . ASP A 1  85  ? 86.236  96.393  130.716 1.00 31.80  ? 82  ASP A CB    1 
ATOM   362   C CG    . ASP A 1  85  ? 84.849  96.771  131.106 1.00 46.78  ? 82  ASP A CG    1 
ATOM   363   O OD1   . ASP A 1  85  ? 84.695  97.537  132.034 1.00 44.90  ? 82  ASP A OD1   1 
ATOM   364   O OD2   . ASP A 1  85  ? 83.932  96.335  130.451 1.00 49.74  ? 82  ASP A OD2   1 
ATOM   365   N N     . LEU A 1  86  ? 89.483  98.080  130.365 1.00 17.75  ? 83  LEU A N     1 
ATOM   366   C CA    . LEU A 1  86  ? 90.873  97.712  130.174 1.00 11.18  ? 83  LEU A CA    1 
ATOM   367   C C     . LEU A 1  86  ? 91.626  97.840  131.446 1.00 15.84  ? 83  LEU A C     1 
ATOM   368   O O     . LEU A 1  86  ? 91.333  98.687  132.286 1.00 26.14  ? 83  LEU A O     1 
ATOM   369   C CB    . LEU A 1  86  ? 91.581  98.573  129.149 1.00 10.24  ? 83  LEU A CB    1 
ATOM   370   C CG    . LEU A 1  86  ? 91.085  98.527  127.756 1.00 18.37  ? 83  LEU A CG    1 
ATOM   371   C CD1   . LEU A 1  86  ? 91.828  99.549  126.978 1.00 23.21  ? 83  LEU A CD1   1 
ATOM   372   C CD2   . LEU A 1  86  ? 91.325  97.148  127.151 1.00 18.01  ? 83  LEU A CD2   1 
ATOM   373   N N     . ARG A 1  87  ? 92.638  97.030  131.562 1.00 12.30  ? 84  ARG A N     1 
ATOM   374   C CA    . ARG A 1  87  ? 93.529  97.051  132.680 1.00 10.35  ? 84  ARG A CA    1 
ATOM   375   C C     . ARG A 1  87  ? 94.888  97.414  132.218 1.00 11.66  ? 84  ARG A C     1 
ATOM   376   O O     . ARG A 1  87  ? 95.188  97.269  131.039 1.00 12.56  ? 84  ARG A O     1 
ATOM   377   C CB    . ARG A 1  87  ? 93.563  95.712  133.281 1.00 16.73  ? 84  ARG A CB    1 
ATOM   378   C CG    . ARG A 1  87  ? 92.318  95.321  133.863 1.00 22.85  ? 84  ARG A CG    1 
ATOM   379   C CD    . ARG A 1  87  ? 92.316  93.954  134.269 1.00 23.29  ? 84  ARG A CD    1 
ATOM   380   N NE    . ARG A 1  87  ? 91.056  93.644  134.828 1.00 35.69  ? 84  ARG A NE    1 
ATOM   381   C CZ    . ARG A 1  87  ? 90.761  93.575  136.115 1.00 40.20  ? 84  ARG A CZ    1 
ATOM   382   N NH1   . ARG A 1  87  ? 91.668  93.688  137.022 1.00 35.36  ? 84  ARG A NH1   1 
ATOM   383   N NH2   . ARG A 1  87  ? 89.519  93.377  136.468 1.00 46.25  ? 84  ARG A NH2   1 
ATOM   384   N N     . PHE A 1  88  ? 95.689  97.940  133.108 1.00 11.38  ? 85  PHE A N     1 
ATOM   385   C CA    . PHE A 1  88  ? 97.045  98.284  132.752 1.00 8.50   ? 85  PHE A CA    1 
ATOM   386   C C     . PHE A 1  88  ? 98.035  97.718  133.685 1.00 9.81   ? 85  PHE A C     1 
ATOM   387   O O     . PHE A 1  88  ? 97.842  97.772  134.886 1.00 19.57  ? 85  PHE A O     1 
ATOM   388   C CB    . PHE A 1  88  ? 97.240  99.791  132.764 1.00 4.38   ? 85  PHE A CB    1 
ATOM   389   C CG    . PHE A 1  88  ? 96.552  100.520 131.722 1.00 4.52   ? 85  PHE A CG    1 
ATOM   390   C CD1   . PHE A 1  88  ? 95.246  100.813 131.799 1.00 5.56   ? 85  PHE A CD1   1 
ATOM   391   C CD2   . PHE A 1  88  ? 97.251  100.949 130.651 1.00 0.99   ? 85  PHE A CD2   1 
ATOM   392   C CE1   . PHE A 1  88  ? 94.650  101.493 130.812 1.00 6.69   ? 85  PHE A CE1   1 
ATOM   393   C CE2   . PHE A 1  88  ? 96.661  101.630 129.677 1.00 0.90   ? 85  PHE A CE2   1 
ATOM   394   C CZ    . PHE A 1  88  ? 95.365  101.897 129.751 1.00 1.38   ? 85  PHE A CZ    1 
ATOM   395   N N     . GLN A 1  89  ? 99.149  97.305  133.163 1.00 7.76   ? 86  GLN A N     1 
ATOM   396   C CA    . GLN A 1  89  ? 100.204 96.898  134.045 1.00 6.85   ? 86  GLN A CA    1 
ATOM   397   C C     . GLN A 1  89  ? 100.858 98.135  134.573 1.00 9.86   ? 86  GLN A C     1 
ATOM   398   O O     . GLN A 1  89  ? 100.945 99.131  133.859 1.00 8.78   ? 86  GLN A O     1 
ATOM   399   C CB    . GLN A 1  89  ? 101.227 96.061  133.348 1.00 7.55   ? 86  GLN A CB    1 
ATOM   400   C CG    . GLN A 1  89  ? 100.724 94.802  132.898 1.00 8.25   ? 86  GLN A CG    1 
ATOM   401   C CD    . GLN A 1  89  ? 101.780 93.970  132.399 1.00 4.40   ? 86  GLN A CD    1 
ATOM   402   O OE1   . GLN A 1  89  ? 102.787 94.472  131.926 1.00 5.07   ? 86  GLN A OE1   1 
ATOM   403   N NE2   . GLN A 1  89  ? 101.603 92.685  132.484 1.00 6.17   ? 86  GLN A NE2   1 
ATOM   404   N N     . SER A 1  90  ? 101.430 98.080  135.763 1.00 8.38   ? 87  SER A N     1 
ATOM   405   C CA    . SER A 1  90  ? 102.069 99.270  136.280 1.00 3.41   ? 87  SER A CA    1 
ATOM   406   C C     . SER A 1  90  ? 103.228 99.707  135.425 1.00 6.67   ? 87  SER A C     1 
ATOM   407   O O     . SER A 1  90  ? 103.507 100.906 135.322 1.00 4.30   ? 87  SER A O     1 
ATOM   408   C CB    . SER A 1  90  ? 102.584 99.008  137.650 1.00 4.15   ? 87  SER A CB    1 
ATOM   409   O OG    . SER A 1  90  ? 103.634 98.101  137.589 1.00 1.29   ? 87  SER A OG    1 
ATOM   410   N N     . SER A 1  91  ? 103.861 98.772  134.743 1.00 5.11   ? 88  SER A N     1 
ATOM   411   C CA    . SER A 1  91  ? 104.951 99.116  133.876 1.00 2.53   ? 88  SER A CA    1 
ATOM   412   C C     . SER A 1  91  ? 104.471 99.739  132.582 1.00 5.59   ? 88  SER A C     1 
ATOM   413   O O     . SER A 1  91  ? 105.248 100.404 131.900 1.00 9.87   ? 88  SER A O     1 
ATOM   414   C CB    . SER A 1  91  ? 105.789 97.903  133.622 1.00 4.93   ? 88  SER A CB    1 
ATOM   415   O OG    . SER A 1  91  ? 105.061 96.951  132.929 1.00 1.05   ? 88  SER A OG    1 
ATOM   416   N N     . ALA A 1  92  ? 103.202 99.565  132.223 1.00 6.57   ? 89  ALA A N     1 
ATOM   417   C CA    . ALA A 1  92  ? 102.712 100.177 131.015 1.00 5.29   ? 89  ALA A CA    1 
ATOM   418   C C     . ALA A 1  92  ? 102.541 101.624 131.276 1.00 8.10   ? 89  ALA A C     1 
ATOM   419   O O     . ALA A 1  92  ? 102.863 102.466 130.442 1.00 9.52   ? 89  ALA A O     1 
ATOM   420   C CB    . ALA A 1  92  ? 101.407 99.588  130.583 1.00 7.62   ? 89  ALA A CB    1 
ATOM   421   N N     . VAL A 1  93  ? 102.087 101.936 132.473 1.00 9.79   ? 90  VAL A N     1 
ATOM   422   C CA    . VAL A 1  93  ? 101.883 103.324 132.778 1.00 5.87   ? 90  VAL A CA    1 
ATOM   423   C C     . VAL A 1  93  ? 103.217 104.014 132.869 1.00 8.27   ? 90  VAL A C     1 
ATOM   424   O O     . VAL A 1  93  ? 103.358 105.124 132.367 1.00 5.43   ? 90  VAL A O     1 
ATOM   425   C CB    . VAL A 1  93  ? 101.089 103.542 134.029 1.00 6.10   ? 90  VAL A CB    1 
ATOM   426   C CG1   . VAL A 1  93  ? 101.055 105.021 134.321 1.00 4.90   ? 90  VAL A CG1   1 
ATOM   427   C CG2   . VAL A 1  93  ? 99.706  102.987 133.830 1.00 6.57   ? 90  VAL A CG2   1 
ATOM   428   N N     . MET A 1  94  ? 104.203 103.404 133.512 1.00 7.23   ? 91  MET A N     1 
ATOM   429   C CA    . MET A 1  94  ? 105.487 104.069 133.558 1.00 2.36   ? 91  MET A CA    1 
ATOM   430   C C     . MET A 1  94  ? 106.049 104.274 132.179 1.00 8.03   ? 91  MET A C     1 
ATOM   431   O O     . MET A 1  94  ? 106.647 105.315 131.921 1.00 9.07   ? 91  MET A O     1 
ATOM   432   C CB    . MET A 1  94  ? 106.468 103.305 134.397 1.00 2.40   ? 91  MET A CB    1 
ATOM   433   C CG    . MET A 1  94  ? 106.149 103.272 135.857 1.00 1.25   ? 91  MET A CG    1 
ATOM   434   S SD    . MET A 1  94  ? 106.158 104.915 136.604 1.00 3.54   ? 91  MET A SD    1 
ATOM   435   C CE    . MET A 1  94  ? 104.428 105.398 136.704 1.00 3.54   ? 91  MET A CE    1 
ATOM   436   N N     . ALA A 1  95  ? 105.874 103.331 131.265 1.00 9.76   ? 92  ALA A N     1 
ATOM   437   C CA    . ALA A 1  95  ? 106.393 103.578 129.943 1.00 6.13   ? 92  ALA A CA    1 
ATOM   438   C C     . ALA A 1  95  ? 105.702 104.773 129.309 1.00 7.21   ? 92  ALA A C     1 
ATOM   439   O O     . ALA A 1  95  ? 106.360 105.627 128.711 1.00 13.70  ? 92  ALA A O     1 
ATOM   440   C CB    . ALA A 1  95  ? 106.224 102.354 129.095 1.00 10.40  ? 92  ALA A CB    1 
ATOM   441   N N     . LEU A 1  96  ? 104.393 104.909 129.502 1.00 8.67   ? 93  LEU A N     1 
ATOM   442   C CA    . LEU A 1  96  ? 103.713 106.057 128.937 1.00 6.63   ? 93  LEU A CA    1 
ATOM   443   C C     . LEU A 1  96  ? 104.162 107.330 129.564 1.00 10.96  ? 93  LEU A C     1 
ATOM   444   O O     . LEU A 1  96  ? 104.240 108.357 128.889 1.00 11.02  ? 93  LEU A O     1 
ATOM   445   C CB    . LEU A 1  96  ? 102.204 105.979 129.113 1.00 6.68   ? 93  LEU A CB    1 
ATOM   446   C CG    . LEU A 1  96  ? 101.463 104.971 128.291 1.00 5.08   ? 93  LEU A CG    1 
ATOM   447   C CD1   . LEU A 1  96  ? 100.066 104.871 128.782 1.00 0.52   ? 93  LEU A CD1   1 
ATOM   448   C CD2   . LEU A 1  96  ? 101.429 105.408 126.856 1.00 2.30   ? 93  LEU A CD2   1 
ATOM   449   N N     . GLN A 1  97  ? 104.432 107.312 130.846 1.00 10.69  ? 94  GLN A N     1 
ATOM   450   C CA    . GLN A 1  97  ? 104.807 108.540 131.472 1.00 5.67   ? 94  GLN A CA    1 
ATOM   451   C C     . GLN A 1  97  ? 106.185 108.980 131.096 1.00 7.02   ? 94  GLN A C     1 
ATOM   452   O O     . GLN A 1  97  ? 106.399 110.173 130.894 1.00 11.10  ? 94  GLN A O     1 
ATOM   453   C CB    . GLN A 1  97  ? 104.706 108.436 132.941 1.00 8.74   ? 94  GLN A CB    1 
ATOM   454   C CG    . GLN A 1  97  ? 104.879 109.693 133.576 1.00 10.73  ? 94  GLN A CG    1 
ATOM   455   C CD    . GLN A 1  97  ? 104.554 109.642 134.936 1.00 8.05   ? 94  GLN A CD    1 
ATOM   456   O OE1   . GLN A 1  97  ? 103.964 108.691 135.422 1.00 9.27   ? 94  GLN A OE1   1 
ATOM   457   N NE2   . GLN A 1  97  ? 104.924 110.664 135.622 1.00 13.75  ? 94  GLN A NE2   1 
ATOM   458   N N     . GLU A 1  98  ? 107.130 108.059 130.967 1.00 10.27  ? 95  GLU A N     1 
ATOM   459   C CA    . GLU A 1  98  ? 108.463 108.477 130.579 1.00 5.87   ? 95  GLU A CA    1 
ATOM   460   C C     . GLU A 1  98  ? 108.419 109.050 129.191 1.00 10.42  ? 95  GLU A C     1 
ATOM   461   O O     . GLU A 1  98  ? 109.087 110.042 128.900 1.00 13.28  ? 95  GLU A O     1 
ATOM   462   C CB    . GLU A 1  98  ? 109.402 107.306 130.501 1.00 4.43   ? 95  GLU A CB    1 
ATOM   463   C CG    . GLU A 1  98  ? 109.823 106.642 131.763 1.00 7.85   ? 95  GLU A CG    1 
ATOM   464   C CD    . GLU A 1  98  ? 110.890 107.298 132.580 0.00 29.57  ? 95  GLU A CD    1 
ATOM   465   O OE1   . GLU A 1  98  ? 111.773 107.913 132.016 0.00 31.06  ? 95  GLU A OE1   1 
ATOM   466   O OE2   . GLU A 1  98  ? 110.882 107.112 133.778 0.00 28.81  ? 95  GLU A OE2   1 
ATOM   467   N N     . ALA A 1  99  ? 107.636 108.439 128.310 1.00 9.38   ? 96  ALA A N     1 
ATOM   468   C CA    . ALA A 1  99  ? 107.572 108.947 126.973 1.00 6.16   ? 96  ALA A CA    1 
ATOM   469   C C     . ALA A 1  99  ? 106.939 110.308 126.924 1.00 8.99   ? 96  ALA A C     1 
ATOM   470   O O     . ALA A 1  99  ? 107.424 111.179 126.204 1.00 9.15   ? 96  ALA A O     1 
ATOM   471   C CB    . ALA A 1  99  ? 106.798 108.010 126.116 1.00 6.97   ? 96  ALA A CB    1 
ATOM   472   N N     . CYS A 1  100 ? 105.890 110.534 127.715 1.00 10.50  ? 97  CYS A N     1 
ATOM   473   C CA    . CYS A 1  100 ? 105.235 111.825 127.690 1.00 6.32   ? 97  CYS A CA    1 
ATOM   474   C C     . CYS A 1  100 ? 106.100 112.920 128.182 1.00 8.14   ? 97  CYS A C     1 
ATOM   475   O O     . CYS A 1  100 ? 106.111 114.005 127.607 1.00 8.23   ? 97  CYS A O     1 
ATOM   476   C CB    . CYS A 1  100 ? 104.010 111.834 128.529 1.00 8.37   ? 97  CYS A CB    1 
ATOM   477   S SG    . CYS A 1  100 ? 102.781 110.903 127.849 1.00 18.28  ? 97  CYS A SG    1 
ATOM   478   N N     . GLU A 1  101 ? 106.837 112.686 129.237 1.00 9.16   ? 98  GLU A N     1 
ATOM   479   C CA    . GLU A 1  101 ? 107.656 113.762 129.670 1.00 4.94   ? 98  GLU A CA    1 
ATOM   480   C C     . GLU A 1  101 ? 108.754 113.999 128.688 1.00 6.28   ? 98  GLU A C     1 
ATOM   481   O O     . GLU A 1  101 ? 108.996 115.133 128.302 1.00 6.72   ? 98  GLU A O     1 
ATOM   482   C CB    . GLU A 1  101 ? 108.235 113.497 131.005 1.00 8.19   ? 98  GLU A CB    1 
ATOM   483   C CG    . GLU A 1  101 ? 107.241 113.490 132.075 1.00 10.75  ? 98  GLU A CG    1 
ATOM   484   C CD    . GLU A 1  101 ? 107.890 113.356 133.349 1.00 20.02  ? 98  GLU A CD    1 
ATOM   485   O OE1   . GLU A 1  101 ? 109.044 113.057 133.331 1.00 23.21  ? 98  GLU A OE1   1 
ATOM   486   O OE2   . GLU A 1  101 ? 107.286 113.598 134.384 1.00 20.71  ? 98  GLU A OE2   1 
ATOM   487   N N     . ALA A 1  102 ? 109.347 112.957 128.131 1.00 6.52   ? 99  ALA A N     1 
ATOM   488   C CA    . ALA A 1  102 ? 110.415 113.217 127.196 1.00 2.90   ? 99  ALA A CA    1 
ATOM   489   C C     . ALA A 1  102 ? 109.920 114.038 126.038 1.00 3.27   ? 99  ALA A C     1 
ATOM   490   O O     . ALA A 1  102 ? 110.621 114.933 125.555 1.00 0.62   ? 99  ALA A O     1 
ATOM   491   C CB    . ALA A 1  102 ? 110.983 111.928 126.695 1.00 0.27   ? 99  ALA A CB    1 
ATOM   492   N N     . TYR A 1  103 ? 108.708 113.766 125.599 1.00 4.98   ? 100 TYR A N     1 
ATOM   493   C CA    . TYR A 1  103 ? 108.130 114.517 124.528 1.00 3.24   ? 100 TYR A CA    1 
ATOM   494   C C     . TYR A 1  103 ? 107.960 115.967 124.882 1.00 5.85   ? 100 TYR A C     1 
ATOM   495   O O     . TYR A 1  103 ? 108.399 116.838 124.131 1.00 8.23   ? 100 TYR A O     1 
ATOM   496   C CB    . TYR A 1  103 ? 106.812 113.931 124.143 1.00 4.65   ? 100 TYR A CB    1 
ATOM   497   C CG    . TYR A 1  103 ? 106.142 114.682 123.145 1.00 4.45   ? 100 TYR A CG    1 
ATOM   498   C CD1   . TYR A 1  103 ? 106.584 114.626 121.898 1.00 6.33   ? 100 TYR A CD1   1 
ATOM   499   C CD2   . TYR A 1  103 ? 105.063 115.401 123.451 1.00 5.06   ? 100 TYR A CD2   1 
ATOM   500   C CE1   . TYR A 1  103 ? 105.953 115.302 120.930 1.00 4.96   ? 100 TYR A CE1   1 
ATOM   501   C CE2   . TYR A 1  103 ? 104.431 116.070 122.487 1.00 5.01   ? 100 TYR A CE2   1 
ATOM   502   C CZ    . TYR A 1  103 ? 104.878 116.021 121.229 1.00 3.88   ? 100 TYR A CZ    1 
ATOM   503   O OH    . TYR A 1  103 ? 104.236 116.695 120.250 1.00 8.78   ? 100 TYR A OH    1 
ATOM   504   N N     . LEU A 1  104 ? 107.353 116.254 126.028 1.00 6.66   ? 101 LEU A N     1 
ATOM   505   C CA    . LEU A 1  104 ? 107.121 117.634 126.395 1.00 4.97   ? 101 LEU A CA    1 
ATOM   506   C C     . LEU A 1  104 ? 108.386 118.369 126.673 1.00 4.69   ? 101 LEU A C     1 
ATOM   507   O O     . LEU A 1  104 ? 108.477 119.550 126.370 1.00 8.09   ? 101 LEU A O     1 
ATOM   508   C CB    . LEU A 1  104 ? 106.212 117.740 127.592 1.00 5.57   ? 101 LEU A CB    1 
ATOM   509   C CG    . LEU A 1  104 ? 104.769 117.317 127.379 1.00 3.31   ? 101 LEU A CG    1 
ATOM   510   C CD1   . LEU A 1  104 ? 104.085 117.328 128.688 1.00 0.97   ? 101 LEU A CD1   1 
ATOM   511   C CD2   . LEU A 1  104 ? 104.055 118.245 126.427 1.00 2.11   ? 101 LEU A CD2   1 
ATOM   512   N N     . VAL A 1  105 ? 109.377 117.727 127.229 1.00 5.81   ? 102 VAL A N     1 
ATOM   513   C CA    . VAL A 1  105 ? 110.582 118.463 127.477 1.00 6.07   ? 102 VAL A CA    1 
ATOM   514   C C     . VAL A 1  105 ? 111.199 118.852 126.165 1.00 4.75   ? 102 VAL A C     1 
ATOM   515   O O     . VAL A 1  105 ? 111.652 119.986 126.022 1.00 3.64   ? 102 VAL A O     1 
ATOM   516   C CB    . VAL A 1  105 ? 111.567 117.680 128.300 1.00 7.43   ? 102 VAL A CB    1 
ATOM   517   C CG1   . VAL A 1  105 ? 112.889 118.415 128.381 1.00 10.42  ? 102 VAL A CG1   1 
ATOM   518   C CG2   . VAL A 1  105 ? 111.001 117.504 129.651 1.00 7.51   ? 102 VAL A CG2   1 
ATOM   519   N N     . GLY A 1  106 ? 111.248 117.938 125.203 1.00 3.00   ? 103 GLY A N     1 
ATOM   520   C CA    . GLY A 1  106 ? 111.818 118.274 123.910 1.00 2.19   ? 103 GLY A CA    1 
ATOM   521   C C     . GLY A 1  106 ? 111.046 119.400 123.240 1.00 3.42   ? 103 GLY A C     1 
ATOM   522   O O     . GLY A 1  106 ? 111.633 120.276 122.603 1.00 6.52   ? 103 GLY A O     1 
ATOM   523   N N     . LEU A 1  107 ? 109.736 119.415 123.414 1.00 5.10   ? 104 LEU A N     1 
ATOM   524   C CA    . LEU A 1  107 ? 108.941 120.460 122.831 1.00 4.06   ? 104 LEU A CA    1 
ATOM   525   C C     . LEU A 1  107 ? 109.286 121.779 123.458 1.00 5.61   ? 104 LEU A C     1 
ATOM   526   O O     . LEU A 1  107 ? 109.390 122.786 122.755 1.00 5.79   ? 104 LEU A O     1 
ATOM   527   C CB    . LEU A 1  107 ? 107.473 120.164 123.006 1.00 5.73   ? 104 LEU A CB    1 
ATOM   528   C CG    . LEU A 1  107 ? 106.497 121.125 122.418 1.00 3.49   ? 104 LEU A CG    1 
ATOM   529   C CD1   . LEU A 1  107 ? 106.678 121.257 120.924 1.00 5.22   ? 104 LEU A CD1   1 
ATOM   530   C CD2   . LEU A 1  107 ? 105.148 120.614 122.716 1.00 4.37   ? 104 LEU A CD2   1 
ATOM   531   N N     . PHE A 1  108 ? 109.500 121.809 124.763 1.00 6.50   ? 105 PHE A N     1 
ATOM   532   C CA    . PHE A 1  108 ? 109.847 123.063 125.376 1.00 4.57   ? 105 PHE A CA    1 
ATOM   533   C C     . PHE A 1  108 ? 111.207 123.544 124.941 1.00 6.29   ? 105 PHE A C     1 
ATOM   534   O O     . PHE A 1  108 ? 111.399 124.749 124.809 1.00 7.81   ? 105 PHE A O     1 
ATOM   535   C CB    . PHE A 1  108 ? 109.761 123.019 126.880 1.00 7.00   ? 105 PHE A CB    1 
ATOM   536   C CG    . PHE A 1  108 ? 108.358 123.079 127.365 1.00 6.54   ? 105 PHE A CG    1 
ATOM   537   C CD1   . PHE A 1  108 ? 107.818 122.071 128.077 1.00 3.84   ? 105 PHE A CD1   1 
ATOM   538   C CD2   . PHE A 1  108 ? 107.571 124.148 127.081 1.00 3.63   ? 105 PHE A CD2   1 
ATOM   539   C CE1   . PHE A 1  108 ? 106.532 122.131 128.495 1.00 2.11   ? 105 PHE A CE1   1 
ATOM   540   C CE2   . PHE A 1  108 ? 106.295 124.202 127.490 1.00 3.10   ? 105 PHE A CE2   1 
ATOM   541   C CZ    . PHE A 1  108 ? 105.776 123.199 128.194 1.00 3.98   ? 105 PHE A CZ    1 
ATOM   542   N N     . GLU A 1  109 ? 112.152 122.660 124.670 1.00 5.60   ? 106 GLU A N     1 
ATOM   543   C CA    . GLU A 1  109 ? 113.435 123.162 124.191 1.00 2.43   ? 106 GLU A CA    1 
ATOM   544   C C     . GLU A 1  109 ? 113.291 123.862 122.839 1.00 7.46   ? 106 GLU A C     1 
ATOM   545   O O     . GLU A 1  109 ? 113.865 124.934 122.625 1.00 10.10  ? 106 GLU A O     1 
ATOM   546   C CB    . GLU A 1  109 ? 114.443 122.051 124.005 1.00 3.00   ? 106 GLU A CB    1 
ATOM   547   C CG    . GLU A 1  109 ? 114.960 121.424 125.261 1.00 1.81   ? 106 GLU A CG    1 
ATOM   548   C CD    . GLU A 1  109 ? 115.888 120.258 125.015 1.00 3.77   ? 106 GLU A CD    1 
ATOM   549   O OE1   . GLU A 1  109 ? 115.992 119.840 123.897 1.00 7.25   ? 106 GLU A OE1   1 
ATOM   550   O OE2   . GLU A 1  109 ? 116.492 119.791 125.947 1.00 5.90   ? 106 GLU A OE2   1 
ATOM   551   N N     . ASP A 1  110 ? 112.472 123.310 121.937 1.00 7.37   ? 107 ASP A N     1 
ATOM   552   C CA    . ASP A 1  110 ? 112.301 123.942 120.630 1.00 3.31   ? 107 ASP A CA    1 
ATOM   553   C C     . ASP A 1  110 ? 111.480 125.207 120.753 1.00 9.93   ? 107 ASP A C     1 
ATOM   554   O O     . ASP A 1  110 ? 111.691 126.192 120.033 1.00 10.29  ? 107 ASP A O     1 
ATOM   555   C CB    . ASP A 1  110 ? 111.622 123.018 119.652 1.00 2.97   ? 107 ASP A CB    1 
ATOM   556   C CG    . ASP A 1  110 ? 112.481 121.854 119.241 1.00 1.63   ? 107 ASP A CG    1 
ATOM   557   O OD1   . ASP A 1  110 ? 113.642 121.837 119.542 1.00 5.64   ? 107 ASP A OD1   1 
ATOM   558   O OD2   . ASP A 1  110 ? 111.974 120.986 118.548 1.00 6.39   ? 107 ASP A OD2   1 
ATOM   559   N N     . THR A 1  111 ? 110.553 125.202 121.690 1.00 10.22  ? 108 THR A N     1 
ATOM   560   C CA    . THR A 1  111 ? 109.721 126.348 121.949 1.00 5.38   ? 108 THR A CA    1 
ATOM   561   C C     . THR A 1  111 ? 110.600 127.482 122.416 1.00 7.86   ? 108 THR A C     1 
ATOM   562   O O     . THR A 1  111 ? 110.433 128.623 121.992 1.00 12.39  ? 108 THR A O     1 
ATOM   563   C CB    . THR A 1  111 ? 108.686 126.020 123.008 1.00 5.23   ? 108 THR A CB    1 
ATOM   564   O OG1   . THR A 1  111 ? 107.853 124.975 122.532 1.00 8.19   ? 108 THR A OG1   1 
ATOM   565   C CG2   . THR A 1  111 ? 107.858 127.171 123.318 1.00 6.48   ? 108 THR A CG2   1 
ATOM   566   N N     . ASN A 1  112 ? 111.547 127.189 123.288 1.00 10.51  ? 109 ASN A N     1 
ATOM   567   C CA    . ASN A 1  112 ? 112.426 128.209 123.787 1.00 7.49   ? 109 ASN A CA    1 
ATOM   568   C C     . ASN A 1  112 ? 113.252 128.812 122.679 1.00 14.89  ? 109 ASN A C     1 
ATOM   569   O O     . ASN A 1  112 ? 113.436 130.026 122.649 1.00 12.80  ? 109 ASN A O     1 
ATOM   570   C CB    . ASN A 1  112 ? 113.324 127.646 124.828 1.00 11.34  ? 109 ASN A CB    1 
ATOM   571   C CG    . ASN A 1  112 ? 114.012 128.655 125.541 1.00 16.59  ? 109 ASN A CG    1 
ATOM   572   O OD1   . ASN A 1  112 ? 113.371 129.499 126.160 1.00 22.96  ? 109 ASN A OD1   1 
ATOM   573   N ND2   . ASN A 1  112 ? 115.297 128.638 125.499 1.00 22.57  ? 109 ASN A ND2   1 
ATOM   574   N N     . LEU A 1  113 ? 113.716 128.006 121.727 1.00 15.18  ? 110 LEU A N     1 
ATOM   575   C CA    . LEU A 1  113 ? 114.505 128.571 120.641 1.00 11.29  ? 110 LEU A CA    1 
ATOM   576   C C     . LEU A 1  113 ? 113.685 129.505 119.800 1.00 12.70  ? 110 LEU A C     1 
ATOM   577   O O     . LEU A 1  113 ? 114.185 130.531 119.339 1.00 16.45  ? 110 LEU A O     1 
ATOM   578   C CB    . LEU A 1  113 ? 115.011 127.500 119.713 1.00 9.18   ? 110 LEU A CB    1 
ATOM   579   C CG    . LEU A 1  113 ? 116.023 126.558 120.240 1.00 9.69   ? 110 LEU A CG    1 
ATOM   580   C CD1   . LEU A 1  113 ? 116.218 125.502 119.212 1.00 9.88   ? 110 LEU A CD1   1 
ATOM   581   C CD2   . LEU A 1  113 ? 117.329 127.270 120.534 1.00 20.15  ? 110 LEU A CD2   1 
ATOM   582   N N     . CYS A 1  114 ? 112.427 129.166 119.591 1.00 12.41  ? 111 CYS A N     1 
ATOM   583   C CA    . CYS A 1  114 ? 111.582 130.023 118.801 1.00 7.95   ? 111 CYS A CA    1 
ATOM   584   C C     . CYS A 1  114 ? 111.407 131.364 119.487 1.00 12.07  ? 111 CYS A C     1 
ATOM   585   O O     . CYS A 1  114 ? 111.491 132.409 118.838 1.00 15.00  ? 111 CYS A O     1 
ATOM   586   C CB    . CYS A 1  114 ? 110.231 129.398 118.612 1.00 9.63   ? 111 CYS A CB    1 
ATOM   587   S SG    . CYS A 1  114 ? 110.253 127.991 117.600 1.00 13.23  ? 111 CYS A SG    1 
ATOM   588   N N     . ALA A 1  115 ? 111.205 131.353 120.801 1.00 13.10  ? 112 ALA A N     1 
ATOM   589   C CA    . ALA A 1  115 ? 111.039 132.597 121.519 1.00 5.62   ? 112 ALA A CA    1 
ATOM   590   C C     . ALA A 1  115 ? 112.280 133.442 121.442 1.00 7.30   ? 112 ALA A C     1 
ATOM   591   O O     . ALA A 1  115 ? 112.188 134.653 121.276 1.00 7.75   ? 112 ALA A O     1 
ATOM   592   C CB    . ALA A 1  115 ? 110.704 132.337 122.949 1.00 9.35   ? 112 ALA A CB    1 
ATOM   593   N N     . ILE A 1  116 ? 113.445 132.823 121.482 1.00 11.63  ? 113 ILE A N     1 
ATOM   594   C CA    . ILE A 1  116 ? 114.683 133.574 121.381 1.00 7.85   ? 113 ILE A CA    1 
ATOM   595   C C     . ILE A 1  116 ? 114.795 134.202 120.008 1.00 12.63  ? 113 ILE A C     1 
ATOM   596   O O     . ILE A 1  116 ? 115.203 135.345 119.873 1.00 17.08  ? 113 ILE A O     1 
ATOM   597   C CB    . ILE A 1  116 ? 115.905 132.725 121.686 1.00 8.80   ? 113 ILE A CB    1 
ATOM   598   C CG1   . ILE A 1  116 ? 115.861 132.353 123.138 1.00 16.19  ? 113 ILE A CG1   1 
ATOM   599   C CG2   . ILE A 1  116 ? 117.163 133.513 121.373 1.00 18.23  ? 113 ILE A CG2   1 
ATOM   600   C CD1   . ILE A 1  116 ? 116.836 131.281 123.561 1.00 28.00  ? 113 ILE A CD1   1 
ATOM   601   N N     . HIS A 1  117 ? 114.442 133.466 118.971 1.00 13.29  ? 114 HIS A N     1 
ATOM   602   C CA    . HIS A 1  117 ? 114.498 133.952 117.598 1.00 9.61   ? 114 HIS A CA    1 
ATOM   603   C C     . HIS A 1  117 ? 113.673 135.212 117.439 1.00 7.27   ? 114 HIS A C     1 
ATOM   604   O O     . HIS A 1  117 ? 114.049 136.150 116.744 1.00 15.25  ? 114 HIS A O     1 
ATOM   605   C CB    . HIS A 1  117 ? 113.958 132.888 116.665 1.00 8.57   ? 114 HIS A CB    1 
ATOM   606   C CG    . HIS A 1  117 ? 114.149 133.154 115.279 1.00 6.90   ? 114 HIS A CG    1 
ATOM   607   N ND1   . HIS A 1  117 ? 115.374 133.123 114.726 1.00 8.57   ? 114 HIS A ND1   1 
ATOM   608   C CD2   . HIS A 1  117 ? 113.296 133.412 114.279 1.00 7.35   ? 114 HIS A CD2   1 
ATOM   609   C CE1   . HIS A 1  117 ? 115.283 133.360 113.461 1.00 10.04  ? 114 HIS A CE1   1 
ATOM   610   N NE2   . HIS A 1  117 ? 114.046 133.538 113.158 1.00 7.65   ? 114 HIS A NE2   1 
ATOM   611   N N     . ALA A 1  118 ? 112.550 135.256 118.119 1.00 7.90   ? 115 ALA A N     1 
ATOM   612   C CA    . ALA A 1  118 ? 111.646 136.383 118.077 1.00 6.14   ? 115 ALA A CA    1 
ATOM   613   C C     . ALA A 1  118 ? 112.064 137.489 119.030 1.00 6.32   ? 115 ALA A C     1 
ATOM   614   O O     . ALA A 1  118 ? 111.358 138.491 119.136 1.00 12.26  ? 115 ALA A O     1 
ATOM   615   C CB    . ALA A 1  118 ? 110.250 135.937 118.395 1.00 11.60  ? 115 ALA A CB    1 
ATOM   616   N N     . LYS A 1  119 ? 113.222 137.308 119.671 1.00 10.41  ? 116 LYS A N     1 
ATOM   617   C CA    . LYS A 1  119 ? 113.797 138.218 120.657 1.00 8.80   ? 116 LYS A CA    1 
ATOM   618   C C     . LYS A 1  119 ? 112.946 138.374 121.911 1.00 11.17  ? 116 LYS A C     1 
ATOM   619   O O     . LYS A 1  119 ? 112.714 139.487 122.380 1.00 14.87  ? 116 LYS A O     1 
ATOM   620   C CB    . LYS A 1  119 ? 114.092 139.584 120.043 1.00 6.57   ? 116 LYS A CB    1 
ATOM   621   C CG    . LYS A 1  119 ? 115.078 139.538 118.886 1.00 15.13  ? 116 LYS A CG    1 
ATOM   622   C CD    . LYS A 1  119 ? 115.584 140.927 118.537 1.00 20.65  ? 116 LYS A CD    1 
ATOM   623   C CE    . LYS A 1  119 ? 116.489 140.890 117.316 1.00 23.08  ? 116 LYS A CE    1 
ATOM   624   N NZ    . LYS A 1  119 ? 117.582 139.891 117.467 1.00 20.65  ? 116 LYS A NZ    1 
ATOM   625   N N     . ARG A 1  120 ? 112.545 137.250 122.486 1.00 9.99   ? 117 ARG A N     1 
ATOM   626   C CA    . ARG A 1  120 ? 111.839 137.235 123.728 1.00 5.11   ? 117 ARG A CA    1 
ATOM   627   C C     . ARG A 1  120 ? 112.430 136.252 124.684 1.00 8.37   ? 117 ARG A C     1 
ATOM   628   O O     . ARG A 1  120 ? 113.215 135.386 124.314 1.00 12.10  ? 117 ARG A O     1 
ATOM   629   C CB    . ARG A 1  120 ? 110.428 136.846 123.556 1.00 7.35   ? 117 ARG A CB    1 
ATOM   630   C CG    . ARG A 1  120 ? 109.648 137.704 122.806 1.00 9.96   ? 117 ARG A CG    1 
ATOM   631   C CD    . ARG A 1  120 ? 108.295 137.415 123.053 1.00 9.51   ? 117 ARG A CD    1 
ATOM   632   N NE    . ARG A 1  120 ? 107.959 136.148 122.650 1.00 8.90   ? 117 ARG A NE    1 
ATOM   633   C CZ    . ARG A 1  120 ? 107.587 135.869 121.436 1.00 7.57   ? 117 ARG A CZ    1 
ATOM   634   N NH1   . ARG A 1  120 ? 107.514 136.806 120.546 1.00 9.11   ? 117 ARG A NH1   1 
ATOM   635   N NH2   . ARG A 1  120 ? 107.282 134.672 121.080 1.00 11.38  ? 117 ARG A NH2   1 
ATOM   636   N N     . VAL A 1  121 ? 112.066 136.397 125.940 1.00 9.12   ? 118 VAL A N     1 
ATOM   637   C CA    . VAL A 1  121 ? 112.440 135.446 126.951 1.00 5.52   ? 118 VAL A CA    1 
ATOM   638   C C     . VAL A 1  121 ? 111.235 134.584 127.234 1.00 6.36   ? 118 VAL A C     1 
ATOM   639   O O     . VAL A 1  121 ? 111.368 133.390 127.474 1.00 10.55  ? 118 VAL A O     1 
ATOM   640   C CB    . VAL A 1  121 ? 112.929 136.138 128.210 1.00 6.06   ? 118 VAL A CB    1 
ATOM   641   C CG1   . VAL A 1  121 ? 113.209 135.135 129.293 1.00 19.13  ? 118 VAL A CG1   1 
ATOM   642   C CG2   . VAL A 1  121 ? 114.165 136.871 127.887 1.00 7.98   ? 118 VAL A CG2   1 
ATOM   643   N N     . THR A 1  122 ? 110.071 135.217 127.273 1.00 7.20   ? 119 THR A N     1 
ATOM   644   C CA    . THR A 1  122 ? 108.833 134.559 127.606 1.00 5.48   ? 119 THR A CA    1 
ATOM   645   C C     . THR A 1  122 ? 108.349 133.704 126.459 1.00 5.18   ? 119 THR A C     1 
ATOM   646   O O     . THR A 1  122 ? 108.247 134.188 125.327 1.00 9.28   ? 119 THR A O     1 
ATOM   647   C CB    . THR A 1  122 ? 107.766 135.610 127.916 1.00 5.80   ? 119 THR A CB    1 
ATOM   648   O OG1   . THR A 1  122 ? 108.249 136.480 128.937 1.00 14.84  ? 119 THR A OG1   1 
ATOM   649   C CG2   . THR A 1  122 ? 106.528 134.943 128.412 1.00 1.71   ? 119 THR A CG2   1 
ATOM   650   N N     . ILE A 1  123 ? 107.987 132.458 126.757 1.00 6.03   ? 120 ILE A N     1 
ATOM   651   C CA    . ILE A 1  123 ? 107.448 131.585 125.727 1.00 4.33   ? 120 ILE A CA    1 
ATOM   652   C C     . ILE A 1  123 ? 105.951 131.779 125.638 1.00 5.89   ? 120 ILE A C     1 
ATOM   653   O O     . ILE A 1  123 ? 105.259 131.880 126.648 1.00 7.28   ? 120 ILE A O     1 
ATOM   654   C CB    . ILE A 1  123 ? 107.789 130.101 125.923 1.00 5.24   ? 120 ILE A CB    1 
ATOM   655   C CG1   . ILE A 1  123 ? 107.244 129.560 127.208 1.00 3.50   ? 120 ILE A CG1   1 
ATOM   656   C CG2   . ILE A 1  123 ? 109.298 129.957 125.884 1.00 5.60   ? 120 ILE A CG2   1 
ATOM   657   C CD1   . ILE A 1  123 ? 107.263 128.053 127.309 1.00 1.37   ? 120 ILE A CD1   1 
ATOM   658   N N     . MET A 1  124 ? 105.438 131.840 124.425 1.00 6.13   ? 121 MET A N     1 
ATOM   659   C CA    . MET A 1  124 ? 104.021 132.036 124.191 1.00 4.76   ? 121 MET A CA    1 
ATOM   660   C C     . MET A 1  124 ? 103.446 130.890 123.371 1.00 8.01   ? 121 MET A C     1 
ATOM   661   O O     . MET A 1  124 ? 104.216 130.192 122.723 1.00 6.72   ? 121 MET A O     1 
ATOM   662   C CB    . MET A 1  124 ? 103.870 133.386 123.540 1.00 7.63   ? 121 MET A CB    1 
ATOM   663   C CG    . MET A 1  124 ? 104.345 134.445 124.434 1.00 5.17   ? 121 MET A CG    1 
ATOM   664   S SD    . MET A 1  124 ? 104.092 136.016 123.837 1.00 19.46  ? 121 MET A SD    1 
ATOM   665   C CE    . MET A 1  124 ? 104.898 136.885 125.162 1.00 7.67   ? 121 MET A CE    1 
ATOM   666   N N     . PRO A 1  125 ? 102.124 130.670 123.322 1.00 6.55   ? 122 PRO A N     1 
ATOM   667   C CA    . PRO A 1  125 ? 101.477 129.621 122.566 1.00 6.61   ? 122 PRO A CA    1 
ATOM   668   C C     . PRO A 1  125 ? 101.927 129.556 121.125 1.00 9.83   ? 122 PRO A C     1 
ATOM   669   O O     . PRO A 1  125 ? 101.981 128.470 120.552 1.00 6.05   ? 122 PRO A O     1 
ATOM   670   C CB    . PRO A 1  125 ? 100.033 130.024 122.659 1.00 6.25   ? 122 PRO A CB    1 
ATOM   671   C CG    . PRO A 1  125 ? 99.951  130.717 123.938 1.00 8.00   ? 122 PRO A CG    1 
ATOM   672   C CD    . PRO A 1  125 ? 101.204 131.481 124.063 1.00 7.34   ? 122 PRO A CD    1 
ATOM   673   N N     . LYS A 1  126 ? 102.262 130.692 120.546 1.00 10.71  ? 123 LYS A N     1 
ATOM   674   C CA    . LYS A 1  126 ? 102.719 130.687 119.170 1.00 5.60   ? 123 LYS A CA    1 
ATOM   675   C C     . LYS A 1  126 ? 104.085 130.034 119.015 1.00 10.62  ? 123 LYS A C     1 
ATOM   676   O O     . LYS A 1  126 ? 104.409 129.566 117.925 1.00 10.72  ? 123 LYS A O     1 
ATOM   677   C CB    . LYS A 1  126 ? 102.730 132.099 118.596 1.00 4.85   ? 123 LYS A CB    1 
ATOM   678   C CG    . LYS A 1  126 ? 101.339 132.693 118.436 1.00 11.20  ? 123 LYS A CG    1 
ATOM   679   C CD    . LYS A 1  126 ? 101.325 133.815 117.413 1.00 15.05  ? 123 LYS A CD    1 
ATOM   680   C CE    . LYS A 1  126 ? 102.030 135.064 117.923 1.00 25.75  ? 123 LYS A CE    1 
ATOM   681   N NZ    . LYS A 1  126 ? 101.830 136.210 116.995 1.00 29.36  ? 123 LYS A NZ    1 
ATOM   682   N N     . ASP A 1  127 ? 104.910 129.983 120.062 1.00 8.74   ? 124 ASP A N     1 
ATOM   683   C CA    . ASP A 1  127 ? 106.201 129.414 119.892 1.00 4.67   ? 124 ASP A CA    1 
ATOM   684   C C     . ASP A 1  127 ? 106.001 127.929 119.943 1.00 11.25  ? 124 ASP A C     1 
ATOM   685   O O     . ASP A 1  127 ? 106.678 127.171 119.247 1.00 11.82  ? 124 ASP A O     1 
ATOM   686   C CB    . ASP A 1  127 ? 107.101 129.881 121.007 1.00 6.78   ? 124 ASP A CB    1 
ATOM   687   C CG    . ASP A 1  127 ? 107.365 131.337 120.974 1.00 10.92  ? 124 ASP A CG    1 
ATOM   688   O OD1   . ASP A 1  127 ? 107.821 131.855 119.974 1.00 13.55  ? 124 ASP A OD1   1 
ATOM   689   O OD2   . ASP A 1  127 ? 107.133 131.978 121.990 1.00 9.00   ? 124 ASP A OD2   1 
ATOM   690   N N     . ILE A 1  128 ? 105.026 127.489 120.723 1.00 10.76  ? 125 ILE A N     1 
ATOM   691   C CA    . ILE A 1  128 ? 104.757 126.062 120.757 1.00 8.38   ? 125 ILE A CA    1 
ATOM   692   C C     . ILE A 1  128 ? 104.233 125.638 119.409 1.00 11.39  ? 125 ILE A C     1 
ATOM   693   O O     . ILE A 1  128 ? 104.662 124.626 118.852 1.00 12.57  ? 125 ILE A O     1 
ATOM   694   C CB    . ILE A 1  128 ? 103.745 125.640 121.830 1.00 5.85   ? 125 ILE A CB    1 
ATOM   695   C CG1   . ILE A 1  128 ? 104.339 125.844 123.192 1.00 5.72   ? 125 ILE A CG1   1 
ATOM   696   C CG2   . ILE A 1  128 ? 103.345 124.189 121.607 1.00 5.82   ? 125 ILE A CG2   1 
ATOM   697   C CD1   . ILE A 1  128 ? 103.369 125.719 124.320 1.00 5.99   ? 125 ILE A CD1   1 
ATOM   698   N N     . GLN A 1  129 ? 103.307 126.404 118.863 1.00 10.49  ? 126 GLN A N     1 
ATOM   699   C CA    . GLN A 1  129 ? 102.742 126.054 117.584 1.00 6.19   ? 126 GLN A CA    1 
ATOM   700   C C     . GLN A 1  129 ? 103.741 126.092 116.463 1.00 12.06  ? 126 GLN A C     1 
ATOM   701   O O     . GLN A 1  129 ? 103.706 125.226 115.590 1.00 17.72  ? 126 GLN A O     1 
ATOM   702   C CB    . GLN A 1  129 ? 101.625 126.975 117.264 1.00 3.64   ? 126 GLN A CB    1 
ATOM   703   C CG    . GLN A 1  129 ? 100.477 126.769 118.125 1.00 4.13   ? 126 GLN A CG    1 
ATOM   704   C CD    . GLN A 1  129 ? 99.479  127.802 117.950 1.00 4.22   ? 126 GLN A CD    1 
ATOM   705   O OE1   . GLN A 1  129 ? 99.721  128.772 117.238 1.00 14.61  ? 126 GLN A OE1   1 
ATOM   706   N NE2   . GLN A 1  129 ? 98.346  127.643 118.597 1.00 5.20   ? 126 GLN A NE2   1 
ATOM   707   N N     . LEU A 1  130 ? 104.659 127.042 116.470 1.00 12.13  ? 127 LEU A N     1 
ATOM   708   C CA    . LEU A 1  130 ? 105.620 127.058 115.406 1.00 8.92   ? 127 LEU A CA    1 
ATOM   709   C C     . LEU A 1  130 ? 106.493 125.842 115.489 1.00 13.20  ? 127 LEU A C     1 
ATOM   710   O O     . LEU A 1  130 ? 106.764 125.214 114.468 1.00 13.45  ? 127 LEU A O     1 
ATOM   711   C CB    . LEU A 1  130 ? 106.506 128.285 115.464 1.00 9.63   ? 127 LEU A CB    1 
ATOM   712   C CG    . LEU A 1  130 ? 107.588 128.393 114.380 1.00 8.97   ? 127 LEU A CG    1 
ATOM   713   C CD1   . LEU A 1  130 ? 106.965 128.450 113.004 1.00 1.40   ? 127 LEU A CD1   1 
ATOM   714   C CD2   . LEU A 1  130 ? 108.401 129.603 114.624 1.00 9.44   ? 127 LEU A CD2   1 
ATOM   715   N N     . ALA A 1  131 ? 106.950 125.475 116.680 1.00 12.70  ? 128 ALA A N     1 
ATOM   716   C CA    . ALA A 1  131 ? 107.818 124.329 116.742 1.00 9.39   ? 128 ALA A CA    1 
ATOM   717   C C     . ALA A 1  131 ? 107.120 123.098 116.243 1.00 11.23  ? 128 ALA A C     1 
ATOM   718   O O     . ALA A 1  131 ? 107.712 122.296 115.524 1.00 17.24  ? 128 ALA A O     1 
ATOM   719   C CB    . ALA A 1  131 ? 108.287 124.098 118.145 1.00 11.81  ? 128 ALA A CB    1 
ATOM   720   N N     . ARG A 1  132 ? 105.853 122.939 116.557 1.00 12.54  ? 129 ARG A N     1 
ATOM   721   C CA    . ARG A 1  132 ? 105.181 121.751 116.098 1.00 8.70   ? 129 ARG A CA    1 
ATOM   722   C C     . ARG A 1  132 ? 105.014 121.739 114.611 1.00 12.30  ? 129 ARG A C     1 
ATOM   723   O O     . ARG A 1  132 ? 105.218 120.709 113.956 1.00 11.02  ? 129 ARG A O     1 
ATOM   724   C CB    . ARG A 1  132 ? 103.861 121.640 116.735 1.00 9.34   ? 129 ARG A CB    1 
ATOM   725   C CG    . ARG A 1  132 ? 103.944 121.339 118.151 1.00 10.31  ? 129 ARG A CG    1 
ATOM   726   C CD    . ARG A 1  132 ? 102.685 121.297 118.743 1.00 9.17   ? 129 ARG A CD    1 
ATOM   727   N NE    . ARG A 1  132 ? 101.978 120.178 118.334 1.00 6.02   ? 129 ARG A NE    1 
ATOM   728   C CZ    . ARG A 1  132 ? 100.678 120.070 118.325 1.00 8.26   ? 129 ARG A CZ    1 
ATOM   729   N NH1   . ARG A 1  132 ? 99.923  121.059 118.693 1.00 13.93  ? 129 ARG A NH1   1 
ATOM   730   N NH2   . ARG A 1  132 ? 100.150 118.957 117.935 1.00 11.79  ? 129 ARG A NH2   1 
ATOM   731   N N     . ARG A 1  133 ? 104.710 122.884 114.045 1.00 15.65  ? 130 ARG A N     1 
ATOM   732   C CA    . ARG A 1  133 ? 104.544 122.945 112.626 1.00 9.99   ? 130 ARG A CA    1 
ATOM   733   C C     . ARG A 1  133 ? 105.798 122.642 111.859 1.00 12.08  ? 130 ARG A C     1 
ATOM   734   O O     . ARG A 1  133 ? 105.744 121.921 110.871 1.00 18.21  ? 130 ARG A O     1 
ATOM   735   C CB    . ARG A 1  133 ? 104.095 124.298 112.261 1.00 10.10  ? 130 ARG A CB    1 
ATOM   736   C CG    . ARG A 1  133 ? 103.994 124.574 110.879 1.00 15.12  ? 130 ARG A CG    1 
ATOM   737   C CD    . ARG A 1  133 ? 103.026 123.798 110.210 1.00 26.48  ? 130 ARG A CD    1 
ATOM   738   N NE    . ARG A 1  133 ? 103.014 124.118 108.795 1.00 29.51  ? 130 ARG A NE    1 
ATOM   739   C CZ    . ARG A 1  133 ? 102.314 125.107 108.218 1.00 32.12  ? 130 ARG A CZ    1 
ATOM   740   N NH1   . ARG A 1  133 ? 101.553 125.902 108.939 1.00 20.12  ? 130 ARG A NH1   1 
ATOM   741   N NH2   . ARG A 1  133 ? 102.400 125.278 106.912 1.00 17.27  ? 130 ARG A NH2   1 
ATOM   742   N N     . ILE A 1  134 ? 106.929 123.149 112.306 1.00 13.52  ? 131 ILE A N     1 
ATOM   743   C CA    . ILE A 1  134 ? 108.171 122.883 111.615 1.00 7.63   ? 131 ILE A CA    1 
ATOM   744   C C     . ILE A 1  134 ? 108.498 121.419 111.712 1.00 12.85  ? 131 ILE A C     1 
ATOM   745   O O     . ILE A 1  134 ? 108.966 120.820 110.753 1.00 18.08  ? 131 ILE A O     1 
ATOM   746   C CB    . ILE A 1  134 ? 109.319 123.732 112.121 1.00 10.89  ? 131 ILE A CB    1 
ATOM   747   C CG1   . ILE A 1  134 ? 109.057 125.153 111.749 1.00 9.12   ? 131 ILE A CG1   1 
ATOM   748   C CG2   . ILE A 1  134 ? 110.630 123.233 111.530 1.00 13.90  ? 131 ILE A CG2   1 
ATOM   749   C CD1   . ILE A 1  134 ? 109.949 126.133 112.413 1.00 8.63   ? 131 ILE A CD1   1 
ATOM   750   N N     . ARG A 1  135 ? 108.299 120.825 112.874 1.00 15.88  ? 132 ARG A N     1 
ATOM   751   C CA    . ARG A 1  135 ? 108.569 119.413 113.019 1.00 10.74  ? 132 ARG A CA    1 
ATOM   752   C C     . ARG A 1  135 ? 107.702 118.566 112.122 1.00 13.37  ? 132 ARG A C     1 
ATOM   753   O O     . ARG A 1  135 ? 108.133 117.503 111.679 1.00 25.38  ? 132 ARG A O     1 
ATOM   754   C CB    . ARG A 1  135 ? 108.313 118.951 114.393 1.00 8.17   ? 132 ARG A CB    1 
ATOM   755   C CG    . ARG A 1  135 ? 109.244 119.371 115.386 1.00 8.91   ? 132 ARG A CG    1 
ATOM   756   C CD    . ARG A 1  135 ? 108.805 118.894 116.646 1.00 7.84   ? 132 ARG A CD    1 
ATOM   757   N NE    . ARG A 1  135 ? 109.716 119.128 117.663 1.00 4.74   ? 132 ARG A NE    1 
ATOM   758   C CZ    . ARG A 1  135 ? 109.645 118.586 118.837 1.00 3.52   ? 132 ARG A CZ    1 
ATOM   759   N NH1   . ARG A 1  135 ? 108.689 117.787 119.178 1.00 5.41   ? 132 ARG A NH1   1 
ATOM   760   N NH2   . ARG A 1  135 ? 110.583 118.853 119.673 1.00 3.89   ? 132 ARG A NH2   1 
ATOM   761   N N     . GLY A 1  136 ? 106.482 119.009 111.847 1.00 14.97  ? 133 GLY A N     1 
ATOM   762   C CA    . GLY A 1  136 ? 105.609 118.244 110.983 1.00 12.24  ? 133 GLY A CA    1 
ATOM   763   C C     . GLY A 1  136 ? 104.417 117.618 111.668 1.00 9.66   ? 133 GLY A C     1 
ATOM   764   O O     . GLY A 1  136 ? 103.858 116.651 111.154 1.00 24.09  ? 133 GLY A O     1 
ATOM   765   N N     . GLU A 1  137 ? 104.048 118.113 112.836 1.00 10.74  ? 134 GLU A N     1 
ATOM   766   C CA    . GLU A 1  137 ? 102.894 117.573 113.526 1.00 6.41   ? 134 GLU A CA    1 
ATOM   767   C C     . GLU A 1  137 ? 101.627 118.246 113.039 1.00 12.14  ? 134 GLU A C     1 
ATOM   768   O O     . GLU A 1  137 ? 101.689 119.108 112.166 1.00 16.96  ? 134 GLU A O     1 
ATOM   769   C CB    . GLU A 1  137 ? 103.045 117.766 115.011 1.00 7.04   ? 134 GLU A CB    1 
ATOM   770   C CG    . GLU A 1  137 ? 104.212 117.042 115.604 1.00 10.11  ? 134 GLU A CG    1 
ATOM   771   C CD    . GLU A 1  137 ? 104.311 117.230 117.069 1.00 18.11  ? 134 GLU A CD    1 
ATOM   772   O OE1   . GLU A 1  137 ? 103.475 117.902 117.609 1.00 21.34  ? 134 GLU A OE1   1 
ATOM   773   O OE2   . GLU A 1  137 ? 105.220 116.722 117.680 1.00 16.47  ? 134 GLU A OE2   1 
ATOM   774   N N     . VAL B 2  25  ? 83.242  105.851 135.548 1.00 60.07  ? 22  VAL B N     1 
ATOM   775   C CA    . VAL B 2  25  ? 83.535  106.770 134.460 1.00 56.75  ? 22  VAL B CA    1 
ATOM   776   C C     . VAL B 2  25  ? 84.460  107.872 134.904 1.00 56.66  ? 22  VAL B C     1 
ATOM   777   O O     . VAL B 2  25  ? 84.216  108.528 135.916 1.00 53.30  ? 22  VAL B O     1 
ATOM   778   C CB    . VAL B 2  25  ? 82.234  107.382 133.917 0.00 59.76  ? 22  VAL B CB    1 
ATOM   779   C CG1   . VAL B 2  25  ? 82.536  108.406 132.807 0.00 51.02  ? 22  VAL B CG1   1 
ATOM   780   C CG2   . VAL B 2  25  ? 81.359  106.265 133.392 0.00 52.55  ? 22  VAL B CG2   1 
ATOM   781   N N     . LEU B 2  26  ? 85.525  108.072 134.156 1.00 53.03  ? 23  LEU B N     1 
ATOM   782   C CA    . LEU B 2  26  ? 86.444  109.141 134.479 1.00 53.07  ? 23  LEU B CA    1 
ATOM   783   C C     . LEU B 2  26  ? 86.207  110.360 133.619 1.00 53.28  ? 23  LEU B C     1 
ATOM   784   O O     . LEU B 2  26  ? 85.822  110.248 132.455 1.00 52.04  ? 23  LEU B O     1 
ATOM   785   C CB    . LEU B 2  26  ? 87.879  108.672 134.292 0.00 46.24  ? 23  LEU B CB    1 
ATOM   786   C CG    . LEU B 2  26  ? 88.354  107.515 135.167 1.00 44.23  ? 23  LEU B CG    1 
ATOM   787   C CD1   . LEU B 2  26  ? 89.737  107.130 134.713 1.00 35.74  ? 23  LEU B CD1   1 
ATOM   788   C CD2   . LEU B 2  26  ? 88.384  107.936 136.635 1.00 44.50  ? 23  LEU B CD2   1 
ATOM   789   N N     . ARG B 2  27  ? 86.466  111.530 134.189 1.00 51.27  ? 24  ARG B N     1 
ATOM   790   C CA    . ARG B 2  27  ? 86.404  112.767 133.435 1.00 52.77  ? 24  ARG B CA    1 
ATOM   791   C C     . ARG B 2  27  ? 87.306  113.814 134.049 1.00 49.88  ? 24  ARG B C     1 
ATOM   792   O O     . ARG B 2  27  ? 87.600  113.767 135.244 1.00 49.91  ? 24  ARG B O     1 
ATOM   793   C CB    . ARG B 2  27  ? 84.987  113.320 133.365 1.00 58.02  ? 24  ARG B CB    1 
ATOM   794   C CG    . ARG B 2  27  ? 83.928  112.445 132.665 1.00 59.31  ? 24  ARG B CG    1 
ATOM   795   C CD    . ARG B 2  27  ? 82.584  113.039 132.660 1.00 65.63  ? 24  ARG B CD    1 
ATOM   796   N NE    . ARG B 2  27  ? 82.527  114.238 131.839 1.00 70.16  ? 24  ARG B NE    1 
ATOM   797   C CZ    . ARG B 2  27  ? 82.327  115.483 132.302 1.00 85.04  ? 24  ARG B CZ    1 
ATOM   798   N NH1   . ARG B 2  27  ? 82.148  115.694 133.585 1.00 60.71  ? 24  ARG B NH1   1 
ATOM   799   N NH2   . ARG B 2  27  ? 82.315  116.498 131.457 1.00 63.67  ? 24  ARG B NH2   1 
ATOM   800   N N     . ASP B 2  28  ? 87.701  114.781 133.235 1.00 48.29  ? 25  ASP B N     1 
ATOM   801   C CA    . ASP B 2  28  ? 88.453  115.953 133.652 1.00 43.99  ? 25  ASP B CA    1 
ATOM   802   C C     . ASP B 2  28  ? 89.714  115.668 134.438 1.00 36.85  ? 25  ASP B C     1 
ATOM   803   O O     . ASP B 2  28  ? 90.049  116.407 135.366 1.00 34.72  ? 25  ASP B O     1 
ATOM   804   C CB    . ASP B 2  28  ? 87.555  116.864 134.459 1.00 46.22  ? 25  ASP B CB    1 
ATOM   805   C CG    . ASP B 2  28  ? 86.403  117.331 133.628 1.00 57.93  ? 25  ASP B CG    1 
ATOM   806   O OD1   . ASP B 2  28  ? 86.597  117.546 132.446 1.00 54.53  ? 25  ASP B OD1   1 
ATOM   807   O OD2   . ASP B 2  28  ? 85.321  117.451 134.153 1.00 57.93  ? 25  ASP B OD2   1 
ATOM   808   N N     . ASN B 2  29  ? 90.483  114.665 134.032 1.00 31.17  ? 26  ASN B N     1 
ATOM   809   C CA    . ASN B 2  29  ? 91.702  114.400 134.755 1.00 29.48  ? 26  ASN B CA    1 
ATOM   810   C C     . ASN B 2  29  ? 92.869  115.054 134.071 1.00 25.79  ? 26  ASN B C     1 
ATOM   811   O O     . ASN B 2  29  ? 94.003  114.980 134.527 1.00 23.67  ? 26  ASN B O     1 
ATOM   812   C CB    . ASN B 2  29  ? 91.896  112.927 134.906 1.00 31.19  ? 26  ASN B CB    1 
ATOM   813   C CG    . ASN B 2  29  ? 90.897  112.377 135.814 1.00 35.02  ? 26  ASN B CG    1 
ATOM   814   O OD1   . ASN B 2  29  ? 91.006  112.503 137.048 1.00 33.89  ? 26  ASN B OD1   1 
ATOM   815   N ND2   . ASN B 2  29  ? 89.902  111.780 135.263 1.00 35.61  ? 26  ASN B ND2   1 
ATOM   816   N N     . ILE B 2  30  ? 92.572  115.827 133.043 1.00 21.58  ? 27  ILE B N     1 
ATOM   817   C CA    . ILE B 2  30  ? 93.564  116.588 132.315 1.00 15.80  ? 27  ILE B CA    1 
ATOM   818   C C     . ILE B 2  30  ? 94.108  117.657 133.222 1.00 18.58  ? 27  ILE B C     1 
ATOM   819   O O     . ILE B 2  30  ? 95.245  118.089 133.099 1.00 21.68  ? 27  ILE B O     1 
ATOM   820   C CB    . ILE B 2  30  ? 92.989  117.164 131.025 1.00 7.84   ? 27  ILE B CB    1 
ATOM   821   C CG1   . ILE B 2  30  ? 94.103  117.634 130.075 1.00 17.86  ? 27  ILE B CG1   1 
ATOM   822   C CG2   . ILE B 2  30  ? 92.057  118.300 131.325 1.00 18.49  ? 27  ILE B CG2   1 
ATOM   823   C CD1   . ILE B 2  30  ? 95.013  116.567 129.504 1.00 18.09  ? 27  ILE B CD1   1 
ATOM   824   N N     . GLN B 2  31  ? 93.315  118.027 134.208 1.00 21.04  ? 28  GLN B N     1 
ATOM   825   C CA    . GLN B 2  31  ? 93.659  119.047 135.163 1.00 19.60  ? 28  GLN B CA    1 
ATOM   826   C C     . GLN B 2  31  ? 94.581  118.504 136.203 1.00 21.48  ? 28  GLN B C     1 
ATOM   827   O O     . GLN B 2  31  ? 95.043  119.221 137.083 1.00 26.73  ? 28  GLN B O     1 
ATOM   828   C CB    . GLN B 2  31  ? 92.436  119.544 135.860 1.00 24.52  ? 28  GLN B CB    1 
ATOM   829   C CG    . GLN B 2  31  ? 91.477  120.200 134.997 1.00 30.23  ? 28  GLN B CG    1 
ATOM   830   C CD    . GLN B 2  31  ? 92.025  121.401 134.413 1.00 35.47  ? 28  GLN B CD    1 
ATOM   831   O OE1   . GLN B 2  31  ? 92.675  122.179 135.100 1.00 37.23  ? 28  GLN B OE1   1 
ATOM   832   N NE2   . GLN B 2  31  ? 91.767  121.616 133.143 1.00 34.74  ? 28  GLN B NE2   1 
ATOM   833   N N     . GLY B 2  32  ? 94.868  117.220 136.111 1.00 20.97  ? 29  GLY B N     1 
ATOM   834   C CA    . GLY B 2  32  ? 95.783  116.570 136.990 1.00 22.05  ? 29  GLY B CA    1 
ATOM   835   C C     . GLY B 2  32  ? 97.188  117.022 136.649 1.00 21.87  ? 29  GLY B C     1 
ATOM   836   O O     . GLY B 2  32  ? 98.122  116.802 137.422 1.00 23.29  ? 29  GLY B O     1 
ATOM   837   N N     . ILE B 2  33  ? 97.356  117.644 135.485 1.00 19.40  ? 30  ILE B N     1 
ATOM   838   C CA    . ILE B 2  33  ? 98.638  118.154 135.128 1.00 13.95  ? 30  ILE B CA    1 
ATOM   839   C C     . ILE B 2  33  ? 98.541  119.595 135.555 1.00 17.44  ? 30  ILE B C     1 
ATOM   840   O O     . ILE B 2  33  ? 97.986  120.443 134.845 1.00 19.31  ? 30  ILE B O     1 
ATOM   841   C CB    . ILE B 2  33  ? 98.875  118.045 133.634 1.00 10.43  ? 30  ILE B CB    1 
ATOM   842   C CG1   . ILE B 2  33  ? 98.596  116.612 133.151 1.00 17.50  ? 30  ILE B CG1   1 
ATOM   843   C CG2   . ILE B 2  33  ? 100.268 118.485 133.313 1.00 15.18  ? 30  ILE B CG2   1 
ATOM   844   C CD1   . ILE B 2  33  ? 99.391  115.509 133.795 1.00 21.53  ? 30  ILE B CD1   1 
ATOM   845   N N     . THR B 2  34  ? 99.079  119.856 136.719 1.00 15.65  ? 31  THR B N     1 
ATOM   846   C CA    . THR B 2  34  ? 98.951  121.106 137.398 1.00 8.81   ? 31  THR B CA    1 
ATOM   847   C C     . THR B 2  34  ? 99.924  122.105 136.864 1.00 15.00  ? 31  THR B C     1 
ATOM   848   O O     . THR B 2  34  ? 100.889 121.738 136.197 1.00 10.83  ? 31  THR B O     1 
ATOM   849   C CB    . THR B 2  34  ? 99.177  120.860 138.875 1.00 14.04  ? 31  THR B CB    1 
ATOM   850   O OG1   . THR B 2  34  ? 100.498 120.329 139.055 1.00 18.86  ? 31  THR B OG1   1 
ATOM   851   C CG2   . THR B 2  34  ? 98.185  119.884 139.381 1.00 29.44  ? 31  THR B CG2   1 
ATOM   852   N N     . LYS B 2  35  ? 99.743  123.370 137.190 1.00 13.38  ? 32  LYS B N     1 
ATOM   853   C CA    . LYS B 2  35  ? 100.683 124.328 136.689 1.00 5.40   ? 32  LYS B CA    1 
ATOM   854   C C     . LYS B 2  35  ? 102.106 124.011 137.028 1.00 10.69  ? 32  LYS B C     1 
ATOM   855   O O     . LYS B 2  35  ? 102.945 124.158 136.149 1.00 6.42   ? 32  LYS B O     1 
ATOM   856   C CB    . LYS B 2  35  ? 100.386 125.707 137.149 1.00 4.99   ? 32  LYS B CB    1 
ATOM   857   C CG    . LYS B 2  35  ? 99.302  126.312 136.527 1.00 5.18   ? 32  LYS B CG    1 
ATOM   858   C CD    . LYS B 2  35  ? 98.916  127.571 137.261 1.00 1.00   ? 32  LYS B CD    1 
ATOM   859   C CE    . LYS B 2  35  ? 100.000 128.614 137.261 1.00 2.10   ? 32  LYS B CE    1 
ATOM   860   N NZ    . LYS B 2  35  ? 99.541  129.852 137.892 1.00 5.79   ? 32  LYS B NZ    1 
ATOM   861   N N     . PRO B 2  36  ? 102.484 123.660 138.261 1.00 8.43   ? 33  PRO B N     1 
ATOM   862   C CA    . PRO B 2  36  ? 103.823 123.315 138.558 1.00 9.27   ? 33  PRO B CA    1 
ATOM   863   C C     . PRO B 2  36  ? 104.307 122.107 137.783 1.00 15.24  ? 33  PRO B C     1 
ATOM   864   O O     . PRO B 2  36  ? 105.502 121.968 137.578 1.00 9.32   ? 33  PRO B O     1 
ATOM   865   C CB    . PRO B 2  36  ? 103.771 123.068 140.038 1.00 14.90  ? 33  PRO B CB    1 
ATOM   866   C CG    . PRO B 2  36  ? 102.613 123.826 140.496 1.00 13.74  ? 33  PRO B CG    1 
ATOM   867   C CD    . PRO B 2  36  ? 101.635 123.677 139.432 1.00 12.53  ? 33  PRO B CD    1 
ATOM   868   N N     . ALA B 2  37  ? 103.441 121.219 137.304 1.00 13.76  ? 34  ALA B N     1 
ATOM   869   C CA    . ALA B 2  37  ? 104.000 120.119 136.565 1.00 7.23   ? 34  ALA B CA    1 
ATOM   870   C C     . ALA B 2  37  ? 104.508 120.643 135.263 1.00 9.61   ? 34  ALA B C     1 
ATOM   871   O O     . ALA B 2  37  ? 105.546 120.214 134.763 1.00 15.70  ? 34  ALA B O     1 
ATOM   872   C CB    . ALA B 2  37  ? 102.981 119.048 136.330 1.00 12.27  ? 34  ALA B CB    1 
ATOM   873   N N     . ILE B 2  38  ? 103.779 121.599 134.725 1.00 8.51   ? 35  ILE B N     1 
ATOM   874   C CA    . ILE B 2  38  ? 104.118 122.197 133.464 1.00 6.88   ? 35  ILE B CA    1 
ATOM   875   C C     . ILE B 2  38  ? 105.330 123.049 133.618 1.00 9.92   ? 35  ILE B C     1 
ATOM   876   O O     . ILE B 2  38  ? 106.226 123.012 132.779 1.00 13.74  ? 35  ILE B O     1 
ATOM   877   C CB    . ILE B 2  38  ? 102.949 122.954 132.906 1.00 7.55   ? 35  ILE B CB    1 
ATOM   878   C CG1   . ILE B 2  38  ? 101.910 121.931 132.578 1.00 7.36   ? 35  ILE B CG1   1 
ATOM   879   C CG2   . ILE B 2  38  ? 103.384 123.764 131.703 1.00 4.45   ? 35  ILE B CG2   1 
ATOM   880   C CD1   . ILE B 2  38  ? 100.547 122.450 132.302 1.00 11.71  ? 35  ILE B CD1   1 
ATOM   881   N N     . ARG B 2  39  ? 105.380 123.835 134.667 1.00 10.29  ? 36  ARG B N     1 
ATOM   882   C CA    . ARG B 2  39  ? 106.534 124.663 134.862 1.00 7.26   ? 36  ARG B CA    1 
ATOM   883   C C     . ARG B 2  39  ? 107.781 123.869 135.045 1.00 13.84  ? 36  ARG B C     1 
ATOM   884   O O     . ARG B 2  39  ? 108.818 124.241 134.515 1.00 20.22  ? 36  ARG B O     1 
ATOM   885   C CB    . ARG B 2  39  ? 106.366 125.499 136.052 1.00 6.80   ? 36  ARG B CB    1 
ATOM   886   C CG    . ARG B 2  39  ? 105.401 126.511 135.867 1.00 8.79   ? 36  ARG B CG    1 
ATOM   887   C CD    . ARG B 2  39  ? 105.038 127.128 137.068 1.00 6.95   ? 36  ARG B CD    1 
ATOM   888   N NE    . ARG B 2  39  ? 106.068 127.792 137.655 1.00 5.53   ? 36  ARG B NE    1 
ATOM   889   C CZ    . ARG B 2  39  ? 106.400 129.018 137.392 1.00 15.70  ? 36  ARG B CZ    1 
ATOM   890   N NH1   . ARG B 2  39  ? 105.745 129.711 136.502 1.00 15.53  ? 36  ARG B NH1   1 
ATOM   891   N NH2   . ARG B 2  39  ? 107.399 129.540 138.046 1.00 30.47  ? 36  ARG B NH2   1 
ATOM   892   N N     . ARG B 2  40  ? 107.723 122.782 135.782 1.00 14.22  ? 37  ARG B N     1 
ATOM   893   C CA    . ARG B 2  40  ? 108.917 122.021 135.968 1.00 10.31  ? 37  ARG B CA    1 
ATOM   894   C C     . ARG B 2  40  ? 109.393 121.414 134.673 1.00 16.34  ? 37  ARG B C     1 
ATOM   895   O O     . ARG B 2  40  ? 110.596 121.392 134.413 1.00 22.25  ? 37  ARG B O     1 
ATOM   896   C CB    . ARG B 2  40  ? 108.699 120.979 136.983 1.00 14.39  ? 37  ARG B CB    1 
ATOM   897   C CG    . ARG B 2  40  ? 108.588 121.473 138.340 1.00 22.57  ? 37  ARG B CG    1 
ATOM   898   C CD    . ARG B 2  40  ? 108.669 120.395 139.296 1.00 21.17  ? 37  ARG B CD    1 
ATOM   899   N NE    . ARG B 2  40  ? 107.543 119.550 139.300 1.00 16.26  ? 37  ARG B NE    1 
ATOM   900   C CZ    . ARG B 2  40  ? 106.495 119.719 140.059 1.00 17.00  ? 37  ARG B CZ    1 
ATOM   901   N NH1   . ARG B 2  40  ? 106.440 120.717 140.891 1.00 24.44  ? 37  ARG B NH1   1 
ATOM   902   N NH2   . ARG B 2  40  ? 105.517 118.860 139.994 1.00 18.12  ? 37  ARG B NH2   1 
ATOM   903   N N     . LEU B 2  41  ? 108.489 120.944 133.828 1.00 14.44  ? 38  LEU B N     1 
ATOM   904   C CA    . LEU B 2  41  ? 108.946 120.407 132.569 1.00 10.01  ? 38  LEU B CA    1 
ATOM   905   C C     . LEU B 2  41  ? 109.581 121.496 131.746 1.00 16.27  ? 38  LEU B C     1 
ATOM   906   O O     . LEU B 2  41  ? 110.635 121.296 131.136 1.00 20.25  ? 38  LEU B O     1 
ATOM   907   C CB    . LEU B 2  41  ? 107.756 119.862 131.802 1.00 7.18   ? 38  LEU B CB    1 
ATOM   908   C CG    . LEU B 2  41  ? 107.130 118.613 132.336 1.00 7.98   ? 38  LEU B CG    1 
ATOM   909   C CD1   . LEU B 2  41  ? 105.818 118.427 131.708 1.00 5.49   ? 38  LEU B CD1   1 
ATOM   910   C CD2   . LEU B 2  41  ? 107.965 117.440 131.974 1.00 4.86   ? 38  LEU B CD2   1 
ATOM   911   N N     . ALA B 2  42  ? 108.977 122.673 131.745 1.00 16.85  ? 39  ALA B N     1 
ATOM   912   C CA    . ALA B 2  42  ? 109.512 123.761 130.972 1.00 12.43  ? 39  ALA B CA    1 
ATOM   913   C C     . ALA B 2  42  ? 110.872 124.176 131.470 1.00 18.99  ? 39  ALA B C     1 
ATOM   914   O O     . ALA B 2  42  ? 111.754 124.485 130.665 1.00 21.62  ? 39  ALA B O     1 
ATOM   915   C CB    . ALA B 2  42  ? 108.561 124.913 131.009 1.00 8.15   ? 39  ALA B CB    1 
ATOM   916   N N     . ARG B 2  43  ? 111.088 124.150 132.773 1.00 19.23  ? 40  ARG B N     1 
ATOM   917   C CA    . ARG B 2  43  ? 112.381 124.533 133.288 1.00 17.98  ? 40  ARG B CA    1 
ATOM   918   C C     . ARG B 2  43  ? 113.426 123.522 132.951 1.00 22.86  ? 40  ARG B C     1 
ATOM   919   O O     . ARG B 2  43  ? 114.532 123.880 132.577 1.00 27.22  ? 40  ARG B O     1 
ATOM   920   C CB    . ARG B 2  43  ? 112.325 124.727 134.760 1.00 21.78  ? 40  ARG B CB    1 
ATOM   921   C CG    . ARG B 2  43  ? 111.493 125.864 135.150 1.00 25.58  ? 40  ARG B CG    1 
ATOM   922   C CD    . ARG B 2  43  ? 112.172 127.085 135.019 1.00 34.08  ? 40  ARG B CD    1 
ATOM   923   N NE    . ARG B 2  43  ? 111.311 128.204 135.148 1.00 38.72  ? 40  ARG B NE    1 
ATOM   924   C CZ    . ARG B 2  43  ? 110.982 128.783 136.256 1.00 34.28  ? 40  ARG B CZ    1 
ATOM   925   N NH1   . ARG B 2  43  ? 111.412 128.319 137.362 1.00 31.62  ? 40  ARG B NH1   1 
ATOM   926   N NH2   . ARG B 2  43  ? 110.233 129.837 136.237 1.00 37.25  ? 40  ARG B NH2   1 
ATOM   927   N N     . ARG B 2  44  ? 113.101 122.252 132.989 1.00 23.04  ? 41  ARG B N     1 
ATOM   928   C CA    . ARG B 2  44  ? 114.088 121.270 132.608 1.00 20.58  ? 41  ARG B CA    1 
ATOM   929   C C     . ARG B 2  44  ? 114.552 121.541 131.182 1.00 24.00  ? 41  ARG B C     1 
ATOM   930   O O     . ARG B 2  44  ? 115.740 121.456 130.864 1.00 31.01  ? 41  ARG B O     1 
ATOM   931   C CB    . ARG B 2  44  ? 113.536 119.892 132.667 1.00 20.02  ? 41  ARG B CB    1 
ATOM   932   C CG    . ARG B 2  44  ? 114.538 118.873 132.439 1.00 22.49  ? 41  ARG B CG    1 
ATOM   933   C CD    . ARG B 2  44  ? 113.984 117.559 132.366 1.00 24.95  ? 41  ARG B CD    1 
ATOM   934   N NE    . ARG B 2  44  ? 113.492 117.041 133.565 1.00 23.59  ? 41  ARG B NE    1 
ATOM   935   C CZ    . ARG B 2  44  ? 114.210 116.400 134.459 1.00 23.36  ? 41  ARG B CZ    1 
ATOM   936   N NH1   . ARG B 2  44  ? 115.468 116.230 134.275 1.00 27.13  ? 41  ARG B NH1   1 
ATOM   937   N NH2   . ARG B 2  44  ? 113.646 115.928 135.518 1.00 23.55  ? 41  ARG B NH2   1 
ATOM   938   N N     . GLY B 2  45  ? 113.623 121.971 130.337 1.00 22.08  ? 42  GLY B N     1 
ATOM   939   C CA    . GLY B 2  45  ? 113.886 122.280 128.939 1.00 16.33  ? 42  GLY B CA    1 
ATOM   940   C C     . GLY B 2  45  ? 114.634 123.611 128.743 1.00 19.51  ? 42  GLY B C     1 
ATOM   941   O O     . GLY B 2  45  ? 114.947 123.995 127.622 1.00 24.51  ? 42  GLY B O     1 
ATOM   942   N N     . GLY B 2  46  ? 114.891 124.339 129.824 1.00 24.90  ? 43  GLY B N     1 
ATOM   943   C CA    . GLY B 2  46  ? 115.609 125.603 129.772 1.00 23.28  ? 43  GLY B CA    1 
ATOM   944   C C     . GLY B 2  46  ? 114.767 126.854 129.604 1.00 23.17  ? 43  GLY B C     1 
ATOM   945   O O     . GLY B 2  46  ? 115.301 127.899 129.252 1.00 32.25  ? 43  GLY B O     1 
ATOM   946   N N     . VAL B 2  47  ? 113.469 126.778 129.818 1.00 22.09  ? 44  VAL B N     1 
ATOM   947   C CA    . VAL B 2  47  ? 112.624 127.944 129.671 1.00 18.41  ? 44  VAL B CA    1 
ATOM   948   C C     . VAL B 2  47  ? 112.719 128.829 130.874 1.00 20.99  ? 44  VAL B C     1 
ATOM   949   O O     . VAL B 2  47  ? 112.531 128.371 131.984 1.00 30.12  ? 44  VAL B O     1 
ATOM   950   C CB    . VAL B 2  47  ? 111.196 127.484 129.501 1.00 16.05  ? 44  VAL B CB    1 
ATOM   951   C CG1   . VAL B 2  47  ? 110.272 128.604 129.468 1.00 14.20  ? 44  VAL B CG1   1 
ATOM   952   C CG2   . VAL B 2  47  ? 111.092 126.702 128.230 1.00 16.88  ? 44  VAL B CG2   1 
ATOM   953   N N     . LYS B 2  48  ? 112.969 130.107 130.689 1.00 25.98  ? 45  LYS B N     1 
ATOM   954   C CA    . LYS B 2  48  ? 113.073 130.990 131.835 1.00 23.45  ? 45  LYS B CA    1 
ATOM   955   C C     . LYS B 2  48  ? 111.770 131.645 132.257 1.00 22.05  ? 45  LYS B C     1 
ATOM   956   O O     . LYS B 2  48  ? 111.565 131.862 133.446 1.00 31.54  ? 45  LYS B O     1 
ATOM   957   C CB    . LYS B 2  48  ? 114.112 132.012 131.581 1.00 22.30  ? 45  LYS B CB    1 
ATOM   958   C CG    . LYS B 2  48  ? 114.357 132.900 132.685 1.00 32.86  ? 45  LYS B CG    1 
ATOM   959   C CD    . LYS B 2  48  ? 115.521 133.806 132.384 1.00 38.57  ? 45  LYS B CD    1 
ATOM   960   C CE    . LYS B 2  48  ? 115.760 134.839 133.483 1.00 51.01  ? 45  LYS B CE    1 
ATOM   961   N NZ    . LYS B 2  48  ? 116.846 135.783 133.116 1.00 54.24  ? 45  LYS B NZ    1 
ATOM   962   N N     . ARG B 2  49  ? 110.912 132.004 131.316 1.00 15.49  ? 46  ARG B N     1 
ATOM   963   C CA    . ARG B 2  49  ? 109.635 132.628 131.649 1.00 11.67  ? 46  ARG B CA    1 
ATOM   964   C C     . ARG B 2  49  ? 108.518 132.043 130.861 1.00 9.50   ? 46  ARG B C     1 
ATOM   965   O O     . ARG B 2  49  ? 108.672 131.742 129.678 1.00 11.15  ? 46  ARG B O     1 
ATOM   966   C CB    . ARG B 2  49  ? 109.642 134.075 131.405 1.00 13.43  ? 46  ARG B CB    1 
ATOM   967   C CG    . ARG B 2  49  ? 110.447 134.852 132.278 1.00 17.21  ? 46  ARG B CG    1 
ATOM   968   C CD    . ARG B 2  49  ? 110.543 136.203 131.805 1.00 10.25  ? 46  ARG B CD    1 
ATOM   969   N NE    . ARG B 2  49  ? 109.338 136.953 131.813 1.00 12.27  ? 46  ARG B NE    1 
ATOM   970   C CZ    . ARG B 2  49  ? 108.902 137.680 132.816 1.00 17.69  ? 46  ARG B CZ    1 
ATOM   971   N NH1   . ARG B 2  49  ? 109.557 137.719 133.945 1.00 22.45  ? 46  ARG B NH1   1 
ATOM   972   N NH2   . ARG B 2  49  ? 107.816 138.375 132.670 1.00 23.10  ? 46  ARG B NH2   1 
ATOM   973   N N     . ILE B 2  50  ? 107.391 131.861 131.511 1.00 10.30  ? 47  ILE B N     1 
ATOM   974   C CA    . ILE B 2  50  ? 106.277 131.204 130.867 1.00 6.66   ? 47  ILE B CA    1 
ATOM   975   C C     . ILE B 2  50  ? 105.015 132.035 130.768 1.00 7.68   ? 47  ILE B C     1 
ATOM   976   O O     . ILE B 2  50  ? 104.458 132.426 131.777 1.00 14.46  ? 47  ILE B O     1 
ATOM   977   C CB    . ILE B 2  50  ? 106.006 129.924 131.685 1.00 5.02   ? 47  ILE B CB    1 
ATOM   978   C CG1   . ILE B 2  50  ? 107.280 129.052 131.695 1.00 5.62   ? 47  ILE B CG1   1 
ATOM   979   C CG2   . ILE B 2  50  ? 104.853 129.150 131.125 1.00 0.60   ? 47  ILE B CG2   1 
ATOM   980   C CD1   . ILE B 2  50  ? 107.268 127.937 132.648 1.00 5.08   ? 47  ILE B CD1   1 
ATOM   981   N N     . SER B 2  51  ? 104.492 132.217 129.572 1.00 6.68   ? 48  SER B N     1 
ATOM   982   C CA    . SER B 2  51  ? 103.239 132.938 129.417 1.00 6.12   ? 48  SER B CA    1 
ATOM   983   C C     . SER B 2  51  ? 102.096 132.233 130.067 1.00 9.18   ? 48  SER B C     1 
ATOM   984   O O     . SER B 2  51  ? 102.062 131.011 130.156 1.00 9.20   ? 48  SER B O     1 
ATOM   985   C CB    . SER B 2  51  ? 102.863 133.168 128.001 1.00 6.18   ? 48  SER B CB    1 
ATOM   986   O OG    . SER B 2  51  ? 101.548 133.655 127.949 1.00 10.04  ? 48  SER B OG    1 
ATOM   987   N N     . GLY B 2  52  ? 101.129 132.992 130.516 1.00 13.10  ? 49  GLY B N     1 
ATOM   988   C CA    . GLY B 2  52  ? 99.973  132.466 131.220 1.00 7.30   ? 49  GLY B CA    1 
ATOM   989   C C     . GLY B 2  52  ? 99.099  131.562 130.381 1.00 5.79   ? 49  GLY B C     1 
ATOM   990   O O     . GLY B 2  52  ? 98.272  130.832 130.912 1.00 14.67  ? 49  GLY B O     1 
ATOM   991   N N     . LEU B 2  53  ? 99.249  131.599 129.074 1.00 7.41   ? 50  LEU B N     1 
ATOM   992   C CA    . LEU B 2  53  ? 98.438  130.733 128.236 1.00 4.99   ? 50  LEU B CA    1 
ATOM   993   C C     . LEU B 2  53  ? 99.114  129.425 127.876 1.00 6.61   ? 50  LEU B C     1 
ATOM   994   O O     . LEU B 2  53  ? 98.508  128.557 127.243 1.00 8.78   ? 50  LEU B O     1 
ATOM   995   C CB    . LEU B 2  53  ? 98.043  131.462 126.981 1.00 6.48   ? 50  LEU B CB    1 
ATOM   996   C CG    . LEU B 2  53  ? 97.189  132.712 127.156 1.00 3.62   ? 50  LEU B CG    1 
ATOM   997   C CD1   . LEU B 2  53  ? 96.991  133.328 125.812 1.00 2.54   ? 50  LEU B CD1   1 
ATOM   998   C CD2   . LEU B 2  53  ? 95.849  132.364 127.771 1.00 3.46   ? 50  LEU B CD2   1 
ATOM   999   N N     . ILE B 2  54  ? 100.347 129.252 128.300 1.00 8.05   ? 51  ILE B N     1 
ATOM   1000  C CA    . ILE B 2  54  ? 101.077 128.045 128.014 1.00 4.98   ? 51  ILE B CA    1 
ATOM   1001  C C     . ILE B 2  54  ? 100.427 126.884 128.648 1.00 10.53  ? 51  ILE B C     1 
ATOM   1002  O O     . ILE B 2  54  ? 100.424 125.795 128.084 1.00 5.02   ? 51  ILE B O     1 
ATOM   1003  C CB    . ILE B 2  54  ? 102.514 128.112 128.483 1.00 5.16   ? 51  ILE B CB    1 
ATOM   1004  C CG1   . ILE B 2  54  ? 103.270 129.119 127.696 1.00 6.18   ? 51  ILE B CG1   1 
ATOM   1005  C CG2   . ILE B 2  54  ? 103.191 126.756 128.474 1.00 3.01   ? 51  ILE B CG2   1 
ATOM   1006  C CD1   . ILE B 2  54  ? 103.436 128.882 126.222 1.00 4.90   ? 51  ILE B CD1   1 
ATOM   1007  N N     . TYR B 2  55  ? 99.919  127.059 129.839 1.00 10.61  ? 52  TYR B N     1 
ATOM   1008  C CA    . TYR B 2  55  ? 99.371  125.955 130.554 1.00 6.88   ? 52  TYR B CA    1 
ATOM   1009  C C     . TYR B 2  55  ? 98.280  125.271 129.776 1.00 8.27   ? 52  TYR B C     1 
ATOM   1010  O O     . TYR B 2  55  ? 98.243  124.044 129.716 1.00 4.91   ? 52  TYR B O     1 
ATOM   1011  C CB    . TYR B 2  55  ? 98.873  126.486 131.863 1.00 8.34   ? 52  TYR B CB    1 
ATOM   1012  C CG    . TYR B 2  55  ? 100.009 127.068 132.564 1.00 5.82   ? 52  TYR B CG    1 
ATOM   1013  C CD1   . TYR B 2  55  ? 100.102 128.390 132.701 1.00 7.55   ? 52  TYR B CD1   1 
ATOM   1014  C CD2   . TYR B 2  55  ? 100.984 126.298 133.007 1.00 8.24   ? 52  TYR B CD2   1 
ATOM   1015  C CE1   . TYR B 2  55  ? 101.186 128.935 133.283 1.00 6.12   ? 52  TYR B CE1   1 
ATOM   1016  C CE2   . TYR B 2  55  ? 102.063 126.832 133.584 1.00 5.91   ? 52  TYR B CE2   1 
ATOM   1017  C CZ    . TYR B 2  55  ? 102.163 128.147 133.717 1.00 5.02   ? 52  TYR B CZ    1 
ATOM   1018  O OH    . TYR B 2  55  ? 103.258 128.693 134.281 1.00 10.73  ? 52  TYR B OH    1 
ATOM   1019  N N     . GLU B 2  56  ? 97.414  126.014 129.136 1.00 4.75   ? 53  GLU B N     1 
ATOM   1020  C CA    . GLU B 2  56  ? 96.366  125.346 128.408 1.00 2.33   ? 53  GLU B CA    1 
ATOM   1021  C C     . GLU B 2  56  ? 96.849  124.732 127.138 1.00 6.92   ? 53  GLU B C     1 
ATOM   1022  O O     . GLU B 2  56  ? 96.422  123.637 126.761 1.00 13.32  ? 53  GLU B O     1 
ATOM   1023  C CB    . GLU B 2  56  ? 95.288  126.299 128.072 1.00 2.92   ? 53  GLU B CB    1 
ATOM   1024  C CG    . GLU B 2  56  ? 94.551  126.758 129.216 1.00 6.33   ? 53  GLU B CG    1 
ATOM   1025  C CD    . GLU B 2  56  ? 93.832  125.682 129.853 1.00 7.79   ? 53  GLU B CD    1 
ATOM   1026  O OE1   . GLU B 2  56  ? 93.266  124.887 129.159 1.00 8.06   ? 53  GLU B OE1   1 
ATOM   1027  O OE2   . GLU B 2  56  ? 93.828  125.624 131.052 1.00 20.61  ? 53  GLU B OE2   1 
ATOM   1028  N N     . GLU B 2  57  ? 97.777  125.391 126.481 1.00 7.75   ? 54  GLU B N     1 
ATOM   1029  C CA    . GLU B 2  57  ? 98.246  124.859 125.236 1.00 3.09   ? 54  GLU B CA    1 
ATOM   1030  C C     . GLU B 2  57  ? 98.993  123.572 125.499 1.00 7.72   ? 54  GLU B C     1 
ATOM   1031  O O     . GLU B 2  57  ? 98.881  122.612 124.737 1.00 11.76  ? 54  GLU B O     1 
ATOM   1032  C CB    . GLU B 2  57  ? 99.163  125.852 124.575 1.00 3.29   ? 54  GLU B CB    1 
ATOM   1033  C CG    . GLU B 2  57  ? 99.553  125.536 123.175 1.00 2.76   ? 54  GLU B CG    1 
ATOM   1034  C CD    . GLU B 2  57  ? 98.395  125.628 122.227 1.00 1.01   ? 54  GLU B CD    1 
ATOM   1035  O OE1   . GLU B 2  57  ? 97.415  126.208 122.607 1.00 2.66   ? 54  GLU B OE1   1 
ATOM   1036  O OE2   . GLU B 2  57  ? 98.493  125.161 121.106 1.00 1.53   ? 54  GLU B OE2   1 
ATOM   1037  N N     . THR B 2  58  ? 99.737  123.535 126.593 1.00 8.84   ? 55  THR B N     1 
ATOM   1038  C CA    . THR B 2  58  ? 100.520 122.382 126.944 1.00 4.46   ? 55  THR B CA    1 
ATOM   1039  C C     . THR B 2  58  ? 99.619  121.212 127.197 1.00 10.59  ? 55  THR B C     1 
ATOM   1040  O O     . THR B 2  58  ? 99.918  120.102 126.762 1.00 12.24  ? 55  THR B O     1 
ATOM   1041  C CB    . THR B 2  58  ? 101.367 122.640 128.171 1.00 6.46   ? 55  THR B CB    1 
ATOM   1042  O OG1   . THR B 2  58  ? 102.244 123.718 127.906 1.00 12.21  ? 55  THR B OG1   1 
ATOM   1043  C CG2   . THR B 2  58  ? 102.190 121.419 128.490 1.00 4.54   ? 55  THR B CG2   1 
ATOM   1044  N N     . ARG B 2  59  ? 98.524  121.420 127.908 1.00 11.07  ? 56  ARG B N     1 
ATOM   1045  C CA    . ARG B 2  59  ? 97.632  120.310 128.143 1.00 8.16   ? 56  ARG B CA    1 
ATOM   1046  C C     . ARG B 2  59  ? 97.052  119.768 126.862 1.00 10.38  ? 56  ARG B C     1 
ATOM   1047  O O     . ARG B 2  59  ? 96.953  118.552 126.700 1.00 15.92  ? 56  ARG B O     1 
ATOM   1048  C CB    . ARG B 2  59  ? 96.526  120.693 129.048 1.00 9.56   ? 56  ARG B CB    1 
ATOM   1049  C CG    . ARG B 2  59  ? 96.988  120.936 130.407 1.00 13.04  ? 56  ARG B CG    1 
ATOM   1050  C CD    . ARG B 2  59  ? 95.948  121.113 131.328 1.00 11.71  ? 56  ARG B CD    1 
ATOM   1051  N NE    . ARG B 2  59  ? 96.455  121.551 132.552 1.00 9.72   ? 56  ARG B NE    1 
ATOM   1052  C CZ    . ARG B 2  59  ? 96.384  122.755 133.009 1.00 9.47   ? 56  ARG B CZ    1 
ATOM   1053  N NH1   . ARG B 2  59  ? 95.782  123.686 132.375 1.00 16.12  ? 56  ARG B NH1   1 
ATOM   1054  N NH2   . ARG B 2  59  ? 96.937  122.986 134.132 1.00 18.23  ? 56  ARG B NH2   1 
ATOM   1055  N N     . GLY B 2  60  ? 96.695  120.636 125.928 1.00 10.93  ? 57  GLY B N     1 
ATOM   1056  C CA    . GLY B 2  60  ? 96.159  120.154 124.667 1.00 8.40   ? 57  GLY B CA    1 
ATOM   1057  C C     . GLY B 2  60  ? 97.182  119.294 123.934 1.00 7.82   ? 57  GLY B C     1 
ATOM   1058  O O     . GLY B 2  60  ? 96.832  118.264 123.353 1.00 6.07   ? 57  GLY B O     1 
ATOM   1059  N N     . VAL B 2  61  ? 98.448  119.692 123.983 1.00 8.47   ? 58  VAL B N     1 
ATOM   1060  C CA    . VAL B 2  61  ? 99.493  118.928 123.338 1.00 6.46   ? 58  VAL B CA    1 
ATOM   1061  C C     . VAL B 2  61  ? 99.708  117.583 123.976 1.00 8.81   ? 58  VAL B C     1 
ATOM   1062  O O     . VAL B 2  61  ? 99.863  116.579 123.277 1.00 12.17  ? 58  VAL B O     1 
ATOM   1063  C CB    . VAL B 2  61  ? 100.808 119.674 123.358 1.00 6.35   ? 58  VAL B CB    1 
ATOM   1064  C CG1   . VAL B 2  61  ? 101.888 118.791 122.887 1.00 5.99   ? 58  VAL B CG1   1 
ATOM   1065  C CG2   . VAL B 2  61  ? 100.723 120.852 122.467 1.00 6.99   ? 58  VAL B CG2   1 
ATOM   1066  N N     . LEU B 2  62  ? 99.747  117.536 125.294 1.00 10.25  ? 59  LEU B N     1 
ATOM   1067  C CA    . LEU B 2  62  ? 99.945  116.270 125.958 1.00 6.11   ? 59  LEU B CA    1 
ATOM   1068  C C     . LEU B 2  62  ? 98.851  115.318 125.650 1.00 7.25   ? 59  LEU B C     1 
ATOM   1069  O O     . LEU B 2  62  ? 99.100  114.140 125.410 1.00 11.01  ? 59  LEU B O     1 
ATOM   1070  C CB    . LEU B 2  62  ? 99.982  116.446 127.452 1.00 5.80   ? 59  LEU B CB    1 
ATOM   1071  C CG    . LEU B 2  62  ? 100.056 115.174 128.284 1.00 5.04   ? 59  LEU B CG    1 
ATOM   1072  C CD1   . LEU B 2  62  ? 101.280 114.374 127.971 1.00 0.78   ? 59  LEU B CD1   1 
ATOM   1073  C CD2   . LEU B 2  62  ? 100.040 115.566 129.713 1.00 4.34   ? 59  LEU B CD2   1 
ATOM   1074  N N     . LYS B 2  63  ? 97.631  115.789 125.681 1.00 8.29   ? 60  LYS B N     1 
ATOM   1075  C CA    . LYS B 2  63  ? 96.542  114.910 125.426 1.00 5.38   ? 60  LYS B CA    1 
ATOM   1076  C C     . LYS B 2  63  ? 96.607  114.300 124.064 1.00 7.54   ? 60  LYS B C     1 
ATOM   1077  O O     . LYS B 2  63  ? 96.355  113.111 123.929 1.00 5.56   ? 60  LYS B O     1 
ATOM   1078  C CB    . LYS B 2  63  ? 95.275  115.624 125.593 1.00 7.05   ? 60  LYS B CB    1 
ATOM   1079  C CG    . LYS B 2  63  ? 94.130  114.820 125.438 1.00 6.51   ? 60  LYS B CG    1 
ATOM   1080  C CD    . LYS B 2  63  ? 92.919  115.623 125.765 1.00 12.11  ? 60  LYS B CD    1 
ATOM   1081  C CE    . LYS B 2  63  ? 91.662  114.810 125.612 1.00 18.14  ? 60  LYS B CE    1 
ATOM   1082  N NZ    . LYS B 2  63  ? 90.447  115.583 125.961 1.00 17.08  ? 60  LYS B NZ    1 
ATOM   1083  N N     . VAL B 2  64  ? 96.966  115.062 123.048 1.00 9.02   ? 61  VAL B N     1 
ATOM   1084  C CA    . VAL B 2  64  ? 97.047  114.459 121.737 1.00 4.54   ? 61  VAL B CA    1 
ATOM   1085  C C     . VAL B 2  64  ? 98.119  113.399 121.683 1.00 9.13   ? 61  VAL B C     1 
ATOM   1086  O O     . VAL B 2  64  ? 97.902  112.340 121.093 1.00 9.70   ? 61  VAL B O     1 
ATOM   1087  C CB    . VAL B 2  64  ? 97.311  115.494 120.668 1.00 4.76   ? 61  VAL B CB    1 
ATOM   1088  C CG1   . VAL B 2  64  ? 97.593  114.819 119.346 1.00 2.16   ? 61  VAL B CG1   1 
ATOM   1089  C CG2   . VAL B 2  64  ? 96.117  116.355 120.556 1.00 2.11   ? 61  VAL B CG2   1 
ATOM   1090  N N     . PHE B 2  65  ? 99.279  113.662 122.261 1.00 9.01   ? 62  PHE B N     1 
ATOM   1091  C CA    . PHE B 2  65  ? 100.321 112.664 122.242 1.00 6.08   ? 62  PHE B CA    1 
ATOM   1092  C C     . PHE B 2  65  ? 99.814  111.387 122.885 1.00 9.26   ? 62  PHE B C     1 
ATOM   1093  O O     . PHE B 2  65  ? 99.937  110.304 122.308 1.00 9.42   ? 62  PHE B O     1 
ATOM   1094  C CB    . PHE B 2  65  ? 101.536 113.172 122.966 1.00 7.12   ? 62  PHE B CB    1 
ATOM   1095  C CG    . PHE B 2  65  ? 102.662 112.252 123.024 1.00 5.70   ? 62  PHE B CG    1 
ATOM   1096  C CD1   . PHE B 2  65  ? 103.485 112.120 121.978 1.00 6.04   ? 62  PHE B CD1   1 
ATOM   1097  C CD2   . PHE B 2  65  ? 102.919 111.546 124.129 1.00 3.51   ? 62  PHE B CD2   1 
ATOM   1098  C CE1   . PHE B 2  65  ? 104.546 111.301 122.032 1.00 5.50   ? 62  PHE B CE1   1 
ATOM   1099  C CE2   . PHE B 2  65  ? 103.984 110.721 124.191 1.00 3.92   ? 62  PHE B CE2   1 
ATOM   1100  C CZ    . PHE B 2  65  ? 104.798 110.604 123.138 1.00 5.14   ? 62  PHE B CZ    1 
ATOM   1101  N N     . LEU B 2  66  ? 99.201  111.483 124.064 1.00 9.70   ? 63  LEU B N     1 
ATOM   1102  C CA    . LEU B 2  66  ? 98.704  110.277 124.691 1.00 6.97   ? 63  LEU B CA    1 
ATOM   1103  C C     . LEU B 2  66  ? 97.648  109.588 123.901 1.00 9.23   ? 63  LEU B C     1 
ATOM   1104  O O     . LEU B 2  66  ? 97.651  108.367 123.817 1.00 8.16   ? 63  LEU B O     1 
ATOM   1105  C CB    . LEU B 2  66  ? 98.110  110.548 126.055 1.00 7.84   ? 63  LEU B CB    1 
ATOM   1106  C CG    . LEU B 2  66  ? 99.021  110.810 127.162 1.00 7.40   ? 63  LEU B CG    1 
ATOM   1107  C CD1   . LEU B 2  66  ? 98.258  111.343 128.308 1.00 3.91   ? 63  LEU B CD1   1 
ATOM   1108  C CD2   . LEU B 2  66  ? 99.626  109.510 127.595 1.00 2.24   ? 63  LEU B CD2   1 
ATOM   1109  N N     . GLU B 2  67  ? 96.741  110.294 123.277 1.00 7.95   ? 64  GLU B N     1 
ATOM   1110  C CA    . GLU B 2  67  ? 95.759  109.537 122.557 1.00 3.41   ? 64  GLU B CA    1 
ATOM   1111  C C     . GLU B 2  67  ? 96.364  108.730 121.460 1.00 7.82   ? 64  GLU B C     1 
ATOM   1112  O O     . GLU B 2  67  ? 95.974  107.586 121.254 1.00 4.83   ? 64  GLU B O     1 
ATOM   1113  C CB    . GLU B 2  67  ? 94.730  110.410 121.951 1.00 3.95   ? 64  GLU B CB    1 
ATOM   1114  C CG    . GLU B 2  67  ? 93.818  111.004 122.894 1.00 7.42   ? 64  GLU B CG    1 
ATOM   1115  C CD    . GLU B 2  67  ? 92.864  111.915 122.234 1.00 8.34   ? 64  GLU B CD    1 
ATOM   1116  O OE1   . GLU B 2  67  ? 93.014  112.134 121.060 1.00 5.94   ? 64  GLU B OE1   1 
ATOM   1117  O OE2   . GLU B 2  67  ? 91.977  112.403 122.887 1.00 13.80  ? 64  GLU B OE2   1 
ATOM   1118  N N     . ASN B 2  68  ? 97.340  109.258 120.758 1.00 9.31   ? 65  ASN B N     1 
ATOM   1119  C CA    . ASN B 2  68  ? 97.880  108.453 119.692 1.00 5.41   ? 65  ASN B CA    1 
ATOM   1120  C C     . ASN B 2  68  ? 98.678  107.261 120.206 1.00 8.33   ? 65  ASN B C     1 
ATOM   1121  O O     . ASN B 2  68  ? 98.614  106.173 119.633 1.00 9.62   ? 65  ASN B O     1 
ATOM   1122  C CB    . ASN B 2  68  ? 98.723  109.309 118.816 1.00 6.61   ? 65  ASN B CB    1 
ATOM   1123  C CG    . ASN B 2  68  ? 97.918  110.243 117.982 1.00 7.86   ? 65  ASN B CG    1 
ATOM   1124  O OD1   . ASN B 2  68  ? 96.741  110.037 117.585 1.00 14.96  ? 65  ASN B OD1   1 
ATOM   1125  N ND2   . ASN B 2  68  ? 98.546  111.336 117.686 1.00 6.43   ? 65  ASN B ND2   1 
ATOM   1126  N N     . VAL B 2  69  ? 99.400  107.415 121.304 1.00 9.89   ? 66  VAL B N     1 
ATOM   1127  C CA    . VAL B 2  69  ? 100.169 106.285 121.790 1.00 6.89   ? 66  VAL B CA    1 
ATOM   1128  C C     . VAL B 2  69  ? 99.259  105.227 122.365 1.00 7.42   ? 66  VAL B C     1 
ATOM   1129  O O     . VAL B 2  69  ? 99.489  104.036 122.149 1.00 12.70  ? 66  VAL B O     1 
ATOM   1130  C CB    . VAL B 2  69  ? 101.205 106.688 122.817 1.00 8.35   ? 66  VAL B CB    1 
ATOM   1131  C CG1   . VAL B 2  69  ? 101.880 105.464 123.377 1.00 3.71   ? 66  VAL B CG1   1 
ATOM   1132  C CG2   . VAL B 2  69  ? 102.201 107.565 122.169 1.00 6.06   ? 66  VAL B CG2   1 
ATOM   1133  N N     . ILE B 2  70  ? 98.261  105.639 123.134 1.00 9.60   ? 67  ILE B N     1 
ATOM   1134  C CA    . ILE B 2  70  ? 97.344  104.706 123.739 1.00 7.67   ? 67  ILE B CA    1 
ATOM   1135  C C     . ILE B 2  70  ? 96.555  104.002 122.691 1.00 10.31  ? 67  ILE B C     1 
ATOM   1136  O O     . ILE B 2  70  ? 96.437  102.788 122.734 1.00 9.62   ? 67  ILE B O     1 
ATOM   1137  C CB    . ILE B 2  70  ? 96.409  105.373 124.739 1.00 9.23   ? 67  ILE B CB    1 
ATOM   1138  C CG1   . ILE B 2  70  ? 97.221  105.825 125.929 1.00 5.53   ? 67  ILE B CG1   1 
ATOM   1139  C CG2   . ILE B 2  70  ? 95.308  104.423 125.147 1.00 11.62  ? 67  ILE B CG2   1 
ATOM   1140  C CD1   . ILE B 2  70  ? 96.507  106.762 126.860 1.00 1.86   ? 67  ILE B CD1   1 
ATOM   1141  N N     . ARG B 2  71  ? 96.048  104.694 121.702 1.00 9.28   ? 68  ARG B N     1 
ATOM   1142  C CA    . ARG B 2  71  ? 95.267  103.998 120.714 1.00 4.82   ? 68  ARG B CA    1 
ATOM   1143  C C     . ARG B 2  71  ? 96.035  102.868 120.062 1.00 6.75   ? 68  ARG B C     1 
ATOM   1144  O O     . ARG B 2  71  ? 95.458  101.804 119.806 1.00 9.96   ? 68  ARG B O     1 
ATOM   1145  C CB    . ARG B 2  71  ? 94.818  104.925 119.664 1.00 4.90   ? 68  ARG B CB    1 
ATOM   1146  C CG    . ARG B 2  71  ? 93.871  104.361 118.751 1.00 5.00   ? 68  ARG B CG    1 
ATOM   1147  C CD    . ARG B 2  71  ? 93.270  105.374 117.859 1.00 6.87   ? 68  ARG B CD    1 
ATOM   1148  N NE    . ARG B 2  71  ? 94.233  105.945 116.990 1.00 6.82   ? 68  ARG B NE    1 
ATOM   1149  C CZ    . ARG B 2  71  ? 94.725  107.181 117.045 1.00 12.05  ? 68  ARG B CZ    1 
ATOM   1150  N NH1   . ARG B 2  71  ? 94.345  108.066 117.908 1.00 11.23  ? 68  ARG B NH1   1 
ATOM   1151  N NH2   . ARG B 2  71  ? 95.655  107.536 116.218 1.00 9.66   ? 68  ARG B NH2   1 
ATOM   1152  N N     . ASP B 2  72  ? 97.316  103.056 119.760 1.00 8.26   ? 69  ASP B N     1 
ATOM   1153  C CA    . ASP B 2  72  ? 98.033  101.945 119.175 1.00 3.31   ? 69  ASP B CA    1 
ATOM   1154  C C     . ASP B 2  72  ? 98.272  100.862 120.215 1.00 8.56   ? 69  ASP B C     1 
ATOM   1155  O O     . ASP B 2  72  ? 98.099  99.678  119.936 1.00 7.85   ? 69  ASP B O     1 
ATOM   1156  C CB    . ASP B 2  72  ? 99.360  102.391 118.617 1.00 5.09   ? 69  ASP B CB    1 
ATOM   1157  C CG    . ASP B 2  72  ? 99.283  103.219 117.366 1.00 5.88   ? 69  ASP B CG    1 
ATOM   1158  O OD1   . ASP B 2  72  ? 98.268  103.271 116.725 1.00 8.65   ? 69  ASP B OD1   1 
ATOM   1159  O OD2   . ASP B 2  72  ? 100.297 103.781 117.018 1.00 10.92  ? 69  ASP B OD2   1 
ATOM   1160  N N     . ALA B 2  73  ? 98.583  101.224 121.452 1.00 9.89   ? 70  ALA B N     1 
ATOM   1161  C CA    . ALA B 2  73  ? 98.811  100.192 122.447 1.00 6.75   ? 70  ALA B CA    1 
ATOM   1162  C C     . ALA B 2  73  ? 97.567  99.350  122.643 1.00 7.47   ? 70  ALA B C     1 
ATOM   1163  O O     . ALA B 2  73  ? 97.659  98.129  122.799 1.00 11.96  ? 70  ALA B O     1 
ATOM   1164  C CB    . ALA B 2  73  ? 99.233  100.804 123.748 1.00 5.72   ? 70  ALA B CB    1 
ATOM   1165  N N     . VAL B 2  74  ? 96.399  99.966  122.584 1.00 8.91   ? 71  VAL B N     1 
ATOM   1166  C CA    . VAL B 2  74  ? 95.179  99.210  122.717 1.00 7.63   ? 71  VAL B CA    1 
ATOM   1167  C C     . VAL B 2  74  ? 95.014  98.327  121.507 1.00 11.32  ? 71  VAL B C     1 
ATOM   1168  O O     . VAL B 2  74  ? 94.692  97.159  121.642 1.00 6.47   ? 71  VAL B O     1 
ATOM   1169  C CB    . VAL B 2  74  ? 93.960  100.089 122.923 1.00 9.73   ? 71  VAL B CB    1 
ATOM   1170  C CG1   . VAL B 2  74  ? 92.699  99.257  122.875 1.00 9.14   ? 71  VAL B CG1   1 
ATOM   1171  C CG2   . VAL B 2  74  ? 94.071  100.742 124.254 1.00 8.60   ? 71  VAL B CG2   1 
ATOM   1172  N N     . THR B 2  75  ? 95.268  98.833  120.316 1.00 12.62  ? 72  THR B N     1 
ATOM   1173  C CA    . THR B 2  75  ? 95.118  98.017  119.122 1.00 6.22   ? 72  THR B CA    1 
ATOM   1174  C C     . THR B 2  75  ? 95.974  96.765  119.187 1.00 8.56   ? 72  THR B C     1 
ATOM   1175  O O     . THR B 2  75  ? 95.500  95.677  118.853 1.00 14.66  ? 72  THR B O     1 
ATOM   1176  C CB    . THR B 2  75  ? 95.460  98.822  117.879 1.00 5.82   ? 72  THR B CB    1 
ATOM   1177  O OG1   . THR B 2  75  ? 94.564  99.923  117.784 1.00 2.41   ? 72  THR B OG1   1 
ATOM   1178  C CG2   . THR B 2  75  ? 95.330  97.985  116.666 1.00 7.38   ? 72  THR B CG2   1 
ATOM   1179  N N     . TYR B 2  76  ? 97.216  96.873  119.632 1.00 10.39  ? 73  TYR B N     1 
ATOM   1180  C CA    . TYR B 2  76  ? 98.022  95.671  119.731 1.00 7.97   ? 73  TYR B CA    1 
ATOM   1181  C C     . TYR B 2  76  ? 97.429  94.715  120.765 1.00 11.85  ? 73  TYR B C     1 
ATOM   1182  O O     . TYR B 2  76  ? 97.374  93.499  120.537 1.00 16.45  ? 73  TYR B O     1 
ATOM   1183  C CB    . TYR B 2  76  ? 99.455  95.990  120.126 1.00 9.21   ? 73  TYR B CB    1 
ATOM   1184  C CG    . TYR B 2  76  ? 100.320 96.586  119.046 1.00 8.59   ? 73  TYR B CG    1 
ATOM   1185  C CD1   . TYR B 2  76  ? 100.763 97.860  119.135 1.00 9.66   ? 73  TYR B CD1   1 
ATOM   1186  C CD2   . TYR B 2  76  ? 100.669 95.849  117.980 1.00 12.27  ? 73  TYR B CD2   1 
ATOM   1187  C CE1   . TYR B 2  76  ? 101.548 98.389  118.148 1.00 10.18  ? 73  TYR B CE1   1 
ATOM   1188  C CE2   . TYR B 2  76  ? 101.455 96.382  116.984 1.00 10.49  ? 73  TYR B CE2   1 
ATOM   1189  C CZ    . TYR B 2  76  ? 101.886 97.635  117.066 1.00 7.70   ? 73  TYR B CZ    1 
ATOM   1190  O OH    . TYR B 2  76  ? 102.661 98.182  116.051 1.00 14.64  ? 73  TYR B OH    1 
ATOM   1191  N N     . THR B 2  77  ? 96.933  95.268  121.874 1.00 13.78  ? 74  THR B N     1 
ATOM   1192  C CA    . THR B 2  77  ? 96.349  94.501  122.967 1.00 7.59   ? 74  THR B CA    1 
ATOM   1193  C C     . THR B 2  77  ? 95.120  93.742  122.482 1.00 11.64  ? 74  THR B C     1 
ATOM   1194  O O     . THR B 2  77  ? 94.924  92.576  122.837 1.00 12.25  ? 74  THR B O     1 
ATOM   1195  C CB    . THR B 2  77  ? 95.940  95.426  124.126 1.00 8.63   ? 74  THR B CB    1 
ATOM   1196  O OG1   . THR B 2  77  ? 97.074  96.151  124.619 1.00 12.37  ? 74  THR B OG1   1 
ATOM   1197  C CG2   . THR B 2  77  ? 95.382  94.635  125.252 1.00 13.11  ? 74  THR B CG2   1 
ATOM   1198  N N     . GLU B 2  78  ? 94.257  94.384  121.700 1.00 12.19  ? 75  GLU B N     1 
ATOM   1199  C CA    . GLU B 2  78  ? 93.081  93.687  121.205 1.00 5.88   ? 75  GLU B CA    1 
ATOM   1200  C C     . GLU B 2  78  ? 93.430  92.603  120.239 1.00 10.42  ? 75  GLU B C     1 
ATOM   1201  O O     . GLU B 2  78  ? 92.857  91.524  120.284 1.00 16.42  ? 75  GLU B O     1 
ATOM   1202  C CB    . GLU B 2  78  ? 92.125  94.580  120.466 1.00 6.12   ? 75  GLU B CB    1 
ATOM   1203  C CG    . GLU B 2  78  ? 91.370  95.557  121.276 1.00 17.94  ? 75  GLU B CG    1 
ATOM   1204  C CD    . GLU B 2  78  ? 90.432  96.387  120.408 1.00 21.06  ? 75  GLU B CD    1 
ATOM   1205  O OE1   . GLU B 2  78  ? 90.479  96.230  119.214 1.00 17.08  ? 75  GLU B OE1   1 
ATOM   1206  O OE2   . GLU B 2  78  ? 89.687  97.168  120.934 1.00 18.88  ? 75  GLU B OE2   1 
ATOM   1207  N N     . HIS B 2  79  ? 94.402  92.841  119.388 1.00 12.79  ? 76  HIS B N     1 
ATOM   1208  C CA    . HIS B 2  79  ? 94.779  91.867  118.385 1.00 11.79  ? 76  HIS B CA    1 
ATOM   1209  C C     . HIS B 2  79  ? 95.127  90.551  119.005 1.00 12.28  ? 76  HIS B C     1 
ATOM   1210  O O     . HIS B 2  79  ? 94.644  89.491  118.580 1.00 18.42  ? 76  HIS B O     1 
ATOM   1211  C CB    . HIS B 2  79  ? 95.965  92.346  117.592 1.00 14.43  ? 76  HIS B CB    1 
ATOM   1212  C CG    . HIS B 2  79  ? 96.398  91.390  116.643 1.00 9.62   ? 76  HIS B CG    1 
ATOM   1213  N ND1   . HIS B 2  79  ? 95.730  91.141  115.495 1.00 10.66  ? 76  HIS B ND1   1 
ATOM   1214  C CD2   . HIS B 2  79  ? 97.438  90.574  116.662 1.00 13.50  ? 76  HIS B CD2   1 
ATOM   1215  C CE1   . HIS B 2  79  ? 96.356  90.197  114.840 1.00 12.08  ? 76  HIS B CE1   1 
ATOM   1216  N NE2   . HIS B 2  79  ? 97.398  89.840  115.532 1.00 11.35  ? 76  HIS B NE2   1 
ATOM   1217  N N     . ALA B 2  80  ? 95.883  90.642  120.090 1.00 11.35  ? 77  ALA B N     1 
ATOM   1218  C CA    . ALA B 2  80  ? 96.383  89.521  120.858 1.00 8.64   ? 77  ALA B CA    1 
ATOM   1219  C C     . ALA B 2  80  ? 95.336  88.909  121.773 1.00 10.86  ? 77  ALA B C     1 
ATOM   1220  O O     . ALA B 2  80  ? 95.622  87.943  122.478 1.00 15.67  ? 77  ALA B O     1 
ATOM   1221  C CB    . ALA B 2  80  ? 97.545  89.978  121.688 1.00 14.54  ? 77  ALA B CB    1 
ATOM   1222  N N     . LYS B 2  81  ? 94.147  89.489  121.790 1.00 14.01  ? 78  LYS B N     1 
ATOM   1223  C CA    . LYS B 2  81  ? 93.014  89.095  122.595 1.00 13.72  ? 78  LYS B CA    1 
ATOM   1224  C C     . LYS B 2  81  ? 93.236  89.122  124.072 1.00 17.54  ? 78  LYS B C     1 
ATOM   1225  O O     . LYS B 2  81  ? 92.805  88.226  124.788 1.00 25.01  ? 78  LYS B O     1 
ATOM   1226  C CB    . LYS B 2  81  ? 92.536  87.741  122.177 1.00 7.11   ? 78  LYS B CB    1 
ATOM   1227  C CG    . LYS B 2  81  ? 92.082  87.726  120.781 1.00 12.57  ? 78  LYS B CG    1 
ATOM   1228  C CD    . LYS B 2  81  ? 91.566  86.397  120.388 1.00 23.29  ? 78  LYS B CD    1 
ATOM   1229  C CE    . LYS B 2  81  ? 91.158  86.365  118.924 1.00 33.36  ? 78  LYS B CE    1 
ATOM   1230  N NZ    . LYS B 2  81  ? 90.717  84.988  118.484 1.00 29.01  ? 78  LYS B NZ    1 
ATOM   1231  N N     . ARG B 2  82  ? 93.890  90.160  124.533 1.00 15.37  ? 79  ARG B N     1 
ATOM   1232  C CA    . ARG B 2  82  ? 94.118  90.370  125.932 1.00 12.01  ? 79  ARG B CA    1 
ATOM   1233  C C     . ARG B 2  82  ? 93.325  91.551  126.380 1.00 18.58  ? 79  ARG B C     1 
ATOM   1234  O O     . ARG B 2  82  ? 92.839  92.316  125.555 1.00 24.53  ? 79  ARG B O     1 
ATOM   1235  C CB    . ARG B 2  82  ? 95.559  90.561  126.215 1.00 11.75  ? 79  ARG B CB    1 
ATOM   1236  C CG    . ARG B 2  82  ? 96.307  89.373  126.029 1.00 16.82  ? 79  ARG B CG    1 
ATOM   1237  C CD    . ARG B 2  82  ? 97.687  89.497  126.386 1.00 13.98  ? 79  ARG B CD    1 
ATOM   1238  N NE    . ARG B 2  82  ? 98.377  90.239  125.479 1.00 9.40   ? 79  ARG B NE    1 
ATOM   1239  C CZ    . ARG B 2  82  ? 98.769  91.451  125.646 1.00 7.42   ? 79  ARG B CZ    1 
ATOM   1240  N NH1   . ARG B 2  82  ? 98.543  92.092  126.711 1.00 13.26  ? 79  ARG B NH1   1 
ATOM   1241  N NH2   . ARG B 2  82  ? 99.388  92.067  124.713 1.00 9.90   ? 79  ARG B NH2   1 
ATOM   1242  N N     . LYS B 2  83  ? 93.161  91.678  127.683 1.00 19.79  ? 80  LYS B N     1 
ATOM   1243  C CA    . LYS B 2  83  ? 92.419  92.787  128.245 1.00 15.43  ? 80  LYS B CA    1 
ATOM   1244  C C     . LYS B 2  83  ? 93.342  93.689  129.052 1.00 15.28  ? 80  LYS B C     1 
ATOM   1245  O O     . LYS B 2  83  ? 92.887  94.647  129.679 1.00 20.48  ? 80  LYS B O     1 
ATOM   1246  C CB    . LYS B 2  83  ? 91.281  92.246  129.105 1.00 14.27  ? 80  LYS B CB    1 
ATOM   1247  C CG    . LYS B 2  83  ? 90.300  91.379  128.325 1.00 15.55  ? 80  LYS B CG    1 
ATOM   1248  C CD    . LYS B 2  83  ? 89.240  90.773  129.230 1.00 22.46  ? 80  LYS B CD    1 
ATOM   1249  C CE    . LYS B 2  83  ? 88.059  91.711  129.415 1.00 32.44  ? 80  LYS B CE    1 
ATOM   1250  N NZ    . LYS B 2  83  ? 87.274  91.860  128.157 1.00 38.84  ? 80  LYS B NZ    1 
ATOM   1251  N N     . THR B 2  84  ? 94.628  93.336  129.087 1.00 12.72  ? 81  THR B N     1 
ATOM   1252  C CA    . THR B 2  84  ? 95.555  94.059  129.901 1.00 9.52   ? 81  THR B CA    1 
ATOM   1253  C C     . THR B 2  84  ? 96.571  94.661  128.996 1.00 9.51   ? 81  THR B C     1 
ATOM   1254  O O     . THR B 2  84  ? 97.173  93.954  128.199 1.00 14.92  ? 81  THR B O     1 
ATOM   1255  C CB    . THR B 2  84  ? 96.269  93.129  130.871 1.00 9.70   ? 81  THR B CB    1 
ATOM   1256  O OG1   . THR B 2  84  ? 95.311  92.468  131.677 1.00 21.76  ? 81  THR B OG1   1 
ATOM   1257  C CG2   . THR B 2  84  ? 97.177  93.937  131.768 1.00 2.31   ? 81  THR B CG2   1 
ATOM   1258  N N     . VAL B 2  85  ? 96.804  95.943  129.114 1.00 8.67   ? 82  VAL B N     1 
ATOM   1259  C CA    . VAL B 2  85  ? 97.796  96.582  128.290 1.00 6.58   ? 82  VAL B CA    1 
ATOM   1260  C C     . VAL B 2  85  ? 99.136  96.381  128.953 1.00 5.56   ? 82  VAL B C     1 
ATOM   1261  O O     . VAL B 2  85  ? 99.294  96.701  130.132 1.00 7.07   ? 82  VAL B O     1 
ATOM   1262  C CB    . VAL B 2  85  ? 97.478  98.062  128.158 1.00 6.10   ? 82  VAL B CB    1 
ATOM   1263  C CG1   . VAL B 2  85  ? 98.533  98.750  127.356 1.00 2.22   ? 82  VAL B CG1   1 
ATOM   1264  C CG2   . VAL B 2  85  ? 96.126  98.226  127.524 1.00 5.64   ? 82  VAL B CG2   1 
ATOM   1265  N N     . THR B 2  86  ? 100.115 95.858  128.235 1.00 4.31   ? 83  THR B N     1 
ATOM   1266  C CA    . THR B 2  86  ? 101.414 95.661  128.858 1.00 2.89   ? 83  THR B CA    1 
ATOM   1267  C C     . THR B 2  86  ? 102.454 96.618  128.393 1.00 5.03   ? 83  THR B C     1 
ATOM   1268  O O     . THR B 2  86  ? 102.231 97.409  127.480 1.00 7.74   ? 83  THR B O     1 
ATOM   1269  C CB    . THR B 2  86  ? 101.947 94.241  128.718 1.00 2.42   ? 83  THR B CB    1 
ATOM   1270  O OG1   . THR B 2  86  ? 103.182 94.157  129.438 1.00 0.15   ? 83  THR B OG1   1 
ATOM   1271  C CG2   . THR B 2  86  ? 102.153 93.851  127.324 1.00 5.61   ? 83  THR B CG2   1 
ATOM   1272  N N     . ALA B 2  87  ? 103.616 96.549  129.008 1.00 4.99   ? 84  ALA B N     1 
ATOM   1273  C CA    . ALA B 2  87  ? 104.686 97.457  128.665 1.00 4.65   ? 84  ALA B CA    1 
ATOM   1274  C C     . ALA B 2  87  ? 105.071 97.308  127.245 1.00 9.13   ? 84  ALA B C     1 
ATOM   1275  O O     . ALA B 2  87  ? 105.391 98.295  126.598 1.00 13.07  ? 84  ALA B O     1 
ATOM   1276  C CB    . ALA B 2  87  ? 105.890 97.234  129.514 1.00 8.01   ? 84  ALA B CB    1 
ATOM   1277  N N     . MET B 2  88  ? 105.007 96.100  126.729 1.00 10.62  ? 85  MET B N     1 
ATOM   1278  C CA    . MET B 2  88  ? 105.385 95.888  125.363 1.00 6.36   ? 85  MET B CA    1 
ATOM   1279  C C     . MET B 2  88  ? 104.422 96.484  124.389 1.00 8.11   ? 85  MET B C     1 
ATOM   1280  O O     . MET B 2  88  ? 104.814 96.789  123.279 1.00 4.42   ? 85  MET B O     1 
ATOM   1281  C CB    . MET B 2  88  ? 105.587 94.433  125.034 1.00 4.98   ? 85  MET B CB    1 
ATOM   1282  C CG    . MET B 2  88  ? 106.774 93.830  125.674 1.00 8.97   ? 85  MET B CG    1 
ATOM   1283  S SD    . MET B 2  88  ? 108.282 94.759  125.360 1.00 21.70  ? 85  MET B SD    1 
ATOM   1284  C CE    . MET B 2  88  ? 108.475 94.725  123.594 1.00 13.77  ? 85  MET B CE    1 
ATOM   1285  N N     . ASP B 2  89  ? 103.185 96.705  124.754 1.00 6.21   ? 86  ASP B N     1 
ATOM   1286  C CA    . ASP B 2  89  ? 102.289 97.229  123.777 1.00 3.59   ? 86  ASP B CA    1 
ATOM   1287  C C     . ASP B 2  89  ? 102.553 98.699  123.699 1.00 11.44  ? 86  ASP B C     1 
ATOM   1288  O O     . ASP B 2  89  ? 102.448 99.309  122.638 1.00 11.76  ? 86  ASP B O     1 
ATOM   1289  C CB    . ASP B 2  89  ? 100.890 96.934  124.200 1.00 5.73   ? 86  ASP B CB    1 
ATOM   1290  C CG    . ASP B 2  89  ? 100.666 95.481  124.203 1.00 9.51   ? 86  ASP B CG    1 
ATOM   1291  O OD1   . ASP B 2  89  ? 101.115 94.821  123.290 1.00 12.38  ? 86  ASP B OD1   1 
ATOM   1292  O OD2   . ASP B 2  89  ? 100.122 94.977  125.173 1.00 8.84   ? 86  ASP B OD2   1 
ATOM   1293  N N     . VAL B 2  90  ? 102.947 99.271  124.821 1.00 11.87  ? 87  VAL B N     1 
ATOM   1294  C CA    . VAL B 2  90  ? 103.297 100.664 124.829 1.00 7.54   ? 87  VAL B CA    1 
ATOM   1295  C C     . VAL B 2  90  ? 104.590 100.843 124.073 1.00 12.95  ? 87  VAL B C     1 
ATOM   1296  O O     . VAL B 2  90  ? 104.714 101.787 123.303 1.00 13.44  ? 87  VAL B O     1 
ATOM   1297  C CB    . VAL B 2  90  ? 103.416 101.219 126.221 1.00 7.53   ? 87  VAL B CB    1 
ATOM   1298  C CG1   . VAL B 2  90  ? 103.934 102.616 126.158 1.00 2.08   ? 87  VAL B CG1   1 
ATOM   1299  C CG2   . VAL B 2  90  ? 102.082 101.195 126.850 1.00 4.00   ? 87  VAL B CG2   1 
ATOM   1300  N N     . VAL B 2  91  ? 105.562 99.967  124.288 1.00 13.25  ? 88  VAL B N     1 
ATOM   1301  C CA    . VAL B 2  91  ? 106.817 100.094 123.586 1.00 9.17   ? 88  VAL B CA    1 
ATOM   1302  C C     . VAL B 2  91  ? 106.638 99.952  122.093 1.00 13.45  ? 88  VAL B C     1 
ATOM   1303  O O     . VAL B 2  91  ? 107.275 100.697 121.353 1.00 15.18  ? 88  VAL B O     1 
ATOM   1304  C CB    . VAL B 2  91  ? 107.861 99.123  124.101 1.00 7.62   ? 88  VAL B CB    1 
ATOM   1305  C CG1   . VAL B 2  91  ? 109.061 99.124  123.222 1.00 8.25   ? 88  VAL B CG1   1 
ATOM   1306  C CG2   . VAL B 2  91  ? 108.281 99.547  125.483 1.00 11.42  ? 88  VAL B CG2   1 
ATOM   1307  N N     . TYR B 2  92  ? 105.821 99.023  121.610 1.00 11.98  ? 89  TYR B N     1 
ATOM   1308  C CA    . TYR B 2  92  ? 105.656 98.979  120.175 1.00 6.87   ? 89  TYR B CA    1 
ATOM   1309  C C     . TYR B 2  92  ? 104.903 100.196 119.693 1.00 13.63  ? 89  TYR B C     1 
ATOM   1310  O O     . TYR B 2  92  ? 105.219 100.742 118.637 1.00 13.26  ? 89  TYR B O     1 
ATOM   1311  C CB    . TYR B 2  92  ? 104.915 97.749  119.719 1.00 8.82   ? 89  TYR B CB    1 
ATOM   1312  C CG    . TYR B 2  92  ? 105.699 96.528  119.819 1.00 6.25   ? 89  TYR B CG    1 
ATOM   1313  C CD1   . TYR B 2  92  ? 105.340 95.590  120.676 1.00 6.26   ? 89  TYR B CD1   1 
ATOM   1314  C CD2   . TYR B 2  92  ? 106.795 96.356  119.058 1.00 17.27  ? 89  TYR B CD2   1 
ATOM   1315  C CE1   . TYR B 2  92  ? 106.062 94.481  120.810 1.00 9.81   ? 89  TYR B CE1   1 
ATOM   1316  C CE2   . TYR B 2  92  ? 107.530 95.222  119.185 1.00 10.94  ? 89  TYR B CE2   1 
ATOM   1317  C CZ    . TYR B 2  92  ? 107.156 94.292  120.069 1.00 12.87  ? 89  TYR B CZ    1 
ATOM   1318  O OH    . TYR B 2  92  ? 107.883 93.147  120.222 1.00 27.17  ? 89  TYR B OH    1 
ATOM   1319  N N     . ALA B 2  93  ? 103.929 100.681 120.453 1.00 13.81  ? 90  ALA B N     1 
ATOM   1320  C CA    . ALA B 2  93  ? 103.204 101.846 120.006 1.00 7.57   ? 90  ALA B CA    1 
ATOM   1321  C C     . ALA B 2  93  ? 104.127 103.023 119.829 1.00 9.81   ? 90  ALA B C     1 
ATOM   1322  O O     . ALA B 2  93  ? 103.967 103.798 118.895 1.00 14.13  ? 90  ALA B O     1 
ATOM   1323  C CB    . ALA B 2  93  ? 102.145 102.201 121.001 1.00 12.23  ? 90  ALA B CB    1 
ATOM   1324  N N     . LEU B 2  94  ? 105.102 103.165 120.709 1.00 13.15  ? 91  LEU B N     1 
ATOM   1325  C CA    . LEU B 2  94  ? 106.049 104.253 120.599 1.00 11.25  ? 91  LEU B CA    1 
ATOM   1326  C C     . LEU B 2  94  ? 107.089 104.025 119.516 1.00 13.54  ? 91  LEU B C     1 
ATOM   1327  O O     . LEU B 2  94  ? 107.385 104.928 118.729 1.00 15.02  ? 91  LEU B O     1 
ATOM   1328  C CB    . LEU B 2  94  ? 106.763 104.425 121.929 1.00 13.05  ? 91  LEU B CB    1 
ATOM   1329  C CG    . LEU B 2  94  ? 105.936 104.902 123.101 1.00 11.12  ? 91  LEU B CG    1 
ATOM   1330  C CD1   . LEU B 2  94  ? 106.739 104.750 124.340 1.00 9.32   ? 91  LEU B CD1   1 
ATOM   1331  C CD2   . LEU B 2  94  ? 105.566 106.334 122.930 1.00 7.64   ? 91  LEU B CD2   1 
ATOM   1332  N N     . LYS B 2  95  ? 107.567 102.795 119.367 1.00 15.60  ? 92  LYS B N     1 
ATOM   1333  C CA    . LYS B 2  95  ? 108.573 102.489 118.356 1.00 14.39  ? 92  LYS B CA    1 
ATOM   1334  C C     . LYS B 2  95  ? 108.070 102.843 116.997 1.00 11.38  ? 92  LYS B C     1 
ATOM   1335  O O     . LYS B 2  95  ? 108.779 103.378 116.148 1.00 19.22  ? 92  LYS B O     1 
ATOM   1336  C CB    . LYS B 2  95  ? 108.898 101.008 118.360 1.00 15.42  ? 92  LYS B CB    1 
ATOM   1337  C CG    . LYS B 2  95  ? 109.966 100.581 117.409 1.00 11.93  ? 92  LYS B CG    1 
ATOM   1338  C CD    . LYS B 2  95  ? 110.221 99.044  117.413 1.00 5.78   ? 92  LYS B CD    1 
ATOM   1339  C CE    . LYS B 2  95  ? 110.923 98.554  118.696 1.00 11.76  ? 92  LYS B CE    1 
ATOM   1340  N NZ    . LYS B 2  95  ? 111.407 97.122  118.589 1.00 3.68   ? 92  LYS B NZ    1 
ATOM   1341  N N     . ARG B 2  96  ? 106.827 102.571 116.801 1.00 11.59  ? 93  ARG B N     1 
ATOM   1342  C CA    . ARG B 2  96  ? 106.149 102.801 115.580 1.00 8.79   ? 93  ARG B CA    1 
ATOM   1343  C C     . ARG B 2  96  ? 106.079 104.240 115.146 1.00 14.10  ? 93  ARG B C     1 
ATOM   1344  O O     . ARG B 2  96  ? 105.878 104.527 113.971 1.00 21.93  ? 93  ARG B O     1 
ATOM   1345  C CB    . ARG B 2  96  ? 104.804 102.252 115.706 1.00 11.01  ? 93  ARG B CB    1 
ATOM   1346  C CG    . ARG B 2  96  ? 104.097 102.303 114.567 1.00 7.69   ? 93  ARG B CG    1 
ATOM   1347  C CD    . ARG B 2  96  ? 102.989 101.553 114.671 1.00 3.13   ? 93  ARG B CD    1 
ATOM   1348  N NE    . ARG B 2  96  ? 102.353 101.600 113.504 1.00 3.38   ? 93  ARG B NE    1 
ATOM   1349  C CZ    . ARG B 2  96  ? 101.504 102.509 113.184 1.00 5.52   ? 93  ARG B CZ    1 
ATOM   1350  N NH1   . ARG B 2  96  ? 101.177 103.455 114.010 1.00 2.80   ? 93  ARG B NH1   1 
ATOM   1351  N NH2   . ARG B 2  96  ? 100.962 102.461 112.032 1.00 5.48   ? 93  ARG B NH2   1 
ATOM   1352  N N     . GLN B 2  97  ? 106.149 105.153 116.082 1.00 15.33  ? 94  GLN B N     1 
ATOM   1353  C CA    . GLN B 2  97  ? 106.043 106.556 115.794 1.00 10.10  ? 94  GLN B CA    1 
ATOM   1354  C C     . GLN B 2  97  ? 107.408 107.169 115.694 1.00 13.96  ? 94  GLN B C     1 
ATOM   1355  O O     . GLN B 2  97  ? 107.545 108.386 115.619 1.00 23.52  ? 94  GLN B O     1 
ATOM   1356  C CB    . GLN B 2  97  ? 105.241 107.254 116.844 1.00 10.00  ? 94  GLN B CB    1 
ATOM   1357  C CG    . GLN B 2  97  ? 103.865 106.793 116.882 1.00 9.80   ? 94  GLN B CG    1 
ATOM   1358  C CD    . GLN B 2  97  ? 103.086 107.501 117.860 1.00 10.41  ? 94  GLN B CD    1 
ATOM   1359  O OE1   . GLN B 2  97  ? 103.504 108.541 118.369 1.00 12.77  ? 94  GLN B OE1   1 
ATOM   1360  N NE2   . GLN B 2  97  ? 101.920 106.986 118.152 1.00 6.64   ? 94  GLN B NE2   1 
ATOM   1361  N N     . GLY B 2  98  ? 108.436 106.340 115.730 1.00 16.21  ? 95  GLY B N     1 
ATOM   1362  C CA    . GLY B 2  98  ? 109.772 106.843 115.645 1.00 12.47  ? 95  GLY B CA    1 
ATOM   1363  C C     . GLY B 2  98  ? 110.345 107.192 116.984 1.00 15.24  ? 95  GLY B C     1 
ATOM   1364  O O     . GLY B 2  98  ? 111.303 107.950 117.056 1.00 25.66  ? 95  GLY B O     1 
ATOM   1365  N N     . ARG B 2  99  ? 109.775 106.687 118.066 1.00 13.78  ? 96  ARG B N     1 
ATOM   1366  C CA    . ARG B 2  99  ? 110.313 107.005 119.355 1.00 11.55  ? 96  ARG B CA    1 
ATOM   1367  C C     . ARG B 2  99  ? 110.691 105.780 120.105 1.00 15.97  ? 96  ARG B C     1 
ATOM   1368  O O     . ARG B 2  99  ? 109.950 105.309 120.955 1.00 19.95  ? 96  ARG B O     1 
ATOM   1369  C CB    . ARG B 2  99  ? 109.300 107.727 120.142 1.00 12.46  ? 96  ARG B CB    1 
ATOM   1370  C CG    . ARG B 2  99  ? 108.965 108.946 119.567 1.00 18.45  ? 96  ARG B CG    1 
ATOM   1371  C CD    . ARG B 2  99  ? 108.001 109.660 120.310 1.00 13.05  ? 96  ARG B CD    1 
ATOM   1372  N NE    . ARG B 2  99  ? 107.680 110.815 119.611 1.00 7.95   ? 96  ARG B NE    1 
ATOM   1373  C CZ    . ARG B 2  99  ? 108.366 111.937 119.665 1.00 16.94  ? 96  ARG B CZ    1 
ATOM   1374  N NH1   . ARG B 2  99  ? 109.415 112.057 120.446 1.00 23.78  ? 96  ARG B NH1   1 
ATOM   1375  N NH2   . ARG B 2  99  ? 107.994 112.929 118.917 1.00 13.74  ? 96  ARG B NH2   1 
ATOM   1376  N N     . THR B 2  100 ? 111.856 105.273 119.838 1.00 15.24  ? 97  THR B N     1 
ATOM   1377  C CA    . THR B 2  100 ? 112.248 104.060 120.475 1.00 9.27   ? 97  THR B CA    1 
ATOM   1378  C C     . THR B 2  100 ? 112.530 104.356 121.922 1.00 13.25  ? 97  THR B C     1 
ATOM   1379  O O     . THR B 2  100 ? 113.239 105.309 122.229 1.00 19.47  ? 97  THR B O     1 
ATOM   1380  C CB    . THR B 2  100 ? 113.495 103.506 119.802 1.00 10.71  ? 97  THR B CB    1 
ATOM   1381  O OG1   . THR B 2  100 ? 113.239 103.279 118.421 1.00 19.33  ? 97  THR B OG1   1 
ATOM   1382  C CG2   . THR B 2  100 ? 113.873 102.223 120.424 1.00 15.32  ? 97  THR B CG2   1 
ATOM   1383  N N     . LEU B 2  101 ? 111.968 103.559 122.808 1.00 15.71  ? 98  LEU B N     1 
ATOM   1384  C CA    . LEU B 2  101 ? 112.166 103.717 124.236 1.00 13.85  ? 98  LEU B CA    1 
ATOM   1385  C C     . LEU B 2  101 ? 112.991 102.578 124.792 1.00 17.01  ? 98  LEU B C     1 
ATOM   1386  O O     . LEU B 2  101 ? 112.672 101.418 124.561 1.00 21.80  ? 98  LEU B O     1 
ATOM   1387  C CB    . LEU B 2  101 ? 110.791 103.799 124.903 1.00 15.51  ? 98  LEU B CB    1 
ATOM   1388  C CG    . LEU B 2  101 ? 110.713 103.846 126.429 1.00 14.56  ? 98  LEU B CG    1 
ATOM   1389  C CD1   . LEU B 2  101 ? 111.336 105.090 126.966 1.00 18.10  ? 98  LEU B CD1   1 
ATOM   1390  C CD2   . LEU B 2  101 ? 109.253 103.805 126.831 1.00 12.25  ? 98  LEU B CD2   1 
ATOM   1391  N N     . TYR B 2  102 ? 114.061 102.895 125.501 1.00 16.41  ? 99  TYR B N     1 
ATOM   1392  C CA    . TYR B 2  102 ? 114.917 101.877 126.088 1.00 13.34  ? 99  TYR B CA    1 
ATOM   1393  C C     . TYR B 2  102 ? 114.678 101.693 127.574 1.00 14.54  ? 99  TYR B C     1 
ATOM   1394  O O     . TYR B 2  102 ? 114.493 102.652 128.325 1.00 20.80  ? 99  TYR B O     1 
ATOM   1395  C CB    . TYR B 2  102 ? 116.395 102.188 125.895 1.00 14.88  ? 99  TYR B CB    1 
ATOM   1396  C CG    . TYR B 2  102 ? 116.988 102.040 124.512 1.00 13.26  ? 99  TYR B CG    1 
ATOM   1397  C CD1   . TYR B 2  102 ? 116.275 101.624 123.431 1.00 15.76  ? 99  TYR B CD1   1 
ATOM   1398  C CD2   . TYR B 2  102 ? 118.308 102.292 124.360 1.00 14.29  ? 99  TYR B CD2   1 
ATOM   1399  C CE1   . TYR B 2  102 ? 116.896 101.476 122.227 1.00 11.54  ? 99  TYR B CE1   1 
ATOM   1400  C CE2   . TYR B 2  102 ? 118.908 102.138 123.160 1.00 14.48  ? 99  TYR B CE2   1 
ATOM   1401  C CZ    . TYR B 2  102 ? 118.202 101.736 122.102 1.00 10.44  ? 99  TYR B CZ    1 
ATOM   1402  O OH    . TYR B 2  102 ? 118.823 101.571 120.897 1.00 16.17  ? 99  TYR B OH    1 
ATOM   1403  N N     . GLY B 2  103 ? 114.820 100.451 128.030 1.00 16.38  ? 100 GLY B N     1 
ATOM   1404  C CA    . GLY B 2  103 ? 114.715 100.123 129.453 1.00 11.77  ? 100 GLY B CA    1 
ATOM   1405  C C     . GLY B 2  103 ? 113.446 99.380  129.897 1.00 10.37  ? 100 GLY B C     1 
ATOM   1406  O O     . GLY B 2  103 ? 113.426 98.820  130.989 1.00 21.24  ? 100 GLY B O     1 
ATOM   1407  N N     . PHE B 2  104 ? 112.407 99.333  129.072 1.00 8.40   ? 101 PHE B N     1 
ATOM   1408  C CA    . PHE B 2  104 ? 111.172 98.613  129.418 1.00 5.02   ? 101 PHE B CA    1 
ATOM   1409  C C     . PHE B 2  104 ? 110.976 97.387  128.563 1.00 8.42   ? 101 PHE B C     1 
ATOM   1410  O O     . PHE B 2  104 ? 109.881 96.843  128.492 1.00 10.16  ? 101 PHE B O     1 
ATOM   1411  C CB    . PHE B 2  104 ? 109.939 99.474  129.233 1.00 6.21   ? 101 PHE B CB    1 
ATOM   1412  C CG    . PHE B 2  104 ? 109.860 100.607 130.105 1.00 8.05   ? 101 PHE B CG    1 
ATOM   1413  C CD1   . PHE B 2  104 ? 110.284 101.794 129.699 1.00 12.52  ? 101 PHE B CD1   1 
ATOM   1414  C CD2   . PHE B 2  104 ? 109.329 100.490 131.336 1.00 8.71   ? 101 PHE B CD2   1 
ATOM   1415  C CE1   . PHE B 2  104 ? 110.199 102.859 130.499 1.00 12.70  ? 101 PHE B CE1   1 
ATOM   1416  C CE2   . PHE B 2  104 ? 109.241 101.553 132.144 1.00 11.06  ? 101 PHE B CE2   1 
ATOM   1417  C CZ    . PHE B 2  104 ? 109.681 102.739 131.726 1.00 12.85  ? 101 PHE B CZ    1 
ATOM   1418  N N     . GLY B 2  105 ? 112.022 96.973  127.888 1.00 13.91  ? 102 GLY B N     1 
ATOM   1419  C CA    . GLY B 2  105 ? 111.953 95.890  126.917 1.00 15.98  ? 102 GLY B CA    1 
ATOM   1420  C C     . GLY B 2  105 ? 112.106 96.571  125.557 1.00 23.16  ? 102 GLY B C     1 
ATOM   1421  O O     . GLY B 2  105 ? 112.125 97.803  125.502 1.00 22.98  ? 102 GLY B O     1 
ATOM   1422  N N     . GLY B 2  106 ? 112.259 95.808  124.469 1.00 16.18  ? 103 GLY B N     1 
ATOM   1423  C CA    . GLY B 2  106 ? 112.455 96.454  123.165 1.00 18.28  ? 103 GLY B CA    1 
ATOM   1424  C C     . GLY B 2  106 ? 112.528 95.461  122.009 1.00 15.67  ? 103 GLY B C     1 
ATOM   1425  O O     . GLY B 2  106 ? 112.282 95.830  120.854 1.00 7.14   ? 103 GLY B O     1 
ATOM   1426  O OXT   . GLY B 2  106 ? 113.199 94.446  122.181 1.00 22.73  ? 103 GLY B OXT   1 
ATOM   1427  N N     . GLY C 3  12  ? 77.369  90.515  101.531 1.00 52.73  ? 9   GLY C N     1 
ATOM   1428  C CA    . GLY C 3  12  ? 78.266  91.168  100.595 1.00 52.20  ? 9   GLY C CA    1 
ATOM   1429  C C     . GLY C 3  12  ? 77.542  91.527  99.315  1.00 56.22  ? 9   GLY C C     1 
ATOM   1430  O O     . GLY C 3  12  ? 76.363  91.891  99.325  1.00 54.12  ? 9   GLY C O     1 
ATOM   1431  N N     . LYS C 3  13  ? 78.266  91.438  98.212  1.00 56.53  ? 10  LYS C N     1 
ATOM   1432  C CA    . LYS C 3  13  ? 77.737  91.763  96.903  1.00 65.21  ? 10  LYS C CA    1 
ATOM   1433  C C     . LYS C 3  13  ? 76.920  90.537  96.489  1.00 64.42  ? 10  LYS C C     1 
ATOM   1434  O O     . LYS C 3  13  ? 77.177  89.438  96.973  1.00 60.71  ? 10  LYS C O     1 
ATOM   1435  C CB    . LYS C 3  13  ? 78.873  92.079  95.943  0.00 58.07  ? 10  LYS C CB    1 
ATOM   1436  C CG    . LYS C 3  13  ? 79.707  93.303  96.350  0.00 56.94  ? 10  LYS C CG    1 
ATOM   1437  C CD    . LYS C 3  13  ? 80.817  93.588  95.342  0.00 62.69  ? 10  LYS C CD    1 
ATOM   1438  C CE    . LYS C 3  13  ? 81.756  94.728  95.802  0.00 67.81  ? 10  LYS C CE    1 
ATOM   1439  N NZ    . LYS C 3  13  ? 82.825  95.070  94.751  0.00 79.86  ? 10  LYS C NZ    1 
ATOM   1440  N N     . ALA C 3  14  ? 75.935  90.702  95.612  1.00 68.10  ? 11  ALA C N     1 
ATOM   1441  C CA    . ALA C 3  14  ? 75.036  89.582  95.298  1.00 73.65  ? 11  ALA C CA    1 
ATOM   1442  C C     . ALA C 3  14  ? 75.652  88.289  94.749  1.00 66.73  ? 11  ALA C C     1 
ATOM   1443  O O     . ALA C 3  14  ? 75.171  87.207  95.091  1.00 65.60  ? 11  ALA C O     1 
ATOM   1444  C CB    . ALA C 3  14  ? 74.010  90.045  94.274  1.00 67.21  ? 11  ALA C CB    1 
ATOM   1445  N N     . ARG C 3  15  ? 76.660  88.354  93.885  1.00 66.09  ? 12  ARG C N     1 
ATOM   1446  C CA    . ARG C 3  15  ? 77.161  87.086  93.342  1.00 63.50  ? 12  ARG C CA    1 
ATOM   1447  C C     . ARG C 3  15  ? 78.498  87.146  92.631  1.00 60.26  ? 12  ARG C C     1 
ATOM   1448  O O     . ARG C 3  15  ? 78.956  88.221  92.220  1.00 60.52  ? 12  ARG C O     1 
ATOM   1449  C CB    . ARG C 3  15  ? 76.160  86.497  92.350  1.00 67.40  ? 12  ARG C CB    1 
ATOM   1450  C CG    . ARG C 3  15  ? 74.800  86.017  92.932  1.00 65.06  ? 12  ARG C CG    1 
ATOM   1451  C CD    . ARG C 3  15  ? 73.896  85.411  91.911  1.00 65.68  ? 12  ARG C CD    1 
ATOM   1452  N NE    . ARG C 3  15  ? 72.597  85.036  92.491  0.00 67.05  ? 12  ARG C NE    1 
ATOM   1453  C CZ    . ARG C 3  15  ? 71.516  84.569  91.808  0.00 78.10  ? 12  ARG C CZ    1 
ATOM   1454  N NH1   . ARG C 3  15  ? 71.547  84.401  90.497  0.00 60.10  ? 12  ARG C NH1   1 
ATOM   1455  N NH2   . ARG C 3  15  ? 70.408  84.282  92.475  0.00 50.32  ? 12  ARG C NH2   1 
ATOM   1456  N N     . ALA C 3  16  ? 79.095  85.967  92.446  1.00 61.92  ? 13  ALA C N     1 
ATOM   1457  C CA    . ALA C 3  16  ? 80.252  85.768  91.577  1.00 63.30  ? 13  ALA C CA    1 
ATOM   1458  C C     . ALA C 3  16  ? 80.353  84.299  91.193  1.00 64.32  ? 13  ALA C C     1 
ATOM   1459  O O     . ALA C 3  16  ? 80.339  83.438  92.071  1.00 61.20  ? 13  ALA C O     1 
ATOM   1460  C CB    . ALA C 3  16  ? 81.519  86.203  92.250  1.00 54.94  ? 13  ALA C CB    1 
ATOM   1461  N N     . LYS C 3  17  ? 80.474  84.020  89.894  1.00 65.36  ? 14  LYS C N     1 
ATOM   1462  C CA    . LYS C 3  17  ? 80.583  82.639  89.408  1.00 67.33  ? 14  LYS C CA    1 
ATOM   1463  C C     . LYS C 3  17  ? 81.869  82.296  88.670  1.00 65.60  ? 14  LYS C C     1 
ATOM   1464  O O     . LYS C 3  17  ? 82.186  81.121  88.489  1.00 59.90  ? 14  LYS C O     1 
ATOM   1465  C CB    . LYS C 3  17  ? 79.398  82.302  88.512  1.00 68.45  ? 14  LYS C CB    1 
ATOM   1466  C CG    . LYS C 3  17  ? 79.416  80.889  87.925  1.00 74.09  ? 14  LYS C CG    1 
ATOM   1467  C CD    . LYS C 3  17  ? 79.365  79.804  89.014  1.00 78.55  ? 14  LYS C CD    1 
ATOM   1468  C CE    . LYS C 3  17  ? 79.212  78.419  88.421  1.00 84.42  ? 14  LYS C CE    1 
ATOM   1469  N NZ    . LYS C 3  17  ? 79.379  77.342  89.456  1.00 78.54  ? 14  LYS C NZ    1 
ATOM   1470  N N     . ALA C 3  18  ? 82.565  83.300  88.162  1.00 59.97  ? 15  ALA C N     1 
ATOM   1471  C CA    . ALA C 3  18  ? 83.738  83.049  87.349  1.00 63.81  ? 15  ALA C CA    1 
ATOM   1472  C C     . ALA C 3  18  ? 84.829  82.441  88.207  1.00 65.75  ? 15  ALA C C     1 
ATOM   1473  O O     . ALA C 3  18  ? 84.875  82.660  89.415  1.00 59.06  ? 15  ALA C O     1 
ATOM   1474  C CB    . ALA C 3  18  ? 84.208  84.311  86.662  1.00 57.92  ? 15  ALA C CB    1 
ATOM   1475  N N     . LYS C 3  19  ? 85.695  81.677  87.551  1.00 63.92  ? 16  LYS C N     1 
ATOM   1476  C CA    . LYS C 3  19  ? 86.795  80.928  88.144  1.00 56.42  ? 16  LYS C CA    1 
ATOM   1477  C C     . LYS C 3  19  ? 87.915  81.658  88.872  1.00 52.50  ? 16  LYS C C     1 
ATOM   1478  O O     . LYS C 3  19  ? 88.564  81.051  89.720  1.00 55.43  ? 16  LYS C O     1 
ATOM   1479  C CB    . LYS C 3  19  ? 87.450  80.095  87.056  1.00 56.69  ? 16  LYS C CB    1 
ATOM   1480  C CG    . LYS C 3  19  ? 86.590  78.967  86.561  1.00 63.57  ? 16  LYS C CG    1 
ATOM   1481  C CD    . LYS C 3  19  ? 87.272  78.161  85.467  1.00 66.10  ? 16  LYS C CD    1 
ATOM   1482  C CE    . LYS C 3  19  ? 86.375  77.024  84.991  1.00 68.54  ? 16  LYS C CE    1 
ATOM   1483  N NZ    . LYS C 3  19  ? 87.015  76.213  83.929  1.00 70.32  ? 16  LYS C NZ    1 
ATOM   1484  N N     . THR C 3  20  ? 88.235  82.889  88.546  1.00 48.26  ? 17  THR C N     1 
ATOM   1485  C CA    . THR C 3  20  ? 89.394  83.426  89.232  1.00 42.80  ? 17  THR C CA    1 
ATOM   1486  C C     . THR C 3  20  ? 89.053  83.843  90.629  1.00 41.02  ? 17  THR C C     1 
ATOM   1487  O O     . THR C 3  20  ? 87.890  84.093  90.960  1.00 44.76  ? 17  THR C O     1 
ATOM   1488  C CB    . THR C 3  20  ? 89.983  84.622  88.485  1.00 44.70  ? 17  THR C CB    1 
ATOM   1489  O OG1   . THR C 3  20  ? 89.018  85.684  88.447  1.00 44.60  ? 17  THR C OG1   1 
ATOM   1490  C CG2   . THR C 3  20  ? 90.334  84.212  87.078  1.00 53.22  ? 17  THR C CG2   1 
ATOM   1491  N N     . ARG C 3  21  ? 90.069  84.011  91.459  1.00 34.67  ? 18  ARG C N     1 
ATOM   1492  C CA    . ARG C 3  21  ? 89.771  84.436  92.808  1.00 30.21  ? 18  ARG C CA    1 
ATOM   1493  C C     . ARG C 3  21  ? 89.280  85.858  92.871  1.00 31.77  ? 18  ARG C C     1 
ATOM   1494  O O     . ARG C 3  21  ? 88.472  86.197  93.739  1.00 39.11  ? 18  ARG C O     1 
ATOM   1495  C CB    . ARG C 3  21  ? 90.952  84.331  93.678  1.00 26.98  ? 18  ARG C CB    1 
ATOM   1496  C CG    . ARG C 3  21  ? 91.408  83.007  94.021  1.00 27.15  ? 18  ARG C CG    1 
ATOM   1497  C CD    . ARG C 3  21  ? 92.573  83.160  94.851  1.00 25.73  ? 18  ARG C CD    1 
ATOM   1498  N NE    . ARG C 3  21  ? 93.195  81.975  95.130  1.00 25.39  ? 18  ARG C NE    1 
ATOM   1499  C CZ    . ARG C 3  21  ? 94.382  81.869  95.728  1.00 27.40  ? 18  ARG C CZ    1 
ATOM   1500  N NH1   . ARG C 3  21  ? 95.046  82.899  96.128  1.00 21.27  ? 18  ARG C NH1   1 
ATOM   1501  N NH2   . ARG C 3  21  ? 94.891  80.692  95.915  1.00 0.01   ? 18  ARG C NH2   1 
ATOM   1502  N N     . SER C 3  22  ? 89.762  86.703  91.968  1.00 27.38  ? 19  SER C N     1 
ATOM   1503  C CA    . SER C 3  22  ? 89.353  88.084  91.977  1.00 24.81  ? 19  SER C CA    1 
ATOM   1504  C C     . SER C 3  22  ? 87.890  88.152  91.668  1.00 28.20  ? 19  SER C C     1 
ATOM   1505  O O     . SER C 3  22  ? 87.167  88.986  92.217  1.00 38.86  ? 19  SER C O     1 
ATOM   1506  C CB    . SER C 3  22  ? 90.116  88.884  90.963  1.00 27.86  ? 19  SER C CB    1 
ATOM   1507  O OG    . SER C 3  22  ? 91.457  88.990  91.302  1.00 37.96  ? 19  SER C OG    1 
ATOM   1508  N N     . SER C 3  23  ? 87.407  87.269  90.803  1.00 29.92  ? 20  SER C N     1 
ATOM   1509  C CA    . SER C 3  23  ? 86.003  87.313  90.506  1.00 30.63  ? 20  SER C CA    1 
ATOM   1510  C C     . SER C 3  23  ? 85.194  86.891  91.697  1.00 29.97  ? 20  SER C C     1 
ATOM   1511  O O     . SER C 3  23  ? 84.238  87.564  92.061  1.00 35.13  ? 20  SER C O     1 
ATOM   1512  C CB    . SER C 3  23  ? 85.693  86.425  89.350  1.00 40.24  ? 20  SER C CB    1 
ATOM   1513  O OG    . SER C 3  23  ? 86.279  86.924  88.180  1.00 44.59  ? 20  SER C OG    1 
ATOM   1514  N N     . ARG C 3  24  ? 85.624  85.867  92.413  1.00 31.26  ? 21  ARG C N     1 
ATOM   1515  C CA    . ARG C 3  24  ? 84.840  85.435  93.559  1.00 30.00  ? 21  ARG C CA    1 
ATOM   1516  C C     . ARG C 3  24  ? 84.758  86.472  94.627  1.00 28.78  ? 21  ARG C C     1 
ATOM   1517  O O     . ARG C 3  24  ? 83.751  86.606  95.312  1.00 34.02  ? 21  ARG C O     1 
ATOM   1518  C CB    . ARG C 3  24  ? 85.397  84.228  94.205  1.00 35.44  ? 21  ARG C CB    1 
ATOM   1519  C CG    . ARG C 3  24  ? 85.227  83.002  93.488  1.00 42.55  ? 21  ARG C CG    1 
ATOM   1520  C CD    . ARG C 3  24  ? 85.737  81.882  94.292  1.00 52.16  ? 21  ARG C CD    1 
ATOM   1521  N NE    . ARG C 3  24  ? 85.612  80.649  93.604  1.00 65.63  ? 21  ARG C NE    1 
ATOM   1522  C CZ    . ARG C 3  24  ? 86.475  80.218  92.683  1.00 62.35  ? 21  ARG C CZ    1 
ATOM   1523  N NH1   . ARG C 3  24  ? 87.489  80.962  92.369  1.00 58.78  ? 21  ARG C NH1   1 
ATOM   1524  N NH2   . ARG C 3  24  ? 86.290  79.058  92.085  1.00 69.79  ? 21  ARG C NH2   1 
ATOM   1525  N N     . ALA C 3  25  ? 85.834  87.193  94.801  1.00 25.40  ? 22  ALA C N     1 
ATOM   1526  C CA    . ALA C 3  25  ? 85.907  88.191  95.831  1.00 24.10  ? 22  ALA C CA    1 
ATOM   1527  C C     . ALA C 3  25  ? 85.242  89.497  95.426  1.00 27.62  ? 22  ALA C C     1 
ATOM   1528  O O     . ALA C 3  25  ? 85.191  90.426  96.228  1.00 31.61  ? 22  ALA C O     1 
ATOM   1529  C CB    . ALA C 3  25  ? 87.351  88.425  96.183  1.00 23.64  ? 22  ALA C CB    1 
ATOM   1530  N N     . GLY C 3  26  ? 84.802  89.623  94.171  1.00 30.12  ? 23  GLY C N     1 
ATOM   1531  C CA    . GLY C 3  26  ? 84.192  90.855  93.697  1.00 32.01  ? 23  GLY C CA    1 
ATOM   1532  C C     . GLY C 3  26  ? 85.191  91.993  93.521  1.00 33.05  ? 23  GLY C C     1 
ATOM   1533  O O     . GLY C 3  26  ? 84.832  93.164  93.721  1.00 41.44  ? 23  GLY C O     1 
ATOM   1534  N N     . LEU C 3  27  ? 86.446  91.663  93.224  1.00 26.75  ? 24  LEU C N     1 
ATOM   1535  C CA    . LEU C 3  27  ? 87.524  92.634  93.097  1.00 25.19  ? 24  LEU C CA    1 
ATOM   1536  C C     . LEU C 3  27  ? 88.024  92.857  91.691  1.00 27.99  ? 24  LEU C C     1 
ATOM   1537  O O     . LEU C 3  27  ? 87.844  92.020  90.811  1.00 29.96  ? 24  LEU C O     1 
ATOM   1538  C CB    . LEU C 3  27  ? 88.691  92.187  93.949  1.00 24.04  ? 24  LEU C CB    1 
ATOM   1539  C CG    . LEU C 3  27  ? 88.403  91.968  95.406  1.00 22.03  ? 24  LEU C CG    1 
ATOM   1540  C CD1   . LEU C 3  27  ? 89.641  91.470  96.058  1.00 22.79  ? 24  LEU C CD1   1 
ATOM   1541  C CD2   . LEU C 3  27  ? 87.950  93.223  96.037  1.00 32.47  ? 24  LEU C CD2   1 
ATOM   1542  N N     . GLN C 3  28  ? 88.661  94.004  91.475  1.00 28.41  ? 25  GLN C N     1 
ATOM   1543  C CA    . GLN C 3  28  ? 89.308  94.275  90.205  1.00 22.63  ? 25  GLN C CA    1 
ATOM   1544  C C     . GLN C 3  28  ? 90.783  93.943  90.313  1.00 25.30  ? 25  GLN C C     1 
ATOM   1545  O O     . GLN C 3  28  ? 91.402  93.512  89.347  1.00 31.02  ? 25  GLN C O     1 
ATOM   1546  C CB    . GLN C 3  28  ? 89.163  95.724  89.842  1.00 22.48  ? 25  GLN C CB    1 
ATOM   1547  C CG    . GLN C 3  28  ? 87.768  96.174  89.712  1.00 30.43  ? 25  GLN C CG    1 
ATOM   1548  C CD    . GLN C 3  28  ? 87.082  95.498  88.662  1.00 36.34  ? 25  GLN C CD    1 
ATOM   1549  O OE1   . GLN C 3  28  ? 87.555  95.468  87.540  1.00 41.77  ? 25  GLN C OE1   1 
ATOM   1550  N NE2   . GLN C 3  28  ? 85.947  94.931  88.967  1.00 44.15  ? 25  GLN C NE2   1 
ATOM   1551  N N     . PHE C 3  29  ? 91.335  94.103  91.506  1.00 19.54  ? 26  PHE C N     1 
ATOM   1552  C CA    . PHE C 3  29  ? 92.730  93.772  91.745  1.00 17.92  ? 26  PHE C CA    1 
ATOM   1553  C C     . PHE C 3  29  ? 92.914  92.275  91.747  1.00 23.03  ? 26  PHE C C     1 
ATOM   1554  O O     . PHE C 3  29  ? 91.960  91.554  92.035  1.00 28.56  ? 26  PHE C O     1 
ATOM   1555  C CB    . PHE C 3  29  ? 93.233  94.433  93.005  1.00 18.49  ? 26  PHE C CB    1 
ATOM   1556  C CG    . PHE C 3  29  ? 93.737  95.778  92.744  1.00 16.30  ? 26  PHE C CG    1 
ATOM   1557  C CD1   . PHE C 3  29  ? 92.946  96.793  92.352  1.00 19.79  ? 26  PHE C CD1   1 
ATOM   1558  C CD2   . PHE C 3  29  ? 95.072  96.018  92.899  1.00 16.19  ? 26  PHE C CD2   1 
ATOM   1559  C CE1   . PHE C 3  29  ? 93.483  98.012  92.102  1.00 17.88  ? 26  PHE C CE1   1 
ATOM   1560  C CE2   . PHE C 3  29  ? 95.596  97.229  92.659  1.00 14.81  ? 26  PHE C CE2   1 
ATOM   1561  C CZ    . PHE C 3  29  ? 94.803  98.224  92.255  1.00 15.32  ? 26  PHE C CZ    1 
ATOM   1562  N N     . PRO C 3  30  ? 94.088  91.766  91.368  1.00 24.11  ? 27  PRO C N     1 
ATOM   1563  C CA    . PRO C 3  30  ? 94.387  90.378  91.307  1.00 25.45  ? 27  PRO C CA    1 
ATOM   1564  C C     . PRO C 3  30  ? 94.466  89.882  92.697  1.00 32.28  ? 27  PRO C C     1 
ATOM   1565  O O     . PRO C 3  30  ? 94.907  90.620  93.566  1.00 33.90  ? 27  PRO C O     1 
ATOM   1566  C CB    . PRO C 3  30  ? 95.743  90.352  90.648  1.00 25.00  ? 27  PRO C CB    1 
ATOM   1567  C CG    . PRO C 3  30  ? 96.347  91.644  91.030  1.00 25.74  ? 27  PRO C CG    1 
ATOM   1568  C CD    . PRO C 3  30  ? 95.224  92.610  91.103  1.00 27.38  ? 27  PRO C CD    1 
ATOM   1569  N N     . VAL C 3  31  ? 94.127  88.634  92.903  1.00 33.34  ? 28  VAL C N     1 
ATOM   1570  C CA    . VAL C 3  31  ? 94.285  88.040  94.204  1.00 20.34  ? 28  VAL C CA    1 
ATOM   1571  C C     . VAL C 3  31  ? 95.448  87.101  94.169  1.00 24.50  ? 28  VAL C C     1 
ATOM   1572  O O     . VAL C 3  31  ? 96.258  87.083  95.087  1.00 28.10  ? 28  VAL C O     1 
ATOM   1573  C CB    . VAL C 3  31  ? 93.030  87.327  94.634  1.00 18.08  ? 28  VAL C CB    1 
ATOM   1574  C CG1   . VAL C 3  31  ? 93.246  86.640  95.929  1.00 24.65  ? 28  VAL C CG1   1 
ATOM   1575  C CG2   . VAL C 3  31  ? 91.929  88.318  94.785  1.00 26.11  ? 28  VAL C CG2   1 
ATOM   1576  N N     . GLY C 3  32  ? 95.537  86.293  93.123  1.00 25.79  ? 29  GLY C N     1 
ATOM   1577  C CA    . GLY C 3  32  ? 96.593  85.300  93.037  1.00 28.30  ? 29  GLY C CA    1 
ATOM   1578  C C     . GLY C 3  32  ? 97.964  85.940  93.059  1.00 25.47  ? 29  GLY C C     1 
ATOM   1579  O O     . GLY C 3  32  ? 98.896  85.416  93.669  1.00 29.81  ? 29  GLY C O     1 
ATOM   1580  N N     . ARG C 3  33  ? 98.089  87.100  92.445  1.00 25.27  ? 30  ARG C N     1 
ATOM   1581  C CA    . ARG C 3  33  ? 99.358  87.782  92.449  1.00 21.58  ? 30  ARG C CA    1 
ATOM   1582  C C     . ARG C 3  33  ? 99.707  88.279  93.816  1.00 25.14  ? 30  ARG C C     1 
ATOM   1583  O O     . ARG C 3  33  ? 100.866 88.272  94.212  1.00 25.95  ? 30  ARG C O     1 
ATOM   1584  C CB    . ARG C 3  33  ? 99.364  88.938  91.537  1.00 23.49  ? 30  ARG C CB    1 
ATOM   1585  C CG    . ARG C 3  33  ? 100.642 89.632  91.514  1.00 28.02  ? 30  ARG C CG    1 
ATOM   1586  C CD    . ARG C 3  33  ? 100.680 90.671  90.530  1.00 33.67  ? 30  ARG C CD    1 
ATOM   1587  N NE    . ARG C 3  33  ? 100.647 90.150  89.220  1.00 40.62  ? 30  ARG C NE    1 
ATOM   1588  C CZ    . ARG C 3  33  ? 100.452 90.863  88.130  1.00 39.67  ? 30  ARG C CZ    1 
ATOM   1589  N NH1   . ARG C 3  33  ? 100.279 92.141  88.207  1.00 34.17  ? 30  ARG C NH1   1 
ATOM   1590  N NH2   . ARG C 3  33  ? 100.441 90.265  86.982  1.00 43.94  ? 30  ARG C NH2   1 
ATOM   1591  N N     . VAL C 3  34  ? 98.722  88.754  94.539  1.00 25.98  ? 31  VAL C N     1 
ATOM   1592  C CA    . VAL C 3  34  ? 98.980  89.288  95.843  1.00 17.42  ? 31  VAL C CA    1 
ATOM   1593  C C     . VAL C 3  34  ? 99.458  88.151  96.691  1.00 21.68  ? 31  VAL C C     1 
ATOM   1594  O O     . VAL C 3  34  ? 100.369 88.316  97.496  1.00 21.60  ? 31  VAL C O     1 
ATOM   1595  C CB    . VAL C 3  34  ? 97.747  89.953  96.418  1.00 18.06  ? 31  VAL C CB    1 
ATOM   1596  C CG1   . VAL C 3  34  ? 97.966  90.342  97.845  1.00 19.71  ? 31  VAL C CG1   1 
ATOM   1597  C CG2   . VAL C 3  34  ? 97.452  91.157  95.604  1.00 20.94  ? 31  VAL C CG2   1 
ATOM   1598  N N     . HIS C 3  35  ? 98.835  86.995  96.534  1.00 21.30  ? 32  HIS C N     1 
ATOM   1599  C CA    . HIS C 3  35  ? 99.228  85.845  97.301  1.00 18.40  ? 32  HIS C CA    1 
ATOM   1600  C C     . HIS C 3  35  ? 100.680 85.535  97.004  1.00 18.86  ? 32  HIS C C     1 
ATOM   1601  O O     . HIS C 3  35  ? 101.483 85.352  97.917  1.00 24.82  ? 32  HIS C O     1 
ATOM   1602  C CB    . HIS C 3  35  ? 98.337  84.666  96.949  1.00 20.59  ? 32  HIS C CB    1 
ATOM   1603  C CG    . HIS C 3  35  ? 98.501  83.471  97.787  1.00 20.81  ? 32  HIS C CG    1 
ATOM   1604  N ND1   . HIS C 3  35  ? 97.790  82.328  97.562  1.00 23.87  ? 32  HIS C ND1   1 
ATOM   1605  C CD2   . HIS C 3  35  ? 99.261  83.227  98.869  1.00 25.08  ? 32  HIS C CD2   1 
ATOM   1606  C CE1   . HIS C 3  35  ? 98.126  81.431  98.460  1.00 25.47  ? 32  HIS C CE1   1 
ATOM   1607  N NE2   . HIS C 3  35  ? 99.008  81.955  99.255  1.00 25.52  ? 32  HIS C NE2   1 
ATOM   1608  N N     . ARG C 3  36  ? 101.060 85.526  95.743  1.00 19.44  ? 33  ARG C N     1 
ATOM   1609  C CA    . ARG C 3  36  ? 102.437 85.237  95.425  1.00 18.82  ? 33  ARG C CA    1 
ATOM   1610  C C     . ARG C 3  36  ? 103.409 86.205  96.037  1.00 18.60  ? 33  ARG C C     1 
ATOM   1611  O O     . ARG C 3  36  ? 104.454 85.791  96.542  1.00 24.34  ? 33  ARG C O     1 
ATOM   1612  C CB    . ARG C 3  36  ? 102.636 85.255  93.957  1.00 22.78  ? 33  ARG C CB    1 
ATOM   1613  C CG    . ARG C 3  36  ? 103.982 84.989  93.537  1.00 24.89  ? 33  ARG C CG    1 
ATOM   1614  C CD    . ARG C 3  36  ? 104.060 84.743  92.075  1.00 32.83  ? 33  ARG C CD    1 
ATOM   1615  N NE    . ARG C 3  36  ? 103.753 85.878  91.234  1.00 33.53  ? 33  ARG C NE    1 
ATOM   1616  C CZ    . ARG C 3  36  ? 104.618 86.860  90.963  1.00 40.78  ? 33  ARG C CZ    1 
ATOM   1617  N NH1   . ARG C 3  36  ? 105.803 86.850  91.502  1.00 38.40  ? 33  ARG C NH1   1 
ATOM   1618  N NH2   . ARG C 3  36  ? 104.316 87.840  90.152  1.00 44.17  ? 33  ARG C NH2   1 
ATOM   1619  N N     . LEU C 3  37  ? 103.072 87.475  96.018  1.00 19.76  ? 34  LEU C N     1 
ATOM   1620  C CA    . LEU C 3  37  ? 103.942 88.480  96.569  1.00 15.82  ? 34  LEU C CA    1 
ATOM   1621  C C     . LEU C 3  37  ? 104.036 88.370  98.072  1.00 18.96  ? 34  LEU C C     1 
ATOM   1622  O O     . LEU C 3  37  ? 105.042 88.756  98.646  1.00 20.12  ? 34  LEU C O     1 
ATOM   1623  C CB    . LEU C 3  37  ? 103.439 89.851  96.190  1.00 19.46  ? 34  LEU C CB    1 
ATOM   1624  C CG    . LEU C 3  37  ? 103.494 90.208  94.707  1.00 21.84  ? 34  LEU C CG    1 
ATOM   1625  C CD1   . LEU C 3  37  ? 102.779 91.517  94.516  1.00 29.88  ? 34  LEU C CD1   1 
ATOM   1626  C CD2   . LEU C 3  37  ? 104.917 90.302  94.219  1.00 25.86  ? 34  LEU C CD2   1 
ATOM   1627  N N     . LEU C 3  38  ? 102.989 87.894  98.739  1.00 20.37  ? 35  LEU C N     1 
ATOM   1628  C CA    . LEU C 3  38  ? 103.074 87.702  100.173 1.00 16.26  ? 35  LEU C CA    1 
ATOM   1629  C C     . LEU C 3  38  ? 103.893 86.477  100.515 1.00 20.78  ? 35  LEU C C     1 
ATOM   1630  O O     . LEU C 3  38  ? 104.523 86.437  101.567 1.00 23.84  ? 35  LEU C O     1 
ATOM   1631  C CB    . LEU C 3  38  ? 101.698 87.552  100.805 1.00 12.79  ? 35  LEU C CB    1 
ATOM   1632  C CG    . LEU C 3  38  ? 100.817 88.755  100.842 1.00 15.19  ? 35  LEU C CG    1 
ATOM   1633  C CD1   . LEU C 3  38  ? 99.435  88.341  101.286 1.00 17.85  ? 35  LEU C CD1   1 
ATOM   1634  C CD2   . LEU C 3  38  ? 101.378 89.766  101.824 1.00 19.71  ? 35  LEU C CD2   1 
ATOM   1635  N N     . ARG C 3  39  ? 103.863 85.447  99.672  1.00 21.77  ? 36  ARG C N     1 
ATOM   1636  C CA    . ARG C 3  39  ? 104.628 84.249  99.973  1.00 21.35  ? 36  ARG C CA    1 
ATOM   1637  C C     . ARG C 3  39  ? 106.093 84.461  99.814  1.00 22.22  ? 36  ARG C C     1 
ATOM   1638  O O     . ARG C 3  39  ? 106.899 83.916  100.567 1.00 39.76  ? 36  ARG C O     1 
ATOM   1639  C CB    . ARG C 3  39  ? 104.238 83.087  99.107  1.00 20.96  ? 36  ARG C CB    1 
ATOM   1640  C CG    . ARG C 3  39  ? 102.978 82.493  99.486  1.00 25.54  ? 36  ARG C CG    1 
ATOM   1641  C CD    . ARG C 3  39  ? 102.660 81.319  98.742  1.00 28.45  ? 36  ARG C CD    1 
ATOM   1642  N NE    . ARG C 3  39  ? 102.225 81.621  97.433  1.00 31.62  ? 36  ARG C NE    1 
ATOM   1643  C CZ    . ARG C 3  39  ? 102.028 80.714  96.476  1.00 43.79  ? 36  ARG C CZ    1 
ATOM   1644  N NH1   . ARG C 3  39  ? 102.250 79.456  96.723  1.00 49.38  ? 36  ARG C NH1   1 
ATOM   1645  N NH2   . ARG C 3  39  ? 101.607 81.078  95.276  1.00 38.26  ? 36  ARG C NH2   1 
ATOM   1646  N N     . LYS C 3  40  ? 106.457 85.341  98.864  1.00 18.76  ? 37  LYS C N     1 
ATOM   1647  C CA    . LYS C 3  40  ? 107.862 85.532  98.438  1.00 16.31  ? 37  LYS C CA    1 
ATOM   1648  C C     . LYS C 3  40  ? 108.830 86.236  99.382  1.00 18.31  ? 37  LYS C C     1 
ATOM   1649  O O     . LYS C 3  40  ? 109.742 85.541  99.872  1.00 22.56  ? 37  LYS C O     1 
ATOM   1650  C CB    . LYS C 3  40  ? 107.893 86.212  97.068  1.00 17.57  ? 37  LYS C CB    1 
ATOM   1651  C CG    . LYS C 3  40  ? 109.248 86.218  96.377  1.00 22.29  ? 37  LYS C CG    1 
ATOM   1652  C CD    . LYS C 3  40  ? 109.237 87.030  95.108  1.00 28.92  ? 37  LYS C CD    1 
ATOM   1653  C CE    . LYS C 3  40  ? 110.593 87.591  94.705  1.00 43.72  ? 37  LYS C CE    1 
ATOM   1654  N NZ    . LYS C 3  40  ? 110.483 88.566  93.586  1.00 47.32  ? 37  LYS C NZ    1 
ATOM   1655  N N     . GLY C 3  41  ? 108.683 87.553  99.629  1.00 20.17  ? 38  GLY C N     1 
ATOM   1656  C CA    . GLY C 3  41  ? 109.782 88.173  100.332 1.00 19.21  ? 38  GLY C CA    1 
ATOM   1657  C C     . GLY C 3  41  ? 109.869 87.989  101.827 1.00 22.78  ? 38  GLY C C     1 
ATOM   1658  O O     . GLY C 3  41  ? 110.080 88.948  102.564 1.00 25.30  ? 38  GLY C O     1 
ATOM   1659  N N     . ASN C 3  42  ? 109.736 86.753  102.283 1.00 23.63  ? 39  ASN C N     1 
ATOM   1660  C CA    . ASN C 3  42  ? 109.880 86.428  103.690 1.00 24.59  ? 39  ASN C CA    1 
ATOM   1661  C C     . ASN C 3  42  ? 109.041 87.220  104.680 1.00 25.80  ? 39  ASN C C     1 
ATOM   1662  O O     . ASN C 3  42  ? 109.573 87.738  105.656 1.00 29.10  ? 39  ASN C O     1 
ATOM   1663  C CB    . ASN C 3  42  ? 111.343 86.510  104.060 1.00 29.36  ? 39  ASN C CB    1 
ATOM   1664  C CG    . ASN C 3  42  ? 112.138 85.501  103.347 1.00 38.47  ? 39  ASN C CG    1 
ATOM   1665  O OD1   . ASN C 3  42  ? 111.718 84.340  103.259 1.00 37.13  ? 39  ASN C OD1   1 
ATOM   1666  N ND2   . ASN C 3  42  ? 113.273 85.903  102.825 1.00 45.82  ? 39  ASN C ND2   1 
ATOM   1667  N N     . TYR C 3  43  ? 107.749 87.353  104.444 1.00 19.58  ? 40  TYR C N     1 
ATOM   1668  C CA    . TYR C 3  43  ? 106.930 88.042  105.424 1.00 16.80  ? 40  TYR C CA    1 
ATOM   1669  C C     . TYR C 3  43  ? 106.555 87.077  106.540 1.00 20.94  ? 40  TYR C C     1 
ATOM   1670  O O     . TYR C 3  43  ? 106.412 87.454  107.703 1.00 26.62  ? 40  TYR C O     1 
ATOM   1671  C CB    . TYR C 3  43  ? 105.684 88.601  104.775 1.00 14.57  ? 40  TYR C CB    1 
ATOM   1672  C CG    . TYR C 3  43  ? 105.969 89.706  103.855 1.00 15.66  ? 40  TYR C CG    1 
ATOM   1673  C CD1   . TYR C 3  43  ? 105.967 89.485  102.529 1.00 18.99  ? 40  TYR C CD1   1 
ATOM   1674  C CD2   . TYR C 3  43  ? 106.242 90.939  104.330 1.00 17.97  ? 40  TYR C CD2   1 
ATOM   1675  C CE1   . TYR C 3  43  ? 106.238 90.486  101.671 1.00 18.28  ? 40  TYR C CE1   1 
ATOM   1676  C CE2   . TYR C 3  43  ? 106.517 91.947  103.467 1.00 16.95  ? 40  TYR C CE2   1 
ATOM   1677  C CZ    . TYR C 3  43  ? 106.517 91.716  102.144 1.00 12.00  ? 40  TYR C CZ    1 
ATOM   1678  O OH    . TYR C 3  43  ? 106.805 92.720  101.274 1.00 18.85  ? 40  TYR C OH    1 
ATOM   1679  N N     . SER C 3  44  ? 106.375 85.830  106.178 1.00 21.47  ? 41  SER C N     1 
ATOM   1680  C CA    . SER C 3  44  ? 106.005 84.781  107.100 1.00 20.09  ? 41  SER C CA    1 
ATOM   1681  C C     . SER C 3  44  ? 106.263 83.459  106.452 1.00 23.74  ? 41  SER C C     1 
ATOM   1682  O O     . SER C 3  44  ? 106.442 83.396  105.236 1.00 27.85  ? 41  SER C O     1 
ATOM   1683  C CB    . SER C 3  44  ? 104.562 84.846  107.439 1.00 21.26  ? 41  SER C CB    1 
ATOM   1684  O OG    . SER C 3  44  ? 103.818 84.551  106.300 1.00 23.71  ? 41  SER C OG    1 
ATOM   1685  N N     . GLU C 3  45  ? 106.241 82.396  107.229 1.00 22.50  ? 42  GLU C N     1 
ATOM   1686  C CA    . GLU C 3  45  ? 106.303 81.080  106.637 1.00 18.76  ? 42  GLU C CA    1 
ATOM   1687  C C     . GLU C 3  45  ? 105.027 80.713  105.914 1.00 21.08  ? 42  GLU C C     1 
ATOM   1688  O O     . GLU C 3  45  ? 105.065 80.009  104.909 1.00 37.31  ? 42  GLU C O     1 
ATOM   1689  C CB    . GLU C 3  45  ? 106.561 80.030  107.669 1.00 23.98  ? 42  GLU C CB    1 
ATOM   1690  C CG    . GLU C 3  45  ? 107.908 80.086  108.269 1.00 31.71  ? 42  GLU C CG    1 
ATOM   1691  C CD    . GLU C 3  45  ? 108.129 78.994  109.263 1.00 44.93  ? 42  GLU C CD    1 
ATOM   1692  O OE1   . GLU C 3  45  ? 107.199 78.286  109.561 1.00 34.69  ? 42  GLU C OE1   1 
ATOM   1693  O OE2   . GLU C 3  45  ? 109.232 78.856  109.722 1.00 52.53  ? 42  GLU C OE2   1 
ATOM   1694  N N     . ARG C 3  46  ? 103.896 81.161  106.433 1.00 18.33  ? 43  ARG C N     1 
ATOM   1695  C CA    . ARG C 3  46  ? 102.613 80.826  105.852 1.00 19.36  ? 43  ARG C CA    1 
ATOM   1696  C C     . ARG C 3  46  ? 101.731 82.021  105.571 1.00 22.11  ? 43  ARG C C     1 
ATOM   1697  O O     . ARG C 3  46  ? 101.705 82.984  106.346 1.00 23.72  ? 43  ARG C O     1 
ATOM   1698  C CB    . ARG C 3  46  ? 101.873 79.966  106.812 1.00 24.74  ? 43  ARG C CB    1 
ATOM   1699  C CG    . ARG C 3  46  ? 102.455 78.685  107.068 1.00 28.09  ? 43  ARG C CG    1 
ATOM   1700  C CD    . ARG C 3  46  ? 101.740 77.957  108.094 1.00 24.30  ? 43  ARG C CD    1 
ATOM   1701  N NE    . ARG C 3  46  ? 102.316 76.708  108.227 1.00 30.93  ? 43  ARG C NE    1 
ATOM   1702  C CZ    . ARG C 3  46  ? 101.929 75.638  107.560 1.00 42.07  ? 43  ARG C CZ    1 
ATOM   1703  N NH1   . ARG C 3  46  ? 100.908 75.680  106.782 1.00 45.53  ? 43  ARG C NH1   1 
ATOM   1704  N NH2   . ARG C 3  46  ? 102.587 74.516  107.660 1.00 53.56  ? 43  ARG C NH2   1 
ATOM   1705  N N     . VAL C 3  47  ? 100.943 81.919  104.513 1.00 20.03  ? 44  VAL C N     1 
ATOM   1706  C CA    . VAL C 3  47  ? 99.963  82.939  104.185 1.00 15.71  ? 44  VAL C CA    1 
ATOM   1707  C C     . VAL C 3  47  ? 98.588  82.333  104.113 1.00 17.72  ? 44  VAL C C     1 
ATOM   1708  O O     . VAL C 3  47  ? 98.352  81.433  103.323 1.00 28.11  ? 44  VAL C O     1 
ATOM   1709  C CB    . VAL C 3  47  ? 100.330 83.600  102.866 1.00 17.96  ? 44  VAL C CB    1 
ATOM   1710  C CG1   . VAL C 3  47  ? 99.315  84.623  102.484 1.00 24.36  ? 44  VAL C CG1   1 
ATOM   1711  C CG2   . VAL C 3  47  ? 101.684 84.245  103.010 1.00 25.80  ? 44  VAL C CG2   1 
ATOM   1712  N N     . GLY C 3  48  ? 97.675  82.844  104.899 1.00 16.34  ? 45  GLY C N     1 
ATOM   1713  C CA    . GLY C 3  48  ? 96.334  82.309  104.968 1.00 13.18  ? 45  GLY C CA    1 
ATOM   1714  C C     . GLY C 3  48  ? 95.538  82.639  103.743 1.00 15.57  ? 45  GLY C C     1 
ATOM   1715  O O     . GLY C 3  48  ? 95.802  83.611  103.049 1.00 20.27  ? 45  GLY C O     1 
ATOM   1716  N N     . ALA C 3  49  ? 94.495  81.879  103.510 1.00 14.76  ? 46  ALA C N     1 
ATOM   1717  C CA    . ALA C 3  49  ? 93.663  82.055  102.331 1.00 9.17   ? 46  ALA C CA    1 
ATOM   1718  C C     . ALA C 3  49  ? 92.993  83.399  102.238 1.00 11.00  ? 46  ALA C C     1 
ATOM   1719  O O     . ALA C 3  49  ? 92.833  83.936  101.149 1.00 19.07  ? 46  ALA C O     1 
ATOM   1720  C CB    . ALA C 3  49  ? 92.599  80.992  102.294 1.00 3.41   ? 46  ALA C CB    1 
ATOM   1721  N N     . GLY C 3  50  ? 92.595  83.968  103.353 1.00 12.20  ? 47  GLY C N     1 
ATOM   1722  C CA    . GLY C 3  50  ? 91.921  85.243  103.278 1.00 8.66   ? 47  GLY C CA    1 
ATOM   1723  C C     . GLY C 3  50  ? 92.895  86.396  103.290 1.00 10.59  ? 47  GLY C C     1 
ATOM   1724  O O     . GLY C 3  50  ? 92.495  87.548  103.168 1.00 14.16  ? 47  GLY C O     1 
ATOM   1725  N N     . ALA C 3  51  ? 94.180  86.139  103.452 1.00 9.18   ? 48  ALA C N     1 
ATOM   1726  C CA    . ALA C 3  51  ? 95.081  87.254  103.528 1.00 7.08   ? 48  ALA C CA    1 
ATOM   1727  C C     . ALA C 3  51  ? 95.140  88.015  102.212 1.00 13.27  ? 48  ALA C C     1 
ATOM   1728  O O     . ALA C 3  51  ? 94.946  89.227  102.239 1.00 11.81  ? 48  ALA C O     1 
ATOM   1729  C CB    . ALA C 3  51  ? 96.450  86.817  103.985 1.00 12.66  ? 48  ALA C CB    1 
ATOM   1730  N N     . PRO C 3  52  ? 95.383  87.410  101.028 1.00 12.89  ? 49  PRO C N     1 
ATOM   1731  C CA    . PRO C 3  52  ? 95.425  88.126  99.795  1.00 8.97   ? 49  PRO C CA    1 
ATOM   1732  C C     . PRO C 3  52  ? 94.073  88.639  99.375  1.00 12.27  ? 49  PRO C C     1 
ATOM   1733  O O     . PRO C 3  52  ? 93.993  89.619  98.651  1.00 15.47  ? 49  PRO C O     1 
ATOM   1734  C CB    . PRO C 3  52  ? 95.949  87.091  98.842  1.00 16.79  ? 49  PRO C CB    1 
ATOM   1735  C CG    . PRO C 3  52  ? 95.567  85.812  99.439  1.00 14.62  ? 49  PRO C CG    1 
ATOM   1736  C CD    . PRO C 3  52  ? 95.667  85.996  100.873 1.00 15.49  ? 49  PRO C CD    1 
ATOM   1737  N N     . VAL C 3  53  ? 92.993  88.061  99.863  1.00 13.12  ? 50  VAL C N     1 
ATOM   1738  C CA    . VAL C 3  53  ? 91.716  88.593  99.462  1.00 10.14  ? 50  VAL C CA    1 
ATOM   1739  C C     . VAL C 3  53  ? 91.470  89.880  100.179 1.00 11.59  ? 50  VAL C C     1 
ATOM   1740  O O     . VAL C 3  53  ? 91.013  90.857  99.587  1.00 17.87  ? 50  VAL C O     1 
ATOM   1741  C CB    . VAL C 3  53  ? 90.589  87.629  99.766  1.00 13.90  ? 50  VAL C CB    1 
ATOM   1742  C CG1   . VAL C 3  53  ? 89.256  88.269  99.484  1.00 23.19  ? 50  VAL C CG1   1 
ATOM   1743  C CG2   . VAL C 3  53  ? 90.748  86.437  98.935  1.00 20.64  ? 50  VAL C CG2   1 
ATOM   1744  N N     . TYR C 3  54  ? 91.719  89.875  101.471 1.00 12.05  ? 51  TYR C N     1 
ATOM   1745  C CA    . TYR C 3  54  ? 91.478  91.040  102.267 1.00 8.16   ? 51  TYR C CA    1 
ATOM   1746  C C     . TYR C 3  54  ? 92.379  92.150  101.779 1.00 7.35   ? 51  TYR C C     1 
ATOM   1747  O O     . TYR C 3  54  ? 91.934  93.276  101.565 1.00 11.51  ? 51  TYR C O     1 
ATOM   1748  C CB    . TYR C 3  54  ? 91.756  90.735  103.721 1.00 9.70   ? 51  TYR C CB    1 
ATOM   1749  C CG    . TYR C 3  54  ? 91.311  91.752  104.671 1.00 10.95  ? 51  TYR C CG    1 
ATOM   1750  C CD1   . TYR C 3  54  ? 90.150  91.564  105.316 1.00 14.12  ? 51  TYR C CD1   1 
ATOM   1751  C CD2   . TYR C 3  54  ? 92.005  92.865  104.879 1.00 12.37  ? 51  TYR C CD2   1 
ATOM   1752  C CE1   . TYR C 3  54  ? 89.692  92.478  106.173 1.00 11.31  ? 51  TYR C CE1   1 
ATOM   1753  C CE2   . TYR C 3  54  ? 91.542  93.787  105.736 1.00 11.74  ? 51  TYR C CE2   1 
ATOM   1754  C CZ    . TYR C 3  54  ? 90.393  93.587  106.369 1.00 12.90  ? 51  TYR C CZ    1 
ATOM   1755  O OH    . TYR C 3  54  ? 89.922  94.517  107.194 1.00 20.62  ? 51  TYR C OH    1 
ATOM   1756  N N     . LEU C 3  55  ? 93.653  91.841  101.576 1.00 8.55   ? 52  LEU C N     1 
ATOM   1757  C CA    . LEU C 3  55  ? 94.589  92.855  101.155 1.00 4.65   ? 52  LEU C CA    1 
ATOM   1758  C C     . LEU C 3  55  ? 94.301  93.390  99.780  1.00 4.72   ? 52  LEU C C     1 
ATOM   1759  O O     . LEU C 3  55  ? 94.451  94.589  99.557  1.00 7.96   ? 52  LEU C O     1 
ATOM   1760  C CB    . LEU C 3  55  ? 96.002  92.317  101.227 1.00 4.17   ? 52  LEU C CB    1 
ATOM   1761  C CG    . LEU C 3  55  ? 97.133  93.242  100.854 1.00 3.00   ? 52  LEU C CG    1 
ATOM   1762  C CD1   . LEU C 3  55  ? 97.112  94.460  101.681 1.00 1.14   ? 52  LEU C CD1   1 
ATOM   1763  C CD2   . LEU C 3  55  ? 98.411  92.525  101.118 1.00 2.28   ? 52  LEU C CD2   1 
ATOM   1764  N N     . ALA C 3  56  ? 93.921  92.552  98.827  1.00 7.52   ? 53  ALA C N     1 
ATOM   1765  C CA    . ALA C 3  56  ? 93.640  93.092  97.526  1.00 6.00   ? 53  ALA C CA    1 
ATOM   1766  C C     . ALA C 3  56  ? 92.489  94.067  97.614  1.00 7.31   ? 53  ALA C C     1 
ATOM   1767  O O     . ALA C 3  56  ? 92.545  95.124  96.992  1.00 11.66  ? 53  ALA C O     1 
ATOM   1768  C CB    . ALA C 3  56  ? 93.324  91.990  96.559  1.00 12.05  ? 53  ALA C CB    1 
ATOM   1769  N N     . ALA C 3  57  ? 91.474  93.779  98.430  1.00 9.01   ? 54  ALA C N     1 
ATOM   1770  C CA    . ALA C 3  57  ? 90.360  94.701  98.559  1.00 6.10   ? 54  ALA C CA    1 
ATOM   1771  C C     . ALA C 3  57  ? 90.784  96.043  99.119  1.00 6.32   ? 54  ALA C C     1 
ATOM   1772  O O     . ALA C 3  57  ? 90.304  97.085  98.669  1.00 13.96  ? 54  ALA C O     1 
ATOM   1773  C CB    . ALA C 3  57  ? 89.319  94.110  99.449  1.00 12.29  ? 54  ALA C CB    1 
ATOM   1774  N N     . VAL C 3  58  ? 91.707  96.045  100.064 1.00 5.05   ? 55  VAL C N     1 
ATOM   1775  C CA    . VAL C 3  58  ? 92.169  97.298  100.627 1.00 5.78   ? 55  VAL C CA    1 
ATOM   1776  C C     . VAL C 3  58  ? 92.924  98.119  99.625  1.00 7.48   ? 55  VAL C C     1 
ATOM   1777  O O     . VAL C 3  58  ? 92.730  99.334  99.556  1.00 9.62   ? 55  VAL C O     1 
ATOM   1778  C CB    . VAL C 3  58  ? 93.043  97.068  101.835 1.00 5.37   ? 55  VAL C CB    1 
ATOM   1779  C CG1   . VAL C 3  58  ? 93.692  98.368  102.291 1.00 4.08   ? 55  VAL C CG1   1 
ATOM   1780  C CG2   . VAL C 3  58  ? 92.189  96.508  102.910 1.00 6.25   ? 55  VAL C CG2   1 
ATOM   1781  N N     . LEU C 3  59  ? 93.805  97.492  98.858  1.00 7.17   ? 56  LEU C N     1 
ATOM   1782  C CA    . LEU C 3  59  ? 94.571  98.240  97.884  1.00 4.91   ? 56  LEU C CA    1 
ATOM   1783  C C     . LEU C 3  59  ? 93.645  98.824  96.851  1.00 6.50   ? 56  LEU C C     1 
ATOM   1784  O O     . LEU C 3  59  ? 93.854  99.953  96.393  1.00 11.16  ? 56  LEU C O     1 
ATOM   1785  C CB    . LEU C 3  59  ? 95.578  97.338  97.197  1.00 5.49   ? 56  LEU C CB    1 
ATOM   1786  C CG    . LEU C 3  59  ? 96.713  96.807  98.053  1.00 3.05   ? 56  LEU C CG    1 
ATOM   1787  C CD1   . LEU C 3  59  ? 97.464  95.781  97.262  1.00 2.61   ? 56  LEU C CD1   1 
ATOM   1788  C CD2   . LEU C 3  59  ? 97.639  97.917  98.486  1.00 2.51   ? 56  LEU C CD2   1 
ATOM   1789  N N     . GLU C 3  60  ? 92.615  98.086  96.481  1.00 8.78   ? 57  GLU C N     1 
ATOM   1790  C CA    . GLU C 3  60  ? 91.674  98.593  95.523  1.00 6.71   ? 57  GLU C CA    1 
ATOM   1791  C C     . GLU C 3  60  ? 90.937  99.793  96.035  1.00 10.91  ? 57  GLU C C     1 
ATOM   1792  O O     . GLU C 3  60  ? 90.766  100.772 95.312  1.00 15.42  ? 57  GLU C O     1 
ATOM   1793  C CB    . GLU C 3  60  ? 90.686  97.553  95.162  1.00 8.38   ? 57  GLU C CB    1 
ATOM   1794  C CG    . GLU C 3  60  ? 89.736  97.989  94.200  1.00 13.00  ? 57  GLU C CG    1 
ATOM   1795  C CD    . GLU C 3  60  ? 88.939  96.906  93.721  1.00 25.88  ? 57  GLU C CD    1 
ATOM   1796  O OE1   . GLU C 3  60  ? 89.497  95.885  93.322  1.00 28.70  ? 57  GLU C OE1   1 
ATOM   1797  O OE2   . GLU C 3  60  ? 87.751  97.033  93.730  1.00 29.59  ? 57  GLU C OE2   1 
ATOM   1798  N N     . TYR C 3  61  ? 90.503  99.747  97.277  1.00 13.07  ? 58  TYR C N     1 
ATOM   1799  C CA    . TYR C 3  61  ? 89.811  100.869 97.854  1.00 9.27   ? 58  TYR C CA    1 
ATOM   1800  C C     . TYR C 3  61  ? 90.646  102.126 97.838  1.00 11.38  ? 58  TYR C C     1 
ATOM   1801  O O     . TYR C 3  61  ? 90.178  103.186 97.421  1.00 10.81  ? 58  TYR C O     1 
ATOM   1802  C CB    . TYR C 3  61  ? 89.380  100.555 99.261  1.00 9.47   ? 58  TYR C CB    1 
ATOM   1803  C CG    . TYR C 3  61  ? 88.877  101.706 99.915  1.00 8.18   ? 58  TYR C CG    1 
ATOM   1804  C CD1   . TYR C 3  61  ? 87.676  102.182 99.590  1.00 10.43  ? 58  TYR C CD1   1 
ATOM   1805  C CD2   . TYR C 3  61  ? 89.627  102.310 100.857 1.00 13.28  ? 58  TYR C CD2   1 
ATOM   1806  C CE1   . TYR C 3  61  ? 87.217  103.298 100.192 1.00 8.16   ? 58  TYR C CE1   1 
ATOM   1807  C CE2   . TYR C 3  61  ? 89.176  103.408 101.464 1.00 12.35  ? 58  TYR C CE2   1 
ATOM   1808  C CZ    . TYR C 3  61  ? 87.980  103.912 101.124 1.00 9.03   ? 58  TYR C CZ    1 
ATOM   1809  O OH    . TYR C 3  61  ? 87.529  105.039 101.722 1.00 18.31  ? 58  TYR C OH    1 
ATOM   1810  N N     . LEU C 3  62  ? 91.882  102.033 98.291  1.00 11.18  ? 59  LEU C N     1 
ATOM   1811  C CA    . LEU C 3  62  ? 92.703  103.221 98.335  1.00 6.81   ? 59  LEU C CA    1 
ATOM   1812  C C     . LEU C 3  62  ? 93.003  103.747 96.944  1.00 12.08  ? 59  LEU C C     1 
ATOM   1813  O O     . LEU C 3  62  ? 93.044  104.964 96.729  1.00 14.47  ? 59  LEU C O     1 
ATOM   1814  C CB    . LEU C 3  62  ? 93.993  102.913 99.038  1.00 7.85   ? 59  LEU C CB    1 
ATOM   1815  C CG    . LEU C 3  62  ? 93.890  102.589 100.491 1.00 8.42   ? 59  LEU C CG    1 
ATOM   1816  C CD1   . LEU C 3  62  ? 95.209  102.122 100.945 1.00 5.99   ? 59  LEU C CD1   1 
ATOM   1817  C CD2   . LEU C 3  62  ? 93.464  103.775 101.285 1.00 11.94  ? 59  LEU C CD2   1 
ATOM   1818  N N     . THR C 3  63  ? 93.192  102.846 95.987  1.00 12.80  ? 60  THR C N     1 
ATOM   1819  C CA    . THR C 3  63  ? 93.453  103.236 94.621  1.00 7.32   ? 60  THR C CA    1 
ATOM   1820  C C     . THR C 3  63  ? 92.285  104.011 94.100  1.00 11.72  ? 60  THR C C     1 
ATOM   1821  O O     . THR C 3  63  ? 92.455  105.064 93.484  1.00 17.54  ? 60  THR C O     1 
ATOM   1822  C CB    . THR C 3  63  ? 93.674  102.005 93.737  1.00 7.14   ? 60  THR C CB    1 
ATOM   1823  O OG1   . THR C 3  63  ? 94.823  101.307 94.195  1.00 3.43   ? 60  THR C OG1   1 
ATOM   1824  C CG2   . THR C 3  63  ? 93.853  102.381 92.305  1.00 13.89  ? 60  THR C CG2   1 
ATOM   1825  N N     . ALA C 3  64  ? 91.084  103.527 94.358  1.00 11.75  ? 61  ALA C N     1 
ATOM   1826  C CA    . ALA C 3  64  ? 89.928  104.220 93.877  1.00 7.80   ? 61  ALA C CA    1 
ATOM   1827  C C     . ALA C 3  64  ? 89.820  105.610 94.440  1.00 14.25  ? 61  ALA C C     1 
ATOM   1828  O O     . ALA C 3  64  ? 89.494  106.528 93.694  1.00 18.93  ? 61  ALA C O     1 
ATOM   1829  C CB    . ALA C 3  64  ? 88.695  103.453 94.216  1.00 13.45  ? 61  ALA C CB    1 
ATOM   1830  N N     . GLU C 3  65  ? 90.160  105.829 95.706  1.00 13.88  ? 62  GLU C N     1 
ATOM   1831  C CA    . GLU C 3  65  ? 90.016  107.184 96.231  1.00 7.27   ? 62  GLU C CA    1 
ATOM   1832  C C     . GLU C 3  65  ? 90.936  108.178 95.594  1.00 14.78  ? 62  GLU C C     1 
ATOM   1833  O O     . GLU C 3  65  ? 90.523  109.291 95.265  1.00 19.45  ? 62  GLU C O     1 
ATOM   1834  C CB    . GLU C 3  65  ? 90.325  107.223 97.699  1.00 2.53   ? 62  GLU C CB    1 
ATOM   1835  C CG    . GLU C 3  65  ? 89.355  106.560 98.495  1.00 7.93   ? 62  GLU C CG    1 
ATOM   1836  C CD    . GLU C 3  65  ? 88.105  107.214 98.435  1.00 0.14   ? 62  GLU C CD    1 
ATOM   1837  O OE1   . GLU C 3  65  ? 88.053  108.358 98.798  1.00 4.70   ? 62  GLU C OE1   1 
ATOM   1838  O OE2   . GLU C 3  65  ? 87.165  106.614 97.978  1.00 2.88   ? 62  GLU C OE2   1 
ATOM   1839  N N     . ILE C 3  66  ? 92.163  107.790 95.337  1.00 16.39  ? 63  ILE C N     1 
ATOM   1840  C CA    . ILE C 3  66  ? 93.039  108.755 94.727  1.00 11.38  ? 63  ILE C CA    1 
ATOM   1841  C C     . ILE C 3  66  ? 92.580  109.063 93.346  1.00 18.10  ? 63  ILE C C     1 
ATOM   1842  O O     . ILE C 3  66  ? 92.602  110.219 92.933  1.00 22.87  ? 63  ILE C O     1 
ATOM   1843  C CB    . ILE C 3  66  ? 94.479  108.329 94.716  1.00 13.18  ? 63  ILE C CB    1 
ATOM   1844  C CG1   . ILE C 3  66  ? 94.946  108.316 96.101  1.00 13.98  ? 63  ILE C CG1   1 
ATOM   1845  C CG2   . ILE C 3  66  ? 95.291  109.291 93.859  1.00 19.97  ? 63  ILE C CG2   1 
ATOM   1846  C CD1   . ILE C 3  66  ? 96.236  107.661 96.302  1.00 6.54   ? 63  ILE C CD1   1 
ATOM   1847  N N     . LEU C 3  67  ? 92.202  108.051 92.595  1.00 18.71  ? 64  LEU C N     1 
ATOM   1848  C CA    . LEU C 3  67  ? 91.784  108.309 91.249  1.00 17.14  ? 64  LEU C CA    1 
ATOM   1849  C C     . LEU C 3  67  ? 90.543  109.145 91.217  1.00 21.63  ? 64  LEU C C     1 
ATOM   1850  O O     . LEU C 3  67  ? 90.393  109.985 90.331  1.00 27.14  ? 64  LEU C O     1 
ATOM   1851  C CB    . LEU C 3  67  ? 91.522  107.019 90.533  1.00 16.46  ? 64  LEU C CB    1 
ATOM   1852  C CG    . LEU C 3  67  ? 92.722  106.163 90.261  1.00 17.40  ? 64  LEU C CG    1 
ATOM   1853  C CD1   . LEU C 3  67  ? 92.224  104.873 89.754  1.00 23.39  ? 64  LEU C CD1   1 
ATOM   1854  C CD2   . LEU C 3  67  ? 93.661  106.804 89.256  1.00 23.63  ? 64  LEU C CD2   1 
ATOM   1855  N N     . GLU C 3  68  ? 89.626  108.946 92.145  1.00 19.71  ? 65  GLU C N     1 
ATOM   1856  C CA    . GLU C 3  68  ? 88.443  109.756 92.085  1.00 20.39  ? 65  GLU C CA    1 
ATOM   1857  C C     . GLU C 3  68  ? 88.752  111.199 92.305  1.00 24.99  ? 65  GLU C C     1 
ATOM   1858  O O     . GLU C 3  68  ? 88.281  112.067 91.557  1.00 30.71  ? 65  GLU C O     1 
ATOM   1859  C CB    . GLU C 3  68  ? 87.432  109.344 93.112  1.00 18.07  ? 65  GLU C CB    1 
ATOM   1860  C CG    . GLU C 3  68  ? 86.172  110.088 92.969  1.00 28.37  ? 65  GLU C CG    1 
ATOM   1861  C CD    . GLU C 3  68  ? 85.127  109.600 93.819  1.00 43.04  ? 65  GLU C CD    1 
ATOM   1862  O OE1   . GLU C 3  68  ? 85.361  108.672 94.528  1.00 44.13  ? 65  GLU C OE1   1 
ATOM   1863  O OE2   . GLU C 3  68  ? 84.063  110.149 93.784  1.00 50.30  ? 65  GLU C OE2   1 
ATOM   1864  N N     . LEU C 3  69  ? 89.566  111.479 93.299  1.00 23.91  ? 66  LEU C N     1 
ATOM   1865  C CA    . LEU C 3  69  ? 89.866  112.847 93.596  1.00 21.80  ? 66  LEU C CA    1 
ATOM   1866  C C     . LEU C 3  69  ? 90.687  113.481 92.491  1.00 25.16  ? 66  LEU C C     1 
ATOM   1867  O O     . LEU C 3  69  ? 90.476  114.649 92.154  1.00 30.03  ? 66  LEU C O     1 
ATOM   1868  C CB    . LEU C 3  69  ? 90.616  112.894 94.898  1.00 18.94  ? 66  LEU C CB    1 
ATOM   1869  C CG    . LEU C 3  69  ? 89.874  112.502 96.130  1.00 15.77  ? 66  LEU C CG    1 
ATOM   1870  C CD1   . LEU C 3  69  ? 90.866  112.403 97.240  1.00 21.23  ? 66  LEU C CD1   1 
ATOM   1871  C CD2   . LEU C 3  69  ? 88.825  113.496 96.467  1.00 29.91  ? 66  LEU C CD2   1 
ATOM   1872  N N     . ALA C 3  70  ? 91.620  112.736 91.910  1.00 23.04  ? 67  ALA C N     1 
ATOM   1873  C CA    . ALA C 3  70  ? 92.420  113.285 90.843  1.00 19.70  ? 67  ALA C CA    1 
ATOM   1874  C C     . ALA C 3  70  ? 91.571  113.559 89.634  1.00 20.19  ? 67  ALA C C     1 
ATOM   1875  O O     . ALA C 3  70  ? 91.793  114.549 88.940  1.00 25.45  ? 67  ALA C O     1 
ATOM   1876  C CB    . ALA C 3  70  ? 93.542  112.364 90.523  1.00 25.82  ? 67  ALA C CB    1 
ATOM   1877  N N     . GLY C 3  71  ? 90.595  112.708 89.362  1.00 22.15  ? 68  GLY C N     1 
ATOM   1878  C CA    . GLY C 3  71  ? 89.720  112.945 88.236  1.00 24.03  ? 68  GLY C CA    1 
ATOM   1879  C C     . GLY C 3  71  ? 88.918  114.214 88.448  1.00 25.58  ? 68  GLY C C     1 
ATOM   1880  O O     . GLY C 3  71  ? 88.689  114.974 87.501  1.00 32.89  ? 68  GLY C O     1 
ATOM   1881  N N     . ASN C 3  72  ? 88.511  114.486 89.687  1.00 26.84  ? 69  ASN C N     1 
ATOM   1882  C CA    . ASN C 3  72  ? 87.781  115.708 89.915  1.00 24.98  ? 69  ASN C CA    1 
ATOM   1883  C C     . ASN C 3  72  ? 88.688  116.896 89.695  1.00 26.47  ? 69  ASN C C     1 
ATOM   1884  O O     . ASN C 3  72  ? 88.260  117.899 89.123  1.00 34.55  ? 69  ASN C O     1 
ATOM   1885  C CB    . ASN C 3  72  ? 87.198  115.734 91.293  1.00 28.03  ? 69  ASN C CB    1 
ATOM   1886  C CG    . ASN C 3  72  ? 86.025  114.852 91.425  1.00 36.96  ? 69  ASN C CG    1 
ATOM   1887  O OD1   . ASN C 3  72  ? 85.357  114.526 90.445  1.00 41.48  ? 69  ASN C OD1   1 
ATOM   1888  N ND2   . ASN C 3  72  ? 85.733  114.447 92.626  1.00 38.75  ? 69  ASN C ND2   1 
ATOM   1889  N N     . ALA C 3  73  ? 89.957  116.781 90.080  1.00 22.35  ? 70  ALA C N     1 
ATOM   1890  C CA    . ALA C 3  73  ? 90.866  117.879 89.834  1.00 20.98  ? 70  ALA C CA    1 
ATOM   1891  C C     . ALA C 3  73  ? 91.001  118.113 88.337  1.00 24.56  ? 70  ALA C C     1 
ATOM   1892  O O     . ALA C 3  73  ? 91.050  119.259 87.880  1.00 34.23  ? 70  ALA C O     1 
ATOM   1893  C CB    . ALA C 3  73  ? 92.219  117.598 90.440  1.00 18.95  ? 70  ALA C CB    1 
ATOM   1894  N N     . ALA C 3  74  ? 91.033  117.039 87.554  1.00 22.46  ? 71  ALA C N     1 
ATOM   1895  C CA    . ALA C 3  74  ? 91.147  117.221 86.130  1.00 20.58  ? 71  ALA C CA    1 
ATOM   1896  C C     . ALA C 3  74  ? 89.960  117.964 85.593  1.00 24.54  ? 71  ALA C C     1 
ATOM   1897  O O     . ALA C 3  74  ? 90.129  118.875 84.785  1.00 42.53  ? 71  ALA C O     1 
ATOM   1898  C CB    . ALA C 3  74  ? 91.274  115.900 85.418  1.00 21.71  ? 71  ALA C CB    1 
ATOM   1899  N N     . ARG C 3  75  ? 88.764  117.675 86.089  1.00 24.49  ? 72  ARG C N     1 
ATOM   1900  C CA    . ARG C 3  75  ? 87.621  118.411 85.583  1.00 26.54  ? 72  ARG C CA    1 
ATOM   1901  C C     . ARG C 3  75  ? 87.679  119.867 85.981  1.00 32.34  ? 72  ARG C C     1 
ATOM   1902  O O     . ARG C 3  75  ? 87.360  120.738 85.179  1.00 34.65  ? 72  ARG C O     1 
ATOM   1903  C CB    . ARG C 3  75  ? 86.316  117.818 86.023  1.00 29.65  ? 72  ARG C CB    1 
ATOM   1904  C CG    . ARG C 3  75  ? 85.993  116.508 85.354  1.00 40.24  ? 72  ARG C CG    1 
ATOM   1905  C CD    . ARG C 3  75  ? 84.708  115.902 85.835  1.00 57.42  ? 72  ARG C CD    1 
ATOM   1906  N NE    . ARG C 3  75  ? 84.427  114.576 85.183  1.00 65.92  ? 72  ARG C NE    1 
ATOM   1907  C CZ    . ARG C 3  75  ? 83.433  113.720 85.549  1.00 64.88  ? 72  ARG C CZ    1 
ATOM   1908  N NH1   . ARG C 3  75  ? 82.632  114.057 86.537  1.00 65.84  ? 72  ARG C NH1   1 
ATOM   1909  N NH2   . ARG C 3  75  ? 83.251  112.548 84.930  1.00 50.92  ? 72  ARG C NH2   1 
ATOM   1910  N N     . ASP C 3  76  ? 88.179  120.177 87.167  1.00 33.78  ? 73  ASP C N     1 
ATOM   1911  C CA    . ASP C 3  76  ? 88.264  121.576 87.572  1.00 34.14  ? 73  ASP C CA    1 
ATOM   1912  C C     . ASP C 3  76  ? 89.158  122.369 86.629  1.00 36.37  ? 73  ASP C C     1 
ATOM   1913  O O     . ASP C 3  76  ? 88.909  123.546 86.371  1.00 40.65  ? 73  ASP C O     1 
ATOM   1914  C CB    . ASP C 3  76  ? 88.782  121.728 88.991  1.00 38.82  ? 73  ASP C CB    1 
ATOM   1915  C CG    . ASP C 3  76  ? 87.776  121.328 90.072  1.00 56.18  ? 73  ASP C CG    1 
ATOM   1916  O OD1   . ASP C 3  76  ? 86.610  121.164 89.785  1.00 52.68  ? 73  ASP C OD1   1 
ATOM   1917  O OD2   . ASP C 3  76  ? 88.194  121.216 91.199  1.00 56.39  ? 73  ASP C OD2   1 
ATOM   1918  N N     . ASN C 3  77  ? 90.167  121.721 86.060  1.00 33.59  ? 74  ASN C N     1 
ATOM   1919  C CA    . ASN C 3  77  ? 91.058  122.377 85.114  1.00 32.67  ? 74  ASN C CA    1 
ATOM   1920  C C     . ASN C 3  77  ? 90.571  122.205 83.680  1.00 32.83  ? 74  ASN C C     1 
ATOM   1921  O O     . ASN C 3  77  ? 91.257  122.596 82.737  1.00 38.33  ? 74  ASN C O     1 
ATOM   1922  C CB    . ASN C 3  77  ? 92.467  121.845 85.234  1.00 34.29  ? 74  ASN C CB    1 
ATOM   1923  C CG    . ASN C 3  77  ? 93.129  122.272 86.479  1.00 35.92  ? 74  ASN C CG    1 
ATOM   1924  O OD1   . ASN C 3  77  ? 92.852  123.365 86.978  1.00 43.73  ? 74  ASN C OD1   1 
ATOM   1925  N ND2   . ASN C 3  77  ? 94.014  121.465 87.014  1.00 37.35  ? 74  ASN C ND2   1 
ATOM   1926  N N     . LYS C 3  78  ? 89.383  121.636 83.529  1.00 32.44  ? 75  LYS C N     1 
ATOM   1927  C CA    . LYS C 3  78  ? 88.714  121.346 82.280  1.00 35.24  ? 75  LYS C CA    1 
ATOM   1928  C C     . LYS C 3  78  ? 89.499  120.454 81.345  1.00 36.60  ? 75  LYS C C     1 
ATOM   1929  O O     . LYS C 3  78  ? 89.528  120.670 80.135  1.00 34.64  ? 75  LYS C O     1 
ATOM   1930  C CB    . LYS C 3  78  ? 88.344  122.628 81.583  1.00 40.99  ? 75  LYS C CB    1 
ATOM   1931  C CG    . LYS C 3  78  ? 87.408  123.496 82.375  1.00 46.28  ? 75  LYS C CG    1 
ATOM   1932  C CD    . LYS C 3  78  ? 87.008  124.737 81.580  1.00 60.71  ? 75  LYS C CD    1 
ATOM   1933  C CE    . LYS C 3  78  ? 86.101  125.665 82.383  1.00 77.94  ? 75  LYS C CE    1 
ATOM   1934  N NZ    . LYS C 3  78  ? 85.758  126.904 81.620  1.00 84.81  ? 75  LYS C NZ    1 
ATOM   1935  N N     . LYS C 3  79  ? 90.105  119.435 81.907  1.00 35.17  ? 76  LYS C N     1 
ATOM   1936  C CA    . LYS C 3  79  ? 90.863  118.462 81.172  1.00 38.10  ? 76  LYS C CA    1 
ATOM   1937  C C     . LYS C 3  79  ? 90.231  117.108 81.324  1.00 39.93  ? 76  LYS C C     1 
ATOM   1938  O O     . LYS C 3  79  ? 89.472  116.880 82.259  1.00 38.44  ? 76  LYS C O     1 
ATOM   1939  C CB    . LYS C 3  79  ? 92.275  118.469 81.658  1.00 38.88  ? 76  LYS C CB    1 
ATOM   1940  C CG    . LYS C 3  79  ? 92.959  119.746 81.385  1.00 42.93  ? 76  LYS C CG    1 
ATOM   1941  C CD    . LYS C 3  79  ? 94.382  119.688 81.809  1.00 49.21  ? 76  LYS C CD    1 
ATOM   1942  C CE    . LYS C 3  79  ? 95.125  120.996 81.560  1.00 75.51  ? 76  LYS C CE    1 
ATOM   1943  N NZ    . LYS C 3  79  ? 95.374  121.259 80.112  1.00 154.64 ? 76  LYS C NZ    1 
ATOM   1944  N N     . THR C 3  80  ? 90.545  116.195 80.427  1.00 46.45  ? 77  THR C N     1 
ATOM   1945  C CA    . THR C 3  80  ? 89.996  114.854 80.480  1.00 44.76  ? 77  THR C CA    1 
ATOM   1946  C C     . THR C 3  80  ? 91.033  113.833 80.840  1.00 37.72  ? 77  THR C C     1 
ATOM   1947  O O     . THR C 3  80  ? 90.873  112.646 80.541  1.00 40.38  ? 77  THR C O     1 
ATOM   1948  C CB    . THR C 3  80  ? 89.370  114.467 79.156  1.00 55.84  ? 77  THR C CB    1 
ATOM   1949  O OG1   . THR C 3  80  ? 90.359  114.551 78.145  1.00 88.93  ? 77  THR C OG1   1 
ATOM   1950  C CG2   . THR C 3  80  ? 88.240  115.412 78.839  1.00 80.47  ? 77  THR C CG2   1 
ATOM   1951  N N     . ARG C 3  81  ? 92.134  114.288 81.395  1.00 35.01  ? 78  ARG C N     1 
ATOM   1952  C CA    . ARG C 3  81  ? 93.195  113.386 81.734  1.00 29.35  ? 78  ARG C CA    1 
ATOM   1953  C C     . ARG C 3  81  ? 93.861  113.652 83.072  1.00 24.55  ? 78  ARG C C     1 
ATOM   1954  O O     . ARG C 3  81  ? 94.035  114.801 83.483  1.00 33.07  ? 78  ARG C O     1 
ATOM   1955  C CB    . ARG C 3  81  ? 94.158  113.445 80.619  1.00 36.44  ? 78  ARG C CB    1 
ATOM   1956  C CG    . ARG C 3  81  ? 95.244  112.569 80.702  1.00 45.89  ? 78  ARG C CG    1 
ATOM   1957  C CD    . ARG C 3  81  ? 95.992  112.546 79.453  1.00 60.56  ? 78  ARG C CD    1 
ATOM   1958  N NE    . ARG C 3  81  ? 95.257  111.928 78.384  1.00 64.39  ? 78  ARG C NE    1 
ATOM   1959  C CZ    . ARG C 3  81  ? 95.630  111.956 77.117  1.00 108.50 ? 78  ARG C CZ    1 
ATOM   1960  N NH1   . ARG C 3  81  ? 96.743  112.560 76.775  1.00 149.41 ? 78  ARG C NH1   1 
ATOM   1961  N NH2   . ARG C 3  81  ? 94.886  111.385 76.201  1.00 124.88 ? 78  ARG C NH2   1 
ATOM   1962  N N     . ILE C 3  82  ? 94.264  112.588 83.734  1.00 24.24  ? 79  ILE C N     1 
ATOM   1963  C CA    . ILE C 3  82  ? 95.018  112.692 84.955  1.00 19.75  ? 79  ILE C CA    1 
ATOM   1964  C C     . ILE C 3  82  ? 96.502  112.750 84.654  1.00 27.38  ? 79  ILE C C     1 
ATOM   1965  O O     . ILE C 3  82  ? 97.035  111.945 83.895  1.00 28.71  ? 79  ILE C O     1 
ATOM   1966  C CB    . ILE C 3  82  ? 94.691  111.544 85.909  1.00 22.38  ? 79  ILE C CB    1 
ATOM   1967  C CG1   . ILE C 3  82  ? 93.229  111.638 86.302  1.00 23.24  ? 79  ILE C CG1   1 
ATOM   1968  C CG2   . ILE C 3  82  ? 95.614  111.580 87.117  1.00 27.14  ? 79  ILE C CG2   1 
ATOM   1969  C CD1   . ILE C 3  82  ? 92.694  110.437 87.028  1.00 28.45  ? 79  ILE C CD1   1 
ATOM   1970  N N     . ILE C 3  83  ? 97.159  113.737 85.223  1.00 24.17  ? 80  ILE C N     1 
ATOM   1971  C CA    . ILE C 3  83  ? 98.586  113.961 85.090  1.00 19.16  ? 80  ILE C CA    1 
ATOM   1972  C C     . ILE C 3  83  ? 99.111  114.041 86.522  1.00 21.69  ? 80  ILE C C     1 
ATOM   1973  O O     . ILE C 3  83  ? 98.300  114.318 87.406  1.00 22.76  ? 80  ILE C O     1 
ATOM   1974  C CB    . ILE C 3  83  ? 98.836  115.227 84.264  1.00 18.77  ? 80  ILE C CB    1 
ATOM   1975  C CG1   . ILE C 3  83  ? 98.265  116.416 84.966  1.00 27.08  ? 80  ILE C CG1   1 
ATOM   1976  C CG2   . ILE C 3  83  ? 98.182  115.041 82.922  1.00 12.68  ? 80  ILE C CG2   1 
ATOM   1977  C CD1   . ILE C 3  83  ? 98.637  117.745 84.400  1.00 25.66  ? 80  ILE C CD1   1 
ATOM   1978  N N     . PRO C 3  84  ? 100.420 113.936 86.798  1.00 17.32  ? 81  PRO C N     1 
ATOM   1979  C CA    . PRO C 3  84  ? 101.017 114.007 88.116  1.00 15.73  ? 81  PRO C CA    1 
ATOM   1980  C C     . PRO C 3  84  ? 100.551 115.184 88.930  1.00 22.56  ? 81  PRO C C     1 
ATOM   1981  O O     . PRO C 3  84  ? 100.415 115.086 90.148  1.00 25.12  ? 81  PRO C O     1 
ATOM   1982  C CB    . PRO C 3  84  ? 102.479 114.134 87.786  1.00 14.36  ? 81  PRO C CB    1 
ATOM   1983  C CG    . PRO C 3  84  ? 102.612 113.408 86.521  1.00 18.23  ? 81  PRO C CG    1 
ATOM   1984  C CD    . PRO C 3  84  ? 101.386 113.723 85.754  1.00 21.05  ? 81  PRO C CD    1 
ATOM   1985  N N     . ARG C 3  85  ? 100.253 116.293 88.292  1.00 24.26  ? 82  ARG C N     1 
ATOM   1986  C CA    . ARG C 3  85  ? 99.787  117.406 89.061  1.00 21.80  ? 82  ARG C CA    1 
ATOM   1987  C C     . ARG C 3  85  ? 98.440  117.151 89.693  1.00 24.45  ? 82  ARG C C     1 
ATOM   1988  O O     . ARG C 3  85  ? 98.163  117.627 90.790  1.00 27.74  ? 82  ARG C O     1 
ATOM   1989  C CB    . ARG C 3  85  ? 99.668  118.628 88.214  1.00 26.38  ? 82  ARG C CB    1 
ATOM   1990  C CG    . ARG C 3  85  ? 99.160  119.824 88.913  1.00 29.88  ? 82  ARG C CG    1 
ATOM   1991  C CD    . ARG C 3  85  ? 100.058 120.205 89.988  1.00 31.67  ? 82  ARG C CD    1 
ATOM   1992  N NE    . ARG C 3  85  ? 99.628  121.301 90.732  1.00 33.76  ? 82  ARG C NE    1 
ATOM   1993  C CZ    . ARG C 3  85  ? 99.774  122.532 90.387  1.00 33.46  ? 82  ARG C CZ    1 
ATOM   1994  N NH1   . ARG C 3  85  ? 100.298 122.810 89.243  1.00 32.27  ? 82  ARG C NH1   1 
ATOM   1995  N NH2   . ARG C 3  85  ? 99.391  123.467 91.199  1.00 32.44  ? 82  ARG C NH2   1 
ATOM   1996  N N     . HIS C 3  86  ? 97.575  116.432 89.010  1.00 22.63  ? 83  HIS C N     1 
ATOM   1997  C CA    . HIS C 3  86  ? 96.249  116.215 89.510  1.00 18.32  ? 83  HIS C CA    1 
ATOM   1998  C C     . HIS C 3  86  ? 96.337  115.263 90.661  1.00 24.51  ? 83  HIS C C     1 
ATOM   1999  O O     . HIS C 3  86  ? 95.570  115.362 91.616  1.00 26.65  ? 83  HIS C O     1 
ATOM   2000  C CB    . HIS C 3  86  ? 95.359  115.717 88.387  1.00 19.51  ? 83  HIS C CB    1 
ATOM   2001  C CG    . HIS C 3  86  ? 95.159  116.794 87.370  1.00 21.58  ? 83  HIS C CG    1 
ATOM   2002  N ND1   . HIS C 3  86  ? 94.777  116.573 86.051  1.00 22.70  ? 83  HIS C ND1   1 
ATOM   2003  C CD2   . HIS C 3  86  ? 95.291  118.110 87.499  1.00 28.71  ? 83  HIS C CD2   1 
ATOM   2004  C CE1   . HIS C 3  86  ? 94.705  117.724 85.434  1.00 23.97  ? 83  HIS C CE1   1 
ATOM   2005  N NE2   . HIS C 3  86  ? 95.001  118.676 86.292  1.00 31.85  ? 83  HIS C NE2   1 
ATOM   2006  N N     . LEU C 3  87  ? 97.292  114.351 90.604  1.00 25.50  ? 84  LEU C N     1 
ATOM   2007  C CA    . LEU C 3  87  ? 97.442  113.436 91.715  1.00 21.95  ? 84  LEU C CA    1 
ATOM   2008  C C     . LEU C 3  87  ? 97.922  114.206 92.937  1.00 23.66  ? 84  LEU C C     1 
ATOM   2009  O O     . LEU C 3  87  ? 97.422  113.989 94.037  1.00 29.91  ? 84  LEU C O     1 
ATOM   2010  C CB    . LEU C 3  87  ? 98.436  112.332 91.375  1.00 21.44  ? 84  LEU C CB    1 
ATOM   2011  C CG    . LEU C 3  87  ? 98.015  111.338 90.272  1.00 19.33  ? 84  LEU C CG    1 
ATOM   2012  C CD1   . LEU C 3  87  ? 99.177  110.474 89.927  1.00 19.86  ? 84  LEU C CD1   1 
ATOM   2013  C CD2   . LEU C 3  87  ? 96.895  110.470 90.728  1.00 20.87  ? 84  LEU C CD2   1 
ATOM   2014  N N     . GLN C 3  88  ? 98.833  115.162 92.756  1.00 23.20  ? 85  GLN C N     1 
ATOM   2015  C CA    . GLN C 3  88  ? 99.316  115.943 93.893  1.00 19.18  ? 85  GLN C CA    1 
ATOM   2016  C C     . GLN C 3  88  ? 98.251  116.791 94.522  1.00 23.02  ? 85  GLN C C     1 
ATOM   2017  O O     . GLN C 3  88  ? 98.185  116.923 95.743  1.00 27.55  ? 85  GLN C O     1 
ATOM   2018  C CB    . GLN C 3  88  ? 100.379 116.905 93.437  1.00 23.48  ? 85  GLN C CB    1 
ATOM   2019  C CG    . GLN C 3  88  ? 101.051 117.781 94.461  1.00 21.86  ? 85  GLN C CG    1 
ATOM   2020  C CD    . GLN C 3  88  ? 101.872 117.098 95.371  1.00 26.97  ? 85  GLN C CD    1 
ATOM   2021  O OE1   . GLN C 3  88  ? 101.462 116.146 96.002  1.00 32.49  ? 85  GLN C OE1   1 
ATOM   2022  N NE2   . GLN C 3  88  ? 103.109 117.542 95.482  1.00 27.03  ? 85  GLN C NE2   1 
ATOM   2023  N N     . LEU C 3  89  ? 97.397  117.383 93.717  1.00 25.55  ? 86  LEU C N     1 
ATOM   2024  C CA    . LEU C 3  89  ? 96.378  118.204 94.309  1.00 22.27  ? 86  LEU C CA    1 
ATOM   2025  C C     . LEU C 3  89  ? 95.366  117.336 95.006  1.00 23.96  ? 86  LEU C C     1 
ATOM   2026  O O     . LEU C 3  89  ? 94.902  117.661 96.098  1.00 29.54  ? 86  LEU C O     1 
ATOM   2027  C CB    . LEU C 3  89  ? 95.700  119.034 93.244  1.00 23.11  ? 86  LEU C CB    1 
ATOM   2028  C CG    . LEU C 3  89  ? 96.567  120.093 92.565  1.00 26.68  ? 86  LEU C CG    1 
ATOM   2029  C CD1   . LEU C 3  89  ? 95.796  120.683 91.415  1.00 30.62  ? 86  LEU C CD1   1 
ATOM   2030  C CD2   . LEU C 3  89  ? 96.972  121.167 93.541  1.00 31.53  ? 86  LEU C CD2   1 
ATOM   2031  N N     . ALA C 3  90  ? 95.054  116.186 94.431  1.00 27.03  ? 87  ALA C N     1 
ATOM   2032  C CA    . ALA C 3  90  ? 94.086  115.314 95.047  1.00 25.71  ? 87  ALA C CA    1 
ATOM   2033  C C     . ALA C 3  90  ? 94.508  114.887 96.421  1.00 22.37  ? 87  ALA C C     1 
ATOM   2034  O O     . ALA C 3  90  ? 93.717  114.908 97.357  1.00 26.20  ? 87  ALA C O     1 
ATOM   2035  C CB    . ALA C 3  90  ? 93.935  114.085 94.206  1.00 31.06  ? 87  ALA C CB    1 
ATOM   2036  N N     . ILE C 3  91  ? 95.779  114.615 96.575  1.00 20.78  ? 88  ILE C N     1 
ATOM   2037  C CA    . ILE C 3  91  ? 96.300  114.198 97.840  1.00 17.25  ? 88  ILE C CA    1 
ATOM   2038  C C     . ILE C 3  91  ? 96.403  115.326 98.820  1.00 19.50  ? 88  ILE C C     1 
ATOM   2039  O O     . ILE C 3  91  ? 96.027  115.180 99.972  1.00 26.19  ? 88  ILE C O     1 
ATOM   2040  C CB    . ILE C 3  91  ? 97.656  113.563 97.643  1.00 17.66  ? 88  ILE C CB    1 
ATOM   2041  C CG1   . ILE C 3  91  ? 97.458  112.288 96.858  1.00 25.80  ? 88  ILE C CG1   1 
ATOM   2042  C CG2   . ILE C 3  91  ? 98.306  113.293 99.010  1.00 21.06  ? 88  ILE C CG2   1 
ATOM   2043  C CD1   . ILE C 3  91  ? 98.698  111.729 96.284  1.00 26.06  ? 88  ILE C CD1   1 
ATOM   2044  N N     . ARG C 3  92  ? 96.927  116.458 98.420  1.00 21.24  ? 89  ARG C N     1 
ATOM   2045  C CA    . ARG C 3  92  ? 97.142  117.477 99.416  1.00 20.20  ? 89  ARG C CA    1 
ATOM   2046  C C     . ARG C 3  92  ? 95.900  118.221 99.858  1.00 21.69  ? 89  ARG C C     1 
ATOM   2047  O O     . ARG C 3  92  ? 95.901  118.839 100.918 1.00 23.64  ? 89  ARG C O     1 
ATOM   2048  C CB    . ARG C 3  92  ? 98.159  118.418 98.922  1.00 21.68  ? 89  ARG C CB    1 
ATOM   2049  C CG    . ARG C 3  92  ? 99.529  117.804 98.669  1.00 26.14  ? 89  ARG C CG    1 
ATOM   2050  C CD    . ARG C 3  92  ? 100.193 117.340 99.875  1.00 33.71  ? 89  ARG C CD    1 
ATOM   2051  N NE    . ARG C 3  92  ? 101.613 116.981 99.651  1.00 41.08  ? 89  ARG C NE    1 
ATOM   2052  C CZ    . ARG C 3  92  ? 102.137 115.733 99.455  1.00 34.33  ? 89  ARG C CZ    1 
ATOM   2053  N NH1   . ARG C 3  92  ? 101.414 114.670 99.462  1.00 26.17  ? 89  ARG C NH1   1 
ATOM   2054  N NH2   . ARG C 3  92  ? 103.428 115.617 99.258  1.00 33.05  ? 89  ARG C NH2   1 
ATOM   2055  N N     . ASN C 3  93  ? 94.814  118.119 99.118  1.00 22.04  ? 90  ASN C N     1 
ATOM   2056  C CA    . ASN C 3  93  ? 93.583  118.756 99.531  1.00 21.23  ? 90  ASN C CA    1 
ATOM   2057  C C     . ASN C 3  93  ? 92.654  117.792 100.269 1.00 25.31  ? 90  ASN C C     1 
ATOM   2058  O O     . ASN C 3  93  ? 91.481  118.097 100.477 1.00 34.05  ? 90  ASN C O     1 
ATOM   2059  C CB    . ASN C 3  93  ? 92.886  119.378 98.359  1.00 22.22  ? 90  ASN C CB    1 
ATOM   2060  C CG    . ASN C 3  93  ? 93.593  120.566 97.867  1.00 29.43  ? 90  ASN C CG    1 
ATOM   2061  O OD1   . ASN C 3  93  ? 94.100  121.372 98.646  1.00 39.80  ? 90  ASN C OD1   1 
ATOM   2062  N ND2   . ASN C 3  93  ? 93.641  120.719 96.582  1.00 38.97  ? 90  ASN C ND2   1 
ATOM   2063  N N     . ASP C 3  94  ? 93.172  116.636 100.677 1.00 24.44  ? 91  ASP C N     1 
ATOM   2064  C CA    . ASP C 3  94  ? 92.419  115.617 101.401 1.00 24.22  ? 91  ASP C CA    1 
ATOM   2065  C C     . ASP C 3  94  ? 93.212  115.210 102.630 1.00 25.54  ? 91  ASP C C     1 
ATOM   2066  O O     . ASP C 3  94  ? 94.341  114.749 102.518 1.00 27.83  ? 91  ASP C O     1 
ATOM   2067  C CB    . ASP C 3  94  ? 92.164  114.428 100.482 1.00 26.05  ? 91  ASP C CB    1 
ATOM   2068  C CG    . ASP C 3  94  ? 91.367  113.294 101.111 1.00 36.61  ? 91  ASP C CG    1 
ATOM   2069  O OD1   . ASP C 3  94  ? 90.167  113.252 100.930 1.00 40.82  ? 91  ASP C OD1   1 
ATOM   2070  O OD2   . ASP C 3  94  ? 91.981  112.449 101.770 1.00 30.32  ? 91  ASP C OD2   1 
ATOM   2071  N N     . GLU C 3  95  ? 92.670  115.430 103.812 1.00 27.07  ? 92  GLU C N     1 
ATOM   2072  C CA    . GLU C 3  95  ? 93.446  115.207 105.018 1.00 25.55  ? 92  GLU C CA    1 
ATOM   2073  C C     . GLU C 3  95  ? 93.893  113.797 105.270 1.00 27.57  ? 92  GLU C C     1 
ATOM   2074  O O     . GLU C 3  95  ? 95.018  113.582 105.725 1.00 30.30  ? 92  GLU C O     1 
ATOM   2075  C CB    . GLU C 3  95  ? 92.648  115.626 106.215 1.00 32.29  ? 92  GLU C CB    1 
ATOM   2076  C CG    . GLU C 3  95  ? 92.404  117.075 106.305 1.00 44.89  ? 92  GLU C CG    1 
ATOM   2077  C CD    . GLU C 3  95  ? 91.306  117.534 105.423 1.00 64.20  ? 92  GLU C CD    1 
ATOM   2078  O OE1   . GLU C 3  95  ? 90.700  116.713 104.775 1.00 45.32  ? 92  GLU C OE1   1 
ATOM   2079  O OE2   . GLU C 3  95  ? 91.059  118.708 105.390 1.00 66.17  ? 92  GLU C OE2   1 
ATOM   2080  N N     . GLU C 3  96  ? 93.061  112.821 105.020 1.00 22.95  ? 93  GLU C N     1 
ATOM   2081  C CA    . GLU C 3  96  ? 93.534  111.507 105.314 1.00 18.17  ? 93  GLU C CA    1 
ATOM   2082  C C     . GLU C 3  96  ? 94.625  111.107 104.364 1.00 17.95  ? 93  GLU C C     1 
ATOM   2083  O O     . GLU C 3  96  ? 95.644  110.554 104.793 1.00 22.29  ? 93  GLU C O     1 
ATOM   2084  C CB    . GLU C 3  96  ? 92.417  110.525 105.269 1.00 20.73  ? 93  GLU C CB    1 
ATOM   2085  C CG    . GLU C 3  96  ? 91.422  110.700 106.340 1.00 23.26  ? 93  GLU C CG    1 
ATOM   2086  C CD    . GLU C 3  96  ? 90.466  111.717 106.049 1.00 35.06  ? 93  GLU C CD    1 
ATOM   2087  O OE1   . GLU C 3  96  ? 90.536  112.275 104.996 1.00 34.97  ? 93  GLU C OE1   1 
ATOM   2088  O OE2   . GLU C 3  96  ? 89.628  111.959 106.867 1.00 40.83  ? 93  GLU C OE2   1 
ATOM   2089  N N     . LEU C 3  97  ? 94.471  111.408 103.078 1.00 16.72  ? 94  LEU C N     1 
ATOM   2090  C CA    . LEU C 3  97  ? 95.539  111.023 102.195 1.00 13.30  ? 94  LEU C CA    1 
ATOM   2091  C C     . LEU C 3  97  ? 96.771  111.829 102.488 1.00 14.67  ? 94  LEU C C     1 
ATOM   2092  O O     . LEU C 3  97  ? 97.873  111.290 102.517 1.00 21.65  ? 94  LEU C O     1 
ATOM   2093  C CB    . LEU C 3  97  ? 95.161  111.193 100.746 1.00 12.22  ? 94  LEU C CB    1 
ATOM   2094  C CG    . LEU C 3  97  ? 94.131  110.255 100.182 1.00 12.50  ? 94  LEU C CG    1 
ATOM   2095  C CD1   . LEU C 3  97  ? 93.776  110.749 98.823  1.00 23.12  ? 94  LEU C CD1   1 
ATOM   2096  C CD2   . LEU C 3  97  ? 94.685  108.825 100.089 1.00 17.99  ? 94  LEU C CD2   1 
ATOM   2097  N N     . ASN C 3  98  ? 96.619  113.097 102.817 1.00 15.93  ? 95  ASN C N     1 
ATOM   2098  C CA    . ASN C 3  98  ? 97.774  113.896 103.097 1.00 15.41  ? 95  ASN C CA    1 
ATOM   2099  C C     . ASN C 3  98  ? 98.579  113.315 104.228 1.00 18.90  ? 95  ASN C C     1 
ATOM   2100  O O     . ASN C 3  98  ? 99.793  113.437 104.228 1.00 24.61  ? 95  ASN C O     1 
ATOM   2101  C CB    . ASN C 3  98  ? 97.381  115.302 103.409 1.00 17.35  ? 95  ASN C CB    1 
ATOM   2102  C CG    . ASN C 3  98  ? 98.526  116.160 103.576 1.00 21.31  ? 95  ASN C CG    1 
ATOM   2103  O OD1   . ASN C 3  98  ? 99.317  116.337 102.665 1.00 28.21  ? 95  ASN C OD1   1 
ATOM   2104  N ND2   . ASN C 3  98  ? 98.666  116.711 104.740 1.00 35.09  ? 95  ASN C ND2   1 
ATOM   2105  N N     . LYS C 3  99  ? 97.942  112.714 105.221 1.00 19.25  ? 96  LYS C N     1 
ATOM   2106  C CA    . LYS C 3  99  ? 98.726  112.121 106.283 1.00 19.71  ? 96  LYS C CA    1 
ATOM   2107  C C     . LYS C 3  99  ? 99.400  110.846 105.825 1.00 25.50  ? 96  LYS C C     1 
ATOM   2108  O O     . LYS C 3  99  ? 100.599 110.645 106.020 1.00 36.63  ? 96  LYS C O     1 
ATOM   2109  C CB    . LYS C 3  99  ? 97.854  111.785 107.451 1.00 20.46  ? 96  LYS C CB    1 
ATOM   2110  C CG    . LYS C 3  99  ? 97.358  112.937 108.174 1.00 28.48  ? 96  LYS C CG    1 
ATOM   2111  C CD    . LYS C 3  99  ? 96.431  112.528 109.296 1.00 32.91  ? 96  LYS C CD    1 
ATOM   2112  C CE    . LYS C 3  99  ? 95.842  113.746 110.000 1.00 45.91  ? 96  LYS C CE    1 
ATOM   2113  N NZ    . LYS C 3  99  ? 94.855  113.374 111.059 1.00 25.69  ? 96  LYS C NZ    1 
ATOM   2114  N N     . LEU C 3  100 ? 98.659  110.021 105.104 1.00 21.26  ? 97  LEU C N     1 
ATOM   2115  C CA    . LEU C 3  100 ? 99.147  108.728 104.665 1.00 18.00  ? 97  LEU C CA    1 
ATOM   2116  C C     . LEU C 3  100 ? 100.355 108.872 103.765 1.00 22.56  ? 97  LEU C C     1 
ATOM   2117  O O     . LEU C 3  100 ? 101.297 108.070 103.809 1.00 32.34  ? 97  LEU C O     1 
ATOM   2118  C CB    . LEU C 3  100 ? 98.019  108.020 103.912 1.00 14.82  ? 97  LEU C CB    1 
ATOM   2119  C CG    . LEU C 3  100 ? 98.270  106.636 103.373 1.00 14.01  ? 97  LEU C CG    1 
ATOM   2120  C CD1   . LEU C 3  100 ? 98.591  105.705 104.479 1.00 19.20  ? 97  LEU C CD1   1 
ATOM   2121  C CD2   . LEU C 3  100 ? 97.042  106.191 102.628 1.00 16.56  ? 97  LEU C CD2   1 
ATOM   2122  N N     . LEU C 3  101 ? 100.306 109.878 102.918 1.00 20.73  ? 98  LEU C N     1 
ATOM   2123  C CA    . LEU C 3  101 ? 101.321 110.178 101.946 1.00 17.91  ? 98  LEU C CA    1 
ATOM   2124  C C     . LEU C 3  101 ? 102.085 111.439 102.295 1.00 19.71  ? 98  LEU C C     1 
ATOM   2125  O O     . LEU C 3  101 ? 102.665 112.085 101.427 1.00 23.04  ? 98  LEU C O     1 
ATOM   2126  C CB    . LEU C 3  101 ? 100.646 110.293 100.600 1.00 10.80  ? 98  LEU C CB    1 
ATOM   2127  C CG    . LEU C 3  101 ? 99.914  109.032 100.168 1.00 12.67  ? 98  LEU C CG    1 
ATOM   2128  C CD1   . LEU C 3  101 ? 99.174  109.308 98.937  1.00 16.76  ? 98  LEU C CD1   1 
ATOM   2129  C CD2   . LEU C 3  101 ? 100.896 107.891 99.945  1.00 22.60  ? 98  LEU C CD2   1 
ATOM   2130  N N     . GLY C 3  102 ? 102.100 111.813 103.560 1.00 20.56  ? 99  GLY C N     1 
ATOM   2131  C CA    . GLY C 3  102 ? 102.724 113.056 103.990 1.00 20.13  ? 99  GLY C CA    1 
ATOM   2132  C C     . GLY C 3  102 ? 104.198 113.211 103.662 1.00 17.73  ? 99  GLY C C     1 
ATOM   2133  O O     . GLY C 3  102 ? 104.680 114.325 103.470 1.00 22.60  ? 99  GLY C O     1 
ATOM   2134  N N     . ARG C 3  103 ? 104.936 112.120 103.602 1.00 17.73  ? 100 ARG C N     1 
ATOM   2135  C CA    . ARG C 3  103 ? 106.355 112.208 103.306 1.00 19.36  ? 100 ARG C CA    1 
ATOM   2136  C C     . ARG C 3  103 ? 106.690 111.963 101.860 1.00 19.25  ? 100 ARG C C     1 
ATOM   2137  O O     . ARG C 3  103 ? 107.860 111.941 101.497 1.00 19.06  ? 100 ARG C O     1 
ATOM   2138  C CB    . ARG C 3  103 ? 107.115 111.179 104.083 1.00 22.49  ? 100 ARG C CB    1 
ATOM   2139  C CG    . ARG C 3  103 ? 106.963 111.225 105.558 1.00 29.85  ? 100 ARG C CG    1 
ATOM   2140  C CD    . ARG C 3  103 ? 107.561 112.397 106.142 1.00 38.14  ? 100 ARG C CD    1 
ATOM   2141  N NE    . ARG C 3  103 ? 108.983 112.437 105.914 1.00 39.91  ? 100 ARG C NE    1 
ATOM   2142  C CZ    . ARG C 3  103 ? 109.784 113.450 106.226 1.00 48.87  ? 100 ARG C CZ    1 
ATOM   2143  N NH1   . ARG C 3  103 ? 109.333 114.553 106.791 1.00 54.29  ? 100 ARG C NH1   1 
ATOM   2144  N NH2   . ARG C 3  103 ? 111.032 113.298 105.949 1.00 30.91  ? 100 ARG C NH2   1 
ATOM   2145  N N     . VAL C 3  104 ? 105.693 111.739 101.041 1.00 17.20  ? 101 VAL C N     1 
ATOM   2146  C CA    . VAL C 3  104 ? 105.941 111.382 99.675  1.00 9.50   ? 101 VAL C CA    1 
ATOM   2147  C C     . VAL C 3  104 ? 106.153 112.520 98.721  1.00 14.30  ? 101 VAL C C     1 
ATOM   2148  O O     . VAL C 3  104 ? 105.350 113.451 98.611  1.00 22.88  ? 101 VAL C O     1 
ATOM   2149  C CB    . VAL C 3  104 ? 104.791 110.540 99.182  1.00 10.09  ? 101 VAL C CB    1 
ATOM   2150  C CG1   . VAL C 3  104 ? 104.927 110.233 97.752  1.00 19.87  ? 101 VAL C CG1   1 
ATOM   2151  C CG2   . VAL C 3  104 ? 104.773 109.282 99.958  1.00 16.48  ? 101 VAL C CG2   1 
ATOM   2152  N N     . THR C 3  105 ? 107.220 112.403 97.962  1.00 14.08  ? 102 THR C N     1 
ATOM   2153  C CA    . THR C 3  105 ? 107.525 113.355 96.935  1.00 12.06  ? 102 THR C CA    1 
ATOM   2154  C C     . THR C 3  105 ? 106.994 112.795 95.650  1.00 14.45  ? 102 THR C C     1 
ATOM   2155  O O     . THR C 3  105 ? 107.339 111.683 95.265  1.00 13.30  ? 102 THR C O     1 
ATOM   2156  C CB    . THR C 3  105 ? 109.035 113.572 96.804  1.00 11.28  ? 102 THR C CB    1 
ATOM   2157  O OG1   . THR C 3  105 ? 109.543 114.089 98.023  1.00 18.68  ? 102 THR C OG1   1 
ATOM   2158  C CG2   . THR C 3  105 ? 109.346 114.525 95.668  1.00 13.40  ? 102 THR C CG2   1 
ATOM   2159  N N     . ILE C 3  106 ? 106.168 113.545 94.976  1.00 14.59  ? 103 ILE C N     1 
ATOM   2160  C CA    . ILE C 3  106 ? 105.633 113.074 93.727  1.00 10.87  ? 103 ILE C CA    1 
ATOM   2161  C C     . ILE C 3  106 ? 106.332 113.768 92.621  1.00 13.04  ? 103 ILE C C     1 
ATOM   2162  O O     . ILE C 3  106 ? 106.257 114.995 92.531  1.00 19.85  ? 103 ILE C O     1 
ATOM   2163  C CB    . ILE C 3  106 ? 104.130 113.305 93.654  1.00 12.53  ? 103 ILE C CB    1 
ATOM   2164  C CG1   . ILE C 3  106 ? 103.483 112.509 94.763  1.00 16.43  ? 103 ILE C CG1   1 
ATOM   2165  C CG2   . ILE C 3  106 ? 103.614 112.962 92.313  1.00 15.40  ? 103 ILE C CG2   1 
ATOM   2166  C CD1   . ILE C 3  106 ? 102.033 112.745 94.958  1.00 26.04  ? 103 ILE C CD1   1 
ATOM   2167  N N     . ALA C 3  107 ? 107.031 113.009 91.801  1.00 11.30  ? 104 ALA C N     1 
ATOM   2168  C CA    . ALA C 3  107 ? 107.796 113.626 90.766  1.00 7.55   ? 104 ALA C CA    1 
ATOM   2169  C C     . ALA C 3  107 ? 106.893 114.415 89.884  1.00 14.22  ? 104 ALA C C     1 
ATOM   2170  O O     . ALA C 3  107 ? 105.886 113.894 89.425  1.00 18.27  ? 104 ALA C O     1 
ATOM   2171  C CB    . ALA C 3  107 ? 108.501 112.568 89.972  1.00 7.49   ? 104 ALA C CB    1 
ATOM   2172  N N     . GLN C 3  108 ? 107.281 115.653 89.589  1.00 14.59  ? 105 GLN C N     1 
ATOM   2173  C CA    . GLN C 3  108 ? 106.537 116.555 88.718  1.00 11.29  ? 105 GLN C CA    1 
ATOM   2174  C C     . GLN C 3  108 ? 105.171 116.911 89.251  1.00 15.36  ? 105 GLN C C     1 
ATOM   2175  O O     . GLN C 3  108 ? 104.309 117.357 88.499  1.00 19.75  ? 105 GLN C O     1 
ATOM   2176  C CB    . GLN C 3  108 ? 106.344 115.918 87.360  1.00 9.69   ? 105 GLN C CB    1 
ATOM   2177  C CG    . GLN C 3  108 ? 107.592 115.536 86.722  1.00 13.49  ? 105 GLN C CG    1 
ATOM   2178  C CD    . GLN C 3  108 ? 108.300 116.694 86.305  1.00 20.90  ? 105 GLN C CD    1 
ATOM   2179  O OE1   . GLN C 3  108 ? 107.828 117.366 85.393  1.00 16.32  ? 105 GLN C OE1   1 
ATOM   2180  N NE2   . GLN C 3  108 ? 109.421 117.025 86.935  1.00 30.62  ? 105 GLN C NE2   1 
ATOM   2181  N N     . GLY C 3  109 ? 104.957 116.719 90.539  1.00 16.73  ? 106 GLY C N     1 
ATOM   2182  C CA    . GLY C 3  109 ? 103.678 117.025 91.135  1.00 22.67  ? 106 GLY C CA    1 
ATOM   2183  C C     . GLY C 3  109 ? 103.422 118.495 91.379  1.00 26.33  ? 106 GLY C C     1 
ATOM   2184  O O     . GLY C 3  109 ? 102.272 118.897 91.479  1.00 31.28  ? 106 GLY C O     1 
ATOM   2185  N N     . GLY C 3  110 ? 104.458 119.298 91.523  1.00 23.67  ? 107 GLY C N     1 
ATOM   2186  C CA    . GLY C 3  110 ? 104.249 120.707 91.824  1.00 27.42  ? 107 GLY C CA    1 
ATOM   2187  C C     . GLY C 3  110 ? 103.916 120.914 93.294  1.00 33.22  ? 107 GLY C C     1 
ATOM   2188  O O     . GLY C 3  110 ? 104.092 120.015 94.125  1.00 37.85  ? 107 GLY C O     1 
ATOM   2189  N N     . VAL C 3  111 ? 103.459 122.123 93.613  1.00 31.43  ? 108 VAL C N     1 
ATOM   2190  C CA    . VAL C 3  111 ? 103.125 122.544 94.970  1.00 30.80  ? 108 VAL C CA    1 
ATOM   2191  C C     . VAL C 3  111 ? 101.751 123.164 94.978  1.00 33.67  ? 108 VAL C C     1 
ATOM   2192  O O     . VAL C 3  111 ? 101.199 123.446 93.920  1.00 34.99  ? 108 VAL C O     1 
ATOM   2193  C CB    . VAL C 3  111 ? 104.123 123.556 95.511  1.00 27.94  ? 108 VAL C CB    1 
ATOM   2194  C CG1   . VAL C 3  111 ? 105.487 122.958 95.540  1.00 30.72  ? 108 VAL C CG1   1 
ATOM   2195  C CG2   . VAL C 3  111 ? 104.093 124.799 94.661  1.00 27.01  ? 108 VAL C CG2   1 
ATOM   2196  N N     . LEU C 3  112 ? 101.183 123.372 96.151  1.00 34.97  ? 109 LEU C N     1 
ATOM   2197  C CA    . LEU C 3  112 ? 99.898  124.036 96.199  1.00 38.39  ? 109 LEU C CA    1 
ATOM   2198  C C     . LEU C 3  112 ? 100.091 125.545 96.289  1.00 41.80  ? 109 LEU C C     1 
ATOM   2199  O O     . LEU C 3  112 ? 101.029 126.003 96.943  1.00 44.81  ? 109 LEU C O     1 
ATOM   2200  C CB    . LEU C 3  112 ? 99.074  123.497 97.355  1.00 40.25  ? 109 LEU C CB    1 
ATOM   2201  C CG    . LEU C 3  112 ? 98.249  122.251 97.023  1.00 36.33  ? 109 LEU C CG    1 
ATOM   2202  C CD1   . LEU C 3  112 ? 99.153  121.062 96.690  1.00 40.56  ? 109 LEU C CD1   1 
ATOM   2203  C CD2   . LEU C 3  112 ? 97.364  121.936 98.185  1.00 36.78  ? 109 LEU C CD2   1 
ATOM   2204  N N     . PRO C 3  113 ? 99.176  126.351 95.730  1.00 36.37  ? 110 PRO C N     1 
ATOM   2205  C CA    . PRO C 3  113 ? 99.244  127.795 95.650  1.00 41.91  ? 110 PRO C CA    1 
ATOM   2206  C C     . PRO C 3  113 ? 98.941  128.528 96.937  1.00 49.01  ? 110 PRO C C     1 
ATOM   2207  O O     . PRO C 3  113 ? 97.946  129.246 97.040  1.00 47.77  ? 110 PRO C O     1 
ATOM   2208  C CB    . PRO C 3  113 ? 98.199  128.089 94.584  1.00 39.28  ? 110 PRO C CB    1 
ATOM   2209  C CG    . PRO C 3  113 ? 97.193  127.011 94.763  1.00 38.80  ? 110 PRO C CG    1 
ATOM   2210  C CD    . PRO C 3  113 ? 97.988  125.790 95.100  1.00 38.37  ? 110 PRO C CD    1 
ATOM   2211  N N     . ASN C 3  114 ? 99.810  128.329 97.908  1.00 49.04  ? 111 ASN C N     1 
ATOM   2212  C CA    . ASN C 3  114 ? 99.690  128.956 99.209  1.00 52.30  ? 111 ASN C CA    1 
ATOM   2213  C C     . ASN C 3  114 ? 100.532 130.222 99.355  1.00 50.76  ? 111 ASN C C     1 
ATOM   2214  O O     . ASN C 3  114 ? 101.759 130.158 99.485  1.00 44.77  ? 111 ASN C O     1 
ATOM   2215  C CB    . ASN C 3  114 ? 100.075 127.974 100.284 1.00 55.44  ? 111 ASN C CB    1 
ATOM   2216  C CG    . ASN C 3  114 ? 99.152  126.815 100.357 1.00 57.94  ? 111 ASN C CG    1 
ATOM   2217  O OD1   . ASN C 3  114 ? 97.924  126.965 100.357 1.00 59.41  ? 111 ASN C OD1   1 
ATOM   2218  N ND2   . ASN C 3  114 ? 99.718  125.638 100.434 1.00 60.95  ? 111 ASN C ND2   1 
ATOM   2219  N N     . ILE C 3  115 ? 99.873  131.374 99.351  1.00 50.72  ? 112 ILE C N     1 
ATOM   2220  C CA    . ILE C 3  115 ? 100.566 132.649 99.485  1.00 51.79  ? 112 ILE C CA    1 
ATOM   2221  C C     . ILE C 3  115 ? 100.166 133.264 100.806 1.00 56.40  ? 112 ILE C C     1 
ATOM   2222  O O     . ILE C 3  115 ? 98.982  133.489 101.049 1.00 54.44  ? 112 ILE C O     1 
ATOM   2223  C CB    . ILE C 3  115 ? 100.216 133.635 98.349  1.00 51.88  ? 112 ILE C CB    1 
ATOM   2224  C CG1   . ILE C 3  115 ? 100.606 133.006 97.022  1.00 52.19  ? 112 ILE C CG1   1 
ATOM   2225  C CG2   . ILE C 3  115 ? 100.943 135.010 98.578  1.00 45.04  ? 112 ILE C CG2   1 
ATOM   2226  C CD1   . ILE C 3  115 ? 100.174 133.753 95.789  1.00 54.27  ? 112 ILE C CD1   1 
ATOM   2227  N N     . GLN C 3  116 ? 101.137 133.561 101.652 1.00 52.31  ? 113 GLN C N     1 
ATOM   2228  C CA    . GLN C 3  116 ? 100.804 134.149 102.942 1.00 53.92  ? 113 GLN C CA    1 
ATOM   2229  C C     . GLN C 3  116 ? 100.224 135.545 102.748 1.00 54.53  ? 113 GLN C C     1 
ATOM   2230  O O     . GLN C 3  116 ? 100.806 136.382 102.066 1.00 52.83  ? 113 GLN C O     1 
ATOM   2231  C CB    . GLN C 3  116 ? 102.038 134.215 103.834 1.00 48.97  ? 113 GLN C CB    1 
ATOM   2232  C CG    . GLN C 3  116 ? 102.591 132.898 104.255 1.00 46.01  ? 113 GLN C CG    1 
ATOM   2233  C CD    . GLN C 3  116 ? 101.706 132.234 105.237 1.00 51.07  ? 113 GLN C CD    1 
ATOM   2234  O OE1   . GLN C 3  116 ? 101.361 132.814 106.268 1.00 42.93  ? 113 GLN C OE1   1 
ATOM   2235  N NE2   . GLN C 3  116 ? 101.305 131.017 104.934 1.00 47.06  ? 113 GLN C NE2   1 
ATOM   2236  N N     . ALA C 3  117 ? 99.125  135.833 103.440 1.00 58.28  ? 114 ALA C N     1 
ATOM   2237  C CA    . ALA C 3  117 ? 98.416  137.112 103.322 1.00 61.71  ? 114 ALA C CA    1 
ATOM   2238  C C     . ALA C 3  117 ? 99.260  138.310 103.708 1.00 55.62  ? 114 ALA C C     1 
ATOM   2239  O O     . ALA C 3  117 ? 99.046  139.419 103.226 1.00 55.40  ? 114 ALA C O     1 
ATOM   2240  C CB    . ALA C 3  117 ? 97.172  137.102 104.179 1.00 57.21  ? 114 ALA C CB    1 
ATOM   2241  N N     . VAL C 3  118 ? 100.233 138.086 104.565 1.00 55.29  ? 115 VAL C N     1 
ATOM   2242  C CA    . VAL C 3  118 ? 101.087 139.145 105.077 1.00 54.47  ? 115 VAL C CA    1 
ATOM   2243  C C     . VAL C 3  118 ? 102.002 139.703 103.996 1.00 51.46  ? 115 VAL C C     1 
ATOM   2244  O O     . VAL C 3  118 ? 102.675 140.710 104.201 1.00 47.74  ? 115 VAL C O     1 
ATOM   2245  C CB    . VAL C 3  118 ? 101.945 138.638 106.252 1.00 57.96  ? 115 VAL C CB    1 
ATOM   2246  C CG1   . VAL C 3  118 ? 101.035 138.128 107.360 1.00 54.75  ? 115 VAL C CG1   1 
ATOM   2247  C CG2   . VAL C 3  118 ? 102.913 137.556 105.784 1.00 42.96  ? 115 VAL C CG2   1 
ATOM   2248  N N     . LEU C 3  119 ? 102.082 139.008 102.869 1.00 51.40  ? 116 LEU C N     1 
ATOM   2249  C CA    . LEU C 3  119 ? 102.924 139.413 101.781 1.00 48.96  ? 116 LEU C CA    1 
ATOM   2250  C C     . LEU C 3  119 ? 102.176 140.264 100.768 1.00 50.88  ? 116 LEU C C     1 
ATOM   2251  O O     . LEU C 3  119 ? 102.781 140.832 99.849  1.00 48.99  ? 116 LEU C O     1 
ATOM   2252  C CB    . LEU C 3  119 ? 103.428 138.145 101.115 1.00 43.69  ? 116 LEU C CB    1 
ATOM   2253  C CG    . LEU C 3  119 ? 104.174 137.189 102.033 1.00 44.76  ? 116 LEU C CG    1 
ATOM   2254  C CD1   . LEU C 3  119 ? 104.548 135.980 101.224 1.00 43.98  ? 116 LEU C CD1   1 
ATOM   2255  C CD2   . LEU C 3  119 ? 105.381 137.849 102.694 1.00 41.10  ? 116 LEU C CD2   1 
ATOM   2256  N N     . LEU C 3  120 ? 100.867 140.384 100.930 1.00 53.65  ? 117 LEU C N     1 
ATOM   2257  C CA    . LEU C 3  120 ? 100.069 141.108 99.970  1.00 56.05  ? 117 LEU C CA    1 
ATOM   2258  C C     . LEU C 3  120 ? 100.041 142.597 100.329 1.00 58.21  ? 117 LEU C C     1 
ATOM   2259  O O     . LEU C 3  120 ? 100.195 142.953 101.496 1.00 57.55  ? 117 LEU C O     1 
ATOM   2260  C CB    . LEU C 3  120 ? 98.657  140.518 99.973  1.00 57.67  ? 117 LEU C CB    1 
ATOM   2261  C CG    . LEU C 3  120 ? 98.552  138.991 99.638  1.00 56.36  ? 117 LEU C CG    1 
ATOM   2262  C CD1   . LEU C 3  120 ? 97.114  138.553 99.801  1.00 56.45  ? 117 LEU C CD1   1 
ATOM   2263  C CD2   . LEU C 3  120 ? 99.047  138.703 98.226  1.00 53.37  ? 117 LEU C CD2   1 
ATOM   2264  N N     . SER D 4  36  ? 112.508 88.776  79.123  1.00 78.78  ? 33  SER D N     1 
ATOM   2265  C CA    . SER D 4  36  ? 112.437 90.034  79.855  1.00 89.25  ? 33  SER D CA    1 
ATOM   2266  C C     . SER D 4  36  ? 111.005 90.448  80.107  1.00 82.12  ? 33  SER D C     1 
ATOM   2267  O O     . SER D 4  36  ? 110.294 90.848  79.180  1.00 76.71  ? 33  SER D O     1 
ATOM   2268  C CB    . SER D 4  36  ? 113.149 91.130  79.102  1.00 88.68  ? 33  SER D CB    1 
ATOM   2269  O OG    . SER D 4  36  ? 113.029 92.347  79.782  1.00 83.60  ? 33  SER D OG    1 
ATOM   2270  N N     . ARG D 4  37  ? 110.548 90.313  81.356  1.00 77.08  ? 34  ARG D N     1 
ATOM   2271  C CA    . ARG D 4  37  ? 109.138 90.661  81.689  1.00 74.88  ? 34  ARG D CA    1 
ATOM   2272  C C     . ARG D 4  37  ? 109.078 91.367  83.046  1.00 74.83  ? 34  ARG D C     1 
ATOM   2273  O O     . ARG D 4  37  ? 109.640 90.830  84.007  1.00 75.99  ? 34  ARG D O     1 
ATOM   2274  C CB    . ARG D 4  37  ? 108.279 89.395  81.750  1.00 66.43  ? 34  ARG D CB    1 
ATOM   2275  C CG    . ARG D 4  37  ? 107.882 88.830  80.395  1.00 68.05  ? 34  ARG D CG    1 
ATOM   2276  C CD    . ARG D 4  37  ? 106.375 88.794  80.237  1.00 67.76  ? 34  ARG D CD    1 
ATOM   2277  N NE    . ARG D 4  37  ? 105.859 87.659  79.486  1.00 67.73  ? 34  ARG D NE    1 
ATOM   2278  C CZ    . ARG D 4  37  ? 104.772 86.971  79.822  1.00 75.49  ? 34  ARG D CZ    1 
ATOM   2279  N NH1   . ARG D 4  37  ? 104.371 85.954  79.080  1.00 74.06  ? 34  ARG D NH1   1 
ATOM   2280  N NH2   . ARG D 4  37  ? 104.088 87.301  80.901  1.00 68.77  ? 34  ARG D NH2   1 
ATOM   2281  N N     . LYS D 4  38  ? 108.414 92.523  83.110  1.00 68.26  ? 35  LYS D N     1 
ATOM   2282  C CA    . LYS D 4  38  ? 108.259 93.264  84.357  1.00 64.88  ? 35  LYS D CA    1 
ATOM   2283  C C     . LYS D 4  38  ? 106.785 93.500  84.639  1.00 61.47  ? 35  LYS D C     1 
ATOM   2284  O O     . LYS D 4  38  ? 106.062 94.007  83.791  1.00 59.05  ? 35  LYS D O     1 
ATOM   2285  C CB    . LYS D 4  38  ? 109.025 94.583  84.283  1.00 62.92  ? 35  LYS D CB    1 
ATOM   2286  C CG    . LYS D 4  38  ? 108.957 95.465  85.532  1.00 64.57  ? 35  LYS D CG    1 
ATOM   2287  C CD    . LYS D 4  38  ? 109.787 94.906  86.693  1.00 65.64  ? 35  LYS D CD    1 
ATOM   2288  C CE    . LYS D 4  38  ? 109.777 95.859  87.889  1.00 61.85  ? 35  LYS D CE    1 
ATOM   2289  N NZ    . LYS D 4  38  ? 110.523 95.309  89.052  1.00 62.23  ? 35  LYS D NZ    1 
ATOM   2290  N N     . GLU D 4  39  ? 106.345 93.138  85.836  1.00 55.81  ? 36  GLU D N     1 
ATOM   2291  C CA    . GLU D 4  39  ? 104.944 93.274  86.217  1.00 53.87  ? 36  GLU D CA    1 
ATOM   2292  C C     . GLU D 4  39  ? 104.637 94.584  86.923  1.00 47.99  ? 36  GLU D C     1 
ATOM   2293  O O     . GLU D 4  39  ? 105.504 95.181  87.562  1.00 49.10  ? 36  GLU D O     1 
ATOM   2294  C CB    . GLU D 4  39  ? 104.538 92.100  87.090  1.00 54.92  ? 36  GLU D CB    1 
ATOM   2295  C CG    . GLU D 4  39  ? 104.604 90.784  86.359  1.00 59.89  ? 36  GLU D CG    1 
ATOM   2296  C CD    . GLU D 4  39  ? 104.175 89.601  87.178  0.00 78.04  ? 36  GLU D CD    1 
ATOM   2297  O OE1   . GLU D 4  39  ? 103.897 89.751  88.351  0.00 59.89  ? 36  GLU D OE1   1 
ATOM   2298  O OE2   . GLU D 4  39  ? 104.122 88.530  86.630  0.00 71.37  ? 36  GLU D OE2   1 
ATOM   2299  N N     . SER D 4  40  ? 103.392 95.017  86.812  1.00 38.30  ? 37  SER D N     1 
ATOM   2300  C CA    . SER D 4  40  ? 102.917 96.220  87.446  1.00 25.20  ? 37  SER D CA    1 
ATOM   2301  C C     . SER D 4  40  ? 101.430 96.101  87.574  1.00 22.66  ? 37  SER D C     1 
ATOM   2302  O O     . SER D 4  40  ? 100.832 95.147  87.089  1.00 26.19  ? 37  SER D O     1 
ATOM   2303  C CB    . SER D 4  40  ? 103.217 97.429  86.631  1.00 31.73  ? 37  SER D CB    1 
ATOM   2304  O OG    . SER D 4  40  ? 102.360 97.499  85.536  1.00 42.15  ? 37  SER D OG    1 
ATOM   2305  N N     . TYR D 4  41  ? 100.822 97.086  88.184  1.00 22.10  ? 38  TYR D N     1 
ATOM   2306  C CA    . TYR D 4  41  ? 99.397  97.120  88.380  1.00 17.71  ? 38  TYR D CA    1 
ATOM   2307  C C     . TYR D 4  41  ? 98.715  98.038  87.402  1.00 21.62  ? 38  TYR D C     1 
ATOM   2308  O O     . TYR D 4  41  ? 97.540  98.367  87.569  1.00 23.83  ? 38  TYR D O     1 
ATOM   2309  C CB    . TYR D 4  41  ? 99.092  97.578  89.786  1.00 15.91  ? 38  TYR D CB    1 
ATOM   2310  C CG    . TYR D 4  41  ? 99.533  96.636  90.811  1.00 18.66  ? 38  TYR D CG    1 
ATOM   2311  C CD1   . TYR D 4  41  ? 100.743 96.786  91.394  1.00 17.15  ? 38  TYR D CD1   1 
ATOM   2312  C CD2   . TYR D 4  41  ? 98.711  95.617  91.193  1.00 25.10  ? 38  TYR D CD2   1 
ATOM   2313  C CE1   . TYR D 4  41  ? 101.137 95.912  92.352  1.00 16.52  ? 38  TYR D CE1   1 
ATOM   2314  C CE2   . TYR D 4  41  ? 99.106  94.747  92.151  1.00 22.31  ? 38  TYR D CE2   1 
ATOM   2315  C CZ    . TYR D 4  41  ? 100.317 94.898  92.726  1.00 19.20  ? 38  TYR D CZ    1 
ATOM   2316  O OH    . TYR D 4  41  ? 100.721 94.033  93.692  1.00 30.09  ? 38  TYR D OH    1 
ATOM   2317  N N     . SER D 4  42  ? 99.404  98.428  86.341  1.00 20.80  ? 39  SER D N     1 
ATOM   2318  C CA    . SER D 4  42  ? 98.841  99.399  85.422  1.00 17.71  ? 39  SER D CA    1 
ATOM   2319  C C     . SER D 4  42  ? 97.493  98.998  84.878  1.00 17.69  ? 39  SER D C     1 
ATOM   2320  O O     . SER D 4  42  ? 96.605  99.834  84.707  1.00 26.67  ? 39  SER D O     1 
ATOM   2321  C CB    . SER D 4  42  ? 99.761  99.575  84.245  1.00 23.87  ? 39  SER D CB    1 
ATOM   2322  O OG    . SER D 4  42  ? 100.992 100.136 84.611  1.00 34.09  ? 39  SER D OG    1 
ATOM   2323  N N     . ILE D 4  43  ? 97.310  97.733  84.603  1.00 16.10  ? 40  ILE D N     1 
ATOM   2324  C CA    . ILE D 4  43  ? 96.050  97.300  84.063  1.00 14.41  ? 40  ILE D CA    1 
ATOM   2325  C C     . ILE D 4  43  ? 94.899  97.392  85.053  1.00 22.44  ? 40  ILE D C     1 
ATOM   2326  O O     . ILE D 4  43  ? 93.755  97.571  84.638  1.00 25.74  ? 40  ILE D O     1 
ATOM   2327  C CB    . ILE D 4  43  ? 96.168  95.898  83.467  1.00 14.27  ? 40  ILE D CB    1 
ATOM   2328  C CG1   . ILE D 4  43  ? 94.972  95.629  82.578  1.00 13.37  ? 40  ILE D CG1   1 
ATOM   2329  C CG2   . ILE D 4  43  ? 96.293  94.881  84.530  1.00 28.12  ? 40  ILE D CG2   1 
ATOM   2330  C CD1   . ILE D 4  43  ? 95.114  94.413  81.686  1.00 0.02   ? 40  ILE D CD1   1 
ATOM   2331  N N     . TYR D 4  44  ? 95.164  97.234  86.348  1.00 24.09  ? 41  TYR D N     1 
ATOM   2332  C CA    . TYR D 4  44  ? 94.085  97.220  87.304  1.00 20.01  ? 41  TYR D CA    1 
ATOM   2333  C C     . TYR D 4  44  ? 93.743  98.625  87.680  1.00 23.40  ? 41  TYR D C     1 
ATOM   2334  O O     . TYR D 4  44  ? 92.585  98.939  87.945  1.00 25.47  ? 41  TYR D O     1 
ATOM   2335  C CB    . TYR D 4  44  ? 94.510  96.439  88.505  1.00 21.71  ? 41  TYR D CB    1 
ATOM   2336  C CG    . TYR D 4  44  ? 94.936  95.110  88.102  1.00 22.39  ? 41  TYR D CG    1 
ATOM   2337  C CD1   . TYR D 4  44  ? 96.242  94.822  88.185  1.00 25.21  ? 41  TYR D CD1   1 
ATOM   2338  C CD2   . TYR D 4  44  ? 94.069  94.202  87.609  1.00 22.94  ? 41  TYR D CD2   1 
ATOM   2339  C CE1   . TYR D 4  44  ? 96.710  93.628  87.787  1.00 25.86  ? 41  TYR D CE1   1 
ATOM   2340  C CE2   . TYR D 4  44  ? 94.531  92.989  87.198  1.00 22.90  ? 41  TYR D CE2   1 
ATOM   2341  C CZ    . TYR D 4  44  ? 95.845  92.705  87.286  1.00 25.33  ? 41  TYR D CZ    1 
ATOM   2342  O OH    . TYR D 4  44  ? 96.317  91.496  86.864  1.00 37.65  ? 41  TYR D OH    1 
ATOM   2343  N N     . VAL D 4  45  ? 94.742  99.491  87.669  1.00 24.31  ? 42  VAL D N     1 
ATOM   2344  C CA    . VAL D 4  45  ? 94.516  100.873 87.993  1.00 19.70  ? 42  VAL D CA    1 
ATOM   2345  C C     . VAL D 4  45  ? 93.617  101.436 86.935  1.00 22.58  ? 42  VAL D C     1 
ATOM   2346  O O     . VAL D 4  45  ? 92.685  102.173 87.238  1.00 27.44  ? 42  VAL D O     1 
ATOM   2347  C CB    . VAL D 4  45  ? 95.821  101.650 88.060  1.00 18.92  ? 42  VAL D CB    1 
ATOM   2348  C CG1   . VAL D 4  45  ? 95.564  103.116 88.191  1.00 25.78  ? 42  VAL D CG1   1 
ATOM   2349  C CG2   . VAL D 4  45  ? 96.613  101.188 89.246  1.00 20.66  ? 42  VAL D CG2   1 
ATOM   2350  N N     . TYR D 4  46  ? 93.887  101.101 85.690  1.00 24.22  ? 43  TYR D N     1 
ATOM   2351  C CA    . TYR D 4  46  ? 93.068  101.570 84.616  1.00 22.83  ? 43  TYR D CA    1 
ATOM   2352  C C     . TYR D 4  46  ? 91.625  101.137 84.780  1.00 23.65  ? 43  TYR D C     1 
ATOM   2353  O O     . TYR D 4  46  ? 90.728  101.949 84.572  1.00 29.43  ? 43  TYR D O     1 
ATOM   2354  C CB    . TYR D 4  46  ? 93.622  101.128 83.298  1.00 29.00  ? 43  TYR D CB    1 
ATOM   2355  C CG    . TYR D 4  46  ? 92.839  101.632 82.187  1.00 38.68  ? 43  TYR D CG    1 
ATOM   2356  C CD1   . TYR D 4  46  ? 92.984  102.940 81.814  1.00 42.42  ? 43  TYR D CD1   1 
ATOM   2357  C CD2   . TYR D 4  46  ? 91.975  100.811 81.517  1.00 48.64  ? 43  TYR D CD2   1 
ATOM   2358  C CE1   . TYR D 4  46  ? 92.259  103.434 80.771  1.00 49.54  ? 43  TYR D CE1   1 
ATOM   2359  C CE2   . TYR D 4  46  ? 91.252  101.297 80.461  1.00 54.10  ? 43  TYR D CE2   1 
ATOM   2360  C CZ    . TYR D 4  46  ? 91.385  102.606 80.087  1.00 57.87  ? 43  TYR D CZ    1 
ATOM   2361  O OH    . TYR D 4  46  ? 90.673  103.114 79.010  1.00 71.87  ? 43  TYR D OH    1 
ATOM   2362  N N     . LYS D 4  47  ? 91.441  99.884  85.159  1.00 25.47  ? 44  LYS D N     1 
ATOM   2363  C CA    . LYS D 4  47  ? 90.124  99.304  85.327  1.00 21.06  ? 44  LYS D CA    1 
ATOM   2364  C C     . LYS D 4  47  ? 89.341  100.018 86.423  1.00 22.40  ? 44  LYS D C     1 
ATOM   2365  O O     . LYS D 4  47  ? 88.134  100.218 86.297  1.00 28.11  ? 44  LYS D O     1 
ATOM   2366  C CB    . LYS D 4  47  ? 90.281  97.820  85.656  1.00 21.86  ? 44  LYS D CB    1 
ATOM   2367  C CG    . LYS D 4  47  ? 89.011  96.994  85.548  1.00 28.89  ? 44  LYS D CG    1 
ATOM   2368  C CD    . LYS D 4  47  ? 88.573  96.825  84.102  1.00 33.05  ? 44  LYS D CD    1 
ATOM   2369  C CE    . LYS D 4  47  ? 87.436  95.821  83.983  1.00 37.87  ? 44  LYS D CE    1 
ATOM   2370  N NZ    . LYS D 4  47  ? 87.083  95.543  82.563  1.00 43.56  ? 44  LYS D NZ    1 
ATOM   2371  N N     . VAL D 4  48  ? 90.013  100.434 87.497  1.00 23.33  ? 45  VAL D N     1 
ATOM   2372  C CA    . VAL D 4  48  ? 89.346  101.161 88.541  1.00 19.14  ? 45  VAL D CA    1 
ATOM   2373  C C     . VAL D 4  48  ? 88.997  102.541 88.037  1.00 23.66  ? 45  VAL D C     1 
ATOM   2374  O O     . VAL D 4  48  ? 87.878  103.015 88.233  1.00 26.53  ? 45  VAL D O     1 
ATOM   2375  C CB    . VAL D 4  48  ? 90.208  101.264 89.792  1.00 18.42  ? 45  VAL D CB    1 
ATOM   2376  C CG1   . VAL D 4  48  ? 89.585  102.188 90.780  1.00 25.49  ? 45  VAL D CG1   1 
ATOM   2377  C CG2   . VAL D 4  48  ? 90.343  99.919  90.406  1.00 20.21  ? 45  VAL D CG2   1 
ATOM   2378  N N     . LEU D 4  49  ? 89.915  103.205 87.342  1.00 24.53  ? 46  LEU D N     1 
ATOM   2379  C CA    . LEU D 4  49  ? 89.643  104.549 86.877  1.00 20.50  ? 46  LEU D CA    1 
ATOM   2380  C C     . LEU D 4  49  ? 88.408  104.586 86.046  1.00 20.12  ? 46  LEU D C     1 
ATOM   2381  O O     . LEU D 4  49  ? 87.634  105.530 86.156  1.00 27.02  ? 46  LEU D O     1 
ATOM   2382  C CB    . LEU D 4  49  ? 90.810  105.103 86.067  1.00 19.29  ? 46  LEU D CB    1 
ATOM   2383  C CG    . LEU D 4  49  ? 90.652  106.507 85.488  1.00 21.19  ? 46  LEU D CG    1 
ATOM   2384  C CD1   . LEU D 4  49  ? 90.388  107.530 86.572  1.00 32.48  ? 46  LEU D CD1   1 
ATOM   2385  C CD2   . LEU D 4  49  ? 91.937  106.862 84.791  1.00 32.61  ? 46  LEU D CD2   1 
ATOM   2386  N N     . LYS D 4  50  ? 88.222  103.549 85.229  1.00 20.76  ? 47  LYS D N     1 
ATOM   2387  C CA    . LYS D 4  50  ? 87.044  103.426 84.387  1.00 18.73  ? 47  LYS D CA    1 
ATOM   2388  C C     . LYS D 4  50  ? 85.766  103.441 85.200  1.00 20.75  ? 47  LYS D C     1 
ATOM   2389  O O     . LYS D 4  50  ? 84.753  103.968 84.743  1.00 24.87  ? 47  LYS D O     1 
ATOM   2390  C CB    . LYS D 4  50  ? 87.055  102.124 83.589  1.00 21.46  ? 47  LYS D CB    1 
ATOM   2391  C CG    . LYS D 4  50  ? 88.028  102.060 82.422  1.00 34.76  ? 47  LYS D CG    1 
ATOM   2392  C CD    . LYS D 4  50  ? 87.861  100.748 81.670  1.00 44.32  ? 47  LYS D CD    1 
ATOM   2393  C CE    . LYS D 4  50  ? 86.680  100.806 80.708  1.00 52.02  ? 47  LYS D CE    1 
ATOM   2394  N NZ    . LYS D 4  50  ? 86.418  99.496  80.048  1.00 51.10  ? 47  LYS D NZ    1 
ATOM   2395  N N     . GLN D 4  51  ? 85.742  102.795 86.360  1.00 22.72  ? 48  GLN D N     1 
ATOM   2396  C CA    . GLN D 4  51  ? 84.479  102.730 87.063  1.00 24.50  ? 48  GLN D CA    1 
ATOM   2397  C C     . GLN D 4  51  ? 84.207  104.011 87.794  1.00 25.50  ? 48  GLN D C     1 
ATOM   2398  O O     . GLN D 4  51  ? 83.054  104.399 87.988  1.00 31.86  ? 48  GLN D O     1 
ATOM   2399  C CB    . GLN D 4  51  ? 84.478  101.638 88.086  1.00 29.76  ? 48  GLN D CB    1 
ATOM   2400  C CG    . GLN D 4  51  ? 84.540  100.299 87.539  1.00 35.93  ? 48  GLN D CG    1 
ATOM   2401  C CD    . GLN D 4  51  ? 84.558  99.327  88.619  1.00 46.94  ? 48  GLN D CD    1 
ATOM   2402  O OE1   . GLN D 4  51  ? 84.929  99.679  89.735  1.00 39.92  ? 48  GLN D OE1   1 
ATOM   2403  N NE2   . GLN D 4  51  ? 84.170  98.109  88.337  1.00 60.72  ? 48  GLN D NE2   1 
ATOM   2404  N N     . VAL D 4  52  ? 85.270  104.657 88.222  1.00 24.26  ? 49  VAL D N     1 
ATOM   2405  C CA    . VAL D 4  52  ? 85.149  105.872 88.988  1.00 20.92  ? 49  VAL D CA    1 
ATOM   2406  C C     . VAL D 4  52  ? 84.822  107.068 88.084  1.00 24.67  ? 49  VAL D C     1 
ATOM   2407  O O     . VAL D 4  52  ? 83.910  107.839 88.370  1.00 33.65  ? 49  VAL D O     1 
ATOM   2408  C CB    . VAL D 4  52  ? 86.459  106.099 89.745  1.00 16.85  ? 49  VAL D CB    1 
ATOM   2409  C CG1   . VAL D 4  52  ? 86.443  107.351 90.434  1.00 27.84  ? 49  VAL D CG1   1 
ATOM   2410  C CG2   . VAL D 4  52  ? 86.689  104.989 90.744  1.00 23.97  ? 49  VAL D CG2   1 
ATOM   2411  N N     . HIS D 4  53  ? 85.572  107.206 87.000  1.00 24.11  ? 50  HIS D N     1 
ATOM   2412  C CA    . HIS D 4  53  ? 85.447  108.254 86.001  1.00 21.07  ? 50  HIS D CA    1 
ATOM   2413  C C     . HIS D 4  53  ? 85.492  107.708 84.583  1.00 20.79  ? 50  HIS D C     1 
ATOM   2414  O O     . HIS D 4  53  ? 86.562  107.684 83.980  1.00 25.85  ? 50  HIS D O     1 
ATOM   2415  C CB    . HIS D 4  53  ? 86.541  109.289 86.109  1.00 22.77  ? 50  HIS D CB    1 
ATOM   2416  C CG    . HIS D 4  53  ? 86.479  110.113 87.256  1.00 23.31  ? 50  HIS D CG    1 
ATOM   2417  N ND1   . HIS D 4  53  ? 85.535  111.079 87.389  1.00 29.82  ? 50  HIS D ND1   1 
ATOM   2418  C CD2   . HIS D 4  53  ? 87.254  110.199 88.324  1.00 24.32  ? 50  HIS D CD2   1 
ATOM   2419  C CE1   . HIS D 4  53  ? 85.722  111.717 88.507  1.00 32.81  ? 50  HIS D CE1   1 
ATOM   2420  N NE2   . HIS D 4  53  ? 86.759  111.212 89.096  1.00 28.28  ? 50  HIS D NE2   1 
ATOM   2421  N N     . PRO D 4  54  ? 84.380  107.253 84.030  1.00 19.57  ? 51  PRO D N     1 
ATOM   2422  C CA    . PRO D 4  54  ? 84.265  106.603 82.748  1.00 21.10  ? 51  PRO D CA    1 
ATOM   2423  C C     . PRO D 4  54  ? 84.840  107.360 81.561  1.00 30.25  ? 51  PRO D C     1 
ATOM   2424  O O     . PRO D 4  54  ? 85.171  106.743 80.551  1.00 37.65  ? 51  PRO D O     1 
ATOM   2425  C CB    . PRO D 4  54  ? 82.762  106.494 82.596  1.00 17.91  ? 51  PRO D CB    1 
ATOM   2426  C CG    . PRO D 4  54  ? 82.261  106.456 83.988  1.00 26.78  ? 51  PRO D CG    1 
ATOM   2427  C CD    . PRO D 4  54  ? 83.133  107.365 84.744  1.00 20.20  ? 51  PRO D CD    1 
ATOM   2428  N N     . ASP D 4  55  ? 84.921  108.690 81.620  1.00 33.76  ? 52  ASP D N     1 
ATOM   2429  C CA    . ASP D 4  55  ? 85.445  109.443 80.506  1.00 35.18  ? 52  ASP D CA    1 
ATOM   2430  C C     . ASP D 4  55  ? 86.799  110.089 80.744  1.00 33.81  ? 52  ASP D C     1 
ATOM   2431  O O     . ASP D 4  55  ? 87.205  110.969 79.989  1.00 43.69  ? 52  ASP D O     1 
ATOM   2432  C CB    . ASP D 4  55  ? 84.412  110.470 80.122  1.00 41.71  ? 52  ASP D CB    1 
ATOM   2433  C CG    . ASP D 4  55  ? 84.063  111.367 81.287  1.00 53.50  ? 52  ASP D CG    1 
ATOM   2434  O OD1   . ASP D 4  55  ? 84.498  111.093 82.419  1.00 43.63  ? 52  ASP D OD1   1 
ATOM   2435  O OD2   . ASP D 4  55  ? 83.336  112.302 81.068  1.00 64.66  ? 52  ASP D OD2   1 
ATOM   2436  N N     . THR D 4  56  ? 87.517  109.651 81.758  1.00 30.88  ? 53  THR D N     1 
ATOM   2437  C CA    . THR D 4  56  ? 88.813  110.244 82.057  1.00 28.16  ? 53  THR D CA    1 
ATOM   2438  C C     . THR D 4  56  ? 89.947  109.292 81.764  1.00 26.11  ? 53  THR D C     1 
ATOM   2439  O O     . THR D 4  56  ? 89.891  108.110 82.084  1.00 40.73  ? 53  THR D O     1 
ATOM   2440  C CB    . THR D 4  56  ? 88.836  110.732 83.506  1.00 27.76  ? 53  THR D CB    1 
ATOM   2441  O OG1   . THR D 4  56  ? 87.837  111.736 83.659  1.00 32.08  ? 53  THR D OG1   1 
ATOM   2442  C CG2   . THR D 4  56  ? 90.167  111.316 83.903  1.00 31.29  ? 53  THR D CG2   1 
ATOM   2443  N N     . GLY D 4  57  ? 90.969  109.781 81.094  1.00 25.63  ? 54  GLY D N     1 
ATOM   2444  C CA    . GLY D 4  57  ? 92.122  108.942 80.821  1.00 27.13  ? 54  GLY D CA    1 
ATOM   2445  C C     . GLY D 4  57  ? 93.236  109.237 81.797  1.00 25.88  ? 54  GLY D C     1 
ATOM   2446  O O     . GLY D 4  57  ? 93.087  110.058 82.702  1.00 30.64  ? 54  GLY D O     1 
ATOM   2447  N N     . ILE D 4  58  ? 94.353  108.573 81.630  1.00 26.60  ? 55  ILE D N     1 
ATOM   2448  C CA    . ILE D 4  58  ? 95.474  108.796 82.531  1.00 23.10  ? 55  ILE D CA    1 
ATOM   2449  C C     . ILE D 4  58  ? 96.780  108.803 81.772  1.00 27.48  ? 55  ILE D C     1 
ATOM   2450  O O     . ILE D 4  58  ? 97.003  107.931 80.948  1.00 38.98  ? 55  ILE D O     1 
ATOM   2451  C CB    . ILE D 4  58  ? 95.399  107.756 83.665  1.00 28.00  ? 55  ILE D CB    1 
ATOM   2452  C CG1   . ILE D 4  58  ? 96.473  107.989 84.688  1.00 28.18  ? 55  ILE D CG1   1 
ATOM   2453  C CG2   . ILE D 4  58  ? 95.429  106.374 83.109  1.00 43.44  ? 55  ILE D CG2   1 
ATOM   2454  C CD1   . ILE D 4  58  ? 96.284  107.261 86.005  1.00 27.99  ? 55  ILE D CD1   1 
ATOM   2455  N N     . SER D 4  59  ? 97.667  109.735 82.070  1.00 26.17  ? 56  SER D N     1 
ATOM   2456  C CA    . SER D 4  59  ? 98.946  109.787 81.374  1.00 26.26  ? 56  SER D CA    1 
ATOM   2457  C C     . SER D 4  59  ? 99.863  108.690 81.828  1.00 26.87  ? 56  SER D C     1 
ATOM   2458  O O     . SER D 4  59  ? 99.648  108.086 82.880  1.00 31.25  ? 56  SER D O     1 
ATOM   2459  C CB    . SER D 4  59  ? 99.639  111.099 81.603  1.00 28.97  ? 56  SER D CB    1 
ATOM   2460  O OG    . SER D 4  59  ? 100.112 111.212 82.915  1.00 30.55  ? 56  SER D OG    1 
ATOM   2461  N N     . SER D 4  60  ? 100.925 108.434 81.070  1.00 31.72  ? 57  SER D N     1 
ATOM   2462  C CA    . SER D 4  60  ? 101.845 107.385 81.474  1.00 25.70  ? 57  SER D CA    1 
ATOM   2463  C C     . SER D 4  60  ? 102.627 107.756 82.699  1.00 25.41  ? 57  SER D C     1 
ATOM   2464  O O     . SER D 4  60  ? 102.986 106.888 83.498  1.00 30.73  ? 57  SER D O     1 
ATOM   2465  C CB    . SER D 4  60  ? 102.833 107.105 80.394  1.00 36.39  ? 57  SER D CB    1 
ATOM   2466  O OG    . SER D 4  60  ? 103.716 108.169 80.277  1.00 50.23  ? 57  SER D OG    1 
ATOM   2467  N N     . LYS D 4  61  ? 102.845 109.033 82.910  1.00 23.51  ? 58  LYS D N     1 
ATOM   2468  C CA    . LYS D 4  61  ? 103.558 109.420 84.094  1.00 19.91  ? 58  LYS D CA    1 
ATOM   2469  C C     . LYS D 4  61  ? 102.667 109.281 85.291  1.00 22.18  ? 58  LYS D C     1 
ATOM   2470  O O     . LYS D 4  61  ? 103.119 108.882 86.365  1.00 26.41  ? 58  LYS D O     1 
ATOM   2471  C CB    . LYS D 4  61  ? 104.041 110.827 83.989  1.00 23.33  ? 58  LYS D CB    1 
ATOM   2472  C CG    . LYS D 4  61  ? 105.115 111.077 82.982  1.00 20.03  ? 58  LYS D CG    1 
ATOM   2473  C CD    . LYS D 4  61  ? 106.423 110.456 83.397  1.00 34.83  ? 58  LYS D CD    1 
ATOM   2474  C CE    . LYS D 4  61  ? 107.564 110.849 82.463  1.00 40.68  ? 58  LYS D CE    1 
ATOM   2475  N NZ    . LYS D 4  61  ? 108.869 110.188 82.854  1.00 24.60  ? 58  LYS D NZ    1 
ATOM   2476  N N     . ALA D 4  62  ? 101.399 109.610 85.131  1.00 19.85  ? 59  ALA D N     1 
ATOM   2477  C CA    . ALA D 4  62  ? 100.493 109.457 86.233  1.00 14.95  ? 59  ALA D CA    1 
ATOM   2478  C C     . ALA D 4  62  ? 100.382 108.001 86.582  1.00 21.98  ? 59  ALA D C     1 
ATOM   2479  O O     . ALA D 4  62  ? 100.284 107.653 87.756  1.00 20.06  ? 59  ALA D O     1 
ATOM   2480  C CB    . ALA D 4  62  ? 99.158  110.010 85.898  1.00 24.83  ? 59  ALA D CB    1 
ATOM   2481  N N     . MET D 4  63  ? 100.424 107.128 85.582  1.00 25.11  ? 60  MET D N     1 
ATOM   2482  C CA    . MET D 4  63  ? 100.333 105.721 85.862  1.00 17.43  ? 60  MET D CA    1 
ATOM   2483  C C     . MET D 4  63  ? 101.562 105.255 86.602  1.00 19.22  ? 60  MET D C     1 
ATOM   2484  O O     . MET D 4  63  ? 101.457 104.465 87.537  1.00 23.48  ? 60  MET D O     1 
ATOM   2485  C CB    . MET D 4  63  ? 100.152 104.927 84.599  1.00 15.95  ? 60  MET D CB    1 
ATOM   2486  C CG    . MET D 4  63  ? 99.883  103.500 84.866  1.00 20.12  ? 60  MET D CG    1 
ATOM   2487  S SD    . MET D 4  63  ? 98.413  103.282 85.783  1.00 27.78  ? 60  MET D SD    1 
ATOM   2488  C CE    . MET D 4  63  ? 97.160  103.283 84.555  1.00 32.59  ? 60  MET D CE    1 
ATOM   2489  N N     . GLY D 4  64  ? 102.731 105.777 86.259  1.00 19.75  ? 61  GLY D N     1 
ATOM   2490  C CA    . GLY D 4  64  ? 103.932 105.380 86.963  1.00 15.66  ? 61  GLY D CA    1 
ATOM   2491  C C     . GLY D 4  64  ? 103.819 105.711 88.440  1.00 16.64  ? 61  GLY D C     1 
ATOM   2492  O O     . GLY D 4  64  ? 104.247 104.932 89.296  1.00 22.19  ? 61  GLY D O     1 
ATOM   2493  N N     . ILE D 4  65  ? 103.192 106.831 88.744  1.00 18.17  ? 62  ILE D N     1 
ATOM   2494  C CA    . ILE D 4  65  ? 102.985 107.222 90.118  1.00 13.34  ? 62  ILE D CA    1 
ATOM   2495  C C     . ILE D 4  65  ? 102.012 106.286 90.783  1.00 15.78  ? 62  ILE D C     1 
ATOM   2496  O O     . ILE D 4  65  ? 102.254 105.857 91.909  1.00 17.91  ? 62  ILE D O     1 
ATOM   2497  C CB    . ILE D 4  65  ? 102.512 108.649 90.212  1.00 13.55  ? 62  ILE D CB    1 
ATOM   2498  C CG1   . ILE D 4  65  ? 103.619 109.531 89.761  1.00 15.28  ? 62  ILE D CG1   1 
ATOM   2499  C CG2   . ILE D 4  65  ? 102.144 108.959 91.651  1.00 14.85  ? 62  ILE D CG2   1 
ATOM   2500  C CD1   . ILE D 4  65  ? 103.197 110.905 89.458  1.00 21.00  ? 62  ILE D CD1   1 
ATOM   2501  N N     . MET D 4  66  ? 100.919 105.947 90.117  1.00 17.92  ? 63  MET D N     1 
ATOM   2502  C CA    . MET D 4  66  ? 99.975  105.041 90.735  1.00 14.26  ? 63  MET D CA    1 
ATOM   2503  C C     . MET D 4  66  ? 100.605 103.685 91.005  1.00 18.04  ? 63  MET D C     1 
ATOM   2504  O O     . MET D 4  66  ? 100.296 103.060 92.018  1.00 18.46  ? 63  MET D O     1 
ATOM   2505  C CB    . MET D 4  66  ? 98.757  104.855 89.871  1.00 16.13  ? 63  MET D CB    1 
ATOM   2506  C CG    . MET D 4  66  ? 97.872  106.044 89.766  1.00 16.54  ? 63  MET D CG    1 
ATOM   2507  S SD    . MET D 4  66  ? 97.282  106.615 91.303  1.00 12.80  ? 63  MET D SD    1 
ATOM   2508  C CE    . MET D 4  66  ? 96.273  105.310 91.889  1.00 13.32  ? 63  MET D CE    1 
ATOM   2509  N N     . ASN D 4  67  ? 101.513 103.229 90.155  1.00 19.76  ? 64  ASN D N     1 
ATOM   2510  C CA    . ASN D 4  67  ? 102.142 101.959 90.433  1.00 11.33  ? 64  ASN D CA    1 
ATOM   2511  C C     . ASN D 4  67  ? 103.029 102.053 91.646  1.00 15.27  ? 64  ASN D C     1 
ATOM   2512  O O     . ASN D 4  67  ? 103.004 101.146 92.478  1.00 15.90  ? 64  ASN D O     1 
ATOM   2513  C CB    . ASN D 4  67  ? 102.957 101.493 89.270  1.00 13.60  ? 64  ASN D CB    1 
ATOM   2514  C CG    . ASN D 4  67  ? 102.156 100.988 88.191  1.00 20.94  ? 64  ASN D CG    1 
ATOM   2515  O OD1   . ASN D 4  67  ? 101.066 100.455 88.387  1.00 27.68  ? 64  ASN D OD1   1 
ATOM   2516  N ND2   . ASN D 4  67  ? 102.648 101.140 87.006  1.00 26.57  ? 64  ASN D ND2   1 
ATOM   2517  N N     . SER D 4  68  ? 103.743 103.164 91.828  1.00 14.12  ? 65  SER D N     1 
ATOM   2518  C CA    . SER D 4  68  ? 104.571 103.268 93.012  1.00 4.84   ? 65  SER D CA    1 
ATOM   2519  C C     . SER D 4  68  ? 103.713 103.341 94.244  1.00 11.30  ? 65  SER D C     1 
ATOM   2520  O O     . SER D 4  68  ? 104.055 102.759 95.272  1.00 12.65  ? 65  SER D O     1 
ATOM   2521  C CB    . SER D 4  68  ? 105.490 104.442 92.953  1.00 10.30  ? 65  SER D CB    1 
ATOM   2522  O OG    . SER D 4  68  ? 106.445 104.262 91.953  1.00 13.48  ? 65  SER D OG    1 
ATOM   2523  N N     . PHE D 4  69  ? 102.577 104.010 94.150  1.00 12.95  ? 66  PHE D N     1 
ATOM   2524  C CA    . PHE D 4  69  ? 101.674 104.092 95.274  1.00 8.90   ? 66  PHE D CA    1 
ATOM   2525  C C     . PHE D 4  69  ? 101.224 102.737 95.715  1.00 12.59  ? 66  PHE D C     1 
ATOM   2526  O O     . PHE D 4  69  ? 101.307 102.412 96.900  1.00 9.03   ? 66  PHE D O     1 
ATOM   2527  C CB    . PHE D 4  69  ? 100.472 104.931 94.941  1.00 11.70  ? 66  PHE D CB    1 
ATOM   2528  C CG    . PHE D 4  69  ? 99.424  104.872 95.937  1.00 7.21   ? 66  PHE D CG    1 
ATOM   2529  C CD1   . PHE D 4  69  ? 99.525  105.515 97.109  1.00 9.96   ? 66  PHE D CD1   1 
ATOM   2530  C CD2   . PHE D 4  69  ? 98.296  104.161 95.679  1.00 8.56   ? 66  PHE D CD2   1 
ATOM   2531  C CE1   . PHE D 4  69  ? 98.517  105.441 98.014  1.00 9.16   ? 66  PHE D CE1   1 
ATOM   2532  C CE2   . PHE D 4  69  ? 97.296  104.089 96.580  1.00 8.57   ? 66  PHE D CE2   1 
ATOM   2533  C CZ    . PHE D 4  69  ? 97.416  104.734 97.750  1.00 7.42   ? 66  PHE D CZ    1 
ATOM   2534  N N     . VAL D 4  70  ? 100.775 101.909 94.787  1.00 14.55  ? 67  VAL D N     1 
ATOM   2535  C CA    . VAL D 4  70  ? 100.301 100.608 95.182  1.00 8.61   ? 67  VAL D CA    1 
ATOM   2536  C C     . VAL D 4  70  ? 101.413 99.795  95.778  1.00 7.51   ? 67  VAL D C     1 
ATOM   2537  O O     . VAL D 4  70  ? 101.194 99.109  96.771  1.00 13.44  ? 67  VAL D O     1 
ATOM   2538  C CB    . VAL D 4  70  ? 99.674  99.856  94.023  1.00 11.32  ? 67  VAL D CB    1 
ATOM   2539  C CG1   . VAL D 4  70  ? 99.365  98.439  94.422  1.00 15.17  ? 67  VAL D CG1   1 
ATOM   2540  C CG2   . VAL D 4  70  ? 98.412  100.546 93.619  1.00 13.08  ? 67  VAL D CG2   1 
ATOM   2541  N N     . ASN D 4  71  ? 102.600 99.828  95.199  1.00 11.18  ? 68  ASN D N     1 
ATOM   2542  C CA    . ASN D 4  71  ? 103.654 99.030  95.774  1.00 7.24   ? 68  ASN D CA    1 
ATOM   2543  C C     . ASN D 4  71  ? 104.025 99.489  97.161  1.00 10.61  ? 68  ASN D C     1 
ATOM   2544  O O     . ASN D 4  71  ? 104.282 98.658  98.028  1.00 10.26  ? 68  ASN D O     1 
ATOM   2545  C CB    . ASN D 4  71  ? 104.885 99.070  94.924  1.00 5.73   ? 68  ASN D CB    1 
ATOM   2546  C CG    . ASN D 4  71  ? 104.734 98.319  93.703  1.00 11.83  ? 68  ASN D CG    1 
ATOM   2547  O OD1   . ASN D 4  71  ? 103.836 97.499  93.583  1.00 23.49  ? 68  ASN D OD1   1 
ATOM   2548  N ND2   . ASN D 4  71  ? 105.602 98.534  92.767  1.00 7.87   ? 68  ASN D ND2   1 
ATOM   2549  N N     . ASP D 4  72  ? 103.987 100.785 97.419  1.00 11.72  ? 69  ASP D N     1 
ATOM   2550  C CA    . ASP D 4  72  ? 104.361 101.285 98.723  1.00 5.20   ? 69  ASP D CA    1 
ATOM   2551  C C     . ASP D 4  72  ? 103.329 100.904 99.767  1.00 10.89  ? 69  ASP D C     1 
ATOM   2552  O O     . ASP D 4  72  ? 103.684 100.443 100.854 1.00 11.42  ? 69  ASP D O     1 
ATOM   2553  C CB    . ASP D 4  72  ? 104.528 102.788 98.622  1.00 10.31  ? 69  ASP D CB    1 
ATOM   2554  C CG    . ASP D 4  72  ? 105.158 103.444 99.780  1.00 13.92  ? 69  ASP D CG    1 
ATOM   2555  O OD1   . ASP D 4  72  ? 106.064 102.887 100.331 1.00 13.82  ? 69  ASP D OD1   1 
ATOM   2556  O OD2   . ASP D 4  72  ? 104.772 104.562 100.101 1.00 14.23  ? 69  ASP D OD2   1 
ATOM   2557  N N     . ILE D 4  73  ? 102.046 101.002 99.442  1.00 12.49  ? 70  ILE D N     1 
ATOM   2558  C CA    . ILE D 4  73  ? 101.051 100.620 100.424 1.00 7.04   ? 70  ILE D CA    1 
ATOM   2559  C C     . ILE D 4  73  ? 101.146 99.134  100.679 1.00 11.58  ? 70  ILE D C     1 
ATOM   2560  O O     . ILE D 4  73  ? 101.038 98.694  101.823 1.00 11.33  ? 70  ILE D O     1 
ATOM   2561  C CB    . ILE D 4  73  ? 99.634  100.988 100.008 1.00 7.27   ? 70  ILE D CB    1 
ATOM   2562  C CG1   . ILE D 4  73  ? 99.455  102.498 99.892  1.00 7.87   ? 70  ILE D CG1   1 
ATOM   2563  C CG2   . ILE D 4  73  ? 98.654  100.412 100.973 1.00 4.18   ? 70  ILE D CG2   1 
ATOM   2564  C CD1   . ILE D 4  73  ? 99.678  103.331 101.144 1.00 13.74  ? 70  ILE D CD1   1 
ATOM   2565  N N     . PHE D 4  74  ? 101.324 98.338  99.636  1.00 12.24  ? 71  PHE D N     1 
ATOM   2566  C CA    . PHE D 4  74  ? 101.432 96.917  99.822  1.00 6.18   ? 71  PHE D CA    1 
ATOM   2567  C C     . PHE D 4  74  ? 102.527 96.591  100.778 1.00 8.01   ? 71  PHE D C     1 
ATOM   2568  O O     . PHE D 4  74  ? 102.320 95.817  101.708 1.00 11.65  ? 71  PHE D O     1 
ATOM   2569  C CB    . PHE D 4  74  ? 101.729 96.215  98.518  1.00 11.44  ? 71  PHE D CB    1 
ATOM   2570  C CG    . PHE D 4  74  ? 101.999 94.777  98.663  1.00 10.56  ? 71  PHE D CG    1 
ATOM   2571  C CD1   . PHE D 4  74  ? 101.012 93.882  98.731  1.00 10.70  ? 71  PHE D CD1   1 
ATOM   2572  C CD2   . PHE D 4  74  ? 103.270 94.327  98.750  1.00 14.86  ? 71  PHE D CD2   1 
ATOM   2573  C CE1   . PHE D 4  74  ? 101.285 92.573  98.883  1.00 14.25  ? 71  PHE D CE1   1 
ATOM   2574  C CE2   . PHE D 4  74  ? 103.536 93.020  98.904  1.00 15.80  ? 71  PHE D CE2   1 
ATOM   2575  C CZ    . PHE D 4  74  ? 102.537 92.149  98.970  1.00 17.02  ? 71  PHE D CZ    1 
ATOM   2576  N N     . GLU D 4  75  ? 103.706 97.146  100.588 1.00 8.71   ? 72  GLU D N     1 
ATOM   2577  C CA    . GLU D 4  75  ? 104.758 96.787  101.501 1.00 6.31   ? 72  GLU D CA    1 
ATOM   2578  C C     . GLU D 4  75  ? 104.509 97.251  102.900 1.00 13.65  ? 72  GLU D C     1 
ATOM   2579  O O     . GLU D 4  75  ? 104.860 96.546  103.840 1.00 17.43  ? 72  GLU D O     1 
ATOM   2580  C CB    . GLU D 4  75  ? 106.091 97.283  101.047 1.00 4.45   ? 72  GLU D CB    1 
ATOM   2581  C CG    . GLU D 4  75  ? 106.588 96.556  99.845  1.00 13.42  ? 72  GLU D CG    1 
ATOM   2582  C CD    . GLU D 4  75  ? 107.922 97.006  99.352  1.00 23.73  ? 72  GLU D CD    1 
ATOM   2583  O OE1   . GLU D 4  75  ? 108.457 97.968  99.863  1.00 29.72  ? 72  GLU D OE1   1 
ATOM   2584  O OE2   . GLU D 4  75  ? 108.423 96.385  98.446  1.00 15.59  ? 72  GLU D OE2   1 
ATOM   2585  N N     . ARG D 4  76  ? 103.918 98.412  103.100 1.00 13.75  ? 73  ARG D N     1 
ATOM   2586  C CA    . ARG D 4  76  ? 103.718 98.800  104.474 1.00 7.43   ? 73  ARG D CA    1 
ATOM   2587  C C     . ARG D 4  76  ? 102.756 97.885  105.185 1.00 11.01  ? 73  ARG D C     1 
ATOM   2588  O O     . ARG D 4  76  ? 103.000 97.508  106.332 1.00 15.87  ? 73  ARG D O     1 
ATOM   2589  C CB    . ARG D 4  76  ? 103.115 100.141 104.584 1.00 7.83   ? 73  ARG D CB    1 
ATOM   2590  C CG    . ARG D 4  76  ? 103.920 101.258 104.207 1.00 7.88   ? 73  ARG D CG    1 
ATOM   2591  C CD    . ARG D 4  76  ? 103.140 102.464 104.375 1.00 6.05   ? 73  ARG D CD    1 
ATOM   2592  N NE    . ARG D 4  76  ? 103.776 103.583 103.845 1.00 10.46  ? 73  ARG D NE    1 
ATOM   2593  C CZ    . ARG D 4  76  ? 103.256 104.810 103.803 1.00 12.65  ? 73  ARG D CZ    1 
ATOM   2594  N NH1   . ARG D 4  76  ? 102.104 105.089 104.319 1.00 18.14  ? 73  ARG D NH1   1 
ATOM   2595  N NH2   . ARG D 4  76  ? 103.918 105.768 103.230 1.00 15.26  ? 73  ARG D NH2   1 
ATOM   2596  N N     . ILE D 4  77  ? 101.674 97.492  104.520 1.00 12.18  ? 74  ILE D N     1 
ATOM   2597  C CA    . ILE D 4  77  ? 100.716 96.645  105.187 1.00 7.83   ? 74  ILE D CA    1 
ATOM   2598  C C     . ILE D 4  77  ? 101.301 95.289  105.403 1.00 12.64  ? 74  ILE D C     1 
ATOM   2599  O O     . ILE D 4  77  ? 101.156 94.718  106.480 1.00 16.29  ? 74  ILE D O     1 
ATOM   2600  C CB    . ILE D 4  77  ? 99.405  96.517  104.436 1.00 8.82   ? 74  ILE D CB    1 
ATOM   2601  C CG1   . ILE D 4  77  ? 98.717  97.844  104.416 1.00 6.27   ? 74  ILE D CG1   1 
ATOM   2602  C CG2   . ILE D 4  77  ? 98.538  95.499  105.143 1.00 4.05   ? 74  ILE D CG2   1 
ATOM   2603  C CD1   . ILE D 4  77  ? 97.554  97.932  103.479 1.00 1.47   ? 74  ILE D CD1   1 
ATOM   2604  N N     . ALA D 4  78  ? 101.931 94.728  104.391 1.00 13.11  ? 75  ALA D N     1 
ATOM   2605  C CA    . ALA D 4  78  ? 102.511 93.424  104.550 1.00 9.82   ? 75  ALA D CA    1 
ATOM   2606  C C     . ALA D 4  78  ? 103.593 93.443  105.606 1.00 13.65  ? 75  ALA D C     1 
ATOM   2607  O O     . ALA D 4  78  ? 103.754 92.473  106.345 1.00 21.17  ? 75  ALA D O     1 
ATOM   2608  C CB    . ALA D 4  78  ? 103.062 92.941  103.243 1.00 18.38  ? 75  ALA D CB    1 
ATOM   2609  N N     . GLY D 4  79  ? 104.356 94.522  105.685 1.00 13.75  ? 76  GLY D N     1 
ATOM   2610  C CA    . GLY D 4  79  ? 105.418 94.644  106.657 1.00 12.95  ? 76  GLY D CA    1 
ATOM   2611  C C     . GLY D 4  79  ? 104.882 94.652  108.072 1.00 14.42  ? 76  GLY D C     1 
ATOM   2612  O O     . GLY D 4  79  ? 105.403 93.954  108.944 1.00 22.89  ? 76  GLY D O     1 
ATOM   2613  N N     . GLU D 4  80  ? 103.837 95.421  108.321 1.00 15.25  ? 77  GLU D N     1 
ATOM   2614  C CA    . GLU D 4  80  ? 103.294 95.450  109.656 1.00 7.47   ? 77  GLU D CA    1 
ATOM   2615  C C     . GLU D 4  80  ? 102.634 94.134  109.983 1.00 15.42  ? 77  GLU D C     1 
ATOM   2616  O O     . GLU D 4  80  ? 102.757 93.639  111.101 1.00 15.08  ? 77  GLU D O     1 
ATOM   2617  C CB    . GLU D 4  80  ? 102.300 96.557  109.804 1.00 5.76   ? 77  GLU D CB    1 
ATOM   2618  C CG    . GLU D 4  80  ? 101.774 96.748  111.180 1.00 6.05   ? 77  GLU D CG    1 
ATOM   2619  C CD    . GLU D 4  80  ? 102.820 97.204  112.154 1.00 10.71  ? 77  GLU D CD    1 
ATOM   2620  O OE1   . GLU D 4  80  ? 103.822 97.687  111.709 1.00 13.85  ? 77  GLU D OE1   1 
ATOM   2621  O OE2   . GLU D 4  80  ? 102.605 97.102  113.354 1.00 17.00  ? 77  GLU D OE2   1 
ATOM   2622  N N     . ALA D 4  81  ? 101.943 93.527  109.028 1.00 15.67  ? 78  ALA D N     1 
ATOM   2623  C CA    . ALA D 4  81  ? 101.301 92.271  109.322 1.00 10.51  ? 78  ALA D CA    1 
ATOM   2624  C C     . ALA D 4  81  ? 102.336 91.236  109.698 1.00 14.44  ? 78  ALA D C     1 
ATOM   2625  O O     . ALA D 4  81  ? 102.105 90.430  110.601 1.00 22.39  ? 78  ALA D O     1 
ATOM   2626  C CB    . ALA D 4  81  ? 100.484 91.827  108.159 1.00 15.68  ? 78  ALA D CB    1 
ATOM   2627  N N     . SER D 4  82  ? 103.498 91.275  109.061 1.00 15.48  ? 79  SER D N     1 
ATOM   2628  C CA    . SER D 4  82  ? 104.559 90.363  109.409 1.00 12.76  ? 79  SER D CA    1 
ATOM   2629  C C     . SER D 4  82  ? 104.995 90.559  110.822 1.00 17.96  ? 79  SER D C     1 
ATOM   2630  O O     . SER D 4  82  ? 105.180 89.587  111.561 1.00 25.19  ? 79  SER D O     1 
ATOM   2631  C CB    . SER D 4  82  ? 105.748 90.577  108.544 1.00 20.56  ? 79  SER D CB    1 
ATOM   2632  O OG    . SER D 4  82  ? 106.779 89.749  108.947 1.00 29.88  ? 79  SER D OG    1 
ATOM   2633  N N     . ARG D 4  83  ? 105.172 91.809  111.220 1.00 18.29  ? 80  ARG D N     1 
ATOM   2634  C CA    . ARG D 4  83  ? 105.584 92.105  112.570 1.00 12.69  ? 80  ARG D CA    1 
ATOM   2635  C C     . ARG D 4  83  ? 104.573 91.645  113.593 1.00 13.52  ? 80  ARG D C     1 
ATOM   2636  O O     . ARG D 4  83  ? 104.963 91.155  114.651 1.00 19.66  ? 80  ARG D O     1 
ATOM   2637  C CB    . ARG D 4  83  ? 105.820 93.556  112.740 1.00 11.92  ? 80  ARG D CB    1 
ATOM   2638  C CG    . ARG D 4  83  ? 106.396 93.931  114.026 1.00 14.99  ? 80  ARG D CG    1 
ATOM   2639  C CD    . ARG D 4  83  ? 106.635 95.410  114.139 1.00 13.54  ? 80  ARG D CD    1 
ATOM   2640  N NE    . ARG D 4  83  ? 107.642 95.911  113.222 1.00 6.15   ? 80  ARG D NE    1 
ATOM   2641  C CZ    . ARG D 4  83  ? 108.991 95.884  113.407 1.00 11.19  ? 80  ARG D CZ    1 
ATOM   2642  N NH1   . ARG D 4  83  ? 109.559 95.370  114.480 1.00 8.92   ? 80  ARG D NH1   1 
ATOM   2643  N NH2   . ARG D 4  83  ? 109.765 96.379  112.486 1.00 9.84   ? 80  ARG D NH2   1 
ATOM   2644  N N     . LEU D 4  84  ? 103.285 91.801  113.316 1.00 16.64  ? 81  LEU D N     1 
ATOM   2645  C CA    . LEU D 4  84  ? 102.294 91.338  114.266 1.00 13.88  ? 81  LEU D CA    1 
ATOM   2646  C C     . LEU D 4  84  ? 102.366 89.840  114.425 1.00 18.64  ? 81  LEU D C     1 
ATOM   2647  O O     . LEU D 4  84  ? 102.254 89.329  115.544 1.00 21.21  ? 81  LEU D O     1 
ATOM   2648  C CB    . LEU D 4  84  ? 100.890 91.665  113.789 1.00 15.30  ? 81  LEU D CB    1 
ATOM   2649  C CG    . LEU D 4  84  ? 100.464 93.080  113.804 1.00 12.50  ? 81  LEU D CG    1 
ATOM   2650  C CD1   . LEU D 4  84  ? 99.199  93.205  113.040 1.00 16.04  ? 81  LEU D CD1   1 
ATOM   2651  C CD2   . LEU D 4  84  ? 100.198 93.516  115.202 1.00 16.52  ? 81  LEU D CD2   1 
ATOM   2652  N N     . ALA D 4  85  ? 102.557 89.114  113.331 1.00 20.19  ? 82  ALA D N     1 
ATOM   2653  C CA    . ALA D 4  85  ? 102.650 87.684  113.459 1.00 12.76  ? 82  ALA D CA    1 
ATOM   2654  C C     . ALA D 4  85  ? 103.852 87.326  114.293 1.00 15.94  ? 82  ALA D C     1 
ATOM   2655  O O     . ALA D 4  85  ? 103.787 86.446  115.142 1.00 22.56  ? 82  ALA D O     1 
ATOM   2656  C CB    . ALA D 4  85  ? 102.742 87.036  112.101 1.00 20.37  ? 82  ALA D CB    1 
ATOM   2657  N N     . HIS D 4  86  ? 104.950 88.034  114.122 1.00 17.50  ? 83  HIS D N     1 
ATOM   2658  C CA    . HIS D 4  86  ? 106.127 87.729  114.904 1.00 17.30  ? 83  HIS D CA    1 
ATOM   2659  C C     . HIS D 4  86  ? 105.885 87.994  116.370 1.00 20.15  ? 83  HIS D C     1 
ATOM   2660  O O     . HIS D 4  86  ? 106.147 87.156  117.219 1.00 28.09  ? 83  HIS D O     1 
ATOM   2661  C CB    . HIS D 4  86  ? 107.305 88.538  114.424 1.00 25.72  ? 83  HIS D CB    1 
ATOM   2662  C CG    . HIS D 4  86  ? 108.555 88.275  115.152 1.00 41.06  ? 83  HIS D CG    1 
ATOM   2663  N ND1   . HIS D 4  86  ? 109.283 87.118  114.996 1.00 49.90  ? 83  HIS D ND1   1 
ATOM   2664  C CD2   . HIS D 4  86  ? 109.228 89.028  116.042 1.00 50.15  ? 83  HIS D CD2   1 
ATOM   2665  C CE1   . HIS D 4  86  ? 110.357 87.176  115.768 1.00 54.19  ? 83  HIS D CE1   1 
ATOM   2666  N NE2   . HIS D 4  86  ? 110.346 88.327  116.406 1.00 52.78  ? 83  HIS D NE2   1 
ATOM   2667  N N     . TYR D 4  87  ? 105.333 89.147  116.690 1.00 22.60  ? 84  TYR D N     1 
ATOM   2668  C CA    . TYR D 4  87  ? 105.079 89.542  118.067 1.00 16.96  ? 84  TYR D CA    1 
ATOM   2669  C C     . TYR D 4  87  ? 104.228 88.537  118.805 1.00 17.19  ? 84  TYR D C     1 
ATOM   2670  O O     . TYR D 4  87  ? 104.490 88.212  119.958 1.00 23.43  ? 84  TYR D O     1 
ATOM   2671  C CB    . TYR D 4  87  ? 104.464 90.938  118.108 1.00 16.14  ? 84  TYR D CB    1 
ATOM   2672  C CG    . TYR D 4  87  ? 104.026 91.437  119.473 1.00 22.46  ? 84  TYR D CG    1 
ATOM   2673  C CD1   . TYR D 4  87  ? 104.717 91.111  120.620 1.00 30.95  ? 84  TYR D CD1   1 
ATOM   2674  C CD2   . TYR D 4  87  ? 102.924 92.267  119.573 1.00 25.25  ? 84  TYR D CD2   1 
ATOM   2675  C CE1   . TYR D 4  87  ? 104.295 91.575  121.838 1.00 12.91  ? 84  TYR D CE1   1 
ATOM   2676  C CE2   . TYR D 4  87  ? 102.518 92.739  120.809 1.00 10.57  ? 84  TYR D CE2   1 
ATOM   2677  C CZ    . TYR D 4  87  ? 103.204 92.381  121.926 1.00 4.45   ? 84  TYR D CZ    1 
ATOM   2678  O OH    . TYR D 4  87  ? 102.828 92.821  123.155 1.00 16.54  ? 84  TYR D OH    1 
ATOM   2679  N N     . ASN D 4  88  ? 103.222 88.007  118.148 1.00 18.52  ? 85  ASN D N     1 
ATOM   2680  C CA    . ASN D 4  88  ? 102.322 87.080  118.790 1.00 17.07  ? 85  ASN D CA    1 
ATOM   2681  C C     . ASN D 4  88  ? 102.732 85.634  118.596 1.00 21.07  ? 85  ASN D C     1 
ATOM   2682  O O     . ASN D 4  88  ? 101.968 84.723  118.919 1.00 27.41  ? 85  ASN D O     1 
ATOM   2683  C CB    . ASN D 4  88  ? 100.940 87.323  118.286 1.00 15.19  ? 85  ASN D CB    1 
ATOM   2684  C CG    . ASN D 4  88  ? 100.445 88.592  118.774 1.00 20.78  ? 85  ASN D CG    1 
ATOM   2685  O OD1   . ASN D 4  88  ? 99.948  88.703  119.896 1.00 30.32  ? 85  ASN D OD1   1 
ATOM   2686  N ND2   . ASN D 4  88  ? 100.588 89.597  117.973 1.00 24.42  ? 85  ASN D ND2   1 
ATOM   2687  N N     . LYS D 4  89  ? 103.943 85.451  118.081 1.00 19.62  ? 86  LYS D N     1 
ATOM   2688  C CA    . LYS D 4  89  ? 104.576 84.151  117.941 1.00 19.87  ? 86  LYS D CA    1 
ATOM   2689  C C     . LYS D 4  89  ? 103.782 83.230  117.018 1.00 23.39  ? 86  LYS D C     1 
ATOM   2690  O O     . LYS D 4  89  ? 103.565 82.063  117.338 1.00 34.75  ? 86  LYS D O     1 
ATOM   2691  C CB    . LYS D 4  89  ? 104.717 83.531  119.332 1.00 19.49  ? 86  LYS D CB    1 
ATOM   2692  C CG    . LYS D 4  89  ? 105.756 82.428  119.460 1.00 27.70  ? 86  LYS D CG    1 
ATOM   2693  C CD    . LYS D 4  89  ? 105.806 81.918  120.893 1.00 34.39  ? 86  LYS D CD    1 
ATOM   2694  C CE    . LYS D 4  89  ? 107.125 81.225  121.203 1.00 42.70  ? 86  LYS D CE    1 
ATOM   2695  N NZ    . LYS D 4  89  ? 108.253 82.193  121.323 1.00 44.53  ? 86  LYS D NZ    1 
ATOM   2696  N N     . ARG D 4  90  ? 103.353 83.741  115.860 1.00 21.04  ? 87  ARG D N     1 
ATOM   2697  C CA    . ARG D 4  90  ? 102.644 82.948  114.903 1.00 20.55  ? 87  ARG D CA    1 
ATOM   2698  C C     . ARG D 4  90  ? 103.443 82.872  113.638 1.00 26.03  ? 87  ARG D C     1 
ATOM   2699  O O     . ARG D 4  90  ? 104.310 83.701  113.384 1.00 35.02  ? 87  ARG D O     1 
ATOM   2700  C CB    . ARG D 4  90  ? 101.318 83.540  114.594 1.00 25.99  ? 87  ARG D CB    1 
ATOM   2701  C CG    . ARG D 4  90  ? 100.435 83.760  115.731 1.00 34.18  ? 87  ARG D CG    1 
ATOM   2702  C CD    . ARG D 4  90  ? 100.044 82.547  116.344 1.00 40.41  ? 87  ARG D CD    1 
ATOM   2703  N NE    . ARG D 4  90  ? 99.134  82.757  117.398 1.00 43.99  ? 87  ARG D NE    1 
ATOM   2704  C CZ    . ARG D 4  90  ? 97.804  82.784  117.280 1.00 53.97  ? 87  ARG D CZ    1 
ATOM   2705  N NH1   . ARG D 4  90  ? 97.218  82.640  116.125 1.00 51.49  ? 87  ARG D NH1   1 
ATOM   2706  N NH2   . ARG D 4  90  ? 97.087  82.943  118.354 1.00 73.37  ? 87  ARG D NH2   1 
ATOM   2707  N N     . SER D 4  91  ? 103.174 81.860  112.836 1.00 27.38  ? 88  SER D N     1 
ATOM   2708  C CA    . SER D 4  91  ? 103.875 81.690  111.589 1.00 18.85  ? 88  SER D CA    1 
ATOM   2709  C C     . SER D 4  91  ? 103.015 82.046  110.409 1.00 24.80  ? 88  SER D C     1 
ATOM   2710  O O     . SER D 4  91  ? 103.455 81.946  109.262 1.00 28.17  ? 88  SER D O     1 
ATOM   2711  C CB    . SER D 4  91  ? 104.305 80.257  111.456 1.00 25.35  ? 88  SER D CB    1 
ATOM   2712  O OG    . SER D 4  91  ? 105.207 79.907  112.458 1.00 39.42  ? 88  SER D OG    1 
ATOM   2713  N N     . THR D 4  92  ? 101.785 82.445  110.673 1.00 23.45  ? 89  THR D N     1 
ATOM   2714  C CA    . THR D 4  92  ? 100.848 82.652  109.598 1.00 16.94  ? 89  THR D CA    1 
ATOM   2715  C C     . THR D 4  92  ? 100.273 84.035  109.572 1.00 19.30  ? 89  THR D C     1 
ATOM   2716  O O     . THR D 4  92  ? 99.828  84.540  110.592 1.00 26.31  ? 89  THR D O     1 
ATOM   2717  C CB    . THR D 4  92  ? 99.655  81.696  109.760 1.00 19.67  ? 89  THR D CB    1 
ATOM   2718  O OG1   . THR D 4  92  ? 100.114 80.360  109.851 1.00 32.69  ? 89  THR D OG1   1 
ATOM   2719  C CG2   . THR D 4  92  ? 98.763  81.779  108.539 1.00 28.07  ? 89  THR D CG2   1 
ATOM   2720  N N     . ILE D 4  93  ? 100.224 84.622  108.396 1.00 18.39  ? 90  ILE D N     1 
ATOM   2721  C CA    . ILE D 4  93  ? 99.541  85.888  108.212 1.00 11.08  ? 90  ILE D CA    1 
ATOM   2722  C C     . ILE D 4  93  ? 98.143  85.578  107.763 1.00 12.23  ? 90  ILE D C     1 
ATOM   2723  O O     . ILE D 4  93  ? 97.944  84.879  106.780 1.00 17.18  ? 90  ILE D O     1 
ATOM   2724  C CB    . ILE D 4  93  ? 100.251 86.794  107.209 1.00 13.96  ? 90  ILE D CB    1 
ATOM   2725  C CG1   . ILE D 4  93  ? 101.593 87.156  107.764 1.00 16.07  ? 90  ILE D CG1   1 
ATOM   2726  C CG2   . ILE D 4  93  ? 99.410  87.996  106.884 1.00 12.65  ? 90  ILE D CG2   1 
ATOM   2727  C CD1   . ILE D 4  93  ? 102.515 87.861  106.806 1.00 21.34  ? 90  ILE D CD1   1 
ATOM   2728  N N     . THR D 4  94  ? 97.165  86.071  108.471 1.00 8.61   ? 91  THR D N     1 
ATOM   2729  C CA    . THR D 4  94  ? 95.787  85.792  108.141 1.00 5.68   ? 91  THR D CA    1 
ATOM   2730  C C     . THR D 4  94  ? 95.089  87.089  107.924 1.00 7.49   ? 91  THR D C     1 
ATOM   2731  O O     . THR D 4  94  ? 95.702  88.155  108.022 1.00 8.70   ? 91  THR D O     1 
ATOM   2732  C CB    . THR D 4  94  ? 95.066  85.057  109.248 1.00 4.53   ? 91  THR D CB    1 
ATOM   2733  O OG1   . THR D 4  94  ? 94.872  85.948  110.346 1.00 9.86   ? 91  THR D OG1   1 
ATOM   2734  C CG2   . THR D 4  94  ? 95.849  83.869  109.696 1.00 0.30   ? 91  THR D CG2   1 
ATOM   2735  N N     . SER D 4  95  ? 93.810  87.034  107.626 1.00 7.66   ? 92  SER D N     1 
ATOM   2736  C CA    . SER D 4  95  ? 93.074  88.254  107.423 1.00 5.40   ? 92  SER D CA    1 
ATOM   2737  C C     . SER D 4  95  ? 92.995  89.074  108.694 1.00 9.98   ? 92  SER D C     1 
ATOM   2738  O O     . SER D 4  95  ? 92.737  90.273  108.640 1.00 9.39   ? 92  SER D O     1 
ATOM   2739  C CB    . SER D 4  95  ? 91.685  87.956  106.939 1.00 8.43   ? 92  SER D CB    1 
ATOM   2740  O OG    . SER D 4  95  ? 90.946  87.313  107.924 1.00 7.46   ? 92  SER D OG    1 
ATOM   2741  N N     . ARG D 4  96  ? 93.234  88.476  109.851 1.00 11.99  ? 93  ARG D N     1 
ATOM   2742  C CA    . ARG D 4  96  ? 93.151  89.251  111.057 1.00 3.57   ? 93  ARG D CA    1 
ATOM   2743  C C     . ARG D 4  96  ? 94.363  90.162  111.173 1.00 8.80   ? 93  ARG D C     1 
ATOM   2744  O O     . ARG D 4  96  ? 94.220  91.317  111.553 1.00 9.89   ? 93  ARG D O     1 
ATOM   2745  C CB    . ARG D 4  96  ? 93.034  88.347  112.231 1.00 3.65   ? 93  ARG D CB    1 
ATOM   2746  C CG    . ARG D 4  96  ? 92.758  89.008  113.532 1.00 13.69  ? 93  ARG D CG    1 
ATOM   2747  C CD    . ARG D 4  96  ? 92.595  87.993  114.649 1.00 17.36  ? 93  ARG D CD    1 
ATOM   2748  N NE    . ARG D 4  96  ? 92.432  88.617  115.976 1.00 13.25  ? 93  ARG D NE    1 
ATOM   2749  C CZ    . ARG D 4  96  ? 91.298  89.033  116.526 1.00 9.87   ? 93  ARG D CZ    1 
ATOM   2750  N NH1   . ARG D 4  96  ? 90.140  88.922  115.937 1.00 2.49   ? 93  ARG D NH1   1 
ATOM   2751  N NH2   . ARG D 4  96  ? 91.410  89.557  117.696 1.00 13.54  ? 93  ARG D NH2   1 
ATOM   2752  N N     . GLU D 4  97  ? 95.560  89.693  110.832 1.00 8.78   ? 94  GLU D N     1 
ATOM   2753  C CA    . GLU D 4  97  ? 96.712  90.571  110.881 1.00 5.35   ? 94  GLU D CA    1 
ATOM   2754  C C     . GLU D 4  97  ? 96.603  91.625  109.849 1.00 11.02  ? 94  GLU D C     1 
ATOM   2755  O O     . GLU D 4  97  ? 97.040  92.747  110.076 1.00 13.14  ? 94  GLU D O     1 
ATOM   2756  C CB    . GLU D 4  97  ? 98.020  89.874  110.664 1.00 7.20   ? 94  GLU D CB    1 
ATOM   2757  C CG    . GLU D 4  97  ? 98.470  89.066  111.742 1.00 10.17  ? 94  GLU D CG    1 
ATOM   2758  C CD    . GLU D 4  97  ? 97.795  87.851  111.803 1.00 13.67  ? 94  GLU D CD    1 
ATOM   2759  O OE1   . GLU D 4  97  ? 97.031  87.571  110.898 1.00 11.42  ? 94  GLU D OE1   1 
ATOM   2760  O OE2   . GLU D 4  97  ? 97.979  87.148  112.746 1.00 15.84  ? 94  GLU D OE2   1 
ATOM   2761  N N     . ILE D 4  98  ? 96.058  91.294  108.694 1.00 11.64  ? 95  ILE D N     1 
ATOM   2762  C CA    . ILE D 4  98  ? 95.982  92.325  107.702 1.00 7.99   ? 95  ILE D CA    1 
ATOM   2763  C C     . ILE D 4  98  ? 95.051  93.386  108.236 1.00 11.64  ? 95  ILE D C     1 
ATOM   2764  O O     . ILE D 4  98  ? 95.354  94.563  108.110 1.00 11.32  ? 95  ILE D O     1 
ATOM   2765  C CB    . ILE D 4  98  ? 95.494  91.850  106.340 1.00 6.42   ? 95  ILE D CB    1 
ATOM   2766  C CG1   . ILE D 4  98  ? 96.441  90.788  105.716 1.00 7.45   ? 95  ILE D CG1   1 
ATOM   2767  C CG2   . ILE D 4  98  ? 95.426  93.061  105.431 1.00 4.53   ? 95  ILE D CG2   1 
ATOM   2768  C CD1   . ILE D 4  98  ? 97.854  91.205  105.380 1.00 4.16   ? 95  ILE D CD1   1 
ATOM   2769  N N     . GLN D 4  99  ? 93.926  93.011  108.833 1.00 11.33  ? 96  GLN D N     1 
ATOM   2770  C CA    . GLN D 4  99  ? 93.025  94.014  109.357 1.00 7.34   ? 96  GLN D CA    1 
ATOM   2771  C C     . GLN D 4  99  ? 93.642  94.876  110.427 1.00 9.60   ? 96  GLN D C     1 
ATOM   2772  O O     . GLN D 4  99  ? 93.452  96.094  110.427 1.00 11.48  ? 96  GLN D O     1 
ATOM   2773  C CB    . GLN D 4  99  ? 91.824  93.357  109.930 1.00 6.55   ? 96  GLN D CB    1 
ATOM   2774  C CG    . GLN D 4  99  ? 90.856  94.249  110.415 1.00 7.56   ? 96  GLN D CG    1 
ATOM   2775  C CD    . GLN D 4  99  ? 89.727  93.542  110.825 1.00 7.96   ? 96  GLN D CD    1 
ATOM   2776  O OE1   . GLN D 4  99  ? 89.605  93.118  111.961 1.00 22.01  ? 96  GLN D OE1   1 
ATOM   2777  N NE2   . GLN D 4  99  ? 88.836  93.352  109.911 1.00 10.39  ? 96  GLN D NE2   1 
ATOM   2778  N N     . THR D 4  100 ? 94.384  94.280  111.339 1.00 11.48  ? 97  THR D N     1 
ATOM   2779  C CA    . THR D 4  100 ? 95.021  95.059  112.365 1.00 7.54   ? 97  THR D CA    1 
ATOM   2780  C C     . THR D 4  100 ? 96.037  95.980  111.738 1.00 12.35  ? 97  THR D C     1 
ATOM   2781  O O     . THR D 4  100 ? 96.147  97.138  112.141 1.00 9.37   ? 97  THR D O     1 
ATOM   2782  C CB    . THR D 4  100 ? 95.653  94.180  113.442 1.00 10.49  ? 97  THR D CB    1 
ATOM   2783  O OG1   . THR D 4  100 ? 94.627  93.422  114.104 1.00 16.06  ? 97  THR D OG1   1 
ATOM   2784  C CG2   . THR D 4  100 ? 96.368  95.025  114.457 1.00 11.78  ? 97  THR D CG2   1 
ATOM   2785  N N     . ALA D 4  101 ? 96.808  95.491  110.773 1.00 11.84  ? 98  ALA D N     1 
ATOM   2786  C CA    . ALA D 4  101 ? 97.798  96.322  110.130 1.00 6.12   ? 98  ALA D CA    1 
ATOM   2787  C C     . ALA D 4  101 ? 97.151  97.505  109.438 1.00 9.87   ? 98  ALA D C     1 
ATOM   2788  O O     . ALA D 4  101 ? 97.678  98.614  109.510 1.00 12.11  ? 98  ALA D O     1 
ATOM   2789  C CB    . ALA D 4  101 ? 98.574  95.517  109.141 1.00 11.30  ? 98  ALA D CB    1 
ATOM   2790  N N     . VAL D 4  102 ? 95.982  97.311  108.839 1.00 12.28  ? 99  VAL D N     1 
ATOM   2791  C CA    . VAL D 4  102 ? 95.282  98.409  108.200 1.00 8.61   ? 99  VAL D CA    1 
ATOM   2792  C C     . VAL D 4  102 ? 94.884  99.441  109.209 1.00 11.30  ? 99  VAL D C     1 
ATOM   2793  O O     . VAL D 4  102 ? 95.074  100.630 108.984 1.00 11.51  ? 99  VAL D O     1 
ATOM   2794  C CB    . VAL D 4  102 ? 94.048  97.914  107.463 1.00 10.09  ? 99  VAL D CB    1 
ATOM   2795  C CG1   . VAL D 4  102 ? 93.200  99.035  107.006 1.00 12.23  ? 99  VAL D CG1   1 
ATOM   2796  C CG2   . VAL D 4  102 ? 94.491  97.173  106.273 1.00 3.84   ? 99  VAL D CG2   1 
ATOM   2797  N N     . ARG D 4  103 ? 94.350  99.029  110.341 1.00 12.32  ? 100 ARG D N     1 
ATOM   2798  C CA    . ARG D 4  103 ? 93.986  100.022 111.329 1.00 7.85   ? 100 ARG D CA    1 
ATOM   2799  C C     . ARG D 4  103 ? 95.159  100.790 111.865 1.00 7.84   ? 100 ARG D C     1 
ATOM   2800  O O     . ARG D 4  103 ? 95.040  101.969 112.173 1.00 11.62  ? 100 ARG D O     1 
ATOM   2801  C CB    . ARG D 4  103 ? 93.344  99.419  112.502 1.00 7.57   ? 100 ARG D CB    1 
ATOM   2802  C CG    . ARG D 4  103 ? 92.054  98.922  112.285 1.00 6.90   ? 100 ARG D CG    1 
ATOM   2803  C CD    . ARG D 4  103 ? 91.524  98.426  113.507 1.00 3.60   ? 100 ARG D CD    1 
ATOM   2804  N NE    . ARG D 4  103 ? 90.284  97.822  113.321 1.00 5.18   ? 100 ARG D NE    1 
ATOM   2805  C CZ    . ARG D 4  103 ? 89.132  98.469  113.223 1.00 18.54  ? 100 ARG D CZ    1 
ATOM   2806  N NH1   . ARG D 4  103 ? 89.088  99.777  113.285 1.00 14.53  ? 100 ARG D NH1   1 
ATOM   2807  N NH2   . ARG D 4  103 ? 88.022  97.789  113.064 1.00 13.86  ? 100 ARG D NH2   1 
ATOM   2808  N N     . LEU D 4  104 ? 96.284  100.138 112.046 1.00 8.33   ? 101 LEU D N     1 
ATOM   2809  C CA    . LEU D 4  104 ? 97.422  100.860 112.549 1.00 3.90   ? 101 LEU D CA    1 
ATOM   2810  C C     . LEU D 4  104 ? 97.970  101.852 111.533 1.00 7.55   ? 101 LEU D C     1 
ATOM   2811  O O     . LEU D 4  104 ? 98.371  102.959 111.897 1.00 13.67  ? 101 LEU D O     1 
ATOM   2812  C CB    . LEU D 4  104 ? 98.524  99.878  112.932 1.00 3.97   ? 101 LEU D CB    1 
ATOM   2813  C CG    . LEU D 4  104 ? 98.290  98.994  114.144 1.00 4.06   ? 101 LEU D CG    1 
ATOM   2814  C CD1   . LEU D 4  104 ? 99.338  97.952  114.184 1.00 7.86   ? 101 LEU D CD1   1 
ATOM   2815  C CD2   . LEU D 4  104 ? 98.391  99.803  115.412 1.00 6.75   ? 101 LEU D CD2   1 
ATOM   2816  N N     . LEU D 4  105 ? 97.986  101.490 110.259 1.00 10.24  ? 102 LEU D N     1 
ATOM   2817  C CA    . LEU D 4  105 ? 98.538  102.362 109.230 1.00 5.84   ? 102 LEU D CA    1 
ATOM   2818  C C     . LEU D 4  105 ? 97.630  103.424 108.628 1.00 8.66   ? 102 LEU D C     1 
ATOM   2819  O O     . LEU D 4  105 ? 98.108  104.511 108.312 1.00 17.91  ? 102 LEU D O     1 
ATOM   2820  C CB    . LEU D 4  105 ? 99.033  101.483 108.106 1.00 5.29   ? 102 LEU D CB    1 
ATOM   2821  C CG    . LEU D 4  105 ? 100.192 100.579 108.433 1.00 3.11   ? 102 LEU D CG    1 
ATOM   2822  C CD1   . LEU D 4  105 ? 100.343 99.597  107.344 1.00 0.51   ? 102 LEU D CD1   1 
ATOM   2823  C CD2   . LEU D 4  105 ? 101.468 101.377 108.537 1.00 4.74   ? 102 LEU D CD2   1 
ATOM   2824  N N     . LEU D 4  106 ? 96.353  103.160 108.428 1.00 10.76  ? 103 LEU D N     1 
ATOM   2825  C CA    . LEU D 4  106 ? 95.563  104.179 107.784 1.00 10.29  ? 103 LEU D CA    1 
ATOM   2826  C C     . LEU D 4  106 ? 94.896  105.048 108.830 1.00 18.66  ? 103 LEU D C     1 
ATOM   2827  O O     . LEU D 4  106 ? 94.519  104.550 109.877 1.00 21.40  ? 103 LEU D O     1 
ATOM   2828  C CB    . LEU D 4  106 ? 94.487  103.557 106.902 1.00 14.34  ? 103 LEU D CB    1 
ATOM   2829  C CG    . LEU D 4  106 ? 94.899  102.658 105.768 1.00 11.78  ? 103 LEU D CG    1 
ATOM   2830  C CD1   . LEU D 4  106 ? 93.645  102.201 105.068 1.00 16.29  ? 103 LEU D CD1   1 
ATOM   2831  C CD2   . LEU D 4  106 ? 95.786  103.348 104.829 1.00 16.73  ? 103 LEU D CD2   1 
ATOM   2832  N N     . PRO D 4  107 ? 94.780  106.361 108.622 1.00 20.20  ? 104 PRO D N     1 
ATOM   2833  C CA    . PRO D 4  107 ? 94.100  107.290 109.488 1.00 19.15  ? 104 PRO D CA    1 
ATOM   2834  C C     . PRO D 4  107 ? 92.587  107.348 109.382 1.00 19.85  ? 104 PRO D C     1 
ATOM   2835  O O     . PRO D 4  107 ? 92.020  107.205 108.295 1.00 20.70  ? 104 PRO D O     1 
ATOM   2836  C CB    . PRO D 4  107 ? 94.668  108.606 109.002 1.00 19.05  ? 104 PRO D CB    1 
ATOM   2837  C CG    . PRO D 4  107 ? 94.924  108.376 107.563 1.00 16.06  ? 104 PRO D CG    1 
ATOM   2838  C CD    . PRO D 4  107 ? 95.397  106.977 107.471 1.00 19.57  ? 104 PRO D CD    1 
ATOM   2839  N N     . GLY D 4  108 ? 91.956  107.711 110.476 1.00 21.53  ? 105 GLY D N     1 
ATOM   2840  C CA    . GLY D 4  108 ? 90.574  108.148 110.470 1.00 16.01  ? 105 GLY D CA    1 
ATOM   2841  C C     . GLY D 4  108 ? 89.577  107.216 109.837 1.00 14.66  ? 105 GLY D C     1 
ATOM   2842  O O     . GLY D 4  108 ? 89.554  106.002 110.047 1.00 21.69  ? 105 GLY D O     1 
ATOM   2843  N N     . GLU D 4  109 ? 88.791  107.820 108.976 1.00 16.11  ? 106 GLU D N     1 
ATOM   2844  C CA    . GLU D 4  109 ? 87.743  107.158 108.250 1.00 16.95  ? 106 GLU D CA    1 
ATOM   2845  C C     . GLU D 4  109 ? 88.290  106.425 107.073 1.00 18.99  ? 106 GLU D C     1 
ATOM   2846  O O     . GLU D 4  109 ? 87.576  105.665 106.425 1.00 22.62  ? 106 GLU D O     1 
ATOM   2847  C CB    . GLU D 4  109 ? 86.752  108.174 107.725 1.00 21.54  ? 106 GLU D CB    1 
ATOM   2848  C CG    . GLU D 4  109 ? 86.043  108.919 108.769 1.00 31.86  ? 106 GLU D CG    1 
ATOM   2849  C CD    . GLU D 4  109 ? 85.038  108.111 109.494 1.00 46.35  ? 106 GLU D CD    1 
ATOM   2850  O OE1   . GLU D 4  109 ? 84.089  107.674 108.878 1.00 34.77  ? 106 GLU D OE1   1 
ATOM   2851  O OE2   . GLU D 4  109 ? 85.199  107.914 110.672 1.00 47.89  ? 106 GLU D OE2   1 
ATOM   2852  N N     . LEU D 4  110 ? 89.540  106.662 106.737 1.00 17.40  ? 107 LEU D N     1 
ATOM   2853  C CA    . LEU D 4  110 ? 90.049  106.006 105.574 1.00 13.18  ? 107 LEU D CA    1 
ATOM   2854  C C     . LEU D 4  110 ? 90.219  104.581 106.034 1.00 17.95  ? 107 LEU D C     1 
ATOM   2855  O O     . LEU D 4  110 ? 89.854  103.631 105.341 1.00 19.32  ? 107 LEU D O     1 
ATOM   2856  C CB    . LEU D 4  110 ? 91.363  106.666 105.139 1.00 13.90  ? 107 LEU D CB    1 
ATOM   2857  C CG    . LEU D 4  110 ? 92.002  106.247 103.834 1.00 15.46  ? 107 LEU D CG    1 
ATOM   2858  C CD1   . LEU D 4  110 ? 91.082  106.555 102.671 1.00 21.63  ? 107 LEU D CD1   1 
ATOM   2859  C CD2   . LEU D 4  110 ? 93.314  106.984 103.673 1.00 16.24  ? 107 LEU D CD2   1 
ATOM   2860  N N     . ALA D 4  111 ? 90.723  104.433 107.261 1.00 17.60  ? 108 ALA D N     1 
ATOM   2861  C CA    . ALA D 4  111 ? 90.903  103.121 107.832 1.00 14.54  ? 108 ALA D CA    1 
ATOM   2862  C C     . ALA D 4  111 ? 89.604  102.407 107.995 1.00 14.73  ? 108 ALA D C     1 
ATOM   2863  O O     . ALA D 4  111 ? 89.502  101.231 107.680 1.00 21.01  ? 108 ALA D O     1 
ATOM   2864  C CB    . ALA D 4  111 ? 91.532  103.217 109.179 1.00 16.05  ? 108 ALA D CB    1 
ATOM   2865  N N     . LYS D 4  112 ? 88.585  103.106 108.434 1.00 15.26  ? 109 LYS D N     1 
ATOM   2866  C CA    . LYS D 4  112 ? 87.320  102.438 108.614 1.00 13.08  ? 109 LYS D CA    1 
ATOM   2867  C C     . LYS D 4  112 ? 86.721  101.926 107.346 1.00 16.38  ? 109 LYS D C     1 
ATOM   2868  O O     . LYS D 4  112 ? 86.200  100.808 107.307 1.00 21.45  ? 109 LYS D O     1 
ATOM   2869  C CB    . LYS D 4  112 ? 86.317  103.327 109.239 1.00 16.98  ? 109 LYS D CB    1 
ATOM   2870  C CG    . LYS D 4  112 ? 84.998  102.651 109.447 1.00 23.59  ? 109 LYS D CG    1 
ATOM   2871  C CD    . LYS D 4  112 ? 84.002  103.538 110.211 1.00 42.38  ? 109 LYS D CD    1 
ATOM   2872  C CE    . LYS D 4  112 ? 83.370  104.613 109.316 1.00 37.62  ? 109 LYS D CE    1 
ATOM   2873  N NZ    . LYS D 4  112 ? 82.352  105.422 110.036 1.00 25.95  ? 109 LYS D NZ    1 
ATOM   2874  N N     . HIS D 4  113 ? 86.766  102.711 106.295 1.00 16.35  ? 110 HIS D N     1 
ATOM   2875  C CA    . HIS D 4  113 ? 86.152  102.226 105.096 1.00 13.99  ? 110 HIS D CA    1 
ATOM   2876  C C     . HIS D 4  113 ? 86.965  101.095 104.515 1.00 16.89  ? 110 HIS D C     1 
ATOM   2877  O O     . HIS D 4  113 ? 86.393  100.162 103.948 1.00 21.61  ? 110 HIS D O     1 
ATOM   2878  C CB    . HIS D 4  113 ? 85.966  103.339 104.099 1.00 17.97  ? 110 HIS D CB    1 
ATOM   2879  C CG    . HIS D 4  113 ? 84.904  104.294 104.484 1.00 21.45  ? 110 HIS D CG    1 
ATOM   2880  N ND1   . HIS D 4  113 ? 83.583  103.929 104.585 1.00 30.65  ? 110 HIS D ND1   1 
ATOM   2881  C CD2   . HIS D 4  113 ? 84.949  105.605 104.780 1.00 18.97  ? 110 HIS D CD2   1 
ATOM   2882  C CE1   . HIS D 4  113 ? 82.870  104.975 104.940 1.00 23.84  ? 110 HIS D CE1   1 
ATOM   2883  N NE2   . HIS D 4  113 ? 83.672  105.999 105.065 1.00 20.31  ? 110 HIS D NE2   1 
ATOM   2884  N N     . ALA D 4  114 ? 88.292  101.144 104.646 1.00 16.84  ? 111 ALA D N     1 
ATOM   2885  C CA    . ALA D 4  114 ? 89.108  100.067 104.137 1.00 11.15  ? 111 ALA D CA    1 
ATOM   2886  C C     . ALA D 4  114 ? 88.790  98.774  104.856 1.00 16.55  ? 111 ALA D C     1 
ATOM   2887  O O     . ALA D 4  114 ? 88.699  97.714  104.235 1.00 21.65  ? 111 ALA D O     1 
ATOM   2888  C CB    . ALA D 4  114 ? 90.556  100.401 104.311 1.00 15.38  ? 111 ALA D CB    1 
ATOM   2889  N N     . VAL D 4  115 ? 88.557  98.848  106.160 1.00 17.90  ? 112 VAL D N     1 
ATOM   2890  C CA    . VAL D 4  115 ? 88.234  97.661  106.915 1.00 11.27  ? 112 VAL D CA    1 
ATOM   2891  C C     . VAL D 4  115 ? 86.929  97.081  106.466 1.00 16.22  ? 112 VAL D C     1 
ATOM   2892  O O     . VAL D 4  115 ? 86.816  95.859  106.337 1.00 23.61  ? 112 VAL D O     1 
ATOM   2893  C CB    . VAL D 4  115 ? 88.242  97.932  108.410 1.00 11.16  ? 112 VAL D CB    1 
ATOM   2894  C CG1   . VAL D 4  115 ? 87.690  96.767  109.157 1.00 21.09  ? 112 VAL D CG1   1 
ATOM   2895  C CG2   . VAL D 4  115 ? 89.676  98.142  108.851 1.00 15.27  ? 112 VAL D CG2   1 
ATOM   2896  N N     . SER D 4  116 ? 85.935  97.913  106.231 1.00 17.74  ? 113 SER D N     1 
ATOM   2897  C CA    . SER D 4  116 ? 84.677  97.383  105.769 1.00 15.12  ? 113 SER D CA    1 
ATOM   2898  C C     . SER D 4  116 ? 84.822  96.673  104.438 1.00 23.22  ? 113 SER D C     1 
ATOM   2899  O O     . SER D 4  116 ? 84.295  95.569  104.271 1.00 28.19  ? 113 SER D O     1 
ATOM   2900  C CB    . SER D 4  116 ? 83.667  98.472  105.620 1.00 25.36  ? 113 SER D CB    1 
ATOM   2901  O OG    . SER D 4  116 ? 82.453  97.952  105.173 1.00 34.33  ? 113 SER D OG    1 
ATOM   2902  N N     . GLU D 4  117 ? 85.570  97.249  103.489 1.00 24.98  ? 114 GLU D N     1 
ATOM   2903  C CA    . GLU D 4  117 ? 85.694  96.604  102.184 1.00 23.09  ? 114 GLU D CA    1 
ATOM   2904  C C     . GLU D 4  117 ? 86.420  95.290  102.262 1.00 22.96  ? 114 GLU D C     1 
ATOM   2905  O O     . GLU D 4  117 ? 86.062  94.327  101.583 1.00 29.66  ? 114 GLU D O     1 
ATOM   2906  C CB    . GLU D 4  117 ? 86.464  97.475  101.220 1.00 20.23  ? 114 GLU D CB    1 
ATOM   2907  C CG    . GLU D 4  117 ? 85.765  98.704  100.795 1.00 28.61  ? 114 GLU D CG    1 
ATOM   2908  C CD    . GLU D 4  117 ? 84.570  98.451  99.998  1.00 51.50  ? 114 GLU D CD    1 
ATOM   2909  O OE1   . GLU D 4  117 ? 84.671  97.851  98.971  1.00 59.97  ? 114 GLU D OE1   1 
ATOM   2910  O OE2   . GLU D 4  117 ? 83.514  98.813  100.438 1.00 54.95  ? 114 GLU D OE2   1 
ATOM   2911  N N     . GLY D 4  118 ? 87.441  95.226  103.088 1.00 19.84  ? 115 GLY D N     1 
ATOM   2912  C CA    . GLY D 4  118 ? 88.182  93.998  103.231 1.00 19.90  ? 115 GLY D CA    1 
ATOM   2913  C C     . GLY D 4  118 ? 87.298  92.918  103.813 1.00 22.77  ? 115 GLY D C     1 
ATOM   2914  O O     . GLY D 4  118 ? 87.262  91.789  103.318 1.00 25.83  ? 115 GLY D O     1 
ATOM   2915  N N     . THR D 4  119 ? 86.545  93.267  104.842 1.00 24.21  ? 116 THR D N     1 
ATOM   2916  C CA    . THR D 4  119 ? 85.697  92.317  105.511 1.00 21.37  ? 116 THR D CA    1 
ATOM   2917  C C     . THR D 4  119 ? 84.678  91.767  104.564 1.00 24.88  ? 116 THR D C     1 
ATOM   2918  O O     . THR D 4  119 ? 84.375  90.564  104.576 1.00 32.84  ? 116 THR D O     1 
ATOM   2919  C CB    . THR D 4  119 ? 84.999  92.974  106.694 1.00 22.77  ? 116 THR D CB    1 
ATOM   2920  O OG1   . THR D 4  119 ? 85.987  93.416  107.628 1.00 29.90  ? 116 THR D OG1   1 
ATOM   2921  C CG2   . THR D 4  119 ? 84.081  91.996  107.359 1.00 38.25  ? 116 THR D CG2   1 
ATOM   2922  N N     . LYS D 4  120 ? 84.101  92.637  103.769 1.00 24.51  ? 117 LYS D N     1 
ATOM   2923  C CA    . LYS D 4  120 ? 83.111  92.214  102.831 1.00 24.22  ? 117 LYS D CA    1 
ATOM   2924  C C     . LYS D 4  120 ? 83.671  91.308  101.758 1.00 26.04  ? 117 LYS D C     1 
ATOM   2925  O O     . LYS D 4  120 ? 83.025  90.321  101.397 1.00 31.39  ? 117 LYS D O     1 
ATOM   2926  C CB    . LYS D 4  120 ? 82.488  93.402  102.215 1.00 21.24  ? 117 LYS D CB    1 
ATOM   2927  C CG    . LYS D 4  120 ? 81.413  93.099  101.314 1.00 30.34  ? 117 LYS D CG    1 
ATOM   2928  C CD    . LYS D 4  120 ? 80.668  94.374  100.913 1.00 38.12  ? 117 LYS D CD    1 
ATOM   2929  C CE    . LYS D 4  120 ? 81.451  95.229  99.921  1.00 46.92  ? 117 LYS D CE    1 
ATOM   2930  N NZ    . LYS D 4  120 ? 80.705  96.452  99.511  1.00 50.81  ? 117 LYS D NZ    1 
ATOM   2931  N N     . ALA D 4  121 ? 84.849  91.628  101.214 1.00 25.95  ? 118 ALA D N     1 
ATOM   2932  C CA    . ALA D 4  121 ? 85.414  90.787  100.173 1.00 21.95  ? 118 ALA D CA    1 
ATOM   2933  C C     . ALA D 4  121 ? 85.696  89.401  100.682 1.00 24.09  ? 118 ALA D C     1 
ATOM   2934  O O     . ALA D 4  121 ? 85.417  88.417  100.000 1.00 28.07  ? 118 ALA D O     1 
ATOM   2935  C CB    . ALA D 4  121 ? 86.694  91.377  99.647  1.00 27.26  ? 118 ALA D CB    1 
ATOM   2936  N N     . VAL D 4  122 ? 86.177  89.293  101.912 1.00 26.83  ? 119 VAL D N     1 
ATOM   2937  C CA    . VAL D 4  122 ? 86.456  87.982  102.442 1.00 23.54  ? 119 VAL D CA    1 
ATOM   2938  C C     . VAL D 4  122 ? 85.176  87.226  102.641 1.00 27.33  ? 119 VAL D C     1 
ATOM   2939  O O     . VAL D 4  122 ? 85.121  86.034  102.348 1.00 38.47  ? 119 VAL D O     1 
ATOM   2940  C CB    . VAL D 4  122 ? 87.252  88.028  103.727 1.00 18.70  ? 119 VAL D CB    1 
ATOM   2941  C CG1   . VAL D 4  122 ? 87.354  86.655  104.303 1.00 30.30  ? 119 VAL D CG1   1 
ATOM   2942  C CG2   . VAL D 4  122 ? 88.617  88.542  103.428 1.00 23.94  ? 119 VAL D CG2   1 
ATOM   2943  N N     . THR D 4  123 ? 84.153  87.885  103.156 1.00 27.46  ? 120 THR D N     1 
ATOM   2944  C CA    . THR D 4  123 ? 82.895  87.218  103.376 1.00 28.01  ? 120 THR D CA    1 
ATOM   2945  C C     . THR D 4  123 ? 82.347  86.670  102.083 1.00 31.03  ? 120 THR D C     1 
ATOM   2946  O O     . THR D 4  123 ? 81.909  85.517  102.025 1.00 39.75  ? 120 THR D O     1 
ATOM   2947  C CB    . THR D 4  123 ? 81.880  88.195  103.961 1.00 32.77  ? 120 THR D CB    1 
ATOM   2948  O OG1   . THR D 4  123 ? 82.359  88.662  105.226 1.00 43.03  ? 120 THR D OG1   1 
ATOM   2949  C CG2   . THR D 4  123 ? 80.534  87.531  104.128 1.00 42.32  ? 120 THR D CG2   1 
ATOM   2950  N N     . LYS D 4  124 ? 82.370  87.467  101.026 1.00 30.91  ? 121 LYS D N     1 
ATOM   2951  C CA    . LYS D 4  124 ? 81.847  86.992  99.765  1.00 29.50  ? 121 LYS D CA    1 
ATOM   2952  C C     . LYS D 4  124 ? 82.655  85.849  99.222  1.00 29.95  ? 121 LYS D C     1 
ATOM   2953  O O     . LYS D 4  124 ? 82.120  84.912  98.645  1.00 35.66  ? 121 LYS D O     1 
ATOM   2954  C CB    . LYS D 4  124 ? 81.850  88.071  98.736  1.00 28.57  ? 121 LYS D CB    1 
ATOM   2955  C CG    . LYS D 4  124 ? 81.204  87.664  97.471  1.00 31.35  ? 121 LYS D CG    1 
ATOM   2956  C CD    . LYS D 4  124 ? 81.198  88.767  96.475  1.00 41.01  ? 121 LYS D CD    1 
ATOM   2957  C CE    . LYS D 4  124 ? 80.434  88.348  95.244  1.00 47.59  ? 121 LYS D CE    1 
ATOM   2958  N NZ    . LYS D 4  124 ? 80.545  89.330  94.162  1.00 51.88  ? 121 LYS D NZ    1 
ATOM   2959  N N     . TYR D 4  125 ? 83.959  85.947  99.353  1.00 27.50  ? 122 TYR D N     1 
ATOM   2960  C CA    . TYR D 4  125 ? 84.852  84.941  98.856  1.00 28.12  ? 122 TYR D CA    1 
ATOM   2961  C C     . TYR D 4  125 ? 84.594  83.579  99.456  1.00 32.12  ? 122 TYR D C     1 
ATOM   2962  O O     . TYR D 4  125 ? 84.564  82.584  98.735  1.00 39.03  ? 122 TYR D O     1 
ATOM   2963  C CB    . TYR D 4  125 ? 86.279  85.365  99.107  1.00 28.68  ? 122 TYR D CB    1 
ATOM   2964  C CG    . TYR D 4  125 ? 87.264  84.406  98.665  1.00 29.14  ? 122 TYR D CG    1 
ATOM   2965  C CD1   . TYR D 4  125 ? 87.560  84.321  97.353  1.00 32.92  ? 122 TYR D CD1   1 
ATOM   2966  C CD2   . TYR D 4  125 ? 87.889  83.623  99.561  1.00 30.20  ? 122 TYR D CD2   1 
ATOM   2967  C CE1   . TYR D 4  125 ? 88.480  83.440  96.927  1.00 35.43  ? 122 TYR D CE1   1 
ATOM   2968  C CE2   . TYR D 4  125 ? 88.814  82.738  99.145  1.00 34.98  ? 122 TYR D CE2   1 
ATOM   2969  C CZ    . TYR D 4  125 ? 89.109  82.644  97.830  1.00 35.48  ? 122 TYR D CZ    1 
ATOM   2970  O OH    . TYR D 4  125 ? 90.042  81.749  97.404  1.00 48.84  ? 122 TYR D OH    1 
ATOM   2971  N N     . THR D 4  126 ? 84.431  83.507  100.783 1.00 36.15  ? 123 THR D N     1 
ATOM   2972  C CA    . THR D 4  126 ? 84.242  82.204  101.405 1.00 37.11  ? 123 THR D CA    1 
ATOM   2973  C C     . THR D 4  126 ? 82.806  81.712  101.345 1.00 43.46  ? 123 THR D C     1 
ATOM   2974  O O     . THR D 4  126 ? 82.562  80.513  101.489 1.00 49.47  ? 123 THR D O     1 
ATOM   2975  C CB    . THR D 4  126 ? 84.668  82.209  102.879 1.00 35.07  ? 123 THR D CB    1 
ATOM   2976  O OG1   . THR D 4  126 ? 83.813  83.066  103.630 1.00 35.69  ? 123 THR D OG1   1 
ATOM   2977  C CG2   . THR D 4  126 ? 86.085  82.725  102.985 1.00 33.08  ? 123 THR D CG2   1 
ATOM   2978  N N     . SER D 4  127 ? 81.853  82.605  101.119 1.00 45.07  ? 124 SER D N     1 
ATOM   2979  C CA    . SER D 4  127 ? 80.454  82.226  101.011 1.00 54.52  ? 124 SER D CA    1 
ATOM   2980  C C     . SER D 4  127 ? 80.212  81.415  99.748  1.00 65.53  ? 124 SER D C     1 
ATOM   2981  O O     . SER D 4  127 ? 80.973  81.489  98.784  1.00 63.15  ? 124 SER D O     1 
ATOM   2982  C CB    . SER D 4  127 ? 79.567  83.450  101.006 1.00 54.32  ? 124 SER D CB    1 
ATOM   2983  O OG    . SER D 4  127 ? 79.646  84.136  102.228 1.00 49.79  ? 124 SER D OG    1 
ATOM   2984  N N     . ALA D 4  128 ? 79.170  80.598  99.764  1.00 73.67  ? 125 ALA D N     1 
ATOM   2985  C CA    . ALA D 4  128 ? 78.831  79.810  98.589  1.00 87.58  ? 125 ALA D CA    1 
ATOM   2986  C C     . ALA D 4  128 ? 78.257  80.702  97.501  1.00 92.83  ? 125 ALA D C     1 
ATOM   2987  O O     . ALA D 4  128 ? 78.121  80.272  96.355  1.00 89.20  ? 125 ALA D O     1 
ATOM   2988  C CB    . ALA D 4  128 ? 77.839  78.721  98.946  1.00 90.15  ? 125 ALA D CB    1 
ATOM   2989  N N     . HIS E 5  43  ? 106.530 153.856 82.801  1.00 79.47  ? 40  HIS E N     1 
ATOM   2990  C CA    . HIS E 5  43  ? 105.702 153.210 83.812  1.00 87.20  ? 40  HIS E CA    1 
ATOM   2991  C C     . HIS E 5  43  ? 106.490 152.186 84.617  1.00 85.93  ? 40  HIS E C     1 
ATOM   2992  O O     . HIS E 5  43  ? 107.342 151.473 84.078  1.00 85.56  ? 40  HIS E O     1 
ATOM   2993  C CB    . HIS E 5  43  ? 104.493 152.525 83.172  0.00 97.74  ? 40  HIS E CB    1 
ATOM   2994  C CG    . HIS E 5  43  ? 103.592 151.893 84.176  0.00 92.57  ? 40  HIS E CG    1 
ATOM   2995  N ND1   . HIS E 5  43  ? 103.889 150.693 84.778  0.00 89.71  ? 40  HIS E ND1   1 
ATOM   2996  C CD2   . HIS E 5  43  ? 102.416 152.298 84.700  0.00 100.91 ? 40  HIS E CD2   1 
ATOM   2997  C CE1   . HIS E 5  43  ? 102.935 150.388 85.636  0.00 87.07  ? 40  HIS E CE1   1 
ATOM   2998  N NE2   . HIS E 5  43  ? 102.028 151.346 85.604  0.00 99.17  ? 40  HIS E NE2   1 
ATOM   2999  N N     . ARG E 5  44  ? 106.238 152.155 85.925  1.00 88.53  ? 41  ARG E N     1 
ATOM   3000  C CA    . ARG E 5  44  ? 106.885 151.213 86.824  1.00 77.97  ? 41  ARG E CA    1 
ATOM   3001  C C     . ARG E 5  44  ? 105.898 150.600 87.797  1.00 76.89  ? 41  ARG E C     1 
ATOM   3002  O O     . ARG E 5  44  ? 104.891 151.213 88.160  1.00 79.37  ? 41  ARG E O     1 
ATOM   3003  C CB    . ARG E 5  44  ? 107.978 151.880 87.641  1.00 74.53  ? 41  ARG E CB    1 
ATOM   3004  C CG    . ARG E 5  44  ? 109.139 152.440 86.857  1.00 76.81  ? 41  ARG E CG    1 
ATOM   3005  C CD    . ARG E 5  44  ? 110.134 153.078 87.759  1.00 77.52  ? 41  ARG E CD    1 
ATOM   3006  N NE    . ARG E 5  44  ? 110.775 152.102 88.626  1.00 67.56  ? 41  ARG E NE    1 
ATOM   3007  C CZ    . ARG E 5  44  ? 111.847 151.364 88.305  1.00 66.65  ? 41  ARG E CZ    1 
ATOM   3008  N NH1   . ARG E 5  44  ? 112.426 151.485 87.135  1.00 60.09  ? 41  ARG E NH1   1 
ATOM   3009  N NH2   . ARG E 5  44  ? 112.319 150.509 89.174  1.00 56.79  ? 41  ARG E NH2   1 
ATOM   3010  N N     . TYR E 5  45  ? 106.232 149.415 88.273  1.00 75.18  ? 42  TYR E N     1 
ATOM   3011  C CA    . TYR E 5  45  ? 105.459 148.760 89.301  1.00 69.93  ? 42  TYR E CA    1 
ATOM   3012  C C     . TYR E 5  45  ? 106.163 148.970 90.621  1.00 64.62  ? 42  TYR E C     1 
ATOM   3013  O O     . TYR E 5  45  ? 107.391 149.030 90.671  1.00 59.34  ? 42  TYR E O     1 
ATOM   3014  C CB    . TYR E 5  45  ? 105.301 147.279 89.004  1.00 70.06  ? 42  TYR E CB    1 
ATOM   3015  C CG    . TYR E 5  45  ? 104.462 147.003 87.794  1.00 72.05  ? 42  TYR E CG    1 
ATOM   3016  C CD1   . TYR E 5  45  ? 105.058 146.800 86.571  1.00 75.79  ? 42  TYR E CD1   1 
ATOM   3017  C CD2   . TYR E 5  45  ? 103.085 146.967 87.906  1.00 71.99  ? 42  TYR E CD2   1 
ATOM   3018  C CE1   . TYR E 5  45  ? 104.280 146.556 85.462  1.00 76.46  ? 42  TYR E CE1   1 
ATOM   3019  C CE2   . TYR E 5  45  ? 102.307 146.721 86.804  1.00 77.41  ? 42  TYR E CE2   1 
ATOM   3020  C CZ    . TYR E 5  45  ? 102.899 146.516 85.582  1.00 79.20  ? 42  TYR E CZ    1 
ATOM   3021  O OH    . TYR E 5  45  ? 102.118 146.275 84.473  1.00 66.96  ? 42  TYR E OH    1 
ATOM   3022  N N     . ARG E 5  46  ? 105.400 149.085 91.690  1.00 64.97  ? 43  ARG E N     1 
ATOM   3023  C CA    . ARG E 5  46  ? 106.003 149.252 92.992  1.00 62.67  ? 43  ARG E CA    1 
ATOM   3024  C C     . ARG E 5  46  ? 106.618 147.925 93.430  1.00 57.37  ? 43  ARG E C     1 
ATOM   3025  O O     . ARG E 5  46  ? 106.035 146.872 93.121  1.00 54.49  ? 43  ARG E O     1 
ATOM   3026  C CB    . ARG E 5  46  ? 104.971 149.702 93.990  1.00 66.05  ? 43  ARG E CB    1 
ATOM   3027  C CG    . ARG E 5  46  ? 104.348 151.030 93.677  1.00 70.14  ? 43  ARG E CG    1 
ATOM   3028  C CD    . ARG E 5  46  ? 105.322 152.119 93.817  1.00 78.54  ? 43  ARG E CD    1 
ATOM   3029  N NE    . ARG E 5  46  ? 104.736 153.425 93.517  1.00 78.66  ? 43  ARG E NE    1 
ATOM   3030  C CZ    . ARG E 5  46  ? 104.057 154.190 94.400  1.00 93.69  ? 43  ARG E CZ    1 
ATOM   3031  N NH1   . ARG E 5  46  ? 103.873 153.772 95.637  1.00 71.53  ? 43  ARG E NH1   1 
ATOM   3032  N NH2   . ARG E 5  46  ? 103.577 155.364 94.018  1.00 72.68  ? 43  ARG E NH2   1 
ATOM   3033  N N     . PRO E 5  47  ? 107.726 147.930 94.201  1.00 56.10  ? 44  PRO E N     1 
ATOM   3034  C CA    . PRO E 5  47  ? 108.393 146.750 94.696  1.00 47.77  ? 44  PRO E CA    1 
ATOM   3035  C C     . PRO E 5  47  ? 107.426 145.849 95.416  1.00 48.64  ? 44  PRO E C     1 
ATOM   3036  O O     . PRO E 5  47  ? 106.626 146.301 96.233  1.00 50.13  ? 44  PRO E O     1 
ATOM   3037  C CB    . PRO E 5  47  ? 109.419 147.336 95.663  1.00 45.48  ? 44  PRO E CB    1 
ATOM   3038  C CG    . PRO E 5  47  ? 109.715 148.693 95.107  1.00 47.89  ? 44  PRO E CG    1 
ATOM   3039  C CD    . PRO E 5  47  ? 108.399 149.192 94.581  1.00 48.62  ? 44  PRO E CD    1 
ATOM   3040  N N     . GLY E 5  48  ? 107.538 144.564 95.113  1.00 46.15  ? 45  GLY E N     1 
ATOM   3041  C CA    . GLY E 5  48  ? 106.693 143.519 95.654  1.00 45.84  ? 45  GLY E CA    1 
ATOM   3042  C C     . GLY E 5  48  ? 105.613 143.114 94.652  1.00 45.30  ? 45  GLY E C     1 
ATOM   3043  O O     . GLY E 5  48  ? 105.067 142.010 94.734  1.00 45.46  ? 45  GLY E O     1 
ATOM   3044  N N     . THR E 5  49  ? 105.331 143.963 93.658  1.00 40.53  ? 46  THR E N     1 
ATOM   3045  C CA    . THR E 5  49  ? 104.305 143.603 92.691  1.00 43.25  ? 46  THR E CA    1 
ATOM   3046  C C     . THR E 5  49  ? 104.755 142.409 91.889  1.00 46.95  ? 46  THR E C     1 
ATOM   3047  O O     . THR E 5  49  ? 103.996 141.462 91.648  1.00 47.44  ? 46  THR E O     1 
ATOM   3048  C CB    . THR E 5  49  ? 104.031 144.744 91.707  1.00 53.73  ? 46  THR E CB    1 
ATOM   3049  O OG1   . THR E 5  49  ? 103.577 145.900 92.422  1.00 56.03  ? 46  THR E OG1   1 
ATOM   3050  C CG2   . THR E 5  49  ? 102.958 144.314 90.698  1.00 53.16  ? 46  THR E CG2   1 
ATOM   3051  N N     . VAL E 5  50  ? 105.990 142.465 91.455  1.00 40.18  ? 47  VAL E N     1 
ATOM   3052  C CA    . VAL E 5  50  ? 106.543 141.422 90.651  1.00 42.09  ? 47  VAL E CA    1 
ATOM   3053  C C     . VAL E 5  50  ? 106.760 140.180 91.466  1.00 43.31  ? 47  VAL E C     1 
ATOM   3054  O O     . VAL E 5  50  ? 106.587 139.079 90.952  1.00 45.19  ? 47  VAL E O     1 
ATOM   3055  C CB    . VAL E 5  50  ? 107.795 141.894 89.954  1.00 44.30  ? 47  VAL E CB    1 
ATOM   3056  C CG1   . VAL E 5  50  ? 108.480 140.731 89.226  1.00 47.82  ? 47  VAL E CG1   1 
ATOM   3057  C CG2   . VAL E 5  50  ? 107.382 143.000 88.971  1.00 47.91  ? 47  VAL E CG2   1 
ATOM   3058  N N     . ALA E 5  51  ? 107.213 140.332 92.701  1.00 40.27  ? 48  ALA E N     1 
ATOM   3059  C CA    . ALA E 5  51  ? 107.454 139.166 93.514  1.00 40.21  ? 48  ALA E CA    1 
ATOM   3060  C C     . ALA E 5  51  ? 106.182 138.375 93.679  1.00 39.05  ? 48  ALA E C     1 
ATOM   3061  O O     . ALA E 5  51  ? 106.212 137.150 93.600  1.00 40.03  ? 48  ALA E O     1 
ATOM   3062  C CB    . ALA E 5  51  ? 107.968 139.561 94.876  1.00 37.27  ? 48  ALA E CB    1 
ATOM   3063  N N     . LEU E 5  52  ? 105.047 139.041 93.851  1.00 37.61  ? 49  LEU E N     1 
ATOM   3064  C CA    . LEU E 5  52  ? 103.832 138.273 93.974  1.00 38.55  ? 49  LEU E CA    1 
ATOM   3065  C C     . LEU E 5  52  ? 103.465 137.598 92.676  1.00 41.63  ? 49  LEU E C     1 
ATOM   3066  O O     . LEU E 5  52  ? 102.956 136.472 92.691  1.00 43.16  ? 49  LEU E O     1 
ATOM   3067  C CB    . LEU E 5  52  ? 102.714 139.137 94.487  1.00 38.56  ? 49  LEU E CB    1 
ATOM   3068  C CG    . LEU E 5  52  ? 102.878 139.576 95.943  1.00 44.51  ? 49  LEU E CG    1 
ATOM   3069  C CD1   . LEU E 5  52  ? 101.866 140.592 96.250  1.00 50.14  ? 49  LEU E CD1   1 
ATOM   3070  C CD2   . LEU E 5  52  ? 102.707 138.373 96.920  1.00 45.14  ? 49  LEU E CD2   1 
ATOM   3071  N N     . ARG E 5  53  ? 103.720 138.238 91.538  1.00 40.54  ? 50  ARG E N     1 
ATOM   3072  C CA    . ARG E 5  53  ? 103.416 137.547 90.301  1.00 40.21  ? 50  ARG E CA    1 
ATOM   3073  C C     . ARG E 5  53  ? 104.265 136.307 90.170  1.00 37.61  ? 50  ARG E C     1 
ATOM   3074  O O     . ARG E 5  53  ? 103.759 135.255 89.767  1.00 40.20  ? 50  ARG E O     1 
ATOM   3075  C CB    . ARG E 5  53  ? 103.677 138.408 89.103  1.00 42.19  ? 50  ARG E CB    1 
ATOM   3076  C CG    . ARG E 5  53  ? 102.718 139.511 88.923  1.00 47.07  ? 50  ARG E CG    1 
ATOM   3077  C CD    . ARG E 5  53  ? 103.082 140.370 87.801  1.00 48.85  ? 50  ARG E CD    1 
ATOM   3078  N NE    . ARG E 5  53  ? 102.124 141.427 87.638  1.00 51.66  ? 50  ARG E NE    1 
ATOM   3079  C CZ    . ARG E 5  53  ? 102.249 142.468 86.803  1.00 64.40  ? 50  ARG E CZ    1 
ATOM   3080  N NH1   . ARG E 5  53  ? 103.317 142.596 86.042  1.00 53.63  ? 50  ARG E NH1   1 
ATOM   3081  N NH2   . ARG E 5  53  ? 101.282 143.363 86.750  1.00 55.81  ? 50  ARG E NH2   1 
ATOM   3082  N N     . GLU E 5  54  ? 105.539 136.399 90.549  1.00 37.30  ? 51  GLU E N     1 
ATOM   3083  C CA    . GLU E 5  54  ? 106.387 135.236 90.460  1.00 34.38  ? 51  GLU E CA    1 
ATOM   3084  C C     . GLU E 5  54  ? 105.940 134.160 91.401  1.00 32.49  ? 51  GLU E C     1 
ATOM   3085  O O     . GLU E 5  54  ? 105.888 132.991 91.030  1.00 35.52  ? 51  GLU E O     1 
ATOM   3086  C CB    . GLU E 5  54  ? 107.827 135.548 90.758  1.00 38.06  ? 51  GLU E CB    1 
ATOM   3087  C CG    . GLU E 5  54  ? 108.510 136.343 89.722  1.00 46.92  ? 51  GLU E CG    1 
ATOM   3088  C CD    . GLU E 5  54  ? 109.971 136.545 90.023  1.00 65.15  ? 51  GLU E CD    1 
ATOM   3089  O OE1   . GLU E 5  54  ? 110.446 136.003 91.004  1.00 55.67  ? 51  GLU E OE1   1 
ATOM   3090  O OE2   . GLU E 5  54  ? 110.618 137.235 89.279  1.00 82.16  ? 51  GLU E OE2   1 
ATOM   3091  N N     . ILE E 5  55  ? 105.493 134.518 92.590  1.00 31.45  ? 52  ILE E N     1 
ATOM   3092  C CA    . ILE E 5  55  ? 105.085 133.466 93.480  1.00 25.62  ? 52  ILE E CA    1 
ATOM   3093  C C     . ILE E 5  55  ? 103.934 132.715 92.854  1.00 28.19  ? 52  ILE E C     1 
ATOM   3094  O O     . ILE E 5  55  ? 103.944 131.487 92.859  1.00 34.68  ? 52  ILE E O     1 
ATOM   3095  C CB    . ILE E 5  55  ? 104.732 133.971 94.886  1.00 26.65  ? 52  ILE E CB    1 
ATOM   3096  C CG1   . ILE E 5  55  ? 105.998 134.475 95.570  1.00 24.63  ? 52  ILE E CG1   1 
ATOM   3097  C CG2   . ILE E 5  55  ? 104.146 132.824 95.681  1.00 26.93  ? 52  ILE E CG2   1 
ATOM   3098  C CD1   . ILE E 5  55  ? 105.796 135.276 96.839  1.00 27.99  ? 52  ILE E CD1   1 
ATOM   3099  N N     . ARG E 5  56  ? 102.945 133.401 92.287  1.00 30.39  ? 53  ARG E N     1 
ATOM   3100  C CA    . ARG E 5  56  ? 101.870 132.630 91.677  1.00 31.36  ? 53  ARG E CA    1 
ATOM   3101  C C     . ARG E 5  56  ? 102.342 131.806 90.499  1.00 32.68  ? 53  ARG E C     1 
ATOM   3102  O O     . ARG E 5  56  ? 101.902 130.670 90.311  1.00 36.47  ? 53  ARG E O     1 
ATOM   3103  C CB    . ARG E 5  56  ? 100.765 133.507 91.178  1.00 41.13  ? 53  ARG E CB    1 
ATOM   3104  C CG    . ARG E 5  56  ? 99.971  134.121 92.221  1.00 51.77  ? 53  ARG E CG    1 
ATOM   3105  C CD    . ARG E 5  56  ? 98.857  134.887 91.683  1.00 69.46  ? 53  ARG E CD    1 
ATOM   3106  N NE    . ARG E 5  56  ? 98.114  135.544 92.749  1.00 81.81  ? 53  ARG E NE    1 
ATOM   3107  C CZ    . ARG E 5  56  ? 98.336  136.798 93.214  1.00 87.18  ? 53  ARG E CZ    1 
ATOM   3108  N NH1   . ARG E 5  56  ? 99.285  137.554 92.710  1.00 73.08  ? 53  ARG E NH1   1 
ATOM   3109  N NH2   . ARG E 5  56  ? 97.583  137.270 94.191  1.00 90.24  ? 53  ARG E NH2   1 
ATOM   3110  N N     . ARG E 5  57  ? 103.223 132.362 89.693  1.00 29.04  ? 54  ARG E N     1 
ATOM   3111  C CA    . ARG E 5  57  ? 103.690 131.660 88.530  1.00 26.65  ? 54  ARG E CA    1 
ATOM   3112  C C     . ARG E 5  57  ? 104.447 130.404 88.848  1.00 26.51  ? 54  ARG E C     1 
ATOM   3113  O O     . ARG E 5  57  ? 104.249 129.381 88.181  1.00 34.07  ? 54  ARG E O     1 
ATOM   3114  C CB    . ARG E 5  57  ? 104.569 132.557 87.748  1.00 32.03  ? 54  ARG E CB    1 
ATOM   3115  C CG    . ARG E 5  57  ? 105.073 132.019 86.527  1.00 38.90  ? 54  ARG E CG    1 
ATOM   3116  C CD    . ARG E 5  57  ? 105.796 133.051 85.786  1.00 46.80  ? 54  ARG E CD    1 
ATOM   3117  N NE    . ARG E 5  57  ? 106.272 132.540 84.536  1.00 60.57  ? 54  ARG E NE    1 
ATOM   3118  C CZ    . ARG E 5  57  ? 107.438 131.932 84.348  1.00 62.14  ? 54  ARG E CZ    1 
ATOM   3119  N NH1   . ARG E 5  57  ? 108.275 131.798 85.336  1.00 53.68  ? 54  ARG E NH1   1 
ATOM   3120  N NH2   . ARG E 5  57  ? 107.740 131.463 83.157  1.00 70.02  ? 54  ARG E NH2   1 
ATOM   3121  N N     . TYR E 5  58  ? 105.317 130.460 89.843  1.00 24.25  ? 55  TYR E N     1 
ATOM   3122  C CA    . TYR E 5  58  ? 106.078 129.284 90.156  1.00 21.77  ? 55  TYR E CA    1 
ATOM   3123  C C     . TYR E 5  58  ? 105.259 128.308 90.930  1.00 23.82  ? 55  TYR E C     1 
ATOM   3124  O O     . TYR E 5  58  ? 105.487 127.110 90.837  1.00 37.35  ? 55  TYR E O     1 
ATOM   3125  C CB    . TYR E 5  58  ? 107.355 129.619 90.879  1.00 21.49  ? 55  TYR E CB    1 
ATOM   3126  C CG    . TYR E 5  58  ? 108.269 130.314 89.990  1.00 26.20  ? 55  TYR E CG    1 
ATOM   3127  C CD1   . TYR E 5  58  ? 108.604 131.597 90.238  1.00 33.61  ? 55  TYR E CD1   1 
ATOM   3128  C CD2   . TYR E 5  58  ? 108.742 129.693 88.887  1.00 28.66  ? 55  TYR E CD2   1 
ATOM   3129  C CE1   . TYR E 5  58  ? 109.419 132.270 89.383  1.00 38.70  ? 55  TYR E CE1   1 
ATOM   3130  C CE2   . TYR E 5  58  ? 109.542 130.357 88.038  1.00 35.25  ? 55  TYR E CE2   1 
ATOM   3131  C CZ    . TYR E 5  58  ? 109.878 131.645 88.282  1.00 34.93  ? 55  TYR E CZ    1 
ATOM   3132  O OH    . TYR E 5  58  ? 110.682 132.318 87.409  1.00 41.14  ? 55  TYR E OH    1 
ATOM   3133  N N     . GLN E 5  59  ? 104.299 128.765 91.707  1.00 21.94  ? 56  GLN E N     1 
ATOM   3134  C CA    . GLN E 5  59  ? 103.496 127.786 92.380  1.00 20.66  ? 56  GLN E CA    1 
ATOM   3135  C C     . GLN E 5  59  ? 102.640 127.026 91.382  1.00 23.53  ? 56  GLN E C     1 
ATOM   3136  O O     . GLN E 5  59  ? 102.428 125.833 91.548  1.00 28.56  ? 56  GLN E O     1 
ATOM   3137  C CB    . GLN E 5  59  ? 102.675 128.409 93.481  1.00 23.84  ? 56  GLN E CB    1 
ATOM   3138  C CG    . GLN E 5  59  ? 103.516 128.849 94.633  1.00 20.65  ? 56  GLN E CG    1 
ATOM   3139  C CD    . GLN E 5  59  ? 102.776 129.471 95.706  1.00 29.54  ? 56  GLN E CD    1 
ATOM   3140  O OE1   . GLN E 5  59  ? 101.717 130.061 95.523  1.00 36.63  ? 56  GLN E OE1   1 
ATOM   3141  N NE2   . GLN E 5  59  ? 103.325 129.329 96.874  1.00 29.66  ? 56  GLN E NE2   1 
ATOM   3142  N N     . LYS E 5  60  ? 102.152 127.684 90.331  1.00 25.82  ? 57  LYS E N     1 
ATOM   3143  C CA    . LYS E 5  60  ? 101.363 126.962 89.342  1.00 29.05  ? 57  LYS E CA    1 
ATOM   3144  C C     . LYS E 5  60  ? 102.125 125.967 88.478  1.00 31.26  ? 57  LYS E C     1 
ATOM   3145  O O     . LYS E 5  60  ? 101.587 124.903 88.167  1.00 34.35  ? 57  LYS E O     1 
ATOM   3146  C CB    . LYS E 5  60  ? 100.665 127.894 88.376  1.00 35.88  ? 57  LYS E CB    1 
ATOM   3147  C CG    . LYS E 5  60  ? 99.524  128.656 88.919  1.00 42.16  ? 57  LYS E CG    1 
ATOM   3148  C CD    . LYS E 5  60  ? 98.935  129.570 87.835  1.00 55.30  ? 57  LYS E CD    1 
ATOM   3149  C CE    . LYS E 5  60  ? 97.770  130.417 88.364  1.00 75.85  ? 57  LYS E CE    1 
ATOM   3150  N NZ    . LYS E 5  60  ? 97.243  131.377 87.332  1.00 67.50  ? 57  LYS E NZ    1 
ATOM   3151  N N     . SER E 5  61  ? 103.341 126.283 88.050  1.00 29.03  ? 58  SER E N     1 
ATOM   3152  C CA    . SER E 5  61  ? 104.032 125.357 87.164  1.00 28.88  ? 58  SER E CA    1 
ATOM   3153  C C     . SER E 5  61  ? 104.657 124.158 87.883  1.00 30.43  ? 58  SER E C     1 
ATOM   3154  O O     . SER E 5  61  ? 104.776 124.126 89.108  1.00 28.92  ? 58  SER E O     1 
ATOM   3155  C CB    . SER E 5  61  ? 105.061 126.074 86.334  1.00 32.88  ? 58  SER E CB    1 
ATOM   3156  O OG    . SER E 5  61  ? 106.151 126.503 87.085  1.00 31.20  ? 58  SER E OG    1 
ATOM   3157  N N     . THR E 5  62  ? 105.048 123.139 87.106  1.00 31.93  ? 59  THR E N     1 
ATOM   3158  C CA    . THR E 5  62  ? 105.667 121.925 87.635  1.00 26.72  ? 59  THR E CA    1 
ATOM   3159  C C     . THR E 5  62  ? 107.111 121.625 87.212  1.00 26.66  ? 59  THR E C     1 
ATOM   3160  O O     . THR E 5  62  ? 107.712 120.674 87.710  1.00 25.49  ? 59  THR E O     1 
ATOM   3161  C CB    . THR E 5  62  ? 104.817 120.725 87.261  1.00 23.71  ? 59  THR E CB    1 
ATOM   3162  O OG1   . THR E 5  62  ? 104.701 120.663 85.838  1.00 26.26  ? 59  THR E OG1   1 
ATOM   3163  C CG2   . THR E 5  62  ? 103.458 120.840 87.875  1.00 29.29  ? 59  THR E CG2   1 
ATOM   3164  N N     . GLU E 5  63  ? 107.685 122.411 86.322  1.00 28.05  ? 60  GLU E N     1 
ATOM   3165  C CA    . GLU E 5  63  ? 109.021 122.138 85.822  1.00 25.76  ? 60  GLU E CA    1 
ATOM   3166  C C     . GLU E 5  63  ? 110.088 122.374 86.853  1.00 25.86  ? 60  GLU E C     1 
ATOM   3167  O O     . GLU E 5  63  ? 109.869 123.049 87.855  1.00 30.66  ? 60  GLU E O     1 
ATOM   3168  C CB    . GLU E 5  63  ? 109.338 122.972 84.593  1.00 28.81  ? 60  GLU E CB    1 
ATOM   3169  C CG    . GLU E 5  63  ? 109.527 124.429 84.858  1.00 34.99  ? 60  GLU E CG    1 
ATOM   3170  C CD    . GLU E 5  63  ? 108.274 125.107 84.937  1.00 42.81  ? 60  GLU E CD    1 
ATOM   3171  O OE1   . GLU E 5  63  ? 107.289 124.447 84.719  1.00 40.41  ? 60  GLU E OE1   1 
ATOM   3172  O OE2   . GLU E 5  63  ? 108.226 126.286 85.231  1.00 43.60  ? 60  GLU E OE2   1 
ATOM   3173  N N     . LEU E 5  64  ? 111.242 121.781 86.605  1.00 23.14  ? 61  LEU E N     1 
ATOM   3174  C CA    . LEU E 5  64  ? 112.409 121.939 87.451  1.00 20.23  ? 61  LEU E CA    1 
ATOM   3175  C C     . LEU E 5  64  ? 112.964 123.340 87.285  1.00 21.29  ? 61  LEU E C     1 
ATOM   3176  O O     . LEU E 5  64  ? 112.840 123.942 86.221  1.00 24.20  ? 61  LEU E O     1 
ATOM   3177  C CB    . LEU E 5  64  ? 113.442 120.897 87.060  1.00 20.84  ? 61  LEU E CB    1 
ATOM   3178  C CG    . LEU E 5  64  ? 113.017 119.424 87.269  1.00 23.41  ? 61  LEU E CG    1 
ATOM   3179  C CD1   . LEU E 5  64  ? 114.039 118.526 86.667  1.00 23.04  ? 61  LEU E CD1   1 
ATOM   3180  C CD2   . LEU E 5  64  ? 112.896 119.101 88.748  1.00 24.89  ? 61  LEU E CD2   1 
ATOM   3181  N N     . LEU E 5  65  ? 113.515 123.880 88.358  1.00 20.16  ? 62  LEU E N     1 
ATOM   3182  C CA    . LEU E 5  65  ? 114.031 125.232 88.361  1.00 14.78  ? 62  LEU E CA    1 
ATOM   3183  C C     . LEU E 5  65  ? 115.543 125.308 88.242  1.00 15.44  ? 62  LEU E C     1 
ATOM   3184  O O     . LEU E 5  65  ? 116.089 126.296 87.741  1.00 21.97  ? 62  LEU E O     1 
ATOM   3185  C CB    . LEU E 5  65  ? 113.511 125.899 89.617  1.00 13.26  ? 62  LEU E CB    1 
ATOM   3186  C CG    . LEU E 5  65  ? 111.941 125.917 89.724  1.00 15.94  ? 62  LEU E CG    1 
ATOM   3187  C CD1   . LEU E 5  65  ? 111.562 126.521 91.020  1.00 24.97  ? 62  LEU E CD1   1 
ATOM   3188  C CD2   . LEU E 5  65  ? 111.303 126.699 88.580  1.00 22.41  ? 62  LEU E CD2   1 
ATOM   3189  N N     . ILE E 5  66  ? 116.235 124.278 88.694  1.00 15.00  ? 63  ILE E N     1 
ATOM   3190  C CA    . ILE E 5  66  ? 117.687 124.273 88.600  1.00 13.09  ? 63  ILE E CA    1 
ATOM   3191  C C     . ILE E 5  66  ? 118.083 123.790 87.205  1.00 20.86  ? 63  ILE E C     1 
ATOM   3192  O O     . ILE E 5  66  ? 117.605 122.755 86.741  1.00 24.05  ? 63  ILE E O     1 
ATOM   3193  C CB    . ILE E 5  66  ? 118.338 123.388 89.674  1.00 15.05  ? 63  ILE E CB    1 
ATOM   3194  C CG1   . ILE E 5  66  ? 118.033 123.914 91.070  1.00 17.94  ? 63  ILE E CG1   1 
ATOM   3195  C CG2   . ILE E 5  66  ? 119.823 123.332 89.445  1.00 24.02  ? 63  ILE E CG2   1 
ATOM   3196  C CD1   . ILE E 5  66  ? 118.413 122.956 92.208  1.00 16.96  ? 63  ILE E CD1   1 
ATOM   3197  N N     . ARG E 5  67  ? 118.969 124.511 86.529  1.00 23.65  ? 64  ARG E N     1 
ATOM   3198  C CA    . ARG E 5  67  ? 119.365 124.097 85.188  1.00 21.50  ? 64  ARG E CA    1 
ATOM   3199  C C     . ARG E 5  67  ? 120.056 122.753 85.231  1.00 24.53  ? 64  ARG E C     1 
ATOM   3200  O O     . ARG E 5  67  ? 120.861 122.487 86.126  1.00 25.57  ? 64  ARG E O     1 
ATOM   3201  C CB    . ARG E 5  67  ? 120.310 125.074 84.576  1.00 28.20  ? 64  ARG E CB    1 
ATOM   3202  C CG    . ARG E 5  67  ? 119.832 126.466 84.358  1.00 31.63  ? 64  ARG E CG    1 
ATOM   3203  C CD    . ARG E 5  67  ? 118.847 126.593 83.312  1.00 29.98  ? 64  ARG E CD    1 
ATOM   3204  N NE    . ARG E 5  67  ? 117.528 126.479 83.829  1.00 39.08  ? 64  ARG E NE    1 
ATOM   3205  C CZ    . ARG E 5  67  ? 116.418 126.443 83.106  1.00 43.08  ? 64  ARG E CZ    1 
ATOM   3206  N NH1   . ARG E 5  67  ? 116.474 126.500 81.805  1.00 49.04  ? 64  ARG E NH1   1 
ATOM   3207  N NH2   . ARG E 5  67  ? 115.259 126.355 83.725  1.00 38.49  ? 64  ARG E NH2   1 
ATOM   3208  N N     . LYS E 5  68  ? 119.771 121.921 84.245  1.00 22.30  ? 65  LYS E N     1 
ATOM   3209  C CA    . LYS E 5  68  ? 120.266 120.567 84.254  1.00 15.49  ? 65  LYS E CA    1 
ATOM   3210  C C     . LYS E 5  68  ? 121.740 120.315 84.077  1.00 21.28  ? 65  LYS E C     1 
ATOM   3211  O O     . LYS E 5  68  ? 122.296 119.528 84.839  1.00 24.48  ? 65  LYS E O     1 
ATOM   3212  C CB    . LYS E 5  68  ? 119.542 119.827 83.201  1.00 11.57  ? 65  LYS E CB    1 
ATOM   3213  C CG    . LYS E 5  68  ? 118.103 119.622 83.526  1.00 16.76  ? 65  LYS E CG    1 
ATOM   3214  C CD    . LYS E 5  68  ? 117.404 118.917 82.412  1.00 20.42  ? 65  LYS E CD    1 
ATOM   3215  C CE    . LYS E 5  68  ? 115.938 118.772 82.653  1.00 14.39  ? 65  LYS E CE    1 
ATOM   3216  N NZ    . LYS E 5  68  ? 115.263 118.100 81.502  1.00 15.97  ? 65  LYS E NZ    1 
ATOM   3217  N N     . LEU E 5  69  ? 122.424 120.950 83.148  1.00 21.62  ? 66  LEU E N     1 
ATOM   3218  C CA    . LEU E 5  69  ? 123.821 120.572 83.107  1.00 18.06  ? 66  LEU E CA    1 
ATOM   3219  C C     . LEU E 5  69  ? 124.634 120.910 84.342  1.00 24.77  ? 66  LEU E C     1 
ATOM   3220  O O     . LEU E 5  69  ? 125.462 120.088 84.730  1.00 27.68  ? 66  LEU E O     1 
ATOM   3221  C CB    . LEU E 5  69  ? 124.561 121.125 81.912  1.00 20.69  ? 66  LEU E CB    1 
ATOM   3222  C CG    . LEU E 5  69  ? 124.227 120.557 80.567  1.00 21.45  ? 66  LEU E CG    1 
ATOM   3223  C CD1   . LEU E 5  69  ? 124.958 121.365 79.543  1.00 29.43  ? 66  LEU E CD1   1 
ATOM   3224  C CD2   . LEU E 5  69  ? 124.634 119.103 80.465  1.00 2.31   ? 66  LEU E CD2   1 
ATOM   3225  N N     . PRO E 5  70  ? 124.556 122.093 84.966  1.00 23.10  ? 67  PRO E N     1 
ATOM   3226  C CA    . PRO E 5  70  ? 125.316 122.341 86.148  1.00 23.55  ? 67  PRO E CA    1 
ATOM   3227  C C     . PRO E 5  70  ? 124.857 121.499 87.308  1.00 25.70  ? 67  PRO E C     1 
ATOM   3228  O O     . PRO E 5  70  ? 125.669 121.139 88.158  1.00 27.78  ? 67  PRO E O     1 
ATOM   3229  C CB    . PRO E 5  70  ? 125.088 123.803 86.376  1.00 28.45  ? 67  PRO E CB    1 
ATOM   3230  C CG    . PRO E 5  70  ? 123.852 124.113 85.658  1.00 27.88  ? 67  PRO E CG    1 
ATOM   3231  C CD    . PRO E 5  70  ? 123.830 123.227 84.481  1.00 24.94  ? 67  PRO E CD    1 
ATOM   3232  N N     . PHE E 5  71  ? 123.598 121.068 87.315  1.00 24.96  ? 68  PHE E N     1 
ATOM   3233  C CA    . PHE E 5  71  ? 123.207 120.198 88.386  1.00 19.67  ? 68  PHE E CA    1 
ATOM   3234  C C     . PHE E 5  71  ? 123.924 118.903 88.204  1.00 23.36  ? 68  PHE E C     1 
ATOM   3235  O O     . PHE E 5  71  ? 124.454 118.329 89.152  1.00 22.62  ? 68  PHE E O     1 
ATOM   3236  C CB    . PHE E 5  71  ? 121.738 119.944 88.431  1.00 17.73  ? 68  PHE E CB    1 
ATOM   3237  C CG    . PHE E 5  71  ? 121.402 119.116 89.565  1.00 18.43  ? 68  PHE E CG    1 
ATOM   3238  C CD1   . PHE E 5  71  ? 121.364 119.642 90.823  1.00 18.66  ? 68  PHE E CD1   1 
ATOM   3239  C CD2   . PHE E 5  71  ? 121.142 117.812 89.402  1.00 19.41  ? 68  PHE E CD2   1 
ATOM   3240  C CE1   . PHE E 5  71  ? 121.063 118.865 91.876  1.00 13.20  ? 68  PHE E CE1   1 
ATOM   3241  C CE2   . PHE E 5  71  ? 120.845 117.034 90.455  1.00 16.30  ? 68  PHE E CE2   1 
ATOM   3242  C CZ    . PHE E 5  71  ? 120.803 117.559 91.683  1.00 16.74  ? 68  PHE E CZ    1 
ATOM   3243  N N     . GLN E 5  72  ? 123.929 118.414 86.980  1.00 22.85  ? 69  GLN E N     1 
ATOM   3244  C CA    . GLN E 5  72  ? 124.561 117.162 86.697  1.00 19.65  ? 69  GLN E CA    1 
ATOM   3245  C C     . GLN E 5  72  ? 126.030 117.171 87.023  1.00 24.02  ? 69  GLN E C     1 
ATOM   3246  O O     . GLN E 5  72  ? 126.548 116.187 87.556  1.00 23.83  ? 69  GLN E O     1 
ATOM   3247  C CB    . GLN E 5  72  ? 124.377 116.826 85.261  1.00 14.98  ? 69  GLN E CB    1 
ATOM   3248  C CG    . GLN E 5  72  ? 124.917 115.574 84.900  1.00 19.90  ? 69  GLN E CG    1 
ATOM   3249  C CD    . GLN E 5  72  ? 124.580 115.245 83.550  1.00 22.68  ? 69  GLN E CD    1 
ATOM   3250  O OE1   . GLN E 5  72  ? 124.524 116.088 82.673  1.00 34.08  ? 69  GLN E OE1   1 
ATOM   3251  N NE2   . GLN E 5  72  ? 124.330 113.984 83.319  1.00 10.01  ? 69  GLN E NE2   1 
ATOM   3252  N N     . ARG E 5  73  ? 126.730 118.248 86.729  1.00 21.25  ? 70  ARG E N     1 
ATOM   3253  C CA    . ARG E 5  73  ? 128.126 118.240 87.079  1.00 17.06  ? 70  ARG E CA    1 
ATOM   3254  C C     . ARG E 5  73  ? 128.325 118.234 88.563  1.00 21.72  ? 70  ARG E C     1 
ATOM   3255  O O     . ARG E 5  73  ? 129.259 117.599 89.042  1.00 27.00  ? 70  ARG E O     1 
ATOM   3256  C CB    . ARG E 5  73  ? 128.863 119.365 86.515  1.00 24.15  ? 70  ARG E CB    1 
ATOM   3257  C CG    . ARG E 5  73  ? 129.020 119.274 85.082  1.00 31.32  ? 70  ARG E CG    1 
ATOM   3258  C CD    . ARG E 5  73  ? 130.034 120.209 84.587  1.00 41.19  ? 70  ARG E CD    1 
ATOM   3259  N NE    . ARG E 5  73  ? 129.703 121.583 84.807  1.00 35.69  ? 70  ARG E NE    1 
ATOM   3260  C CZ    . ARG E 5  73  ? 129.005 122.349 83.985  1.00 34.81  ? 70  ARG E CZ    1 
ATOM   3261  N NH1   . ARG E 5  73  ? 128.554 121.871 82.862  1.00 32.16  ? 70  ARG E NH1   1 
ATOM   3262  N NH2   . ARG E 5  73  ? 128.773 123.601 84.319  1.00 38.21  ? 70  ARG E NH2   1 
ATOM   3263  N N     . LEU E 5  74  ? 127.471 118.917 89.310  1.00 23.05  ? 71  LEU E N     1 
ATOM   3264  C CA    . LEU E 5  74  ? 127.609 118.903 90.746  1.00 20.11  ? 71  LEU E CA    1 
ATOM   3265  C C     . LEU E 5  74  ? 127.480 117.491 91.267  1.00 26.06  ? 71  LEU E C     1 
ATOM   3266  O O     . LEU E 5  74  ? 128.257 117.071 92.128  1.00 25.05  ? 71  LEU E O     1 
ATOM   3267  C CB    . LEU E 5  74  ? 126.547 119.782 91.384  1.00 18.75  ? 71  LEU E CB    1 
ATOM   3268  C CG    . LEU E 5  74  ? 126.505 119.835 92.885  1.00 19.48  ? 71  LEU E CG    1 
ATOM   3269  C CD1   . LEU E 5  74  ? 127.808 120.352 93.433  1.00 25.79  ? 71  LEU E CD1   1 
ATOM   3270  C CD2   . LEU E 5  74  ? 125.346 120.721 93.282  1.00 22.12  ? 71  LEU E CD2   1 
ATOM   3271  N N     . VAL E 5  75  ? 126.535 116.731 90.734  1.00 24.57  ? 72  VAL E N     1 
ATOM   3272  C CA    . VAL E 5  75  ? 126.376 115.366 91.184  1.00 16.94  ? 72  VAL E CA    1 
ATOM   3273  C C     . VAL E 5  75  ? 127.631 114.575 90.930  1.00 21.04  ? 72  VAL E C     1 
ATOM   3274  O O     . VAL E 5  75  ? 128.098 113.849 91.805  1.00 21.58  ? 72  VAL E O     1 
ATOM   3275  C CB    . VAL E 5  75  ? 125.207 114.705 90.463  1.00 15.93  ? 72  VAL E CB    1 
ATOM   3276  C CG1   . VAL E 5  75  ? 125.172 113.248 90.719  1.00 4.57   ? 72  VAL E CG1   1 
ATOM   3277  C CG2   . VAL E 5  75  ? 123.949 115.313 90.948  1.00 16.05  ? 72  VAL E CG2   1 
ATOM   3278  N N     . ARG E 5  76  ? 128.207 114.718 89.763  1.00 22.56  ? 73  ARG E N     1 
ATOM   3279  C CA    . ARG E 5  76  ? 129.410 113.982 89.478  1.00 16.37  ? 73  ARG E CA    1 
ATOM   3280  C C     . ARG E 5  76  ? 130.582 114.376 90.324  1.00 20.79  ? 73  ARG E C     1 
ATOM   3281  O O     . ARG E 5  76  ? 131.342 113.514 90.748  1.00 26.94  ? 73  ARG E O     1 
ATOM   3282  C CB    . ARG E 5  76  ? 129.790 114.192 88.086  1.00 20.27  ? 73  ARG E CB    1 
ATOM   3283  C CG    . ARG E 5  76  ? 128.901 113.577 87.195  1.00 22.66  ? 73  ARG E CG    1 
ATOM   3284  C CD    . ARG E 5  76  ? 129.248 113.825 85.844  1.00 25.55  ? 73  ARG E CD    1 
ATOM   3285  N NE    . ARG E 5  76  ? 128.272 113.302 85.020  1.00 23.96  ? 73  ARG E NE    1 
ATOM   3286  C CZ    . ARG E 5  76  ? 128.221 112.066 84.654  1.00 25.11  ? 73  ARG E CZ    1 
ATOM   3287  N NH1   . ARG E 5  76  ? 129.143 111.237 85.040  1.00 32.59  ? 73  ARG E NH1   1 
ATOM   3288  N NH2   . ARG E 5  76  ? 127.261 111.659 83.908  1.00 25.44  ? 73  ARG E NH2   1 
ATOM   3289  N N     . GLU E 5  77  ? 130.746 115.655 90.590  1.00 22.50  ? 74  GLU E N     1 
ATOM   3290  C CA    . GLU E 5  77  ? 131.862 116.096 91.395  1.00 23.78  ? 74  GLU E CA    1 
ATOM   3291  C C     . GLU E 5  77  ? 131.821 115.425 92.750  1.00 22.15  ? 74  GLU E C     1 
ATOM   3292  O O     . GLU E 5  77  ? 132.829 114.910 93.245  1.00 31.07  ? 74  GLU E O     1 
ATOM   3293  C CB    . GLU E 5  77  ? 131.776 117.598 91.565  1.00 28.49  ? 74  GLU E CB    1 
ATOM   3294  C CG    . GLU E 5  77  ? 132.847 118.240 92.393  1.00 34.21  ? 74  GLU E CG    1 
ATOM   3295  C CD    . GLU E 5  77  ? 132.619 119.755 92.570  1.00 43.36  ? 74  GLU E CD    1 
ATOM   3296  O OE1   . GLU E 5  77  ? 132.259 120.426 91.618  1.00 39.36  ? 74  GLU E OE1   1 
ATOM   3297  O OE2   . GLU E 5  77  ? 132.790 120.233 93.671  1.00 42.26  ? 74  GLU E OE2   1 
ATOM   3298  N N     . ILE E 5  78  ? 130.642 115.384 93.340  1.00 21.17  ? 75  ILE E N     1 
ATOM   3299  C CA    . ILE E 5  78  ? 130.490 114.773 94.634  1.00 16.80  ? 75  ILE E CA    1 
ATOM   3300  C C     . ILE E 5  78  ? 130.769 113.294 94.558  1.00 20.58  ? 75  ILE E C     1 
ATOM   3301  O O     . ILE E 5  78  ? 131.447 112.721 95.415  1.00 24.46  ? 75  ILE E O     1 
ATOM   3302  C CB    . ILE E 5  78  ? 129.091 115.022 95.172  1.00 15.55  ? 75  ILE E CB    1 
ATOM   3303  C CG1   . ILE E 5  78  ? 128.936 116.502 95.481  1.00 18.36  ? 75  ILE E CG1   1 
ATOM   3304  C CG2   . ILE E 5  78  ? 128.854 114.160 96.374  1.00 21.25  ? 75  ILE E CG2   1 
ATOM   3305  C CD1   . ILE E 5  78  ? 127.517 116.940 95.739  1.00 18.14  ? 75  ILE E CD1   1 
ATOM   3306  N N     . ALA E 5  79  ? 130.229 112.652 93.550  1.00 20.12  ? 76  ALA E N     1 
ATOM   3307  C CA    . ALA E 5  79  ? 130.414 111.241 93.411  1.00 13.11  ? 76  ALA E CA    1 
ATOM   3308  C C     . ALA E 5  79  ? 131.868 110.862 93.275  1.00 15.16  ? 76  ALA E C     1 
ATOM   3309  O O     . ALA E 5  79  ? 132.250 109.819 93.787  1.00 19.11  ? 76  ALA E O     1 
ATOM   3310  C CB    . ALA E 5  79  ? 129.637 110.762 92.243  1.00 20.00  ? 76  ALA E CB    1 
ATOM   3311  N N     . GLN E 5  80  ? 132.692 111.688 92.626  1.00 19.39  ? 77  GLN E N     1 
ATOM   3312  C CA    . GLN E 5  80  ? 134.108 111.362 92.462  1.00 19.48  ? 77  GLN E CA    1 
ATOM   3313  C C     . GLN E 5  80  ? 134.819 111.281 93.767  1.00 20.17  ? 77  GLN E C     1 
ATOM   3314  O O     . GLN E 5  80  ? 135.710 110.458 93.939  1.00 23.64  ? 77  GLN E O     1 
ATOM   3315  C CB    . GLN E 5  80  ? 134.852 112.374 91.619  1.00 25.47  ? 77  GLN E CB    1 
ATOM   3316  C CG    . GLN E 5  80  ? 134.510 112.346 90.172  1.00 35.02  ? 77  GLN E CG    1 
ATOM   3317  C CD    . GLN E 5  80  ? 135.194 113.459 89.364  1.00 46.41  ? 77  GLN E CD    1 
ATOM   3318  O OE1   . GLN E 5  80  ? 135.684 114.464 89.915  1.00 42.98  ? 77  GLN E OE1   1 
ATOM   3319  N NE2   . GLN E 5  80  ? 135.228 113.273 88.047  1.00 45.92  ? 77  GLN E NE2   1 
ATOM   3320  N N     . ASP E 5  81  ? 134.444 112.112 94.719  1.00 24.47  ? 78  ASP E N     1 
ATOM   3321  C CA    . ASP E 5  81  ? 135.116 112.016 96.003  1.00 26.76  ? 78  ASP E CA    1 
ATOM   3322  C C     . ASP E 5  81  ? 134.859 110.671 96.657  1.00 23.39  ? 78  ASP E C     1 
ATOM   3323  O O     . ASP E 5  81  ? 135.724 110.148 97.358  1.00 25.08  ? 78  ASP E O     1 
ATOM   3324  C CB    . ASP E 5  81  ? 134.683 113.117 96.960  1.00 33.99  ? 78  ASP E CB    1 
ATOM   3325  C CG    . ASP E 5  81  ? 135.262 114.484 96.641  1.00 54.25  ? 78  ASP E CG    1 
ATOM   3326  O OD1   . ASP E 5  81  ? 136.210 114.573 95.895  1.00 52.34  ? 78  ASP E OD1   1 
ATOM   3327  O OD2   . ASP E 5  81  ? 134.745 115.441 97.162  1.00 59.12  ? 78  ASP E OD2   1 
ATOM   3328  N N     . PHE E 5  82  ? 133.679 110.098 96.443  1.00 20.33  ? 79  PHE E N     1 
ATOM   3329  C CA    . PHE E 5  82  ? 133.417 108.813 97.063  1.00 13.84  ? 79  PHE E CA    1 
ATOM   3330  C C     . PHE E 5  82  ? 134.079 107.683 96.303  1.00 13.85  ? 79  PHE E C     1 
ATOM   3331  O O     . PHE E 5  82  ? 134.653 106.776 96.908  1.00 15.13  ? 79  PHE E O     1 
ATOM   3332  C CB    . PHE E 5  82  ? 131.927 108.528 97.127  1.00 11.71  ? 79  PHE E CB    1 
ATOM   3333  C CG    . PHE E 5  82  ? 131.202 109.454 97.995  1.00 13.61  ? 79  PHE E CG    1 
ATOM   3334  C CD1   . PHE E 5  82  ? 130.160 110.160 97.504  1.00 17.67  ? 79  PHE E CD1   1 
ATOM   3335  C CD2   . PHE E 5  82  ? 131.567 109.655 99.288  1.00 18.01  ? 79  PHE E CD2   1 
ATOM   3336  C CE1   . PHE E 5  82  ? 129.490 111.041 98.279  1.00 18.27  ? 79  PHE E CE1   1 
ATOM   3337  C CE2   . PHE E 5  82  ? 130.905 110.545 100.062 1.00 17.92  ? 79  PHE E CE2   1 
ATOM   3338  C CZ    . PHE E 5  82  ? 129.864 111.239 99.552  1.00 16.18  ? 79  PHE E CZ    1 
ATOM   3339  N N     . LYS E 5  83  ? 133.916 107.674 94.989  1.00 15.08  ? 80  LYS E N     1 
ATOM   3340  C CA    . LYS E 5  83  ? 134.530 106.642 94.167  1.00 15.83  ? 80  LYS E CA    1 
ATOM   3341  C C     . LYS E 5  83  ? 134.788 107.162 92.765  1.00 18.89  ? 80  LYS E C     1 
ATOM   3342  O O     . LYS E 5  83  ? 133.945 107.851 92.192  1.00 24.09  ? 80  LYS E O     1 
ATOM   3343  C CB    . LYS E 5  83  ? 133.644 105.397 94.119  1.00 16.02  ? 80  LYS E CB    1 
ATOM   3344  C CG    . LYS E 5  83  ? 134.368 104.122 93.708  1.00 22.13  ? 80  LYS E CG    1 
ATOM   3345  C CD    . LYS E 5  83  ? 133.465 102.906 93.852  1.00 23.89  ? 80  LYS E CD    1 
ATOM   3346  C CE    . LYS E 5  83  ? 134.265 101.612 93.828  1.00 32.06  ? 80  LYS E CE    1 
ATOM   3347  N NZ    . LYS E 5  83  ? 135.093 101.484 92.598  1.00 40.77  ? 80  LYS E NZ    1 
ATOM   3348  N N     . THR E 5  84  ? 135.924 106.813 92.180  1.00 21.28  ? 81  THR E N     1 
ATOM   3349  C CA    . THR E 5  84  ? 136.196 107.269 90.849  1.00 25.07  ? 81  THR E CA    1 
ATOM   3350  C C     . THR E 5  84  ? 135.551 106.414 89.799  1.00 26.92  ? 81  THR E C     1 
ATOM   3351  O O     . THR E 5  84  ? 135.125 105.292 90.044  1.00 31.14  ? 81  THR E O     1 
ATOM   3352  C CB    . THR E 5  84  ? 137.703 107.332 90.614  1.00 32.92  ? 81  THR E CB    1 
ATOM   3353  O OG1   . THR E 5  84  ? 138.264 106.021 90.747  1.00 35.64  ? 81  THR E OG1   1 
ATOM   3354  C CG2   . THR E 5  84  ? 138.328 108.253 91.639  1.00 36.67  ? 81  THR E CG2   1 
ATOM   3355  N N     . ASP E 5  85  ? 135.508 106.950 88.597  1.00 30.52  ? 82  ASP E N     1 
ATOM   3356  C CA    . ASP E 5  85  ? 135.011 106.269 87.422  1.00 30.57  ? 82  ASP E CA    1 
ATOM   3357  C C     . ASP E 5  85  ? 133.607 105.696 87.530  1.00 27.85  ? 82  ASP E C     1 
ATOM   3358  O O     . ASP E 5  85  ? 133.337 104.604 87.040  1.00 28.27  ? 82  ASP E O     1 
ATOM   3359  C CB    . ASP E 5  85  ? 135.990 105.183 87.052  1.00 36.31  ? 82  ASP E CB    1 
ATOM   3360  C CG    . ASP E 5  85  ? 137.327 105.791 86.770  1.00 55.97  ? 82  ASP E CG    1 
ATOM   3361  O OD1   . ASP E 5  85  ? 137.365 106.872 86.215  1.00 45.90  ? 82  ASP E OD1   1 
ATOM   3362  O OD2   . ASP E 5  85  ? 138.316 105.205 87.141  1.00 60.20  ? 82  ASP E OD2   1 
ATOM   3363  N N     . LEU E 5  86  ? 132.698 106.435 88.132  1.00 21.74  ? 83  LEU E N     1 
ATOM   3364  C CA    . LEU E 5  86  ? 131.320 105.996 88.180  1.00 15.22  ? 83  LEU E CA    1 
ATOM   3365  C C     . LEU E 5  86  ? 130.576 106.585 87.041  1.00 19.92  ? 83  LEU E C     1 
ATOM   3366  O O     . LEU E 5  86  ? 130.905 107.659 86.546  1.00 32.50  ? 83  LEU E O     1 
ATOM   3367  C CB    . LEU E 5  86  ? 130.583 106.418 89.434  1.00 12.13  ? 83  LEU E CB    1 
ATOM   3368  C CG    . LEU E 5  86  ? 131.056 105.911 90.730  1.00 19.40  ? 83  LEU E CG    1 
ATOM   3369  C CD1   . LEU E 5  86  ? 130.252 106.579 91.781  1.00 23.81  ? 83  LEU E CD1   1 
ATOM   3370  C CD2   . LEU E 5  86  ? 130.870 104.402 90.816  1.00 19.42  ? 83  LEU E CD2   1 
ATOM   3371  N N     . ARG E 5  87  ? 129.543 105.906 86.653  1.00 17.20  ? 84  ARG E N     1 
ATOM   3372  C CA    . ARG E 5  87  ? 128.653 106.365 85.632  1.00 15.19  ? 84  ARG E CA    1 
ATOM   3373  C C     . ARG E 5  87  ? 127.300 106.539 86.211  1.00 16.74  ? 84  ARG E C     1 
ATOM   3374  O O     . ARG E 5  87  ? 127.008 105.955 87.249  1.00 16.99  ? 84  ARG E O     1 
ATOM   3375  C CB    . ARG E 5  87  ? 128.583 105.349 84.583  1.00 25.27  ? 84  ARG E CB    1 
ATOM   3376  C CG    . ARG E 5  87  ? 129.796 105.154 83.893  1.00 31.70  ? 84  ARG E CG    1 
ATOM   3377  C CD    . ARG E 5  87  ? 129.708 104.034 83.031  1.00 33.99  ? 84  ARG E CD    1 
ATOM   3378  N NE    . ARG E 5  87  ? 130.909 103.900 82.357  1.00 47.94  ? 84  ARG E NE    1 
ATOM   3379  C CZ    . ARG E 5  87  ? 131.166 104.325 81.133  1.00 62.73  ? 84  ARG E CZ    1 
ATOM   3380  N NH1   . ARG E 5  87  ? 130.244 104.850 80.384  1.00 55.88  ? 84  ARG E NH1   1 
ATOM   3381  N NH2   . ARG E 5  87  ? 132.380 104.204 80.682  1.00 81.79  ? 84  ARG E NH2   1 
ATOM   3382  N N     . PHE E 5  88  ? 126.490 107.360 85.597  1.00 15.93  ? 85  PHE E N     1 
ATOM   3383  C CA    . PHE E 5  88  ? 125.136 107.515 86.076  1.00 12.58  ? 85  PHE E CA    1 
ATOM   3384  C C     . PHE E 5  88  ? 124.136 107.336 85.014  1.00 12.17  ? 85  PHE E C     1 
ATOM   3385  O O     . PHE E 5  88  ? 124.296 107.864 83.932  1.00 22.03  ? 85  PHE E O     1 
ATOM   3386  C CB    . PHE E 5  88  ? 124.910 108.907 86.636  1.00 10.03  ? 85  PHE E CB    1 
ATOM   3387  C CG    . PHE E 5  88  ? 125.589 109.215 87.858  1.00 9.43   ? 85  PHE E CG    1 
ATOM   3388  C CD1   . PHE E 5  88  ? 126.881 109.568 87.885  1.00 10.60  ? 85  PHE E CD1   1 
ATOM   3389  C CD2   . PHE E 5  88  ? 124.893 109.181 89.013  1.00 4.14   ? 85  PHE E CD2   1 
ATOM   3390  C CE1   . PHE E 5  88  ? 127.471 109.853 89.051  1.00 9.25   ? 85  PHE E CE1   1 
ATOM   3391  C CE2   . PHE E 5  88  ? 125.473 109.468 90.170  1.00 1.86   ? 85  PHE E CE2   1 
ATOM   3392  C CZ    . PHE E 5  88  ? 126.760 109.798 90.197  1.00 1.98   ? 85  PHE E CZ    1 
ATOM   3393  N N     . GLN E 5  89  ? 123.038 106.723 85.333  1.00 10.28  ? 86  GLN E N     1 
ATOM   3394  C CA    . GLN E 5  89  ? 121.990 106.700 84.349  1.00 10.23  ? 86  GLN E CA    1 
ATOM   3395  C C     . GLN E 5  89  ? 121.356 108.051 84.331  1.00 15.68  ? 86  GLN E C     1 
ATOM   3396  O O     . GLN E 5  89  ? 121.261 108.699 85.373  1.00 11.58  ? 86  GLN E O     1 
ATOM   3397  C CB    . GLN E 5  89  ? 120.929 105.683 84.635  1.00 8.31   ? 86  GLN E CB    1 
ATOM   3398  C CG    . GLN E 5  89  ? 121.359 104.342 84.528  1.00 9.37   ? 86  GLN E CG    1 
ATOM   3399  C CD    . GLN E 5  89  ? 120.238 103.440 84.641  1.00 6.00   ? 86  GLN E CD    1 
ATOM   3400  O OE1   . GLN E 5  89  ? 119.271 103.742 85.326  1.00 7.11   ? 86  GLN E OE1   1 
ATOM   3401  N NE2   . GLN E 5  89  ? 120.313 102.308 83.994  1.00 5.24   ? 86  GLN E NE2   1 
ATOM   3402  N N     . SER E 5  90  ? 120.796 108.451 83.200  1.00 14.91  ? 87  SER E N     1 
ATOM   3403  C CA    . SER E 5  90  ? 120.151 109.748 83.147  1.00 6.69   ? 87  SER E CA    1 
ATOM   3404  C C     . SER E 5  90  ? 118.983 109.811 84.091  1.00 11.17  ? 87  SER E C     1 
ATOM   3405  O O     . SER E 5  90  ? 118.694 110.870 84.651  1.00 13.67  ? 87  SER E O     1 
ATOM   3406  C CB    . SER E 5  90  ? 119.632 110.011 81.777  1.00 10.35  ? 87  SER E CB    1 
ATOM   3407  O OG    . SER E 5  90  ? 118.546 109.182 81.518  1.00 20.89  ? 87  SER E OG    1 
ATOM   3408  N N     . SER E 5  91  ? 118.382 108.673 84.376  1.00 7.46   ? 88  SER E N     1 
ATOM   3409  C CA    . SER E 5  91  ? 117.285 108.637 85.297  1.00 5.18   ? 88  SER E CA    1 
ATOM   3410  C C     . SER E 5  91  ? 117.762 108.814 86.727  1.00 10.51  ? 88  SER E C     1 
ATOM   3411  O O     . SER E 5  91  ? 116.986 109.236 87.581  1.00 13.79  ? 88  SER E O     1 
ATOM   3412  C CB    . SER E 5  91  ? 116.551 107.338 85.175  1.00 8.95   ? 88  SER E CB    1 
ATOM   3413  O OG    . SER E 5  91  ? 115.962 107.211 83.920  1.00 8.64   ? 88  SER E OG    1 
ATOM   3414  N N     . ALA E 5  92  ? 119.014 108.472 87.030  1.00 9.81   ? 89  ALA E N     1 
ATOM   3415  C CA    . ALA E 5  92  ? 119.499 108.634 88.377  1.00 7.57   ? 89  ALA E CA    1 
ATOM   3416  C C     . ALA E 5  92  ? 119.690 110.083 88.641  1.00 13.07  ? 89  ALA E C     1 
ATOM   3417  O O     . ALA E 5  92  ? 119.356 110.583 89.713  1.00 13.17  ? 89  ALA E O     1 
ATOM   3418  C CB    . ALA E 5  92  ? 120.797 107.913 88.577  1.00 11.25  ? 89  ALA E CB    1 
ATOM   3419  N N     . VAL E 5  93  ? 120.174 110.788 87.638  1.00 14.20  ? 90  VAL E N     1 
ATOM   3420  C CA    . VAL E 5  93  ? 120.405 112.195 87.823  1.00 8.01   ? 90  VAL E CA    1 
ATOM   3421  C C     . VAL E 5  93  ? 119.083 112.897 87.961  1.00 10.90  ? 90  VAL E C     1 
ATOM   3422  O O     . VAL E 5  93  ? 118.948 113.772 88.813  1.00 11.35  ? 90  VAL E O     1 
ATOM   3423  C CB    . VAL E 5  93  ? 121.239 112.793 86.716  1.00 8.79   ? 90  VAL E CB    1 
ATOM   3424  C CG1   . VAL E 5  93  ? 121.321 114.293 86.890  1.00 14.68  ? 90  VAL E CG1   1 
ATOM   3425  C CG2   . VAL E 5  93  ? 122.609 112.183 86.767  1.00 8.97   ? 90  VAL E CG2   1 
ATOM   3426  N N     . MET E 5  94  ? 118.099 112.544 87.143  1.00 9.01   ? 91  MET E N     1 
ATOM   3427  C CA    . MET E 5  94  ? 116.818 113.192 87.283  1.00 3.77   ? 91  MET E CA    1 
ATOM   3428  C C     . MET E 5  94  ? 116.196 112.917 88.627  1.00 10.12  ? 91  MET E C     1 
ATOM   3429  O O     . MET E 5  94  ? 115.593 113.816 89.207  1.00 11.42  ? 91  MET E O     1 
ATOM   3430  C CB    . MET E 5  94  ? 115.867 112.725 86.223  1.00 4.48   ? 91  MET E CB    1 
ATOM   3431  C CG    . MET E 5  94  ? 116.208 113.182 84.855  1.00 4.55   ? 91  MET E CG    1 
ATOM   3432  S SD    . MET E 5  94  ? 116.259 114.935 84.692  1.00 46.78  ? 91  MET E SD    1 
ATOM   3433  C CE    . MET E 5  94  ? 114.546 115.378 84.873  1.00 2.11   ? 91  MET E CE    1 
ATOM   3434  N N     . ALA E 5  95  ? 116.330 111.703 89.156  1.00 11.74  ? 92  ALA E N     1 
ATOM   3435  C CA    . ALA E 5  95  ? 115.759 111.429 90.456  1.00 6.11   ? 92  ALA E CA    1 
ATOM   3436  C C     . ALA E 5  95  ? 116.409 112.273 91.522  1.00 7.81   ? 92  ALA E C     1 
ATOM   3437  O O     . ALA E 5  95  ? 115.723 112.810 92.394  1.00 14.42  ? 92  ALA E O     1 
ATOM   3438  C CB    . ALA E 5  95  ? 115.910 109.976 90.787  1.00 9.62   ? 92  ALA E CB    1 
ATOM   3439  N N     . LEU E 5  96  ? 117.720 112.465 91.444  1.00 10.59  ? 93  LEU E N     1 
ATOM   3440  C CA    . LEU E 5  96  ? 118.353 113.295 92.438  1.00 7.82   ? 93  LEU E CA    1 
ATOM   3441  C C     . LEU E 5  96  ? 117.896 114.705 92.329  1.00 12.61  ? 93  LEU E C     1 
ATOM   3442  O O     . LEU E 5  96  ? 117.646 115.350 93.347  1.00 12.24  ? 93  LEU E O     1 
ATOM   3443  C CB    . LEU E 5  96  ? 119.865 113.308 92.281  1.00 9.42   ? 93  LEU E CB    1 
ATOM   3444  C CG    . LEU E 5  96  ? 120.608 112.069 92.644  1.00 6.96   ? 93  LEU E CG    1 
ATOM   3445  C CD1   . LEU E 5  96  ? 122.011 112.181 92.172  1.00 1.74   ? 93  LEU E CD1   1 
ATOM   3446  C CD2   . LEU E 5  96  ? 120.624 111.906 94.127  1.00 2.66   ? 93  LEU E CD2   1 
ATOM   3447  N N     . GLN E 5  97  ? 117.737 115.205 91.119  1.00 12.26  ? 94  GLN E N     1 
ATOM   3448  C CA    . GLN E 5  97  ? 117.339 116.578 91.008  1.00 8.66   ? 94  GLN E CA    1 
ATOM   3449  C C     . GLN E 5  97  ? 115.954 116.819 91.506  1.00 7.95   ? 94  GLN E C     1 
ATOM   3450  O O     . GLN E 5  97  ? 115.707 117.829 92.161  1.00 13.42  ? 94  GLN E O     1 
ATOM   3451  C CB    . GLN E 5  97  ? 117.427 117.067 89.603  1.00 11.64  ? 94  GLN E CB    1 
ATOM   3452  C CG    . GLN E 5  97  ? 117.164 118.470 89.532  1.00 17.74  ? 94  GLN E CG    1 
ATOM   3453  C CD    . GLN E 5  97  ? 117.479 119.049 88.302  1.00 11.58  ? 94  GLN E CD    1 
ATOM   3454  O OE1   . GLN E 5  97  ? 118.105 118.470 87.434  1.00 11.11  ? 94  GLN E OE1   1 
ATOM   3455  N NE2   . GLN E 5  97  ? 117.049 120.266 88.192  1.00 21.75  ? 94  GLN E NE2   1 
ATOM   3456  N N     . GLU E 5  98  ? 115.048 115.911 91.231  1.00 9.12   ? 95  GLU E N     1 
ATOM   3457  C CA    . GLU E 5  98  ? 113.693 116.101 91.670  1.00 4.46   ? 95  GLU E CA    1 
ATOM   3458  C C     . GLU E 5  98  ? 113.652 116.126 93.184  1.00 9.29   ? 95  GLU E C     1 
ATOM   3459  O O     . GLU E 5  98  ? 112.951 116.941 93.790  1.00 15.00  ? 95  GLU E O     1 
ATOM   3460  C CB    . GLU E 5  98  ? 112.850 114.949 91.206  1.00 4.72   ? 95  GLU E CB    1 
ATOM   3461  C CG    . GLU E 5  98  ? 111.408 115.081 91.413  1.00 8.51   ? 95  GLU E CG    1 
ATOM   3462  C CD    . GLU E 5  98  ? 110.734 115.973 90.432  1.00 22.04  ? 95  GLU E CD    1 
ATOM   3463  O OE1   . GLU E 5  98  ? 111.150 116.010 89.304  1.00 24.15  ? 95  GLU E OE1   1 
ATOM   3464  O OE2   . GLU E 5  98  ? 109.759 116.604 90.783  1.00 21.04  ? 95  GLU E OE2   1 
ATOM   3465  N N     . ALA E 5  99  ? 114.392 115.220 93.820  1.00 11.05  ? 96  ALA E N     1 
ATOM   3466  C CA    . ALA E 5  99  ? 114.407 115.174 95.261  1.00 5.74   ? 96  ALA E CA    1 
ATOM   3467  C C     . ALA E 5  99  ? 115.046 116.401 95.863  1.00 11.17  ? 96  ALA E C     1 
ATOM   3468  O O     . ALA E 5  99  ? 114.564 116.910 96.875  1.00 13.87  ? 96  ALA E O     1 
ATOM   3469  C CB    . ALA E 5  99  ? 115.142 113.966 95.719  1.00 9.81   ? 96  ALA E CB    1 
ATOM   3470  N N     . CYS E 5  100 ? 116.111 116.909 95.245  1.00 13.28  ? 97  CYS E N     1 
ATOM   3471  C CA    . CYS E 5  100 ? 116.778 118.079 95.781  1.00 7.42   ? 97  CYS E CA    1 
ATOM   3472  C C     . CYS E 5  100 ? 115.916 119.285 95.745  1.00 10.05  ? 97  CYS E C     1 
ATOM   3473  O O     . CYS E 5  100 ? 115.889 120.056 96.702  1.00 9.77   ? 97  CYS E O     1 
ATOM   3474  C CB    . CYS E 5  100 ? 118.018 118.401 95.028  1.00 9.03   ? 97  CYS E CB    1 
ATOM   3475  S SG    . CYS E 5  100 ? 119.238 117.253 95.305  1.00 18.60  ? 97  CYS E SG    1 
ATOM   3476  N N     . GLU E 5  101 ? 115.186 119.482 94.670  1.00 11.72  ? 98  GLU E N     1 
ATOM   3477  C CA    . GLU E 5  101 ? 114.355 120.640 94.674  1.00 6.15   ? 98  GLU E CA    1 
ATOM   3478  C C     . GLU E 5  101 ? 113.255 120.487 95.666  1.00 8.38   ? 98  GLU E C     1 
ATOM   3479  O O     . GLU E 5  101 ? 113.004 121.392 96.447  1.00 7.31   ? 98  GLU E O     1 
ATOM   3480  C CB    . GLU E 5  101 ? 113.754 120.891 93.351  1.00 8.26   ? 98  GLU E CB    1 
ATOM   3481  C CG    . GLU E 5  101 ? 114.715 121.302 92.352  1.00 14.19  ? 98  GLU E CG    1 
ATOM   3482  C CD    . GLU E 5  101 ? 114.038 121.668 91.152  1.00 24.27  ? 98  GLU E CD    1 
ATOM   3483  O OE1   . GLU E 5  101 ? 112.872 121.415 91.094  1.00 25.43  ? 98  GLU E OE1   1 
ATOM   3484  O OE2   . GLU E 5  101 ? 114.634 122.248 90.256  1.00 24.32  ? 98  GLU E OE2   1 
ATOM   3485  N N     . ALA E 5  102 ? 112.661 119.310 95.779  1.00 8.67   ? 99  ALA E N     1 
ATOM   3486  C CA    . ALA E 5  102 ? 111.587 119.189 96.730  1.00 3.95   ? 99  ALA E CA    1 
ATOM   3487  C C     . ALA E 5  102 ? 112.068 119.529 98.123  1.00 4.75   ? 99  ALA E C     1 
ATOM   3488  O O     . ALA E 5  102 ? 111.339 120.157 98.898  1.00 1.97   ? 99  ALA E O     1 
ATOM   3489  C CB    . ALA E 5  102 ? 111.036 117.801 96.700  1.00 1.04   ? 99  ALA E CB    1 
ATOM   3490  N N     . TYR E 5  103 ? 113.288 119.136 98.437  1.00 5.77   ? 100 TYR E N     1 
ATOM   3491  C CA    . TYR E 5  103 ? 113.864 119.435 99.714  1.00 4.01   ? 100 TYR E CA    1 
ATOM   3492  C C     . TYR E 5  103 ? 114.030 120.907 99.926  1.00 7.14   ? 100 TYR E C     1 
ATOM   3493  O O     . TYR E 5  103 ? 113.575 121.439 100.940 1.00 9.12   ? 100 TYR E O     1 
ATOM   3494  C CB    . TYR E 5  103 ? 115.168 118.732 99.885  1.00 7.02   ? 100 TYR E CB    1 
ATOM   3495  C CG    . TYR E 5  103 ? 115.829 119.041 101.145 1.00 6.36   ? 100 TYR E CG    1 
ATOM   3496  C CD1   . TYR E 5  103 ? 115.268 118.621 102.262 1.00 8.45   ? 100 TYR E CD1   1 
ATOM   3497  C CD2   . TYR E 5  103 ? 117.016 119.669 101.190 1.00 7.09   ? 100 TYR E CD2   1 
ATOM   3498  C CE1   . TYR E 5  103 ? 115.853 118.834 103.445 1.00 6.11   ? 100 TYR E CE1   1 
ATOM   3499  C CE2   . TYR E 5  103 ? 117.616 119.873 102.386 1.00 5.97   ? 100 TYR E CE2   1 
ATOM   3500  C CZ    . TYR E 5  103 ? 117.033 119.455 103.505 1.00 4.46   ? 100 TYR E CZ    1 
ATOM   3501  O OH    . TYR E 5  103 ? 117.633 119.627 104.736 1.00 10.11  ? 100 TYR E OH    1 
ATOM   3502  N N     . LEU E 5  104 ? 114.638 121.600 98.972  1.00 8.27   ? 101 LEU E N     1 
ATOM   3503  C CA    . LEU E 5  104 ? 114.856 123.016 99.142  1.00 5.39   ? 101 LEU E CA    1 
ATOM   3504  C C     . LEU E 5  104 ? 113.572 123.793 99.154  1.00 5.41   ? 101 LEU E C     1 
ATOM   3505  O O     . LEU E 5  104 ? 113.461 124.771 99.882  1.00 9.55   ? 101 LEU E O     1 
ATOM   3506  C CB    . LEU E 5  104 ? 115.766 123.551 98.080  1.00 6.62   ? 101 LEU E CB    1 
ATOM   3507  C CG    . LEU E 5  104 ? 117.211 123.068 98.136  1.00 4.97   ? 101 LEU E CG    1 
ATOM   3508  C CD1   . LEU E 5  104 ? 117.907 123.592 96.934  1.00 1.01   ? 101 LEU E CD1   1 
ATOM   3509  C CD2   . LEU E 5  104 ? 117.911 123.537 99.391  1.00 2.74   ? 101 LEU E CD2   1 
ATOM   3510  N N     . VAL E 5  105 ? 112.583 123.393 98.398  1.00 5.93   ? 102 VAL E N     1 
ATOM   3511  C CA    . VAL E 5  105 ? 111.357 124.140 98.444  1.00 5.89   ? 102 VAL E CA    1 
ATOM   3512  C C     . VAL E 5  105 ? 110.741 123.999 99.808  1.00 5.45   ? 102 VAL E C     1 
ATOM   3513  O O     . VAL E 5  105 ? 110.260 124.985 100.365 1.00 2.59   ? 102 VAL E O     1 
ATOM   3514  C CB    . VAL E 5  105 ? 110.381 123.681 97.392  1.00 7.01   ? 102 VAL E CB    1 
ATOM   3515  C CG1   . VAL E 5  105 ? 109.044 124.336 97.586  1.00 8.91   ? 102 VAL E CG1   1 
ATOM   3516  C CG2   . VAL E 5  105 ? 110.923 124.038 96.064  1.00 5.14   ? 102 VAL E CG2   1 
ATOM   3517  N N     . GLY E 5  106 ? 110.712 122.791 100.356 1.00 3.82   ? 103 GLY E N     1 
ATOM   3518  C CA    . GLY E 5  106 ? 110.148 122.609 101.679 1.00 2.73   ? 103 GLY E CA    1 
ATOM   3519  C C     . GLY E 5  106 ? 110.920 123.402 102.720 1.00 3.87   ? 103 GLY E C     1 
ATOM   3520  O O     . GLY E 5  106 ? 110.337 123.964 103.648 1.00 7.70   ? 103 GLY E O     1 
ATOM   3521  N N     . LEU E 5  107 ? 112.226 123.501 102.559 1.00 5.46   ? 104 LEU E N     1 
ATOM   3522  C CA    . LEU E 5  107 ? 113.006 124.260 103.496 1.00 4.31   ? 104 LEU E CA    1 
ATOM   3523  C C     . LEU E 5  107 ? 112.633 125.712 103.420 1.00 6.58   ? 104 LEU E C     1 
ATOM   3524  O O     . LEU E 5  107 ? 112.512 126.372 104.453 1.00 7.79   ? 104 LEU E O     1 
ATOM   3525  C CB    . LEU E 5  107 ? 114.478 124.084 103.222 1.00 6.96   ? 104 LEU E CB    1 
ATOM   3526  C CG    . LEU E 5  107 ? 115.443 124.784 104.138 1.00 8.28   ? 104 LEU E CG    1 
ATOM   3527  C CD1   . LEU E 5  107 ? 115.264 124.344 105.573 1.00 7.53   ? 104 LEU E CD1   1 
ATOM   3528  C CD2   . LEU E 5  107 ? 116.812 124.453 103.683 1.00 6.28   ? 104 LEU E CD2   1 
ATOM   3529  N N     . PHE E 5  108 ? 112.417 126.240 102.227 1.00 7.43   ? 105 PHE E N     1 
ATOM   3530  C CA    . PHE E 5  108 ? 112.057 127.631 102.151 1.00 5.08   ? 105 PHE E CA    1 
ATOM   3531  C C     . PHE E 5  108 ? 110.698 127.891 102.739 1.00 6.46   ? 105 PHE E C     1 
ATOM   3532  O O     . PHE E 5  108 ? 110.498 128.947 103.330 1.00 8.67   ? 105 PHE E O     1 
ATOM   3533  C CB    . PHE E 5  108 ? 112.144 128.177 100.751 1.00 7.02   ? 105 PHE E CB    1 
ATOM   3534  C CG    . PHE E 5  108 ? 113.555 128.432 100.337 1.00 6.61   ? 105 PHE E CG    1 
ATOM   3535  C CD1   . PHE E 5  108 ? 114.124 127.764 99.302  1.00 3.78   ? 105 PHE E CD1   1 
ATOM   3536  C CD2   . PHE E 5  108 ? 114.324 129.330 101.011 1.00 3.46   ? 105 PHE E CD2   1 
ATOM   3537  C CE1   . PHE E 5  108 ? 115.415 127.993 98.950  1.00 4.34   ? 105 PHE E CE1   1 
ATOM   3538  C CE2   . PHE E 5  108 ? 115.611 129.549 100.661 1.00 3.37   ? 105 PHE E CE2   1 
ATOM   3539  C CZ    . PHE E 5  108 ? 116.154 128.885 99.635  1.00 5.78   ? 105 PHE E CZ    1 
ATOM   3540  N N     . GLU E 5  109 ? 109.757 126.965 102.641 1.00 5.11   ? 106 GLU E N     1 
ATOM   3541  C CA    . GLU E 5  109 ? 108.482 127.252 103.283 1.00 2.04   ? 106 GLU E CA    1 
ATOM   3542  C C     . GLU E 5  109 ? 108.648 127.387 104.791 1.00 8.14   ? 106 GLU E C     1 
ATOM   3543  O O     . GLU E 5  109 ? 108.092 128.302 105.403 1.00 9.17   ? 106 GLU E O     1 
ATOM   3544  C CB    . GLU E 5  109 ? 107.464 126.158 103.061 1.00 1.70   ? 106 GLU E CB    1 
ATOM   3545  C CG    . GLU E 5  109 ? 106.926 126.036 101.672 1.00 0.86   ? 106 GLU E CG    1 
ATOM   3546  C CD    . GLU E 5  109 ? 105.920 124.886 101.496 1.00 1.02   ? 106 GLU E CD    1 
ATOM   3547  O OE1   . GLU E 5  109 ? 105.803 124.093 102.390 1.00 6.36   ? 106 GLU E OE1   1 
ATOM   3548  O OE2   . GLU E 5  109 ? 105.273 124.825 100.476 1.00 2.74   ? 106 GLU E OE2   1 
ATOM   3549  N N     . ASP E 5  110 ? 109.465 126.532 105.400 1.00 8.32   ? 107 ASP E N     1 
ATOM   3550  C CA    . ASP E 5  110 ? 109.653 126.614 106.845 1.00 4.61   ? 107 ASP E CA    1 
ATOM   3551  C C     . ASP E 5  110 ? 110.516 127.792 107.238 1.00 10.79  ? 107 ASP E C     1 
ATOM   3552  O O     . ASP E 5  110 ? 110.323 128.407 108.295 1.00 11.68  ? 107 ASP E O     1 
ATOM   3553  C CB    . ASP E 5  110 ? 110.216 125.326 107.362 1.00 3.34   ? 107 ASP E CB    1 
ATOM   3554  C CG    . ASP E 5  110 ? 109.177 124.242 107.301 1.00 6.07   ? 107 ASP E CG    1 
ATOM   3555  O OD1   . ASP E 5  110 ? 108.009 124.545 107.243 1.00 4.86   ? 107 ASP E OD1   1 
ATOM   3556  O OD2   . ASP E 5  110 ? 109.544 123.095 107.306 1.00 13.48  ? 107 ASP E OD2   1 
ATOM   3557  N N     . THR E 5  111 ? 111.440 128.147 106.377 1.00 10.88  ? 108 THR E N     1 
ATOM   3558  C CA    . THR E 5  111 ? 112.284 129.284 106.617 1.00 5.71   ? 108 THR E CA    1 
ATOM   3559  C C     . THR E 5  111 ? 111.407 130.510 106.646 1.00 10.37  ? 108 THR E C     1 
ATOM   3560  O O     . THR E 5  111 ? 111.567 131.377 107.501 1.00 12.16  ? 108 THR E O     1 
ATOM   3561  C CB    . THR E 5  111 ? 113.320 129.423 105.523 1.00 6.33   ? 108 THR E CB    1 
ATOM   3562  O OG1   . THR E 5  111 ? 114.140 128.257 105.508 1.00 12.48  ? 108 THR E OG1   1 
ATOM   3563  C CG2   . THR E 5  111 ? 114.156 130.598 105.741 1.00 8.67   ? 108 THR E CG2   1 
ATOM   3564  N N     . ASN E 5  112 ? 110.466 130.595 105.716 1.00 11.37  ? 109 ASN E N     1 
ATOM   3565  C CA    . ASN E 5  112 ? 109.583 131.729 105.645 1.00 8.37   ? 109 ASN E CA    1 
ATOM   3566  C C     . ASN E 5  112 ? 108.740 131.857 106.890 1.00 14.35  ? 109 ASN E C     1 
ATOM   3567  O O     . ASN E 5  112 ? 108.531 132.968 107.374 1.00 16.08  ? 109 ASN E O     1 
ATOM   3568  C CB    . ASN E 5  112 ? 108.702 131.612 104.454 1.00 10.98  ? 109 ASN E CB    1 
ATOM   3569  C CG    . ASN E 5  112 ? 108.006 132.806 104.173 1.00 15.63  ? 109 ASN E CG    1 
ATOM   3570  O OD1   . ASN E 5  112 ? 108.628 133.828 103.901 1.00 22.33  ? 109 ASN E OD1   1 
ATOM   3571  N ND2   . ASN E 5  112 ? 106.724 132.757 104.225 1.00 21.42  ? 109 ASN E ND2   1 
ATOM   3572  N N     . LEU E 5  113 ? 108.288 130.742 107.459 1.00 14.77  ? 110 LEU E N     1 
ATOM   3573  C CA    . LEU E 5  113 ? 107.485 130.842 108.666 1.00 11.47  ? 110 LEU E CA    1 
ATOM   3574  C C     . LEU E 5  113 ? 108.294 131.399 109.799 1.00 10.93  ? 110 LEU E C     1 
ATOM   3575  O O     . LEU E 5  113 ? 107.783 132.170 110.613 1.00 16.10  ? 110 LEU E O     1 
ATOM   3576  C CB    . LEU E 5  113 ? 106.968 129.489 109.108 1.00 10.26  ? 110 LEU E CB    1 
ATOM   3577  C CG    . LEU E 5  113 ? 105.958 128.813 108.224 1.00 10.15  ? 110 LEU E CG    1 
ATOM   3578  C CD1   . LEU E 5  113 ? 105.718 127.425 108.768 1.00 8.42   ? 110 LEU E CD1   1 
ATOM   3579  C CD2   . LEU E 5  113 ? 104.669 129.600 108.170 1.00 15.22  ? 110 LEU E CD2   1 
ATOM   3580  N N     . CYS E 5  114 ? 109.556 131.028 109.865 1.00 11.80  ? 111 CYS E N     1 
ATOM   3581  C CA    . CYS E 5  114 ? 110.384 131.540 110.925 1.00 8.53   ? 111 CYS E CA    1 
ATOM   3582  C C     . CYS E 5  114 ? 110.536 133.044 110.790 1.00 11.94  ? 111 CYS E C     1 
ATOM   3583  O O     . CYS E 5  114 ? 110.449 133.768 111.785 1.00 15.65  ? 111 CYS E O     1 
ATOM   3584  C CB    . CYS E 5  114 ? 111.746 130.901 110.884 1.00 11.42  ? 111 CYS E CB    1 
ATOM   3585  S SG    . CYS E 5  114 ? 111.743 129.207 111.309 1.00 14.81  ? 111 CYS E SG    1 
ATOM   3586  N N     . ALA E 5  115 ? 110.729 133.531 109.567 1.00 13.39  ? 112 ALA E N     1 
ATOM   3587  C CA    . ALA E 5  115 ? 110.875 134.965 109.378 1.00 7.26   ? 112 ALA E CA    1 
ATOM   3588  C C     . ALA E 5  115 ? 109.620 135.711 109.763 1.00 8.77   ? 112 ALA E C     1 
ATOM   3589  O O     . ALA E 5  115 ? 109.706 136.764 110.387 1.00 9.67   ? 112 ALA E O     1 
ATOM   3590  C CB    . ALA E 5  115 ? 111.220 135.282 107.961 1.00 9.43   ? 112 ALA E CB    1 
ATOM   3591  N N     . ILE E 5  116 ? 108.455 135.150 109.474 1.00 13.03  ? 113 ILE E N     1 
ATOM   3592  C CA    . ILE E 5  116 ? 107.207 135.800 109.845 1.00 9.32   ? 113 ILE E CA    1 
ATOM   3593  C C     . ILE E 5  116 ? 107.089 135.875 111.353 1.00 12.81  ? 113 ILE E C     1 
ATOM   3594  O O     . ILE E 5  116 ? 106.674 136.883 111.905 1.00 18.32  ? 113 ILE E O     1 
ATOM   3595  C CB    . ILE E 5  116 ? 105.987 135.103 109.259 1.00 9.86   ? 113 ILE E CB    1 
ATOM   3596  C CG1   . ILE E 5  116 ? 105.998 135.285 107.759 1.00 14.31  ? 113 ILE E CG1   1 
ATOM   3597  C CG2   . ILE E 5  116 ? 104.723 135.689 109.868 1.00 15.56  ? 113 ILE E CG2   1 
ATOM   3598  C CD1   . ILE E 5  116 ? 105.021 134.409 106.999 1.00 25.90  ? 113 ILE E CD1   1 
ATOM   3599  N N     . HIS E 5  117 ? 107.449 134.810 112.042 1.00 14.21  ? 114 HIS E N     1 
ATOM   3600  C CA    . HIS E 5  117 ? 107.397 134.745 113.498 1.00 12.21  ? 114 HIS E CA    1 
ATOM   3601  C C     . HIS E 5  117 ? 108.225 135.858 114.123 1.00 9.43   ? 114 HIS E C     1 
ATOM   3602  O O     . HIS E 5  117 ? 107.849 136.468 115.120 1.00 16.40  ? 114 HIS E O     1 
ATOM   3603  C CB    . HIS E 5  117 ? 107.934 133.404 113.952 1.00 11.07  ? 114 HIS E CB    1 
ATOM   3604  C CG    . HIS E 5  117 ? 107.770 133.119 115.328 1.00 7.68   ? 114 HIS E CG    1 
ATOM   3605  N ND1   . HIS E 5  117 ? 106.558 132.865 115.859 1.00 8.58   ? 114 HIS E ND1   1 
ATOM   3606  C CD2   . HIS E 5  117 ? 108.648 132.980 116.320 1.00 8.35   ? 114 HIS E CD2   1 
ATOM   3607  C CE1   . HIS E 5  117 ? 106.692 132.598 117.115 1.00 9.93   ? 114 HIS E CE1   1 
ATOM   3608  N NE2   . HIS E 5  117 ? 107.939 132.660 117.419 1.00 8.07   ? 114 HIS E NE2   1 
ATOM   3609  N N     . ALA E 5  118 ? 109.346 136.162 113.502 1.00 9.45   ? 115 ALA E N     1 
ATOM   3610  C CA    . ALA E 5  118 ? 110.251 137.193 113.958 1.00 6.11   ? 115 ALA E CA    1 
ATOM   3611  C C     . ALA E 5  118 ? 109.811 138.581 113.511 1.00 10.61  ? 115 ALA E C     1 
ATOM   3612  O O     . ALA E 5  118 ? 110.509 139.555 113.793 1.00 15.64  ? 115 ALA E O     1 
ATOM   3613  C CB    . ALA E 5  118 ? 111.638 136.914 113.461 1.00 10.42  ? 115 ALA E CB    1 
ATOM   3614  N N     . LYS E 5  119 ? 108.654 138.674 112.859 1.00 14.19  ? 116 LYS E N     1 
ATOM   3615  C CA    . LYS E 5  119 ? 108.097 139.927 112.353 1.00 9.90   ? 116 LYS E CA    1 
ATOM   3616  C C     . LYS E 5  119 ? 108.906 140.503 111.188 1.00 11.23  ? 116 LYS E C     1 
ATOM   3617  O O     . LYS E 5  119 ? 109.049 141.719 111.077 1.00 21.15  ? 116 LYS E O     1 
ATOM   3618  C CB    . LYS E 5  119 ? 108.034 140.976 113.468 1.00 9.26   ? 116 LYS E CB    1 
ATOM   3619  C CG    . LYS E 5  119 ? 107.436 140.498 114.788 1.00 19.64  ? 116 LYS E CG    1 
ATOM   3620  C CD    . LYS E 5  119 ? 105.980 140.079 114.668 1.00 28.02  ? 116 LYS E CD    1 
ATOM   3621  C CE    . LYS E 5  119 ? 105.046 141.281 114.630 1.00 28.71  ? 116 LYS E CE    1 
ATOM   3622  N NZ    . LYS E 5  119 ? 103.664 140.893 115.022 1.00 33.40  ? 116 LYS E NZ    1 
ATOM   3623  N N     . ARG E 5  120 ? 109.400 139.650 110.295 1.00 11.41  ? 117 ARG E N     1 
ATOM   3624  C CA    . ARG E 5  120 ? 110.103 140.073 109.118 1.00 6.13   ? 117 ARG E CA    1 
ATOM   3625  C C     . ARG E 5  120 ? 109.501 139.530 107.858 1.00 9.47   ? 117 ARG E C     1 
ATOM   3626  O O     . ARG E 5  120 ? 108.757 138.556 107.871 1.00 15.12  ? 117 ARG E O     1 
ATOM   3627  C CB    . ARG E 5  120 ? 111.536 139.677 109.173 1.00 8.97   ? 117 ARG E CB    1 
ATOM   3628  C CG    . ARG E 5  120 ? 112.317 140.419 110.082 1.00 10.70  ? 117 ARG E CG    1 
ATOM   3629  C CD    . ARG E 5  120 ? 113.705 140.072 110.019 1.00 11.33  ? 117 ARG E CD    1 
ATOM   3630  N NE    . ARG E 5  120 ? 114.034 138.986 110.776 1.00 10.51  ? 117 ARG E NE    1 
ATOM   3631  C CZ    . ARG E 5  120 ? 114.267 137.760 110.371 1.00 8.53   ? 117 ARG E CZ    1 
ATOM   3632  N NH1   . ARG E 5  120 ? 114.164 137.368 109.161 1.00 9.93   ? 117 ARG E NH1   1 
ATOM   3633  N NH2   . ARG E 5  120 ? 114.611 136.869 111.241 1.00 10.72  ? 117 ARG E NH2   1 
ATOM   3634  N N     . VAL E 5  121 ? 109.819 140.170 106.746 1.00 12.04  ? 118 VAL E N     1 
ATOM   3635  C CA    . VAL E 5  121 ? 109.425 139.674 105.452 1.00 6.13   ? 118 VAL E CA    1 
ATOM   3636  C C     . VAL E 5  121 ? 110.621 139.001 104.829 1.00 6.39   ? 118 VAL E C     1 
ATOM   3637  O O     . VAL E 5  121 ? 110.485 137.991 104.146 1.00 6.38   ? 118 VAL E O     1 
ATOM   3638  C CB    . VAL E 5  121 ? 108.909 140.785 104.560 1.00 6.97   ? 118 VAL E CB    1 
ATOM   3639  C CG1   . VAL E 5  121 ? 108.609 140.254 103.181 1.00 20.15  ? 118 VAL E CG1   1 
ATOM   3640  C CG2   . VAL E 5  121 ? 107.684 141.338 105.159 1.00 5.75   ? 118 VAL E CG2   1 
ATOM   3641  N N     . THR E 5  122 ? 111.780 139.615 105.007 1.00 7.81   ? 119 THR E N     1 
ATOM   3642  C CA    . THR E 5  122 ? 113.026 139.155 104.429 1.00 5.44   ? 119 THR E CA    1 
ATOM   3643  C C     . THR E 5  122 ? 113.553 137.946 105.149 1.00 4.63   ? 119 THR E C     1 
ATOM   3644  O O     . THR E 5  122 ? 113.664 137.984 106.372 1.00 8.54   ? 119 THR E O     1 
ATOM   3645  C CB    . THR E 5  122 ? 114.071 140.267 104.533 1.00 5.13   ? 119 THR E CB    1 
ATOM   3646  O OG1   . THR E 5  122 ? 113.578 141.447 103.889 1.00 13.87  ? 119 THR E OG1   1 
ATOM   3647  C CG2   . THR E 5  122 ? 115.330 139.849 103.874 1.00 0.40   ? 119 THR E CG2   1 
ATOM   3648  N N     . ILE E 5  123 ? 113.945 136.909 104.403 1.00 4.84   ? 120 ILE E N     1 
ATOM   3649  C CA    . ILE E 5  123 ? 114.526 135.727 105.032 1.00 4.24   ? 120 ILE E CA    1 
ATOM   3650  C C     . ILE E 5  123 ? 116.035 135.874 105.179 1.00 5.52   ? 120 ILE E C     1 
ATOM   3651  O O     . ILE E 5  123 ? 116.742 136.367 104.290 1.00 7.06   ? 120 ILE E O     1 
ATOM   3652  C CB    . ILE E 5  123 ? 114.176 134.407 104.328 1.00 5.76   ? 120 ILE E CB    1 
ATOM   3653  C CG1   . ILE E 5  123 ? 114.668 134.368 102.922 1.00 3.17   ? 120 ILE E CG1   1 
ATOM   3654  C CG2   . ILE E 5  123 ? 112.671 134.242 104.374 1.00 5.36   ? 120 ILE E CG2   1 
ATOM   3655  C CD1   . ILE E 5  123 ? 114.633 132.999 102.286 1.00 2.94   ? 120 ILE E CD1   1 
ATOM   3656  N N     . MET E 5  124 ? 116.538 135.460 106.327 1.00 5.36   ? 121 MET E N     1 
ATOM   3657  C CA    . MET E 5  124 ? 117.947 135.553 106.646 1.00 4.81   ? 121 MET E CA    1 
ATOM   3658  C C     . MET E 5  124 ? 118.529 134.184 106.982 1.00 8.27   ? 121 MET E C     1 
ATOM   3659  O O     . MET E 5  124 ? 117.763 133.278 107.288 1.00 5.75   ? 121 MET E O     1 
ATOM   3660  C CB    . MET E 5  124 ? 118.068 136.563 107.751 1.00 6.92   ? 121 MET E CB    1 
ATOM   3661  C CG    . MET E 5  124 ? 117.625 137.879 107.297 1.00 5.07   ? 121 MET E CG    1 
ATOM   3662  S SD    . MET E 5  124 ? 117.853 139.105 108.447 1.00 17.44  ? 121 MET E SD    1 
ATOM   3663  C CE    . MET E 5  124 ? 117.052 140.396 107.546 1.00 9.95   ? 121 MET E CE    1 
ATOM   3664  N N     . PRO E 5  125 ? 119.849 133.977 106.956 1.00 5.45   ? 122 PRO E N     1 
ATOM   3665  C CA    . PRO E 5  125 ? 120.502 132.727 107.244 1.00 5.14   ? 122 PRO E CA    1 
ATOM   3666  C C     . PRO E 5  125 ? 120.067 132.078 108.524 1.00 9.74   ? 122 PRO E C     1 
ATOM   3667  O O     . PRO E 5  125 ? 119.998 130.854 108.600 1.00 3.31   ? 122 PRO E O     1 
ATOM   3668  C CB    . PRO E 5  125 ? 121.936 133.155 107.356 1.00 5.91   ? 122 PRO E CB    1 
ATOM   3669  C CG    . PRO E 5  125 ? 122.027 134.294 106.472 1.00 8.90   ? 122 PRO E CG    1 
ATOM   3670  C CD    . PRO E 5  125 ? 120.770 135.032 106.632 1.00 7.15   ? 122 PRO E CD    1 
ATOM   3671  N N     . LYS E 5  126 ? 119.799 132.878 109.533 1.00 10.43  ? 123 LYS E N     1 
ATOM   3672  C CA    . LYS E 5  126 ? 119.343 132.331 110.783 1.00 7.12   ? 123 LYS E CA    1 
ATOM   3673  C C     . LYS E 5  126 ? 117.926 131.783 110.726 1.00 9.33   ? 123 LYS E C     1 
ATOM   3674  O O     . LYS E 5  126 ? 117.558 131.001 111.602 1.00 13.41  ? 123 LYS E O     1 
ATOM   3675  C CB    . LYS E 5  126 ? 119.540 133.333 111.910 1.00 5.96   ? 123 LYS E CB    1 
ATOM   3676  C CG    . LYS E 5  126 ? 118.790 134.644 111.762 1.00 11.35  ? 123 LYS E CG    1 
ATOM   3677  C CD    . LYS E 5  126 ? 119.092 135.531 112.957 1.00 17.29  ? 123 LYS E CD    1 
ATOM   3678  C CE    . LYS E 5  126 ? 118.501 136.923 112.798 1.00 27.51  ? 123 LYS E CE    1 
ATOM   3679  N NZ    . LYS E 5  126 ? 118.787 137.792 113.975 1.00 23.84  ? 123 LYS E NZ    1 
ATOM   3680  N N     . ASP E 5  127 ? 117.115 132.123 109.723 1.00 8.22   ? 124 ASP E N     1 
ATOM   3681  C CA    . ASP E 5  127 ? 115.796 131.596 109.723 1.00 5.38   ? 124 ASP E CA    1 
ATOM   3682  C C     . ASP E 5  127 ? 115.966 130.219 109.153 1.00 13.02  ? 124 ASP E C     1 
ATOM   3683  O O     . ASP E 5  127 ? 115.255 129.285 109.521 1.00 12.44  ? 124 ASP E O     1 
ATOM   3684  C CB    . ASP E 5  127 ? 114.887 132.416 108.850 1.00 6.07   ? 124 ASP E CB    1 
ATOM   3685  C CG    . ASP E 5  127 ? 114.670 133.795 109.338 1.00 10.44  ? 124 ASP E CG    1 
ATOM   3686  O OD1   . ASP E 5  127 ? 114.303 134.027 110.477 1.00 15.45  ? 124 ASP E OD1   1 
ATOM   3687  O OD2   . ASP E 5  127 ? 114.879 134.690 108.553 1.00 8.03   ? 124 ASP E OD2   1 
ATOM   3688  N N     . ILE E 5  128 ? 116.942 130.064 108.261 1.00 12.09  ? 125 ILE E N     1 
ATOM   3689  C CA    . ILE E 5  128 ? 117.194 128.744 107.705 1.00 8.21   ? 125 ILE E CA    1 
ATOM   3690  C C     . ILE E 5  128 ? 117.721 127.851 108.784 1.00 10.29  ? 125 ILE E C     1 
ATOM   3691  O O     . ILE E 5  128 ? 117.294 126.706 108.916 1.00 15.17  ? 125 ILE E O     1 
ATOM   3692  C CB    . ILE E 5  128 ? 118.188 128.716 106.535 1.00 6.02   ? 125 ILE E CB    1 
ATOM   3693  C CG1   . ILE E 5  128 ? 117.591 129.400 105.329 1.00 6.86   ? 125 ILE E CG1   1 
ATOM   3694  C CG2   . ILE E 5  128 ? 118.557 127.280 106.222 1.00 8.46   ? 125 ILE E CG2   1 
ATOM   3695  C CD1   . ILE E 5  128 ? 118.557 129.659 104.204 1.00 7.33   ? 125 ILE E CD1   1 
ATOM   3696  N N     . GLN E 5  129 ? 118.658 128.350 109.563 1.00 10.47  ? 126 GLN E N     1 
ATOM   3697  C CA    . GLN E 5  129 ? 119.232 127.528 110.599 1.00 8.42   ? 126 GLN E CA    1 
ATOM   3698  C C     . GLN E 5  129 ? 118.232 127.134 111.651 1.00 14.55  ? 126 GLN E C     1 
ATOM   3699  O O     . GLN E 5  129 ? 118.256 125.995 112.114 1.00 19.74  ? 126 GLN E O     1 
ATOM   3700  C CB    . GLN E 5  129 ? 120.381 128.241 111.226 1.00 6.43   ? 126 GLN E CB    1 
ATOM   3701  C CG    . GLN E 5  129 ? 121.491 128.354 110.282 1.00 6.76   ? 126 GLN E CG    1 
ATOM   3702  C CD    . GLN E 5  129 ? 122.586 129.196 110.740 1.00 5.08   ? 126 GLN E CD    1 
ATOM   3703  O OE1   . GLN E 5  129 ? 122.580 129.722 111.850 1.00 15.57  ? 126 GLN E OE1   1 
ATOM   3704  N NE2   . GLN E 5  129 ? 123.563 129.360 109.879 1.00 6.33   ? 126 GLN E NE2   1 
ATOM   3705  N N     . LEU E 5  130 ? 117.318 128.015 112.016 1.00 14.43  ? 127 LEU E N     1 
ATOM   3706  C CA    . LEU E 5  130 ? 116.350 127.607 112.993 1.00 9.67   ? 127 LEU E CA    1 
ATOM   3707  C C     . LEU E 5  130 ? 115.470 126.540 112.418 1.00 13.11  ? 127 LEU E C     1 
ATOM   3708  O O     . LEU E 5  130 ? 115.163 125.565 113.100 1.00 14.29  ? 127 LEU E O     1 
ATOM   3709  C CB    . LEU E 5  130 ? 115.461 128.750 113.420 1.00 10.90  ? 127 LEU E CB    1 
ATOM   3710  C CG    . LEU E 5  130 ? 114.395 128.422 114.465 1.00 10.15  ? 127 LEU E CG    1 
ATOM   3711  C CD1   . LEU E 5  130 ? 115.035 127.955 115.757 1.00 2.80   ? 127 LEU E CD1   1 
ATOM   3712  C CD2   . LEU E 5  130 ? 113.575 129.619 114.704 1.00 8.50   ? 127 LEU E CD2   1 
ATOM   3713  N N     . ALA E 5  131 ? 115.027 126.690 111.174 1.00 12.76  ? 128 ALA E N     1 
ATOM   3714  C CA    . ALA E 5  131 ? 114.146 125.681 110.641 1.00 10.05  ? 128 ALA E CA    1 
ATOM   3715  C C     . ALA E 5  131 ? 114.820 124.340 110.618 1.00 12.00  ? 128 ALA E C     1 
ATOM   3716  O O     . ALA E 5  131 ? 114.205 123.331 110.958 1.00 16.38  ? 128 ALA E O     1 
ATOM   3717  C CB    . ALA E 5  131 ? 113.704 126.042 109.253 1.00 13.60  ? 128 ALA E CB    1 
ATOM   3718  N N     . ARG E 5  132 ? 116.095 124.300 110.288 1.00 13.41  ? 129 ARG E N     1 
ATOM   3719  C CA    . ARG E 5  132 ? 116.759 123.022 110.259 1.00 10.35  ? 129 ARG E CA    1 
ATOM   3720  C C     . ARG E 5  132 ? 116.926 122.426 111.626 1.00 13.11  ? 129 ARG E C     1 
ATOM   3721  O O     . ARG E 5  132 ? 116.818 121.208 111.803 1.00 15.46  ? 129 ARG E O     1 
ATOM   3722  C CB    . ARG E 5  132 ? 118.085 123.136 109.619 1.00 10.83  ? 129 ARG E CB    1 
ATOM   3723  C CG    . ARG E 5  132 ? 118.008 123.362 108.174 1.00 11.64  ? 129 ARG E CG    1 
ATOM   3724  C CD    . ARG E 5  132 ? 119.273 123.479 107.594 1.00 9.49   ? 129 ARG E CD    1 
ATOM   3725  N NE    . ARG E 5  132 ? 119.947 122.240 107.593 1.00 9.45   ? 129 ARG E NE    1 
ATOM   3726  C CZ    . ARG E 5  132 ? 121.255 122.092 107.594 1.00 12.11  ? 129 ARG E CZ    1 
ATOM   3727  N NH1   . ARG E 5  132 ? 122.037 123.126 107.609 1.00 19.41  ? 129 ARG E NH1   1 
ATOM   3728  N NH2   . ARG E 5  132 ? 121.773 120.908 107.591 1.00 11.40  ? 129 ARG E NH2   1 
ATOM   3729  N N     . ARG E 5  133 ? 117.229 123.241 112.611 1.00 15.24  ? 130 ARG E N     1 
ATOM   3730  C CA    . ARG E 5  133 ? 117.415 122.671 113.915 1.00 10.44  ? 130 ARG E CA    1 
ATOM   3731  C C     . ARG E 5  133 ? 116.164 122.128 114.516 1.00 12.95  ? 130 ARG E C     1 
ATOM   3732  O O     . ARG E 5  133 ? 116.192 121.061 115.115 1.00 21.45  ? 130 ARG E O     1 
ATOM   3733  C CB    . ARG E 5  133 ? 117.927 123.655 114.855 1.00 9.21   ? 130 ARG E CB    1 
ATOM   3734  C CG    . ARG E 5  133 ? 118.194 123.096 116.142 1.00 13.93  ? 130 ARG E CG    1 
ATOM   3735  C CD    . ARG E 5  133 ? 118.742 124.056 116.980 1.00 21.16  ? 130 ARG E CD    1 
ATOM   3736  N NE    . ARG E 5  133 ? 120.012 124.487 116.543 1.00 22.25  ? 130 ARG E NE    1 
ATOM   3737  C CZ    . ARG E 5  133 ? 120.596 125.629 116.918 1.00 36.34  ? 130 ARG E CZ    1 
ATOM   3738  N NH1   . ARG E 5  133 ? 120.001 126.440 117.746 1.00 30.01  ? 130 ARG E NH1   1 
ATOM   3739  N NH2   . ARG E 5  133 ? 121.781 125.941 116.451 1.00 40.40  ? 130 ARG E NH2   1 
ATOM   3740  N N     . ILE E 5  134 ? 115.062 122.840 114.381 1.00 13.67  ? 131 ILE E N     1 
ATOM   3741  C CA    . ILE E 5  134 ? 113.828 122.355 114.956 1.00 8.44   ? 131 ILE E CA    1 
ATOM   3742  C C     . ILE E 5  134 ? 113.440 121.103 114.267 1.00 14.84  ? 131 ILE E C     1 
ATOM   3743  O O     . ILE E 5  134 ? 113.001 120.147 114.890 1.00 19.63  ? 131 ILE E O     1 
ATOM   3744  C CB    . ILE E 5  134 ? 112.695 123.351 114.864 1.00 10.30  ? 131 ILE E CB    1 
ATOM   3745  C CG1   . ILE E 5  134 ? 112.996 124.489 115.755 1.00 8.27   ? 131 ILE E CG1   1 
ATOM   3746  C CG2   . ILE E 5  134 ? 111.373 122.667 115.208 1.00 14.44  ? 131 ILE E CG2   1 
ATOM   3747  C CD1   . ILE E 5  134 ? 112.111 125.646 115.561 1.00 10.94  ? 131 ILE E CD1   1 
ATOM   3748  N N     . ARG E 5  135 ? 113.568 121.106 112.968 1.00 16.06  ? 132 ARG E N     1 
ATOM   3749  C CA    . ARG E 5  135 ? 113.249 119.965 112.183 1.00 9.60   ? 132 ARG E CA    1 
ATOM   3750  C C     . ARG E 5  135 ? 114.076 118.752 112.583 1.00 12.14  ? 132 ARG E C     1 
ATOM   3751  O O     . ARG E 5  135 ? 113.574 117.630 112.535 1.00 23.31  ? 132 ARG E O     1 
ATOM   3752  C CB    . ARG E 5  135 ? 113.452 120.302 110.765 1.00 9.22   ? 132 ARG E CB    1 
ATOM   3753  C CG    . ARG E 5  135 ? 113.100 119.306 109.906 1.00 11.74  ? 132 ARG E CG    1 
ATOM   3754  C CD    . ARG E 5  135 ? 113.368 119.661 108.571 1.00 12.11  ? 132 ARG E CD    1 
ATOM   3755  N NE    . ARG E 5  135 ? 112.492 120.591 108.043 1.00 6.07   ? 132 ARG E NE    1 
ATOM   3756  C CZ    . ARG E 5  135 ? 112.641 121.066 106.864 1.00 6.75   ? 132 ARG E CZ    1 
ATOM   3757  N NH1   . ARG E 5  135 ? 113.656 120.711 106.133 1.00 7.65   ? 132 ARG E NH1   1 
ATOM   3758  N NH2   . ARG E 5  135 ? 111.769 121.881 106.408 1.00 13.03  ? 132 ARG E NH2   1 
ATOM   3759  N N     . GLY E 5  136 ? 115.336 118.956 112.975 1.00 15.21  ? 133 GLY E N     1 
ATOM   3760  C CA    . GLY E 5  136 ? 116.177 117.852 113.407 1.00 13.08  ? 133 GLY E CA    1 
ATOM   3761  C C     . GLY E 5  136 ? 117.348 117.486 112.508 1.00 12.81  ? 133 GLY E C     1 
ATOM   3762  O O     . GLY E 5  136 ? 117.856 116.370 112.607 1.00 27.57  ? 133 GLY E O     1 
ATOM   3763  N N     . GLU E 5  137 ? 117.755 118.376 111.622 1.00 12.78  ? 134 GLU E N     1 
ATOM   3764  C CA    . GLU E 5  137 ? 118.880 118.097 110.743 1.00 7.27   ? 134 GLU E CA    1 
ATOM   3765  C C     . GLU E 5  137 ? 120.176 118.528 111.407 1.00 11.37  ? 134 GLU E C     1 
ATOM   3766  O O     . GLU E 5  137 ? 120.174 118.942 112.563 1.00 17.49  ? 134 GLU E O     1 
ATOM   3767  C CB    . GLU E 5  137 ? 118.710 118.847 109.429 1.00 13.91  ? 134 GLU E CB    1 
ATOM   3768  C CG    . GLU E 5  137 ? 117.477 118.464 108.573 1.00 15.91  ? 134 GLU E CG    1 
ATOM   3769  C CD    . GLU E 5  137 ? 117.600 117.137 107.877 1.00 19.20  ? 134 GLU E CD    1 
ATOM   3770  O OE1   . GLU E 5  137 ? 118.702 116.659 107.771 1.00 21.46  ? 134 GLU E OE1   1 
ATOM   3771  O OE2   . GLU E 5  137 ? 116.600 116.604 107.423 1.00 17.75  ? 134 GLU E OE2   1 
ATOM   3772  N N     . LEU F 2  26  ? 136.651 117.014 88.810  1.00 51.65  ? 23  LEU F N     1 
ATOM   3773  C CA    . LEU F 2  26  ? 135.809 118.207 88.730  1.00 51.19  ? 23  LEU F CA    1 
ATOM   3774  C C     . LEU F 2  26  ? 135.925 119.099 89.945  1.00 51.74  ? 23  LEU F C     1 
ATOM   3775  O O     . LEU F 2  26  ? 136.089 118.616 91.070  1.00 47.57  ? 23  LEU F O     1 
ATOM   3776  C CB    . LEU F 2  26  ? 134.337 117.812 88.595  1.00 45.39  ? 23  LEU F CB    1 
ATOM   3777  C CG    . LEU F 2  26  ? 133.899 117.047 87.351  1.00 42.66  ? 23  LEU F CG    1 
ATOM   3778  C CD1   . LEU F 2  26  ? 132.452 116.636 87.541  1.00 36.02  ? 23  LEU F CD1   1 
ATOM   3779  C CD2   . LEU F 2  26  ? 134.030 117.928 86.111  1.00 43.99  ? 23  LEU F CD2   1 
ATOM   3780  N N     . ARG F 2  27  ? 135.820 120.411 89.719  1.00 51.39  ? 24  ARG F N     1 
ATOM   3781  C CA    . ARG F 2  27  ? 135.862 121.386 90.801  1.00 52.00  ? 24  ARG F CA    1 
ATOM   3782  C C     . ARG F 2  27  ? 134.871 122.525 90.613  1.00 49.77  ? 24  ARG F C     1 
ATOM   3783  O O     . ARG F 2  27  ? 134.585 122.939 89.490  1.00 47.39  ? 24  ARG F O     1 
ATOM   3784  C CB    . ARG F 2  27  ? 137.257 121.991 90.938  0.00 58.19  ? 24  ARG F CB    1 
ATOM   3785  C CG    . ARG F 2  27  ? 138.381 121.014 91.331  0.00 62.64  ? 24  ARG F CG    1 
ATOM   3786  C CD    . ARG F 2  27  ? 138.243 120.550 92.745  0.00 65.10  ? 24  ARG F CD    1 
ATOM   3787  N NE    . ARG F 2  27  ? 139.353 119.708 93.170  0.00 70.58  ? 24  ARG F NE    1 
ATOM   3788  C CZ    . ARG F 2  27  ? 139.438 118.367 92.984  0.00 81.92  ? 24  ARG F CZ    1 
ATOM   3789  N NH1   . ARG F 2  27  ? 138.486 117.693 92.356  0.00 61.93  ? 24  ARG F NH1   1 
ATOM   3790  N NH2   . ARG F 2  27  ? 140.498 117.715 93.444  0.00 62.38  ? 24  ARG F NH2   1 
ATOM   3791  N N     . ASP F 2  28  ? 134.388 123.048 91.735  1.00 48.72  ? 25  ASP F N     1 
ATOM   3792  C CA    . ASP F 2  28  ? 133.544 124.234 91.812  1.00 46.03  ? 25  ASP F CA    1 
ATOM   3793  C C     . ASP F 2  28  ? 132.296 124.245 90.952  1.00 39.92  ? 25  ASP F C     1 
ATOM   3794  O O     . ASP F 2  28  ? 131.940 125.283 90.393  1.00 39.41  ? 25  ASP F O     1 
ATOM   3795  C CB    . ASP F 2  28  ? 134.370 125.468 91.494  1.00 40.30  ? 25  ASP F CB    1 
ATOM   3796  C CG    . ASP F 2  28  ? 135.468 125.653 92.501  1.00 55.81  ? 25  ASP F CG    1 
ATOM   3797  O OD1   . ASP F 2  28  ? 135.249 125.330 93.653  1.00 52.54  ? 25  ASP F OD1   1 
ATOM   3798  O OD2   . ASP F 2  28  ? 136.526 126.101 92.132  1.00 54.87  ? 25  ASP F OD2   1 
ATOM   3799  N N     . ASN F 2  29  ? 131.558 123.144 90.902  1.00 30.63  ? 26  ASN F N     1 
ATOM   3800  C CA    . ASN F 2  29  ? 130.353 123.169 90.096  1.00 28.42  ? 26  ASN F CA    1 
ATOM   3801  C C     . ASN F 2  29  ? 129.153 123.536 90.936  1.00 24.46  ? 26  ASN F C     1 
ATOM   3802  O O     . ASN F 2  29  ? 128.045 123.684 90.438  1.00 24.54  ? 26  ASN F O     1 
ATOM   3803  C CB    . ASN F 2  29  ? 130.176 121.848 89.414  1.00 32.95  ? 26  ASN F CB    1 
ATOM   3804  C CG    . ASN F 2  29  ? 131.210 121.662 88.372  1.00 39.32  ? 26  ASN F CG    1 
ATOM   3805  O OD1   . ASN F 2  29  ? 131.112 122.191 87.251  1.00 37.36  ? 26  ASN F OD1   1 
ATOM   3806  N ND2   . ASN F 2  29  ? 132.225 120.946 88.709  1.00 39.93  ? 26  ASN F ND2   1 
ATOM   3807  N N     . ILE F 2  30  ? 129.411 123.826 92.199  1.00 23.36  ? 27  ILE F N     1 
ATOM   3808  C CA    . ILE F 2  30  ? 128.418 124.272 93.162  1.00 17.89  ? 27  ILE F CA    1 
ATOM   3809  C C     . ILE F 2  30  ? 127.937 125.646 92.783  1.00 20.17  ? 27  ILE F C     1 
ATOM   3810  O O     . ILE F 2  30  ? 126.825 126.044 93.093  1.00 23.53  ? 27  ILE F O     1 
ATOM   3811  C CB    . ILE F 2  30  ? 128.972 124.240 94.591  1.00 12.10  ? 27  ILE F CB    1 
ATOM   3812  C CG1   . ILE F 2  30  ? 127.852 124.355 95.656  1.00 12.18  ? 27  ILE F CG1   1 
ATOM   3813  C CG2   . ILE F 2  30  ? 129.967 125.339 94.784  1.00 20.62  ? 27  ILE F CG2   1 
ATOM   3814  C CD1   . ILE F 2  30  ? 126.862 123.222 95.749  1.00 23.22  ? 27  ILE F CD1   1 
ATOM   3815  N N     . GLN F 2  31  ? 128.755 126.365 92.041  1.00 22.53  ? 28  GLN F N     1 
ATOM   3816  C CA    . GLN F 2  31  ? 128.421 127.704 91.632  1.00 20.35  ? 28  GLN F CA    1 
ATOM   3817  C C     . GLN F 2  31  ? 127.493 127.674 90.463  1.00 21.52  ? 28  GLN F C     1 
ATOM   3818  O O     . GLN F 2  31  ? 127.027 128.709 90.006  1.00 27.33  ? 28  GLN F O     1 
ATOM   3819  C CB    . GLN F 2  31  ? 129.635 128.467 91.201  1.00 25.31  ? 28  GLN F CB    1 
ATOM   3820  C CG    . GLN F 2  31  ? 130.646 128.666 92.226  1.00 30.66  ? 28  GLN F CG    1 
ATOM   3821  C CD    . GLN F 2  31  ? 130.149 129.404 93.340  1.00 34.96  ? 28  GLN F CD    1 
ATOM   3822  O OE1   . GLN F 2  31  ? 129.304 130.278 93.195  1.00 36.48  ? 28  GLN F OE1   1 
ATOM   3823  N NE2   . GLN F 2  31  ? 130.681 129.115 94.506  1.00 43.11  ? 28  GLN F NE2   1 
ATOM   3824  N N     . GLY F 2  32  ? 127.206 126.485 89.964  1.00 20.44  ? 29  GLY F N     1 
ATOM   3825  C CA    . GLY F 2  32  ? 126.296 126.321 88.876  1.00 20.60  ? 29  GLY F CA    1 
ATOM   3826  C C     . GLY F 2  32  ? 124.885 126.477 89.399  1.00 22.92  ? 29  GLY F C     1 
ATOM   3827  O O     . GLY F 2  32  ? 123.933 126.574 88.622  1.00 27.73  ? 29  GLY F O     1 
ATOM   3828  N N     . ILE F 2  33  ? 124.729 126.522 90.722  1.00 21.02  ? 30  ILE F N     1 
ATOM   3829  C CA    . ILE F 2  33  ? 123.434 126.755 91.281  1.00 20.30  ? 30  ILE F CA    1 
ATOM   3830  C C     . ILE F 2  33  ? 123.463 128.261 91.477  1.00 22.19  ? 30  ILE F C     1 
ATOM   3831  O O     . ILE F 2  33  ? 124.018 128.782 92.457  1.00 21.73  ? 30  ILE F O     1 
ATOM   3832  C CB    . ILE F 2  33  ? 123.260 126.011 92.597  1.00 11.60  ? 30  ILE F CB    1 
ATOM   3833  C CG1   . ILE F 2  33  ? 123.632 124.518 92.432  1.00 15.00  ? 30  ILE F CG1   1 
ATOM   3834  C CG2   . ILE F 2  33  ? 121.852 126.172 93.076  1.00 19.42  ? 30  ILE F CG2   1 
ATOM   3835  C CD1   . ILE F 2  33  ? 122.867 123.727 91.403  1.00 22.76  ? 30  ILE F CD1   1 
ATOM   3836  N N     . THR F 2  34  ? 122.887 128.947 90.513  1.00 20.03  ? 31  THR F N     1 
ATOM   3837  C CA    . THR F 2  34  ? 122.990 130.368 90.368  1.00 14.50  ? 31  THR F CA    1 
ATOM   3838  C C     . THR F 2  34  ? 121.996 131.100 91.201  1.00 20.69  ? 31  THR F C     1 
ATOM   3839  O O     . THR F 2  34  ? 120.995 130.530 91.628  1.00 17.64  ? 31  THR F O     1 
ATOM   3840  C CB    . THR F 2  34  ? 122.800 130.713 88.908  1.00 22.55  ? 31  THR F CB    1 
ATOM   3841  O OG1   . THR F 2  34  ? 121.497 130.272 88.499  1.00 25.09  ? 31  THR F OG1   1 
ATOM   3842  C CG2   . THR F 2  34  ? 123.824 130.047 88.088  1.00 32.73  ? 31  THR F CG2   1 
ATOM   3843  N N     . LYS F 2  35  ? 122.190 132.396 91.366  1.00 18.45  ? 32  LYS F N     1 
ATOM   3844  C CA    . LYS F 2  35  ? 121.248 133.149 92.146  1.00 7.76   ? 32  LYS F CA    1 
ATOM   3845  C C     . LYS F 2  35  ? 119.822 133.021 91.691  1.00 13.35  ? 32  LYS F C     1 
ATOM   3846  O O     . LYS F 2  35  ? 118.953 132.920 92.550  1.00 9.61   ? 32  LYS F O     1 
ATOM   3847  C CB    . LYS F 2  35  ? 121.612 134.589 92.222  1.00 7.89   ? 32  LYS F CB    1 
ATOM   3848  C CG    . LYS F 2  35  ? 122.697 134.876 93.088  1.00 9.03   ? 32  LYS F CG    1 
ATOM   3849  C CD    . LYS F 2  35  ? 123.156 136.325 92.942  1.00 1.59   ? 32  LYS F CD    1 
ATOM   3850  C CE    . LYS F 2  35  ? 122.112 137.334 93.383  1.00 3.01   ? 32  LYS F CE    1 
ATOM   3851  N NZ    . LYS F 2  35  ? 122.635 138.708 93.333  1.00 3.42   ? 32  LYS F NZ    1 
ATOM   3852  N N     . PRO F 2  36  ? 119.474 133.126 90.410  1.00 10.50  ? 33  PRO F N     1 
ATOM   3853  C CA    . PRO F 2  36  ? 118.131 132.941 89.985  1.00 12.11  ? 33  PRO F CA    1 
ATOM   3854  C C     . PRO F 2  36  ? 117.604 131.553 90.267  1.00 18.44  ? 33  PRO F C     1 
ATOM   3855  O O     . PRO F 2  36  ? 116.401 131.384 90.395  1.00 14.53  ? 33  PRO F O     1 
ATOM   3856  C CB    . PRO F 2  36  ? 118.220 133.225 88.516  1.00 21.54  ? 33  PRO F CB    1 
ATOM   3857  C CG    . PRO F 2  36  ? 119.409 134.069 88.377  1.00 19.60  ? 33  PRO F CG    1 
ATOM   3858  C CD    . PRO F 2  36  ? 120.355 133.544 89.352  1.00 14.36  ? 33  PRO F CD    1 
ATOM   3859  N N     . ALA F 2  37  ? 118.446 130.534 90.412  1.00 18.04  ? 34  ALA F N     1 
ATOM   3860  C CA    . ALA F 2  37  ? 117.860 129.255 90.711  1.00 11.20  ? 34  ALA F CA    1 
ATOM   3861  C C     . ALA F 2  37  ? 117.390 129.285 92.130  1.00 14.06  ? 34  ALA F C     1 
ATOM   3862  O O     . ALA F 2  37  ? 116.300 128.815 92.458  1.00 19.81  ? 34  ALA F O     1 
ATOM   3863  C CB    . ALA F 2  37  ? 118.850 128.144 90.513  1.00 19.77  ? 34  ALA F CB    1 
ATOM   3864  N N     . ILE F 2  38  ? 118.181 129.927 92.970  1.00 14.89  ? 35  ILE F N     1 
ATOM   3865  C CA    . ILE F 2  38  ? 117.862 129.977 94.369  1.00 8.45   ? 35  ILE F CA    1 
ATOM   3866  C C     . ILE F 2  38  ? 116.610 130.773 94.545  1.00 12.94  ? 35  ILE F C     1 
ATOM   3867  O O     . ILE F 2  38  ? 115.725 130.385 95.305  1.00 15.94  ? 35  ILE F O     1 
ATOM   3868  C CB    . ILE F 2  38  ? 118.966 130.645 95.174  1.00 9.27   ? 35  ILE F CB    1 
ATOM   3869  C CG1   . ILE F 2  38  ? 120.292 129.877 95.063  1.00 8.76   ? 35  ILE F CG1   1 
ATOM   3870  C CG2   . ILE F 2  38  ? 118.539 130.801 96.625  1.00 3.98   ? 35  ILE F CG2   1 
ATOM   3871  C CD1   . ILE F 2  38  ? 120.299 128.480 95.514  1.00 9.74   ? 35  ILE F CD1   1 
ATOM   3872  N N     . ARG F 2  39  ? 116.511 131.888 93.851  1.00 14.08  ? 36  ARG F N     1 
ATOM   3873  C CA    . ARG F 2  39  ? 115.337 132.698 93.989  1.00 8.52   ? 36  ARG F CA    1 
ATOM   3874  C C     . ARG F 2  39  ? 114.103 132.017 93.502  1.00 17.64  ? 36  ARG F C     1 
ATOM   3875  O O     . ARG F 2  39  ? 113.076 132.114 94.154  1.00 20.22  ? 36  ARG F O     1 
ATOM   3876  C CB    . ARG F 2  39  ? 115.475 133.945 93.229  1.00 7.38   ? 36  ARG F CB    1 
ATOM   3877  C CG    . ARG F 2  39  ? 116.450 134.843 93.785  1.00 11.35  ? 36  ARG F CG    1 
ATOM   3878  C CD    . ARG F 2  39  ? 116.750 135.923 92.888  1.00 10.77  ? 36  ARG F CD    1 
ATOM   3879  N NE    . ARG F 2  39  ? 115.701 136.818 92.731  1.00 7.13   ? 36  ARG F NE    1 
ATOM   3880  C CZ    . ARG F 2  39  ? 115.524 137.878 93.481  1.00 14.32  ? 36  ARG F CZ    1 
ATOM   3881  N NH1   . ARG F 2  39  ? 116.363 138.156 94.450  1.00 13.56  ? 36  ARG F NH1   1 
ATOM   3882  N NH2   . ARG F 2  39  ? 114.510 138.660 93.234  1.00 25.41  ? 36  ARG F NH2   1 
ATOM   3883  N N     . ARG F 2  40  ? 114.160 131.309 92.390  1.00 16.80  ? 37  ARG F N     1 
ATOM   3884  C CA    . ARG F 2  40  ? 112.956 130.671 91.921  1.00 12.59  ? 37  ARG F CA    1 
ATOM   3885  C C     . ARG F 2  40  ? 112.477 129.620 92.894  1.00 17.41  ? 37  ARG F C     1 
ATOM   3886  O O     . ARG F 2  40  ? 111.272 129.487 93.116  1.00 22.90  ? 37  ARG F O     1 
ATOM   3887  C CB    . ARG F 2  40  ? 113.170 130.089 90.578  1.00 18.88  ? 37  ARG F CB    1 
ATOM   3888  C CG    . ARG F 2  40  ? 113.292 131.073 89.490  1.00 26.04  ? 37  ARG F CG    1 
ATOM   3889  C CD    . ARG F 2  40  ? 113.212 130.447 88.183  1.00 20.74  ? 37  ARG F CD    1 
ATOM   3890  N NE    . ARG F 2  40  ? 114.329 129.626 87.865  1.00 16.28  ? 37  ARG F NE    1 
ATOM   3891  C CZ    . ARG F 2  40  ? 115.410 130.044 87.252  1.00 20.00  ? 37  ARG F CZ    1 
ATOM   3892  N NH1   . ARG F 2  40  ? 115.517 131.291 86.893  1.00 29.47  ? 37  ARG F NH1   1 
ATOM   3893  N NH2   . ARG F 2  40  ? 116.367 129.200 86.975  1.00 23.18  ? 37  ARG F NH2   1 
ATOM   3894  N N     . LEU F 2  41  ? 113.393 128.876 93.506  1.00 17.71  ? 38  LEU F N     1 
ATOM   3895  C CA    . LEU F 2  41  ? 112.966 127.895 94.480  1.00 13.18  ? 38  LEU F CA    1 
ATOM   3896  C C     . LEU F 2  41  ? 112.334 128.594 95.661  1.00 18.27  ? 38  LEU F C     1 
ATOM   3897  O O     . LEU F 2  41  ? 111.286 128.175 96.161  1.00 20.86  ? 38  LEU F O     1 
ATOM   3898  C CB    . LEU F 2  41  ? 114.173 127.110 94.971  1.00 10.75  ? 38  LEU F CB    1 
ATOM   3899  C CG    . LEU F 2  41  ? 114.807 126.156 93.990  1.00 10.06  ? 38  LEU F CG    1 
ATOM   3900  C CD1   . LEU F 2  41  ? 116.137 125.747 94.500  1.00 8.41   ? 38  LEU F CD1   1 
ATOM   3901  C CD2   . LEU F 2  41  ? 113.973 124.921 93.867  1.00 12.39  ? 38  LEU F CD2   1 
ATOM   3902  N N     . ALA F 2  42  ? 112.930 129.693 96.090  1.00 17.69  ? 39  ALA F N     1 
ATOM   3903  C CA    . ALA F 2  42  ? 112.392 130.422 97.204  1.00 13.10  ? 39  ALA F CA    1 
ATOM   3904  C C     . ALA F 2  42  ? 111.020 130.969 96.891  1.00 19.97  ? 39  ALA F C     1 
ATOM   3905  O O     . ALA F 2  42  ? 110.144 130.956 97.757  1.00 20.80  ? 39  ALA F O     1 
ATOM   3906  C CB    . ALA F 2  42  ? 113.326 131.524 97.577  1.00 10.84  ? 39  ALA F CB    1 
ATOM   3907  N N     . ARG F 2  43  ? 110.784 131.397 95.654  1.00 21.52  ? 40  ARG F N     1 
ATOM   3908  C CA    . ARG F 2  43  ? 109.470 131.913 95.330  1.00 17.70  ? 40  ARG F CA    1 
ATOM   3909  C C     . ARG F 2  43  ? 108.442 130.850 95.340  1.00 19.60  ? 40  ARG F C     1 
ATOM   3910  O O     . ARG F 2  43  ? 107.344 131.047 95.836  1.00 24.13  ? 40  ARG F O     1 
ATOM   3911  C CB    . ARG F 2  43  ? 109.388 132.467 93.964  1.00 19.92  ? 40  ARG F CB    1 
ATOM   3912  C CG    . ARG F 2  43  ? 110.163 133.609 93.678  1.00 25.40  ? 40  ARG F CG    1 
ATOM   3913  C CD    . ARG F 2  43  ? 109.886 134.662 94.489  1.00 25.55  ? 40  ARG F CD    1 
ATOM   3914  N NE    . ARG F 2  43  ? 110.464 135.787 93.988  1.00 29.02  ? 40  ARG F NE    1 
ATOM   3915  C CZ    . ARG F 2  43  ? 110.671 136.875 94.658  1.00 30.47  ? 40  ARG F CZ    1 
ATOM   3916  N NH1   . ARG F 2  43  ? 110.362 136.958 95.913  1.00 29.28  ? 40  ARG F NH1   1 
ATOM   3917  N NH2   . ARG F 2  43  ? 111.182 137.880 94.041  1.00 34.56  ? 40  ARG F NH2   1 
ATOM   3918  N N     . ARG F 2  44  ? 108.773 129.690 94.844  1.00 22.00  ? 41  ARG F N     1 
ATOM   3919  C CA    . ARG F 2  44  ? 107.806 128.629 94.836  1.00 18.41  ? 41  ARG F CA    1 
ATOM   3920  C C     . ARG F 2  44  ? 107.352 128.345 96.258  1.00 21.06  ? 41  ARG F C     1 
ATOM   3921  O O     . ARG F 2  44  ? 106.170 128.124 96.528  1.00 29.90  ? 41  ARG F O     1 
ATOM   3922  C CB    . ARG F 2  44  ? 108.382 127.402 94.237  1.00 17.04  ? 41  ARG F CB    1 
ATOM   3923  C CG    . ARG F 2  44  ? 107.424 126.383 94.031  1.00 19.92  ? 41  ARG F CG    1 
ATOM   3924  C CD    . ARG F 2  44  ? 108.005 125.160 93.577  1.00 22.59  ? 41  ARG F CD    1 
ATOM   3925  N NE    . ARG F 2  44  ? 108.496 125.141 92.270  1.00 19.01  ? 41  ARG F NE    1 
ATOM   3926  C CZ    . ARG F 2  44  ? 107.777 124.880 91.200  1.00 21.45  ? 41  ARG F CZ    1 
ATOM   3927  N NH1   . ARG F 2  44  ? 106.517 124.663 91.306  1.00 23.59  ? 41  ARG F NH1   1 
ATOM   3928  N NH2   . ARG F 2  44  ? 108.343 124.829 90.038  1.00 25.88  ? 41  ARG F NH2   1 
ATOM   3929  N N     . GLY F 2  45  ? 108.282 128.459 97.193  1.00 21.52  ? 42  GLY F N     1 
ATOM   3930  C CA    . GLY F 2  45  ? 108.034 128.238 98.609  1.00 16.67  ? 42  GLY F CA    1 
ATOM   3931  C C     . GLY F 2  45  ? 107.294 129.404 99.281  1.00 19.84  ? 42  GLY F C     1 
ATOM   3932  O O     . GLY F 2  45  ? 107.013 129.362 100.475 1.00 24.82  ? 42  GLY F O     1 
ATOM   3933  N N     . GLY F 2  46  ? 107.008 130.467 98.542  1.00 24.62  ? 43  GLY F N     1 
ATOM   3934  C CA    . GLY F 2  46  ? 106.291 131.622 99.057  1.00 21.78  ? 43  GLY F CA    1 
ATOM   3935  C C     . GLY F 2  46  ? 107.129 132.723 99.677  1.00 21.44  ? 43  GLY F C     1 
ATOM   3936  O O     . GLY F 2  46  ? 106.593 133.548 100.409 1.00 30.42  ? 43  GLY F O     1 
ATOM   3937  N N     . VAL F 2  47  ? 108.421 132.751 99.429  1.00 20.86  ? 44  VAL F N     1 
ATOM   3938  C CA    . VAL F 2  47  ? 109.261 133.778 100.000 1.00 16.79  ? 44  VAL F CA    1 
ATOM   3939  C C     . VAL F 2  47  ? 109.170 135.057 99.216  1.00 20.24  ? 44  VAL F C     1 
ATOM   3940  O O     . VAL F 2  47  ? 109.379 135.058 98.007  1.00 27.85  ? 44  VAL F O     1 
ATOM   3941  C CB    . VAL F 2  47  ? 110.691 133.296 99.987  1.00 16.50  ? 44  VAL F CB    1 
ATOM   3942  C CG1   . VAL F 2  47  ? 111.618 134.327 100.452 1.00 15.19  ? 44  VAL F CG1   1 
ATOM   3943  C CG2   . VAL F 2  47  ? 110.796 132.083 100.854 1.00 18.18  ? 44  VAL F CG2   1 
ATOM   3944  N N     . LYS F 2  48  ? 108.904 136.163 99.888  1.00 24.82  ? 45  LYS F N     1 
ATOM   3945  C CA    . LYS F 2  48  ? 108.795 137.427 99.191  1.00 21.66  ? 45  LYS F CA    1 
ATOM   3946  C C     . LYS F 2  48  ? 110.103 138.201 99.072  1.00 21.91  ? 45  LYS F C     1 
ATOM   3947  O O     . LYS F 2  48  ? 110.301 138.886 98.070  1.00 32.37  ? 45  LYS F O     1 
ATOM   3948  C CB    . LYS F 2  48  ? 107.752 138.261 99.827  1.00 24.43  ? 45  LYS F CB    1 
ATOM   3949  C CG    . LYS F 2  48  ? 107.520 139.520 99.157  1.00 35.95  ? 45  LYS F CG    1 
ATOM   3950  C CD    . LYS F 2  48  ? 106.368 140.269 99.778  1.00 35.99  ? 45  LYS F CD    1 
ATOM   3951  C CE    . LYS F 2  48  ? 106.183 141.646 99.165  1.00 38.47  ? 45  LYS F CE    1 
ATOM   3952  N NZ    . LYS F 2  48  ? 105.137 142.405 99.863  1.00 45.36  ? 45  LYS F NZ    1 
ATOM   3953  N N     . ARG F 2  49  ? 110.960 138.159 100.085 1.00 14.50  ? 46  ARG F N     1 
ATOM   3954  C CA    . ARG F 2  49  ? 112.239 138.870 100.033 1.00 11.73  ? 46  ARG F CA    1 
ATOM   3955  C C     . ARG F 2  49  ? 113.358 138.022 100.527 1.00 8.76   ? 46  ARG F C     1 
ATOM   3956  O O     . ARG F 2  49  ? 113.203 137.282 101.494 1.00 10.93  ? 46  ARG F O     1 
ATOM   3957  C CB    . ARG F 2  49  ? 112.222 140.109 100.829 1.00 13.15  ? 46  ARG F CB    1 
ATOM   3958  C CG    . ARG F 2  49  ? 111.438 141.169 100.317 1.00 17.79  ? 46  ARG F CG    1 
ATOM   3959  C CD    . ARG F 2  49  ? 111.307 142.221 101.282 1.00 14.22  ? 46  ARG F CD    1 
ATOM   3960  N NE    . ARG F 2  49  ? 112.480 142.911 101.608 1.00 13.92  ? 46  ARG F NE    1 
ATOM   3961  C CZ    . ARG F 2  49  ? 112.933 143.955 100.984 1.00 21.45  ? 46  ARG F CZ    1 
ATOM   3962  N NH1   . ARG F 2  49  ? 112.323 144.415 99.930  1.00 25.83  ? 46  ARG F NH1   1 
ATOM   3963  N NH2   . ARG F 2  49  ? 114.002 144.541 101.437 1.00 26.59  ? 46  ARG F NH2   1 
ATOM   3964  N N     . ILE F 2  50  ? 114.483 138.109 99.853  1.00 9.90   ? 47  ILE F N     1 
ATOM   3965  C CA    . ILE F 2  50  ? 115.617 137.271 100.183 1.00 6.00   ? 47  ILE F CA    1 
ATOM   3966  C C     . ILE F 2  50  ? 116.858 138.059 100.533 1.00 7.84   ? 47  ILE F C     1 
ATOM   3967  O O     . ILE F 2  50  ? 117.353 138.803 99.706  1.00 14.20  ? 47  ILE F O     1 
ATOM   3968  C CB    . ILE F 2  50  ? 115.882 136.399 98.945  1.00 3.16   ? 47  ILE F CB    1 
ATOM   3969  C CG1   . ILE F 2  50  ? 114.610 135.585 98.623  1.00 2.73   ? 47  ILE F CG1   1 
ATOM   3970  C CG2   . ILE F 2  50  ? 117.057 135.481 99.168  1.00 0.98   ? 47  ILE F CG2   1 
ATOM   3971  C CD1   . ILE F 2  50  ? 114.601 134.915 97.313  1.00 3.79   ? 47  ILE F CD1   1 
ATOM   3972  N N     . SER F 2  51  ? 117.433 137.858 101.703 1.00 5.89   ? 48  SER F N     1 
ATOM   3973  C CA    . SER F 2  51  ? 118.637 138.607 102.005 1.00 6.51   ? 48  SER F CA    1 
ATOM   3974  C C     . SER F 2  51  ? 119.801 138.076 101.208 1.00 8.42   ? 48  SER F C     1 
ATOM   3975  O O     . SER F 2  51  ? 119.792 136.950 100.726 1.00 10.87  ? 48  SER F O     1 
ATOM   3976  C CB    . SER F 2  51  ? 118.961 138.569 103.463 1.00 5.04   ? 48  SER F CB    1 
ATOM   3977  O OG    . SER F 2  51  ? 119.322 137.303 103.841 1.00 8.72   ? 48  SER F OG    1 
ATOM   3978  N N     . GLY F 2  52  ? 120.863 138.850 101.133 1.00 13.09  ? 49  GLY F N     1 
ATOM   3979  C CA    . GLY F 2  52  ? 122.036 138.519 100.337 1.00 8.30   ? 49  GLY F CA    1 
ATOM   3980  C C     . GLY F 2  52  ? 122.876 137.368 100.833 1.00 7.30   ? 49  GLY F C     1 
ATOM   3981  O O     . GLY F 2  52  ? 123.729 136.868 100.111 1.00 15.36  ? 49  GLY F O     1 
ATOM   3982  N N     . LEU F 2  53  ? 122.671 136.936 102.048 1.00 7.61   ? 50  LEU F N     1 
ATOM   3983  C CA    . LEU F 2  53  ? 123.468 135.845 102.555 1.00 3.17   ? 50  LEU F CA    1 
ATOM   3984  C C     . LEU F 2  53  ? 122.802 134.497 102.385 1.00 4.71   ? 50  LEU F C     1 
ATOM   3985  O O     . LEU F 2  53  ? 123.376 133.464 102.729 1.00 7.64   ? 50  LEU F O     1 
ATOM   3986  C CB    . LEU F 2  53  ? 123.769 136.100 104.002 1.00 6.65   ? 50  LEU F CB    1 
ATOM   3987  C CG    . LEU F 2  53  ? 124.554 137.378 104.321 1.00 4.07   ? 50  LEU F CG    1 
ATOM   3988  C CD1   . LEU F 2  53  ? 124.660 137.501 105.809 1.00 5.01   ? 50  LEU F CD1   1 
ATOM   3989  C CD2   . LEU F 2  53  ? 125.930 137.337 103.705 1.00 3.05   ? 50  LEU F CD2   1 
ATOM   3990  N N     . ILE F 2  54  ? 121.591 134.490 101.869 1.00 6.84   ? 51  ILE F N     1 
ATOM   3991  C CA    . ILE F 2  54  ? 120.868 133.259 101.659 1.00 4.90   ? 51  ILE F CA    1 
ATOM   3992  C C     . ILE F 2  54  ? 121.528 132.417 100.640 1.00 10.19  ? 51  ILE F C     1 
ATOM   3993  O O     . ILE F 2  54  ? 121.510 131.193 100.738 1.00 7.43   ? 51  ILE F O     1 
ATOM   3994  C CB    . ILE F 2  54  ? 119.431 133.494 101.243 1.00 5.39   ? 51  ILE F CB    1 
ATOM   3995  C CG1   . ILE F 2  54  ? 118.670 134.114 102.345 1.00 7.12   ? 51  ILE F CG1   1 
ATOM   3996  C CG2   . ILE F 2  54  ? 118.755 132.234 100.731 1.00 6.50   ? 51  ILE F CG2   1 
ATOM   3997  C CD1   . ILE F 2  54  ? 118.532 133.328 103.626 1.00 5.59   ? 51  ILE F CD1   1 
ATOM   3998  N N     . TYR F 2  55  ? 122.050 133.027 99.614  1.00 10.65  ? 52  TYR F N     1 
ATOM   3999  C CA    . TYR F 2  55  ? 122.598 132.269 98.544  1.00 6.84   ? 52  TYR F CA    1 
ATOM   4000  C C     . TYR F 2  55  ? 123.689 131.335 99.016  1.00 7.72   ? 52  TYR F C     1 
ATOM   4001  O O     . TYR F 2  55  ? 123.677 130.154 98.678  1.00 6.51   ? 52  TYR F O     1 
ATOM   4002  C CB    . TYR F 2  55  ? 123.095 133.267 97.538  1.00 10.53  ? 52  TYR F CB    1 
ATOM   4003  C CG    . TYR F 2  55  ? 121.945 134.094 97.091  1.00 7.30   ? 52  TYR F CG    1 
ATOM   4004  C CD1   . TYR F 2  55  ? 121.830 135.362 97.498  1.00 8.86   ? 52  TYR F CD1   1 
ATOM   4005  C CD2   . TYR F 2  55  ? 120.997 133.570 96.336  1.00 10.21  ? 52  TYR F CD2   1 
ATOM   4006  C CE1   . TYR F 2  55  ? 120.748 136.092 97.139  1.00 6.96   ? 52  TYR F CE1   1 
ATOM   4007  C CE2   . TYR F 2  55  ? 119.922 134.294 95.979  1.00 7.39   ? 52  TYR F CE2   1 
ATOM   4008  C CZ    . TYR F 2  55  ? 119.801 135.541 96.382  1.00 5.70   ? 52  TYR F CZ    1 
ATOM   4009  O OH    . TYR F 2  55  ? 118.717 136.260 96.034  1.00 10.49  ? 52  TYR F OH    1 
ATOM   4010  N N     . GLU F 2  56  ? 124.581 131.786 99.865  1.00 5.11   ? 53  GLU F N     1 
ATOM   4011  C CA    . GLU F 2  56  ? 125.614 130.870 100.306 1.00 2.76   ? 53  GLU F CA    1 
ATOM   4012  C C     . GLU F 2  56  ? 125.100 129.828 101.249 1.00 7.76   ? 53  GLU F C     1 
ATOM   4013  O O     . GLU F 2  56  ? 125.505 128.664 101.188 1.00 13.72  ? 53  GLU F O     1 
ATOM   4014  C CB    . GLU F 2  56  ? 126.695 131.598 101.023 1.00 2.73   ? 53  GLU F CB    1 
ATOM   4015  C CG    . GLU F 2  56  ? 127.504 132.450 100.195 1.00 7.80   ? 53  GLU F CG    1 
ATOM   4016  C CD    . GLU F 2  56  ? 128.281 131.692 99.250  1.00 3.63   ? 53  GLU F CD    1 
ATOM   4017  O OE1   . GLU F 2  56  ? 128.837 130.704 99.638  1.00 13.47  ? 53  GLU F OE1   1 
ATOM   4018  O OE2   . GLU F 2  56  ? 128.346 132.078 98.112  1.00 12.66  ? 53  GLU F OE2   1 
ATOM   4019  N N     . GLU F 2  57  ? 124.176 130.213 102.108 1.00 7.72   ? 54  GLU F N     1 
ATOM   4020  C CA    . GLU F 2  57  ? 123.686 129.271 103.072 1.00 3.57   ? 54  GLU F CA    1 
ATOM   4021  C C     . GLU F 2  57  ? 122.940 128.165 102.358 1.00 8.90   ? 54  GLU F C     1 
ATOM   4022  O O     . GLU F 2  57  ? 123.062 126.990 102.713 1.00 11.73  ? 54  GLU F O     1 
ATOM   4023  C CB    . GLU F 2  57  ? 122.734 129.970 104.011 1.00 2.57   ? 54  GLU F CB    1 
ATOM   4024  C CG    . GLU F 2  57  ? 122.316 129.224 105.215 1.00 2.28   ? 54  GLU F CG    1 
ATOM   4025  C CD    . GLU F 2  57  ? 123.389 129.098 106.194 1.00 0.72   ? 54  GLU F CD    1 
ATOM   4026  O OE1   . GLU F 2  57  ? 124.306 129.877 106.134 1.00 1.03   ? 54  GLU F OE1   1 
ATOM   4027  O OE2   . GLU F 2  57  ? 123.311 128.238 107.044 1.00 2.51   ? 54  GLU F OE2   1 
ATOM   4028  N N     . THR F 2  58  ? 122.192 128.529 101.323 1.00 8.47   ? 55  THR F N     1 
ATOM   4029  C CA    . THR F 2  58  ? 121.396 127.574 100.594 1.00 4.87   ? 55  THR F CA    1 
ATOM   4030  C C     . THR F 2  58  ? 122.292 126.599 99.885  1.00 12.07  ? 55  THR F C     1 
ATOM   4031  O O     . THR F 2  58  ? 121.995 125.405 99.848  1.00 14.37  ? 55  THR F O     1 
ATOM   4032  C CB    . THR F 2  58  ? 120.486 128.235 99.585  1.00 6.84   ? 55  THR F CB    1 
ATOM   4033  O OG1   . THR F 2  58  ? 119.649 129.162 100.243 1.00 13.44  ? 55  THR F OG1   1 
ATOM   4034  C CG2   . THR F 2  58  ? 119.592 127.173 98.990  1.00 7.65   ? 55  THR F CG2   1 
ATOM   4035  N N     . ARG F 2  59  ? 123.379 127.077 99.286  1.00 12.90  ? 56  ARG F N     1 
ATOM   4036  C CA    . ARG F 2  59  ? 124.268 126.154 98.619  1.00 8.71   ? 56  ARG F CA    1 
ATOM   4037  C C     . ARG F 2  59  ? 124.853 125.155 99.583  1.00 10.34  ? 56  ARG F C     1 
ATOM   4038  O O     . ARG F 2  59  ? 124.974 123.979 99.245  1.00 17.30  ? 56  ARG F O     1 
ATOM   4039  C CB    . ARG F 2  59  ? 125.394 126.854 97.945  1.00 10.15  ? 56  ARG F CB    1 
ATOM   4040  C CG    . ARG F 2  59  ? 124.980 127.632 96.783  1.00 12.18  ? 56  ARG F CG    1 
ATOM   4041  C CD    . ARG F 2  59  ? 126.075 128.105 96.026  1.00 12.99  ? 56  ARG F CD    1 
ATOM   4042  N NE    . ARG F 2  59  ? 125.644 129.002 95.043  1.00 12.93  ? 56  ARG F NE    1 
ATOM   4043  C CZ    . ARG F 2  59  ? 125.827 130.287 95.047  1.00 11.15  ? 56  ARG F CZ    1 
ATOM   4044  N NH1   . ARG F 2  59  ? 126.494 130.882 95.971  1.00 14.22  ? 56  ARG F NH1   1 
ATOM   4045  N NH2   . ARG F 2  59  ? 125.319 130.949 94.072  1.00 20.90  ? 56  ARG F NH2   1 
ATOM   4046  N N     . GLY F 2  60  ? 125.199 125.590 100.786 1.00 12.02  ? 57  GLY F N     1 
ATOM   4047  C CA    . GLY F 2  60  ? 125.738 124.661 101.760 1.00 9.96   ? 57  GLY F CA    1 
ATOM   4048  C C     . GLY F 2  60  ? 124.724 123.577 102.092 1.00 9.21   ? 57  GLY F C     1 
ATOM   4049  O O     . GLY F 2  60  ? 125.073 122.397 102.166 1.00 13.71  ? 57  GLY F O     1 
ATOM   4050  N N     . VAL F 2  61  ? 123.459 123.953 102.222 1.00 12.37  ? 58  VAL F N     1 
ATOM   4051  C CA    . VAL F 2  61  ? 122.430 122.977 102.517 1.00 6.62   ? 58  VAL F CA    1 
ATOM   4052  C C     . VAL F 2  61  ? 122.249 121.987 101.397 1.00 10.20  ? 58  VAL F C     1 
ATOM   4053  O O     . VAL F 2  61  ? 122.112 120.787 101.648 1.00 13.98  ? 58  VAL F O     1 
ATOM   4054  C CB    . VAL F 2  61  ? 121.093 123.641 102.780 1.00 7.11   ? 58  VAL F CB    1 
ATOM   4055  C CG1   . VAL F 2  61  ? 120.042 122.604 102.877 1.00 7.62   ? 58  VAL F CG1   1 
ATOM   4056  C CG2   . VAL F 2  61  ? 121.154 124.411 104.046 1.00 9.56   ? 58  VAL F CG2   1 
ATOM   4057  N N     . LEU F 2  62  ? 122.221 122.459 100.162 1.00 11.56  ? 59  LEU F N     1 
ATOM   4058  C CA    . LEU F 2  62  ? 122.056 121.553 99.053  1.00 6.56   ? 59  LEU F CA    1 
ATOM   4059  C C     . LEU F 2  62  ? 123.170 120.577 98.977  1.00 8.72   ? 59  LEU F C     1 
ATOM   4060  O O     . LEU F 2  62  ? 122.939 119.394 98.741  1.00 12.75  ? 59  LEU F O     1 
ATOM   4061  C CB    . LEU F 2  62  ? 122.020 122.298 97.743  1.00 7.49   ? 59  LEU F CB    1 
ATOM   4062  C CG    . LEU F 2  62  ? 121.972 121.453 96.478  1.00 6.40   ? 59  LEU F CG    1 
ATOM   4063  C CD1   . LEU F 2  62  ? 120.759 120.575 96.447  1.00 1.03   ? 59  LEU F CD1   1 
ATOM   4064  C CD2   . LEU F 2  62  ? 121.975 122.374 95.303  1.00 6.86   ? 59  LEU F CD2   1 
ATOM   4065  N N     . LYS F 2  63  ? 124.386 121.038 99.145  1.00 10.62  ? 60  LYS F N     1 
ATOM   4066  C CA    . LYS F 2  63  ? 125.488 120.131 99.047  1.00 7.39   ? 60  LYS F CA    1 
ATOM   4067  C C     . LYS F 2  63  ? 125.417 119.033 100.065 1.00 9.90   ? 60  LYS F C     1 
ATOM   4068  O O     . LYS F 2  63  ? 125.680 117.886 99.728  1.00 9.32   ? 60  LYS F O     1 
ATOM   4069  C CB    . LYS F 2  63  ? 126.763 120.852 99.194  1.00 8.36   ? 60  LYS F CB    1 
ATOM   4070  C CG    . LYS F 2  63  ? 127.901 120.045 99.036  1.00 6.49   ? 60  LYS F CG    1 
ATOM   4071  C CD    . LYS F 2  63  ? 129.105 120.879 99.076  1.00 8.35   ? 60  LYS F CD    1 
ATOM   4072  C CE    . LYS F 2  63  ? 130.337 120.048 98.940  1.00 14.70  ? 60  LYS F CE    1 
ATOM   4073  N NZ    . LYS F 2  63  ? 131.574 120.859 98.981  1.00 18.90  ? 60  LYS F NZ    1 
ATOM   4074  N N     . VAL F 2  64  ? 125.048 119.342 101.297 1.00 10.84  ? 61  VAL F N     1 
ATOM   4075  C CA    . VAL F 2  64  ? 124.960 118.294 102.284 1.00 5.69   ? 61  VAL F CA    1 
ATOM   4076  C C     . VAL F 2  64  ? 123.904 117.287 101.926 1.00 9.72   ? 61  VAL F C     1 
ATOM   4077  O O     . VAL F 2  64  ? 124.123 116.086 102.080 1.00 11.77  ? 61  VAL F O     1 
ATOM   4078  C CB    . VAL F 2  64  ? 124.660 118.851 103.649 1.00 4.88   ? 61  VAL F CB    1 
ATOM   4079  C CG1   . VAL F 2  64  ? 124.354 117.741 104.608 1.00 1.27   ? 61  VAL F CG1   1 
ATOM   4080  C CG2   . VAL F 2  64  ? 125.845 119.593 104.096 1.00 2.18   ? 61  VAL F CG2   1 
ATOM   4081  N N     . PHE F 2  65  ? 122.762 117.748 101.485 1.00 10.62  ? 62  PHE F N     1 
ATOM   4082  C CA    . PHE F 2  65  ? 121.730 116.826 101.105 1.00 6.34   ? 62  PHE F CA    1 
ATOM   4083  C C     . PHE F 2  65  ? 122.249 115.901 100.038 1.00 10.34  ? 62  PHE F C     1 
ATOM   4084  O O     . PHE F 2  65  ? 122.113 114.683 100.137 1.00 9.52   ? 62  PHE F O     1 
ATOM   4085  C CB    . PHE F 2  65  ? 120.518 117.568 100.637 1.00 8.15   ? 62  PHE F CB    1 
ATOM   4086  C CG    . PHE F 2  65  ? 119.406 116.729 100.269 1.00 6.52   ? 62  PHE F CG    1 
ATOM   4087  C CD1   . PHE F 2  65  ? 118.659 116.184 101.212 1.00 6.60   ? 62  PHE F CD1   1 
ATOM   4088  C CD2   . PHE F 2  65  ? 119.090 116.508 99.000  1.00 6.66   ? 62  PHE F CD2   1 
ATOM   4089  C CE1   . PHE F 2  65  ? 117.608 115.434 100.909 1.00 5.61   ? 62  PHE F CE1   1 
ATOM   4090  C CE2   . PHE F 2  65  ? 118.026 115.746 98.679  1.00 6.25   ? 62  PHE F CE2   1 
ATOM   4091  C CZ    . PHE F 2  65  ? 117.283 115.218 99.641  1.00 5.52   ? 62  PHE F CZ    1 
ATOM   4092  N N     . LEU F 2  66  ? 122.878 116.444 98.996  1.00 10.89  ? 63  LEU F N     1 
ATOM   4093  C CA    . LEU F 2  66  ? 123.387 115.568 97.970  1.00 7.51   ? 63  LEU F CA    1 
ATOM   4094  C C     . LEU F 2  66  ? 124.447 114.642 98.449  1.00 10.12  ? 63  LEU F C     1 
ATOM   4095  O O     . LEU F 2  66  ? 124.452 113.479 98.064  1.00 8.56   ? 63  LEU F O     1 
ATOM   4096  C CB    . LEU F 2  66  ? 123.980 116.328 96.808  1.00 8.82   ? 63  LEU F CB    1 
ATOM   4097  C CG    . LEU F 2  66  ? 123.067 116.981 95.867  1.00 6.98   ? 63  LEU F CG    1 
ATOM   4098  C CD1   . LEU F 2  66  ? 123.854 117.877 94.987  1.00 6.71   ? 63  LEU F CD1   1 
ATOM   4099  C CD2   . LEU F 2  66  ? 122.419 115.931 95.000  1.00 3.01   ? 63  LEU F CD2   1 
ATOM   4100  N N     . GLU F 2  67  ? 125.357 115.057 99.296  1.00 8.67   ? 64  GLU F N     1 
ATOM   4101  C CA    . GLU F 2  67  ? 126.335 114.070 99.669  1.00 4.38   ? 64  GLU F CA    1 
ATOM   4102  C C     . GLU F 2  67  ? 125.729 112.913 100.377 1.00 8.61   ? 64  GLU F C     1 
ATOM   4103  O O     . GLU F 2  67  ? 126.117 111.776 100.138 1.00 3.86   ? 64  GLU F O     1 
ATOM   4104  C CB    . GLU F 2  67  ? 127.395 114.614 100.549 1.00 4.84   ? 64  GLU F CB    1 
ATOM   4105  C CG    . GLU F 2  67  ? 128.344 115.461 99.889  1.00 9.40   ? 64  GLU F CG    1 
ATOM   4106  C CD    . GLU F 2  67  ? 129.375 115.956 100.810 1.00 11.76  ? 64  GLU F CD    1 
ATOM   4107  O OE1   . GLU F 2  67  ? 129.173 115.855 101.993 1.00 4.35   ? 64  GLU F OE1   1 
ATOM   4108  O OE2   . GLU F 2  67  ? 130.391 116.418 100.351 1.00 10.11  ? 64  GLU F OE2   1 
ATOM   4109  N N     . ASN F 2  68  ? 124.759 113.140 101.224 1.00 10.32  ? 65  ASN F N     1 
ATOM   4110  C CA    . ASN F 2  68  ? 124.220 111.997 101.906 1.00 5.07   ? 65  ASN F CA    1 
ATOM   4111  C C     . ASN F 2  68  ? 123.422 111.094 100.973 1.00 7.57   ? 65  ASN F C     1 
ATOM   4112  O O     . ASN F 2  68  ? 123.487 109.870 101.075 1.00 9.56   ? 65  ASN F O     1 
ATOM   4113  C CB    . ASN F 2  68  ? 123.391 112.476 103.041 1.00 7.01   ? 65  ASN F CB    1 
ATOM   4114  C CG    . ASN F 2  68  ? 124.223 113.042 104.149 1.00 7.03   ? 65  ASN F CG    1 
ATOM   4115  O OD1   . ASN F 2  68  ? 125.399 112.689 104.425 1.00 13.09  ? 65  ASN F OD1   1 
ATOM   4116  N ND2   . ASN F 2  68  ? 123.623 113.966 104.827 1.00 5.55   ? 65  ASN F ND2   1 
ATOM   4117  N N     . VAL F 2  69  ? 122.704 111.654 100.014 1.00 10.02  ? 66  VAL F N     1 
ATOM   4118  C CA    . VAL F 2  69  ? 121.943 110.787 99.132  1.00 7.10   ? 66  VAL F CA    1 
ATOM   4119  C C     . VAL F 2  69  ? 122.860 110.037 98.198  1.00 8.58   ? 66  VAL F C     1 
ATOM   4120  O O     . VAL F 2  69  ? 122.630 108.856 97.932  1.00 13.28  ? 66  VAL F O     1 
ATOM   4121  C CB    . VAL F 2  69  ? 120.904 111.540 98.328  1.00 8.06   ? 66  VAL F CB    1 
ATOM   4122  C CG1   . VAL F 2  69  ? 120.229 110.607 97.341  1.00 7.30   ? 66  VAL F CG1   1 
ATOM   4123  C CG2   . VAL F 2  69  ? 119.904 112.114 99.253  1.00 4.35   ? 66  VAL F CG2   1 
ATOM   4124  N N     . ILE F 2  70  ? 123.853 110.718 97.644  1.00 10.52  ? 67  ILE F N     1 
ATOM   4125  C CA    . ILE F 2  70  ? 124.767 110.094 96.724  1.00 8.12   ? 67  ILE F CA    1 
ATOM   4126  C C     . ILE F 2  70  ? 125.561 109.044 97.413  1.00 11.73  ? 67  ILE F C     1 
ATOM   4127  O O     . ILE F 2  70  ? 125.656 107.936 96.913  1.00 9.85   ? 67  ILE F O     1 
ATOM   4128  C CB    . ILE F 2  70  ? 125.704 111.099 96.066  1.00 9.94   ? 67  ILE F CB    1 
ATOM   4129  C CG1   . ILE F 2  70  ? 124.899 111.976 95.150  1.00 7.29   ? 67  ILE F CG1   1 
ATOM   4130  C CG2   . ILE F 2  70  ? 126.815 110.389 95.327  1.00 14.08  ? 67  ILE F CG2   1 
ATOM   4131  C CD1   . ILE F 2  70  ? 125.618 113.198 94.665  1.00 4.60   ? 67  ILE F CD1   1 
ATOM   4132  N N     . ARG F 2  71  ? 126.084 109.306 98.587  1.00 10.08  ? 68  ARG F N     1 
ATOM   4133  C CA    . ARG F 2  71  ? 126.877 108.289 99.226  1.00 5.28   ? 68  ARG F CA    1 
ATOM   4134  C C     . ARG F 2  71  ? 126.130 106.995 99.401  1.00 7.89   ? 68  ARG F C     1 
ATOM   4135  O O     . ARG F 2  71  ? 126.718 105.920 99.223  1.00 10.48  ? 68  ARG F O     1 
ATOM   4136  C CB    . ARG F 2  71  ? 127.317 108.730 100.558 1.00 6.25   ? 68  ARG F CB    1 
ATOM   4137  C CG    . ARG F 2  71  ? 128.271 107.839 101.201 1.00 10.13  ? 68  ARG F CG    1 
ATOM   4138  C CD    . ARG F 2  71  ? 128.850 108.420 102.454 1.00 9.49   ? 68  ARG F CD    1 
ATOM   4139  N NE    . ARG F 2  71  ? 127.848 108.625 103.445 1.00 6.12   ? 68  ARG F NE    1 
ATOM   4140  C CZ    . ARG F 2  71  ? 127.362 109.793 103.845 1.00 8.45   ? 68  ARG F CZ    1 
ATOM   4141  N NH1   . ARG F 2  71  ? 127.782 110.932 103.394 1.00 9.46   ? 68  ARG F NH1   1 
ATOM   4142  N NH2   . ARG F 2  71  ? 126.397 109.818 104.711 1.00 10.36  ? 68  ARG F NH2   1 
ATOM   4143  N N     . ASP F 2  72  ? 124.856 107.045 99.763  1.00 9.10   ? 69  ASP F N     1 
ATOM   4144  C CA    . ASP F 2  72  ? 124.159 105.793 99.917  1.00 4.02   ? 69  ASP F CA    1 
ATOM   4145  C C     . ASP F 2  72  ? 123.873 105.171 98.560  1.00 10.22  ? 69  ASP F C     1 
ATOM   4146  O O     . ASP F 2  72  ? 124.042 103.966 98.380  1.00 8.66   ? 69  ASP F O     1 
ATOM   4147  C CB    . ASP F 2  72  ? 122.892 106.006 100.686 1.00 4.67   ? 69  ASP F CB    1 
ATOM   4148  C CG    . ASP F 2  72  ? 123.158 106.357 102.116 1.00 6.63   ? 69  ASP F CG    1 
ATOM   4149  O OD1   . ASP F 2  72  ? 124.255 106.166 102.579 1.00 6.20   ? 69  ASP F OD1   1 
ATOM   4150  O OD2   . ASP F 2  72  ? 122.239 106.766 102.778 1.00 12.19  ? 69  ASP F OD2   1 
ATOM   4151  N N     . ALA F 2  73  ? 123.527 105.963 97.555  1.00 11.33  ? 70  ALA F N     1 
ATOM   4152  C CA    . ALA F 2  73  ? 123.278 105.373 96.255  1.00 7.36   ? 70  ALA F CA    1 
ATOM   4153  C C     . ALA F 2  73  ? 124.528 104.703 95.728  1.00 8.84   ? 70  ALA F C     1 
ATOM   4154  O O     . ALA F 2  73  ? 124.456 103.631 95.119  1.00 13.46  ? 70  ALA F O     1 
ATOM   4155  C CB    . ALA F 2  73  ? 122.809 106.414 95.288  1.00 8.97   ? 70  ALA F CB    1 
ATOM   4156  N N     . VAL F 2  74  ? 125.684 105.287 95.987  1.00 9.38   ? 71  VAL F N     1 
ATOM   4157  C CA    . VAL F 2  74  ? 126.914 104.689 95.542  1.00 8.56   ? 71  VAL F CA    1 
ATOM   4158  C C     . VAL F 2  74  ? 127.150 103.410 96.289  1.00 12.32  ? 71  VAL F C     1 
ATOM   4159  O O     . VAL F 2  74  ? 127.534 102.424 95.676  1.00 4.61   ? 71  VAL F O     1 
ATOM   4160  C CB    . VAL F 2  74  ? 128.099 105.624 95.663  1.00 10.99  ? 71  VAL F CB    1 
ATOM   4161  C CG1   . VAL F 2  74  ? 129.379 104.894 95.370  1.00 10.63  ? 71  VAL F CG1   1 
ATOM   4162  C CG2   . VAL F 2  74  ? 127.930 106.714 94.675  1.00 12.00  ? 71  VAL F CG2   1 
ATOM   4163  N N     . THR F 2  75  ? 126.912 103.387 97.590  1.00 12.52  ? 72  THR F N     1 
ATOM   4164  C CA    . THR F 2  75  ? 127.100 102.177 98.377  1.00 5.42   ? 72  THR F CA    1 
ATOM   4165  C C     . THR F 2  75  ? 126.245 101.033 97.861  1.00 8.14   ? 72  THR F C     1 
ATOM   4166  O O     . THR F 2  75  ? 126.728 99.906  97.760  1.00 13.30  ? 72  THR F O     1 
ATOM   4167  C CB    . THR F 2  75  ? 126.801 102.433 99.841  1.00 5.47   ? 72  THR F CB    1 
ATOM   4168  O OG1   . THR F 2  75  ? 127.701 103.420 100.327 1.00 0.24   ? 72  THR F OG1   1 
ATOM   4169  C CG2   . THR F 2  75  ? 126.973 101.192 100.628 1.00 5.42   ? 72  THR F CG2   1 
ATOM   4170  N N     . TYR F 2  76  ? 124.990 101.282 97.516  1.00 10.84  ? 73  TYR F N     1 
ATOM   4171  C CA    . TYR F 2  76  ? 124.191 100.193 96.977  1.00 8.73   ? 73  TYR F CA    1 
ATOM   4172  C C     . TYR F 2  76  ? 124.755 99.722  95.640  1.00 13.69  ? 73  TYR F C     1 
ATOM   4173  O O     . TYR F 2  76  ? 124.830 98.513  95.376  1.00 16.27  ? 73  TYR F O     1 
ATOM   4174  C CB    . TYR F 2  76  ? 122.747 100.607 96.753  1.00 10.75  ? 73  TYR F CB    1 
ATOM   4175  C CG    . TYR F 2  76  ? 121.893 100.696 97.960  1.00 10.66  ? 73  TYR F CG    1 
ATOM   4176  C CD1   . TYR F 2  76  ? 121.493 101.884 98.430  1.00 11.44  ? 73  TYR F CD1   1 
ATOM   4177  C CD2   . TYR F 2  76  ? 121.500 99.586  98.578  1.00 13.75  ? 73  TYR F CD2   1 
ATOM   4178  C CE1   . TYR F 2  76  ? 120.710 101.957 99.530  1.00 11.99  ? 73  TYR F CE1   1 
ATOM   4179  C CE2   . TYR F 2  76  ? 120.711 99.660  99.692  1.00 12.65  ? 73  TYR F CE2   1 
ATOM   4180  C CZ    . TYR F 2  76  ? 120.327 100.828 100.158 1.00 8.89   ? 73  TYR F CZ    1 
ATOM   4181  O OH    . TYR F 2  76  ? 119.562 100.915 101.290 1.00 15.57  ? 73  TYR F OH    1 
ATOM   4182  N N     . THR F 2  77  ? 125.206 100.669 94.817  1.00 15.15  ? 74  THR F N     1 
ATOM   4183  C CA    . THR F 2  77  ? 125.742 100.374 93.502  1.00 9.95   ? 74  THR F CA    1 
ATOM   4184  C C     . THR F 2  77  ? 126.956 99.498  93.633  1.00 11.05  ? 74  THR F C     1 
ATOM   4185  O O     . THR F 2  77  ? 127.125 98.540  92.875  1.00 14.68  ? 74  THR F O     1 
ATOM   4186  C CB    . THR F 2  77  ? 126.152 101.661 92.779  1.00 10.02  ? 74  THR F CB    1 
ATOM   4187  O OG1   . THR F 2  77  ? 125.021 102.515 92.634  1.00 15.32  ? 74  THR F OG1   1 
ATOM   4188  C CG2   . THR F 2  77  ? 126.683 101.353 91.410  1.00 17.99  ? 74  THR F CG2   1 
ATOM   4189  N N     . GLU F 2  78  ? 127.829 99.829  94.566  1.00 10.82  ? 75  GLU F N     1 
ATOM   4190  C CA    . GLU F 2  78  ? 129.019 99.047  94.779  1.00 6.86   ? 75  GLU F CA    1 
ATOM   4191  C C     . GLU F 2  78  ? 128.742 97.680  95.322  1.00 11.82  ? 75  GLU F C     1 
ATOM   4192  O O     . GLU F 2  78  ? 129.345 96.708  94.890  1.00 17.97  ? 75  GLU F O     1 
ATOM   4193  C CB    . GLU F 2  78  ? 129.958 99.712  95.719  1.00 4.15   ? 75  GLU F CB    1 
ATOM   4194  C CG    . GLU F 2  78  ? 131.185 98.920  95.945  1.00 14.97  ? 75  GLU F CG    1 
ATOM   4195  C CD    . GLU F 2  78  ? 132.169 99.620  96.783  1.00 4.23   ? 75  GLU F CD    1 
ATOM   4196  O OE1   . GLU F 2  78  ? 131.966 100.765 97.099  1.00 15.56  ? 75  GLU F OE1   1 
ATOM   4197  O OE2   . GLU F 2  78  ? 133.143 99.004  97.136  1.00 12.56  ? 75  GLU F OE2   1 
ATOM   4198  N N     . HIS F 2  79  ? 127.826 97.564  96.257  1.00 13.04  ? 76  HIS F N     1 
ATOM   4199  C CA    . HIS F 2  79  ? 127.522 96.282  96.859  1.00 10.53  ? 76  HIS F CA    1 
ATOM   4200  C C     . HIS F 2  79  ? 127.217 95.251  95.820  1.00 12.13  ? 76  HIS F C     1 
ATOM   4201  O O     . HIS F 2  79  ? 127.753 94.133  95.840  1.00 19.42  ? 76  HIS F O     1 
ATOM   4202  C CB    . HIS F 2  79  ? 126.321 96.404  97.761  1.00 14.21  ? 76  HIS F CB    1 
ATOM   4203  C CG    . HIS F 2  79  ? 125.899 95.155  98.300  1.00 11.13  ? 76  HIS F CG    1 
ATOM   4204  N ND1   . HIS F 2  79  ? 126.557 94.523  99.299  1.00 12.64  ? 76  HIS F ND1   1 
ATOM   4205  C CD2   . HIS F 2  79  ? 124.877 94.382  97.969  1.00 15.34  ? 76  HIS F CD2   1 
ATOM   4206  C CE1   . HIS F 2  79  ? 125.945 93.397  99.560  1.00 11.31  ? 76  HIS F CE1   1 
ATOM   4207  N NE2   . HIS F 2  79  ? 124.920 93.293  98.763  1.00 12.38  ? 76  HIS F NE2   1 
ATOM   4208  N N     . ALA F 2  80  ? 126.426 95.677  94.846  1.00 12.94  ? 77  ALA F N     1 
ATOM   4209  C CA    . ALA F 2  80  ? 125.948 94.879  93.738  1.00 11.04  ? 77  ALA F CA    1 
ATOM   4210  C C     . ALA F 2  80  ? 126.991 94.671  92.655  1.00 13.76  ? 77  ALA F C     1 
ATOM   4211  O O     . ALA F 2  80  ? 126.726 93.992  91.665  1.00 18.84  ? 77  ALA F O     1 
ATOM   4212  C CB    . ALA F 2  80  ? 124.755 95.557  93.133  1.00 14.30  ? 77  ALA F CB    1 
ATOM   4213  N N     . LYS F 2  81  ? 128.153 95.275  92.830  1.00 17.00  ? 78  LYS F N     1 
ATOM   4214  C CA    . LYS F 2  81  ? 129.281 95.249  91.929  1.00 17.58  ? 78  LYS F CA    1 
ATOM   4215  C C     . LYS F 2  81  ? 129.020 95.805  90.567  1.00 19.59  ? 78  LYS F C     1 
ATOM   4216  O O     . LYS F 2  81  ? 129.457 95.250  89.566  1.00 29.88  ? 78  LYS F O     1 
ATOM   4217  C CB    . LYS F 2  81  ? 129.823 93.855  91.826  1.00 16.56  ? 78  LYS F CB    1 
ATOM   4218  C CG    . LYS F 2  81  ? 130.320 93.352  93.133  1.00 21.79  ? 78  LYS F CG    1 
ATOM   4219  C CD    . LYS F 2  81  ? 130.948 91.994  93.018  1.00 34.02  ? 78  LYS F CD    1 
ATOM   4220  C CE    . LYS F 2  81  ? 131.435 91.477  94.368  1.00 30.31  ? 78  LYS F CE    1 
ATOM   4221  N NZ    . LYS F 2  81  ? 131.987 90.094  94.272  1.00 28.23  ? 78  LYS F NZ    1 
ATOM   4222  N N     . ARG F 2  82  ? 128.326 96.915  90.532  1.00 16.40  ? 79  ARG F N     1 
ATOM   4223  C CA    . ARG F 2  82  ? 128.054 97.626  89.321  1.00 13.48  ? 79  ARG F CA    1 
ATOM   4224  C C     . ARG F 2  82  ? 128.845 98.890  89.283  1.00 21.49  ? 79  ARG F C     1 
ATOM   4225  O O     . ARG F 2  82  ? 129.457 99.273  90.277  1.00 26.71  ? 79  ARG F O     1 
ATOM   4226  C CB    . ARG F 2  82  ? 126.609 97.907  89.169  1.00 14.77  ? 79  ARG F CB    1 
ATOM   4227  C CG    . ARG F 2  82  ? 125.845 96.745  88.876  1.00 19.77  ? 79  ARG F CG    1 
ATOM   4228  C CD    . ARG F 2  82  ? 124.479 97.032  88.616  1.00 15.91  ? 79  ARG F CD    1 
ATOM   4229  N NE    . ARG F 2  82  ? 123.776 97.286  89.760  1.00 14.34  ? 79  ARG F NE    1 
ATOM   4230  C CZ    . ARG F 2  82  ? 123.405 98.456  90.185  1.00 14.51  ? 79  ARG F CZ    1 
ATOM   4231  N NH1   . ARG F 2  82  ? 123.703 99.514  89.583  1.00 17.88  ? 79  ARG F NH1   1 
ATOM   4232  N NH2   . ARG F 2  82  ? 122.724 98.591  91.263  1.00 8.71   ? 79  ARG F NH2   1 
ATOM   4233  N N     . LYS F 2  83  ? 128.915 99.491  88.105  1.00 25.22  ? 80  LYS F N     1 
ATOM   4234  C CA    . LYS F 2  83  ? 129.658 100.717 87.918  1.00 20.04  ? 80  LYS F CA    1 
ATOM   4235  C C     . LYS F 2  83  ? 128.746 101.879 87.579  1.00 19.39  ? 80  LYS F C     1 
ATOM   4236  O O     . LYS F 2  83  ? 129.225 103.006 87.440  1.00 25.86  ? 80  LYS F O     1 
ATOM   4237  C CB    . LYS F 2  83  ? 130.718 100.525 86.841  1.00 20.74  ? 80  LYS F CB    1 
ATOM   4238  C CG    . LYS F 2  83  ? 131.802 99.535  87.237  1.00 29.27  ? 80  LYS F CG    1 
ATOM   4239  C CD    . LYS F 2  83  ? 132.826 99.361  86.130  1.00 41.01  ? 80  LYS F CD    1 
ATOM   4240  C CE    . LYS F 2  83  ? 133.959 98.455  86.578  1.00 45.75  ? 80  LYS F CE    1 
ATOM   4241  N NZ    . LYS F 2  83  ? 134.740 99.085  87.679  1.00 49.87  ? 80  LYS F NZ    1 
ATOM   4242  N N     . THR F 2  84  ? 127.465 101.604 87.351  1.00 18.52  ? 81  THR F N     1 
ATOM   4243  C CA    . THR F 2  84  ? 126.578 102.646 86.938  1.00 15.97  ? 81  THR F CA    1 
ATOM   4244  C C     . THR F 2  84  ? 125.559 102.807 88.014  1.00 14.47  ? 81  THR F C     1 
ATOM   4245  O O     . THR F 2  84  ? 124.930 101.839 88.417  1.00 19.68  ? 81  THR F O     1 
ATOM   4246  C CB    . THR F 2  84  ? 125.869 102.290 85.622  1.00 19.49  ? 81  THR F CB    1 
ATOM   4247  O OG1   . THR F 2  84  ? 126.838 102.062 84.604  1.00 29.34  ? 81  THR F OG1   1 
ATOM   4248  C CG2   . THR F 2  84  ? 124.987 103.440 85.187  1.00 3.58   ? 81  THR F CG2   1 
ATOM   4249  N N     . VAL F 2  85  ? 125.361 104.014 88.475  1.00 13.66  ? 82  VAL F N     1 
ATOM   4250  C CA    . VAL F 2  85  ? 124.375 104.257 89.493  1.00 9.01   ? 82  VAL F CA    1 
ATOM   4251  C C     . VAL F 2  85  ? 123.028 104.311 88.811  1.00 8.77   ? 82  VAL F C     1 
ATOM   4252  O O     . VAL F 2  85  ? 122.856 105.053 87.845  1.00 11.20  ? 82  VAL F O     1 
ATOM   4253  C CB    . VAL F 2  85  ? 124.682 105.572 90.191  1.00 9.68   ? 82  VAL F CB    1 
ATOM   4254  C CG1   . VAL F 2  85  ? 123.633 105.881 91.201  1.00 5.63   ? 82  VAL F CG1   1 
ATOM   4255  C CG2   . VAL F 2  85  ? 126.042 105.495 90.829  1.00 10.13  ? 82  VAL F CG2   1 
ATOM   4256  N N     . THR F 2  86  ? 122.058 103.543 89.278  1.00 7.65   ? 83  THR F N     1 
ATOM   4257  C CA    . THR F 2  86  ? 120.763 103.587 88.621  1.00 4.59   ? 83  THR F CA    1 
ATOM   4258  C C     . THR F 2  86  ? 119.719 104.298 89.401  1.00 8.48   ? 83  THR F C     1 
ATOM   4259  O O     . THR F 2  86  ? 119.927 104.683 90.548  1.00 9.46   ? 83  THR F O     1 
ATOM   4260  C CB    . THR F 2  86  ? 120.231 102.217 88.219  1.00 7.09   ? 83  THR F CB    1 
ATOM   4261  O OG1   . THR F 2  86  ? 118.999 102.410 87.511  1.00 9.47   ? 83  THR F OG1   1 
ATOM   4262  C CG2   . THR F 2  86  ? 120.014 101.336 89.365  1.00 10.03  ? 83  THR F CG2   1 
ATOM   4263  N N     . ALA F 2  87  ? 118.565 104.462 88.794  1.00 7.35   ? 84  ALA F N     1 
ATOM   4264  C CA    . ALA F 2  87  ? 117.494 105.182 89.435  1.00 6.04   ? 84  ALA F CA    1 
ATOM   4265  C C     . ALA F 2  87  ? 117.102 104.529 90.705  1.00 11.45  ? 84  ALA F C     1 
ATOM   4266  O O     . ALA F 2  87  ? 116.788 105.216 91.667  1.00 13.75  ? 84  ALA F O     1 
ATOM   4267  C CB    . ALA F 2  87  ? 116.302 105.271 88.550  1.00 10.03  ? 84  ALA F CB    1 
ATOM   4268  N N     . MET F 2  88  ? 117.160 103.215 90.746  1.00 12.98  ? 85  MET F N     1 
ATOM   4269  C CA    . MET F 2  88  ? 116.774 102.505 91.935  1.00 7.67   ? 85  MET F CA    1 
ATOM   4270  C C     . MET F 2  88  ? 117.734 102.692 93.065  1.00 8.74   ? 85  MET F C     1 
ATOM   4271  O O     . MET F 2  88  ? 117.342 102.578 94.212  1.00 9.88   ? 85  MET F O     1 
ATOM   4272  C CB    . MET F 2  88  ? 116.592 101.033 91.680  1.00 6.10   ? 85  MET F CB    1 
ATOM   4273  C CG    . MET F 2  88  ? 115.412 100.705 90.835  1.00 9.34   ? 85  MET F CG    1 
ATOM   4274  S SD    . MET F 2  88  ? 113.891 101.428 91.463  1.00 23.30  ? 85  MET F SD    1 
ATOM   4275  C CE    . MET F 2  88  ? 113.705 100.704 93.074  1.00 17.48  ? 85  MET F CE    1 
ATOM   4276  N N     . ASP F 2  89  ? 118.973 103.015 92.799  1.00 8.06   ? 86  ASP F N     1 
ATOM   4277  C CA    . ASP F 2  89  ? 119.894 103.145 93.882  1.00 5.43   ? 86  ASP F CA    1 
ATOM   4278  C C     . ASP F 2  89  ? 119.621 104.480 94.519  1.00 13.30  ? 86  ASP F C     1 
ATOM   4279  O O     . ASP F 2  89  ? 119.737 104.646 95.734  1.00 13.40  ? 86  ASP F O     1 
ATOM   4280  C CB    . ASP F 2  89  ? 121.286 103.063 93.334  1.00 7.32   ? 86  ASP F CB    1 
ATOM   4281  C CG    . ASP F 2  89  ? 121.568 101.705 92.777  1.00 12.14  ? 86  ASP F CG    1 
ATOM   4282  O OD1   . ASP F 2  89  ? 121.148 100.722 93.355  1.00 17.58  ? 86  ASP F OD1   1 
ATOM   4283  O OD2   . ASP F 2  89  ? 122.132 101.629 91.698  1.00 16.27  ? 86  ASP F OD2   1 
ATOM   4284  N N     . VAL F 2  90  ? 119.210 105.431 93.696  1.00 13.45  ? 87  VAL F N     1 
ATOM   4285  C CA    . VAL F 2  90  ? 118.851 106.729 94.203  1.00 8.28   ? 87  VAL F CA    1 
ATOM   4286  C C     . VAL F 2  90  ? 117.565 106.621 94.983  1.00 13.30  ? 87  VAL F C     1 
ATOM   4287  O O     . VAL F 2  90  ? 117.449 107.213 96.051  1.00 15.38  ? 87  VAL F O     1 
ATOM   4288  C CB    . VAL F 2  90  ? 118.720 107.756 93.110  1.00 7.41   ? 87  VAL F CB    1 
ATOM   4289  C CG1   . VAL F 2  90  ? 118.186 109.030 93.686  1.00 2.94   ? 87  VAL F CG1   1 
ATOM   4290  C CG2   . VAL F 2  90  ? 120.053 107.982 92.519  1.00 6.65   ? 87  VAL F CG2   1 
ATOM   4291  N N     . VAL F 2  91  ? 116.591 105.887 94.470  1.00 13.64  ? 88  VAL F N     1 
ATOM   4292  C CA    . VAL F 2  91  ? 115.342 105.763 95.179  1.00 9.78   ? 88  VAL F CA    1 
ATOM   4293  C C     . VAL F 2  91  ? 115.536 105.108 96.529  1.00 14.72  ? 88  VAL F C     1 
ATOM   4294  O O     . VAL F 2  91  ? 114.930 105.559 97.501  1.00 17.54  ? 88  VAL F O     1 
ATOM   4295  C CB    . VAL F 2  91  ? 114.299 105.013 94.363  1.00 7.91   ? 88  VAL F CB    1 
ATOM   4296  C CG1   . VAL F 2  91  ? 113.102 104.710 95.199  1.00 13.07  ? 88  VAL F CG1   1 
ATOM   4297  C CG2   . VAL F 2  91  ? 113.872 105.867 93.196  1.00 11.70  ? 88  VAL F CG2   1 
ATOM   4298  N N     . TYR F 2  92  ? 116.350 104.062 96.637  1.00 13.00  ? 89  TYR F N     1 
ATOM   4299  C CA    . TYR F 2  92  ? 116.531 103.492 97.954  1.00 7.73   ? 89  TYR F CA    1 
ATOM   4300  C C     . TYR F 2  92  ? 117.272 104.447 98.863  1.00 13.42  ? 89  TYR F C     1 
ATOM   4301  O O     . TYR F 2  92  ? 116.945 104.571 100.046 1.00 16.53  ? 89  TYR F O     1 
ATOM   4302  C CB    . TYR F 2  92  ? 117.292 102.193 97.900  1.00 8.92   ? 89  TYR F CB    1 
ATOM   4303  C CG    . TYR F 2  92  ? 116.520 101.092 97.332  1.00 6.80   ? 89  TYR F CG    1 
ATOM   4304  C CD1   . TYR F 2  92  ? 116.898 100.536 96.196  1.00 5.26   ? 89  TYR F CD1   1 
ATOM   4305  C CD2   . TYR F 2  92  ? 115.422 100.654 97.947  1.00 14.50  ? 89  TYR F CD2   1 
ATOM   4306  C CE1   . TYR F 2  92  ? 116.188 99.556  95.650  1.00 5.27   ? 89  TYR F CE1   1 
ATOM   4307  C CE2   . TYR F 2  92  ? 114.699 99.649  97.400  1.00 13.74  ? 89  TYR F CE2   1 
ATOM   4308  C CZ    . TYR F 2  92  ? 115.088 99.109  96.248  1.00 15.09  ? 89  TYR F CZ    1 
ATOM   4309  O OH    . TYR F 2  92  ? 114.362 98.102  95.676  1.00 35.40  ? 89  TYR F OH    1 
ATOM   4310  N N     . ALA F 2  93  ? 118.246 105.170 98.342  1.00 12.92  ? 90  ALA F N     1 
ATOM   4311  C CA    . ALA F 2  93  ? 118.961 106.081 99.197  1.00 7.72   ? 90  ALA F CA    1 
ATOM   4312  C C     . ALA F 2  93  ? 118.035 107.113 99.797  1.00 10.68  ? 90  ALA F C     1 
ATOM   4313  O O     . ALA F 2  93  ? 118.194 107.487 100.955 1.00 15.56  ? 90  ALA F O     1 
ATOM   4314  C CB    . ALA F 2  93  ? 120.025 106.770 98.410  1.00 12.62  ? 90  ALA F CB    1 
ATOM   4315  N N     . LEU F 2  94  ? 117.063 107.574 99.024  1.00 15.45  ? 91  LEU F N     1 
ATOM   4316  C CA    . LEU F 2  94  ? 116.109 108.550 99.512  1.00 11.68  ? 91  LEU F CA    1 
ATOM   4317  C C     . LEU F 2  94  ? 115.103 107.941 100.470 1.00 14.22  ? 91  LEU F C     1 
ATOM   4318  O O     . LEU F 2  94  ? 114.767 108.532 101.503 1.00 11.95  ? 91  LEU F O     1 
ATOM   4319  C CB    . LEU F 2  94  ? 115.365 109.157 98.332  1.00 11.69  ? 91  LEU F CB    1 
ATOM   4320  C CG    . LEU F 2  94  ? 116.158 110.030 97.388  1.00 10.66  ? 91  LEU F CG    1 
ATOM   4321  C CD1   . LEU F 2  94  ? 115.340 110.304 96.185  1.00 10.40  ? 91  LEU F CD1   1 
ATOM   4322  C CD2   . LEU F 2  94  ? 116.498 111.311 98.041  1.00 7.56   ? 91  LEU F CD2   1 
ATOM   4323  N N     . LYS F 2  95  ? 114.679 106.717 100.206 1.00 15.48  ? 92  LYS F N     1 
ATOM   4324  C CA    . LYS F 2  95  ? 113.715 106.058 101.069 1.00 13.49  ? 92  LYS F CA    1 
ATOM   4325  C C     . LYS F 2  95  ? 114.219 105.939 102.476 1.00 12.92  ? 92  LYS F C     1 
ATOM   4326  O O     . LYS F 2  95  ? 113.476 106.130 103.437 1.00 21.43  ? 92  LYS F O     1 
ATOM   4327  C CB    . LYS F 2  95  ? 113.397 104.684 100.555 1.00 15.56  ? 92  LYS F CB    1 
ATOM   4328  C CG    . LYS F 2  95  ? 112.350 103.966 101.306 1.00 13.74  ? 92  LYS F CG    1 
ATOM   4329  C CD    . LYS F 2  95  ? 112.063 102.546 100.738 1.00 16.52  ? 92  LYS F CD    1 
ATOM   4330  C CE    . LYS F 2  95  ? 111.302 102.586 99.418  1.00 19.98  ? 92  LYS F CE    1 
ATOM   4331  N NZ    . LYS F 2  95  ? 110.733 101.248 99.041  1.00 17.89  ? 92  LYS F NZ    1 
ATOM   4332  N N     . ARG F 2  96  ? 115.489 105.678 102.625 1.00 11.63  ? 93  ARG F N     1 
ATOM   4333  C CA    . ARG F 2  96  ? 116.048 105.526 103.944 1.00 9.10   ? 93  ARG F CA    1 
ATOM   4334  C C     . ARG F 2  96  ? 116.109 106.756 104.773 1.00 13.84  ? 93  ARG F C     1 
ATOM   4335  O O     . ARG F 2  96  ? 116.339 106.685 105.975 1.00 22.58  ? 93  ARG F O     1 
ATOM   4336  C CB    . ARG F 2  96  ? 117.420 105.030 103.890 1.00 8.57   ? 93  ARG F CB    1 
ATOM   4337  C CG    . ARG F 2  96  ? 117.494 103.714 103.475 1.00 17.48  ? 93  ARG F CG    1 
ATOM   4338  C CD    . ARG F 2  96  ? 118.799 103.214 103.478 1.00 9.39   ? 93  ARG F CD    1 
ATOM   4339  N NE    . ARG F 2  96  ? 119.352 103.162 104.767 1.00 6.39   ? 93  ARG F NE    1 
ATOM   4340  C CZ    . ARG F 2  96  ? 120.325 103.917 105.213 1.00 6.44   ? 93  ARG F CZ    1 
ATOM   4341  N NH1   . ARG F 2  96  ? 120.858 104.831 104.470 1.00 5.52   ? 93  ARG F NH1   1 
ATOM   4342  N NH2   . ARG F 2  96  ? 120.771 103.713 106.416 1.00 6.73   ? 93  ARG F NH2   1 
ATOM   4343  N N     . GLN F 2  97  ? 115.972 107.892 104.164 1.00 13.65  ? 94  GLN F N     1 
ATOM   4344  C CA    . GLN F 2  97  ? 116.050 109.106 104.905 1.00 9.28   ? 94  GLN F CA    1 
ATOM   4345  C C     . GLN F 2  97  ? 114.665 109.584 105.210 1.00 14.21  ? 94  GLN F C     1 
ATOM   4346  O O     . GLN F 2  97  ? 114.479 110.684 105.723 1.00 24.99  ? 94  GLN F O     1 
ATOM   4347  C CB    . GLN F 2  97  ? 116.823 110.124 104.142 1.00 11.69  ? 94  GLN F CB    1 
ATOM   4348  C CG    . GLN F 2  97  ? 118.207 109.704 103.924 1.00 11.39  ? 94  GLN F CG    1 
ATOM   4349  C CD    . GLN F 2  97  ? 118.945 110.680 103.198 1.00 12.20  ? 94  GLN F CD    1 
ATOM   4350  O OE1   . GLN F 2  97  ? 118.611 111.865 103.200 1.00 14.29  ? 94  GLN F OE1   1 
ATOM   4351  N NE2   . GLN F 2  97  ? 119.976 110.238 102.543 1.00 14.71  ? 94  GLN F NE2   1 
ATOM   4352  N N     . GLY F 2  98  ? 113.671 108.770 104.881 1.00 13.64  ? 95  GLY F N     1 
ATOM   4353  C CA    . GLY F 2  98  ? 112.319 109.160 105.132 1.00 10.44  ? 95  GLY F CA    1 
ATOM   4354  C C     . GLY F 2  98  ? 111.791 110.013 104.027 1.00 14.34  ? 95  GLY F C     1 
ATOM   4355  O O     . GLY F 2  98  ? 110.900 110.839 104.247 1.00 24.73  ? 95  GLY F O     1 
ATOM   4356  N N     . ARG F 2  99  ? 112.367 109.902 102.837 1.00 11.79  ? 96  ARG F N     1 
ATOM   4357  C CA    . ARG F 2  99  ? 111.879 110.699 101.751 1.00 9.86   ? 96  ARG F CA    1 
ATOM   4358  C C     . ARG F 2  99  ? 111.501 109.849 100.586 1.00 14.40  ? 96  ARG F C     1 
ATOM   4359  O O     . ARG F 2  99  ? 112.225 109.754 99.605  1.00 19.38  ? 96  ARG F O     1 
ATOM   4360  C CB    . ARG F 2  99  ? 112.898 111.684 101.323 1.00 11.35  ? 96  ARG F CB    1 
ATOM   4361  C CG    . ARG F 2  99  ? 113.174 112.637 102.336 1.00 14.70  ? 96  ARG F CG    1 
ATOM   4362  C CD    . ARG F 2  99  ? 114.004 113.702 101.912 1.00 9.47   ? 96  ARG F CD    1 
ATOM   4363  N NE    . ARG F 2  99  ? 114.027 114.698 102.925 1.00 5.62   ? 96  ARG F NE    1 
ATOM   4364  C CZ    . ARG F 2  99  ? 114.847 114.721 103.945 1.00 15.27  ? 96  ARG F CZ    1 
ATOM   4365  N NH1   . ARG F 2  99  ? 115.770 113.804 104.092 1.00 21.32  ? 96  ARG F NH1   1 
ATOM   4366  N NH2   . ARG F 2  99  ? 114.739 115.694 104.821 1.00 13.99  ? 96  ARG F NH2   1 
ATOM   4367  N N     . THR F 2  100 ? 110.358 109.236 100.667 1.00 13.94  ? 97  THR F N     1 
ATOM   4368  C CA    . THR F 2  100 ? 109.945 108.344 99.632  1.00 8.70   ? 97  THR F CA    1 
ATOM   4369  C C     . THR F 2  100 ? 109.650 109.122 98.386  1.00 12.03  ? 97  THR F C     1 
ATOM   4370  O O     . THR F 2  100 ? 108.926 110.112 98.430  1.00 17.13  ? 97  THR F O     1 
ATOM   4371  C CB    . THR F 2  100 ? 108.704 107.588 100.079 1.00 10.25  ? 97  THR F CB    1 
ATOM   4372  O OG1   . THR F 2  100 ? 108.993 106.865 101.270 1.00 19.00  ? 97  THR F OG1   1 
ATOM   4373  C CG2   . THR F 2  100 ? 108.293 106.634 99.035  1.00 11.91  ? 97  THR F CG2   1 
ATOM   4374  N N     . LEU F 2  101 ? 110.197 108.678 97.275  1.00 13.87  ? 98  LEU F N     1 
ATOM   4375  C CA    . LEU F 2  101 ? 109.988 109.319 95.993  1.00 12.14  ? 98  LEU F CA    1 
ATOM   4376  C C     . LEU F 2  101 ? 109.178 108.457 95.061  1.00 13.97  ? 98  LEU F C     1 
ATOM   4377  O O     . LEU F 2  101 ? 109.514 107.300 94.848  1.00 19.57  ? 98  LEU F O     1 
ATOM   4378  C CB    . LEU F 2  101 ? 111.352 109.646 95.395  1.00 12.10  ? 98  LEU F CB    1 
ATOM   4379  C CG    . LEU F 2  101 ? 111.402 110.200 93.984  1.00 10.62  ? 98  LEU F CG    1 
ATOM   4380  C CD1   . LEU F 2  101 ? 110.734 111.535 93.908  1.00 13.76  ? 98  LEU F CD1   1 
ATOM   4381  C CD2   . LEU F 2  101 ? 112.852 110.348 93.587  1.00 9.28   ? 98  LEU F CD2   1 
ATOM   4382  N N     . TYR F 2  102 ? 108.111 109.000 94.505  1.00 12.87  ? 99  TYR F N     1 
ATOM   4383  C CA    . TYR F 2  102 ? 107.283 108.255 93.575  1.00 11.51  ? 99  TYR F CA    1 
ATOM   4384  C C     . TYR F 2  102 ? 107.505 108.674 92.138  1.00 12.38  ? 99  TYR F C     1 
ATOM   4385  O O     . TYR F 2  102 ? 107.623 109.859 91.826  1.00 18.46  ? 99  TYR F O     1 
ATOM   4386  C CB    . TYR F 2  102 ? 105.796 108.426 93.854  1.00 12.61  ? 99  TYR F CB    1 
ATOM   4387  C CG    . TYR F 2  102 ? 105.193 107.780 95.075  1.00 11.35  ? 99  TYR F CG    1 
ATOM   4388  C CD1   . TYR F 2  102 ? 105.896 107.024 95.947  1.00 13.39  ? 99  TYR F CD1   1 
ATOM   4389  C CD2   . TYR F 2  102 ? 103.863 107.934 95.270  1.00 12.87  ? 99  TYR F CD2   1 
ATOM   4390  C CE1   . TYR F 2  102 ? 105.264 106.443 97.005  1.00 9.33   ? 99  TYR F CE1   1 
ATOM   4391  C CE2   . TYR F 2  102 ? 103.244 107.353 96.316  1.00 12.85  ? 99  TYR F CE2   1 
ATOM   4392  C CZ    . TYR F 2  102 ? 103.942 106.614 97.183  1.00 10.85  ? 99  TYR F CZ    1 
ATOM   4393  O OH    . TYR F 2  102 ? 103.291 106.016 98.239  1.00 17.67  ? 99  TYR F OH    1 
ATOM   4394  N N     . GLY F 2  103 ? 107.412 107.708 91.228  1.00 14.28  ? 100 GLY F N     1 
ATOM   4395  C CA    . GLY F 2  103 ? 107.468 107.984 89.791  1.00 9.67   ? 100 GLY F CA    1 
ATOM   4396  C C     . GLY F 2  103 ? 108.751 107.616 89.038  1.00 7.11   ? 100 GLY F C     1 
ATOM   4397  O O     . GLY F 2  103 ? 108.762 107.673 87.812  1.00 20.85  ? 100 GLY F O     1 
ATOM   4398  N N     . PHE F 2  104 ? 109.811 107.214 89.725  1.00 6.68   ? 101 PHE F N     1 
ATOM   4399  C CA    . PHE F 2  104 ? 111.073 106.841 89.065  1.00 4.28   ? 101 PHE F CA    1 
ATOM   4400  C C     . PHE F 2  104 ? 111.409 105.381 89.183  1.00 6.43   ? 101 PHE F C     1 
ATOM   4401  O O     . PHE F 2  104 ? 112.578 105.008 89.144  1.00 12.04  ? 101 PHE F O     1 
ATOM   4402  C CB    . PHE F 2  104 ? 112.256 107.599 89.621  1.00 3.96   ? 101 PHE F CB    1 
ATOM   4403  C CG    . PHE F 2  104 ? 112.261 108.982 89.323  1.00 5.68   ? 101 PHE F CG    1 
ATOM   4404  C CD1   . PHE F 2  104 ? 111.754 109.859 90.175  1.00 11.83  ? 101 PHE F CD1   1 
ATOM   4405  C CD2   . PHE F 2  104 ? 112.819 109.424 88.180  1.00 6.93   ? 101 PHE F CD2   1 
ATOM   4406  C CE1   . PHE F 2  104 ? 111.782 111.175 89.903  1.00 14.17  ? 101 PHE F CE1   1 
ATOM   4407  C CE2   . PHE F 2  104 ? 112.852 110.741 87.895  1.00 11.33  ? 101 PHE F CE2   1 
ATOM   4408  C CZ    . PHE F 2  104 ? 112.325 111.621 88.763  1.00 12.16  ? 101 PHE F CZ    1 
ATOM   4409  N N     . GLY F 2  105 ? 110.410 104.551 89.339  1.00 8.49   ? 102 GLY F N     1 
ATOM   4410  C CA    . GLY F 2  105 ? 110.643 103.143 89.549  1.00 7.59   ? 102 GLY F CA    1 
ATOM   4411  C C     . GLY F 2  105 ? 110.389 102.920 91.013  1.00 16.53  ? 102 GLY F C     1 
ATOM   4412  O O     . GLY F 2  105 ? 110.355 103.885 91.781  1.00 18.65  ? 102 GLY F O     1 
ATOM   4413  N N     . GLY F 2  106 ? 110.191 101.674 91.407  1.00 13.52  ? 103 GLY F N     1 
ATOM   4414  C CA    . GLY F 2  106 ? 109.888 101.379 92.795  1.00 11.15  ? 103 GLY F CA    1 
ATOM   4415  C C     . GLY F 2  106 ? 108.422 101.009 92.915  1.00 0.03   ? 103 GLY F C     1 
ATOM   4416  O O     . GLY F 2  106 ? 108.108 99.823  92.958  1.00 5.24   ? 103 GLY F O     1 
ATOM   4417  O OXT   . GLY F 2  106 ? 107.554 101.847 92.651  1.00 15.70  ? 103 GLY F OXT   1 
ATOM   4418  N N     . LYS G 3  13  ? 143.634 88.201  115.353 1.00 84.72  ? 10  LYS G N     1 
ATOM   4419  C CA    . LYS G 3  13  ? 144.287 88.008  116.636 1.00 87.80  ? 10  LYS G CA    1 
ATOM   4420  C C     . LYS G 3  13  ? 145.077 86.698  116.525 1.00 82.94  ? 10  LYS G C     1 
ATOM   4421  O O     . LYS G 3  13  ? 144.731 85.842  115.714 1.00 82.20  ? 10  LYS G O     1 
ATOM   4422  C CB    . LYS G 3  13  ? 143.239 87.985  117.739 0.00 82.27  ? 10  LYS G CB    1 
ATOM   4423  C CG    . LYS G 3  13  ? 142.310 89.227  117.775 0.00 78.51  ? 10  LYS G CG    1 
ATOM   4424  C CD    . LYS G 3  13  ? 142.994 90.511  118.230 0.00 94.84  ? 10  LYS G CD    1 
ATOM   4425  C CE    . LYS G 3  13  ? 143.267 90.497  119.727 0.00 101.99 ? 10  LYS G CE    1 
ATOM   4426  N NZ    . LYS G 3  13  ? 143.752 91.813  120.225 0.00 108.84 ? 10  LYS G NZ    1 
ATOM   4427  N N     . ALA G 3  14  ? 146.127 86.529  117.331 1.00 87.09  ? 11  ALA G N     1 
ATOM   4428  C CA    . ALA G 3  14  ? 147.022 85.372  117.182 1.00 89.48  ? 11  ALA G CA    1 
ATOM   4429  C C     . ALA G 3  14  ? 146.421 83.970  117.262 1.00 78.65  ? 11  ALA G C     1 
ATOM   4430  O O     . ALA G 3  14  ? 146.856 83.098  116.510 1.00 78.26  ? 11  ALA G O     1 
ATOM   4431  C CB    . ALA G 3  14  ? 148.096 85.435  118.260 1.00 86.95  ? 11  ALA G CB    1 
ATOM   4432  N N     . ARG G 3  15  ? 145.462 83.716  118.147 1.00 78.10  ? 12  ARG G N     1 
ATOM   4433  C CA    . ARG G 3  15  ? 144.955 82.345  118.239 1.00 74.32  ? 12  ARG G CA    1 
ATOM   4434  C C     . ARG G 3  15  ? 143.752 82.172  119.126 1.00 69.45  ? 12  ARG G C     1 
ATOM   4435  O O     . ARG G 3  15  ? 143.329 83.093  119.831 1.00 61.32  ? 12  ARG G O     1 
ATOM   4436  C CB    . ARG G 3  15  ? 146.015 81.392  118.746 0.00 76.63  ? 12  ARG G CB    1 
ATOM   4437  C CG    . ARG G 3  15  ? 146.516 81.681  120.130 0.00 75.14  ? 12  ARG G CG    1 
ATOM   4438  C CD    . ARG G 3  15  ? 147.654 80.809  120.449 0.00 72.48  ? 12  ARG G CD    1 
ATOM   4439  N NE    . ARG G 3  15  ? 148.779 81.091  119.566 0.00 74.66  ? 12  ARG G NE    1 
ATOM   4440  C CZ    . ARG G 3  15  ? 149.700 82.063  119.746 0.00 85.87  ? 12  ARG G CZ    1 
ATOM   4441  N NH1   . ARG G 3  15  ? 149.654 82.854  120.803 0.00 70.07  ? 12  ARG G NH1   1 
ATOM   4442  N NH2   . ARG G 3  15  ? 150.656 82.219  118.847 0.00 54.40  ? 12  ARG G NH2   1 
ATOM   4443  N N     . ALA G 3  16  ? 143.219 80.964  119.104 1.00 74.12  ? 13  ALA G N     1 
ATOM   4444  C CA    . ALA G 3  16  ? 142.168 80.535  120.000 1.00 82.55  ? 13  ALA G CA    1 
ATOM   4445  C C     . ALA G 3  16  ? 142.375 79.063  120.278 1.00 74.25  ? 13  ALA G C     1 
ATOM   4446  O O     . ALA G 3  16  ? 142.878 78.338  119.421 1.00 76.65  ? 13  ALA G O     1 
ATOM   4447  C CB    . ALA G 3  16  ? 140.799 80.753  119.392 1.00 66.59  ? 13  ALA G CB    1 
ATOM   4448  N N     . LYS G 3  17  ? 141.979 78.619  121.460 1.00 78.37  ? 14  LYS G N     1 
ATOM   4449  C CA    . LYS G 3  17  ? 142.046 77.205  121.783 1.00 81.49  ? 14  LYS G CA    1 
ATOM   4450  C C     . LYS G 3  17  ? 140.853 76.790  122.606 1.00 80.55  ? 14  LYS G C     1 
ATOM   4451  O O     . LYS G 3  17  ? 140.907 76.753  123.837 1.00 77.26  ? 14  LYS G O     1 
ATOM   4452  C CB    . LYS G 3  17  ? 143.336 76.862  122.510 1.00 83.22  ? 14  LYS G CB    1 
ATOM   4453  C CG    . LYS G 3  17  ? 143.481 75.381  122.866 1.00 84.48  ? 14  LYS G CG    1 
ATOM   4454  C CD    . LYS G 3  17  ? 143.681 74.518  121.627 1.00 88.91  ? 14  LYS G CD    1 
ATOM   4455  C CE    . LYS G 3  17  ? 143.929 73.074  122.012 1.00 103.77 ? 14  LYS G CE    1 
ATOM   4456  N NZ    . LYS G 3  17  ? 144.128 72.205  120.823 1.00 104.38 ? 14  LYS G NZ    1 
ATOM   4457  N N     . ALA G 3  18  ? 139.759 76.541  121.925 1.00 80.70  ? 15  ALA G N     1 
ATOM   4458  C CA    . ALA G 3  18  ? 138.507 76.225  122.564 1.00 81.52  ? 15  ALA G CA    1 
ATOM   4459  C C     . ALA G 3  18  ? 137.604 75.584  121.564 1.00 81.64  ? 15  ALA G C     1 
ATOM   4460  O O     . ALA G 3  18  ? 137.868 75.622  120.365 1.00 74.03  ? 15  ALA G O     1 
ATOM   4461  C CB    . ALA G 3  18  ? 137.855 77.447  123.130 1.00 75.36  ? 15  ALA G CB    1 
ATOM   4462  N N     . LYS G 3  19  ? 136.531 75.003  122.050 1.00 79.29  ? 16  LYS G N     1 
ATOM   4463  C CA    . LYS G 3  19  ? 135.570 74.420  121.154 1.00 78.87  ? 16  LYS G CA    1 
ATOM   4464  C C     . LYS G 3  19  ? 134.499 75.385  120.667 1.00 76.00  ? 16  LYS G C     1 
ATOM   4465  O O     . LYS G 3  19  ? 133.822 75.076  119.693 1.00 82.25  ? 16  LYS G O     1 
ATOM   4466  C CB    . LYS G 3  19  ? 134.930 73.221  121.837 1.00 84.65  ? 16  LYS G CB    1 
ATOM   4467  C CG    . LYS G 3  19  ? 135.911 72.086  122.060 1.00 97.07  ? 16  LYS G CG    1 
ATOM   4468  C CD    . LYS G 3  19  ? 135.281 70.896  122.747 1.00 109.64 ? 16  LYS G CD    1 
ATOM   4469  C CE    . LYS G 3  19  ? 136.304 69.768  122.914 1.00 120.73 ? 16  LYS G CE    1 
ATOM   4470  N NZ    . LYS G 3  19  ? 135.743 68.593  123.643 1.00 136.23 ? 16  LYS G NZ    1 
ATOM   4471  N N     . THR G 3  20  ? 134.324 76.542  121.303 1.00 64.97  ? 17  THR G N     1 
ATOM   4472  C CA    . THR G 3  20  ? 133.216 77.387  120.891 1.00 64.13  ? 17  THR G CA    1 
ATOM   4473  C C     . THR G 3  20  ? 133.550 78.248  119.690 1.00 61.74  ? 17  THR G C     1 
ATOM   4474  O O     . THR G 3  20  ? 134.725 78.498  119.384 1.00 59.25  ? 17  THR G O     1 
ATOM   4475  C CB    . THR G 3  20  ? 132.774 78.292  122.050 1.00 62.00  ? 17  THR G CB    1 
ATOM   4476  O OG1   . THR G 3  20  ? 133.820 79.228  122.381 1.00 58.07  ? 17  THR G OG1   1 
ATOM   4477  C CG2   . THR G 3  20  ? 132.495 77.427  123.268 1.00 75.41  ? 17  THR G CG2   1 
ATOM   4478  N N     . ARG G 3  21  ? 132.509 78.771  119.039 1.00 57.19  ? 18  ARG G N     1 
ATOM   4479  C CA    . ARG G 3  21  ? 132.741 79.626  117.886 1.00 50.93  ? 18  ARG G CA    1 
ATOM   4480  C C     . ARG G 3  21  ? 133.151 81.024  118.291 1.00 48.43  ? 18  ARG G C     1 
ATOM   4481  O O     . ARG G 3  21  ? 133.908 81.685  117.576 1.00 48.15  ? 18  ARG G O     1 
ATOM   4482  C CB    . ARG G 3  21  ? 131.515 79.655  117.025 1.00 51.88  ? 18  ARG G CB    1 
ATOM   4483  C CG    . ARG G 3  21  ? 131.229 78.348  116.368 1.00 54.66  ? 18  ARG G CG    1 
ATOM   4484  C CD    . ARG G 3  21  ? 129.960 78.331  115.633 1.00 56.02  ? 18  ARG G CD    1 
ATOM   4485  N NE    . ARG G 3  21  ? 129.990 79.070  114.410 1.00 56.48  ? 18  ARG G NE    1 
ATOM   4486  C CZ    . ARG G 3  21  ? 128.900 79.380  113.699 1.00 63.79  ? 18  ARG G CZ    1 
ATOM   4487  N NH1   . ARG G 3  21  ? 127.716 79.032  114.138 1.00 53.09  ? 18  ARG G NH1   1 
ATOM   4488  N NH2   . ARG G 3  21  ? 129.023 80.021  112.547 1.00 58.03  ? 18  ARG G NH2   1 
ATOM   4489  N N     . SER G 3  22  ? 132.686 81.464  119.454 1.00 48.31  ? 19  SER G N     1 
ATOM   4490  C CA    . SER G 3  22  ? 133.028 82.782  119.934 1.00 42.06  ? 19  SER G CA    1 
ATOM   4491  C C     . SER G 3  22  ? 134.494 82.800  120.228 1.00 43.24  ? 19  SER G C     1 
ATOM   4492  O O     . SER G 3  22  ? 135.171 83.792  119.976 1.00 46.67  ? 19  SER G O     1 
ATOM   4493  C CB    . SER G 3  22  ? 132.266 83.126  121.194 1.00 43.01  ? 19  SER G CB    1 
ATOM   4494  O OG    . SER G 3  22  ? 130.901 83.266  120.951 1.00 45.64  ? 19  SER G OG    1 
ATOM   4495  N N     . SER G 3  23  ? 135.029 81.708  120.764 1.00 45.05  ? 20  SER G N     1 
ATOM   4496  C CA    . SER G 3  23  ? 136.444 81.714  121.039 1.00 44.55  ? 20  SER G CA    1 
ATOM   4497  C C     . SER G 3  23  ? 137.230 81.764  119.753 1.00 45.36  ? 20  SER G C     1 
ATOM   4498  O O     . SER G 3  23  ? 138.125 82.594  119.605 1.00 44.59  ? 20  SER G O     1 
ATOM   4499  C CB    . SER G 3  23  ? 136.829 80.539  121.837 1.00 50.62  ? 20  SER G CB    1 
ATOM   4500  O OG    . SER G 3  23  ? 138.202 80.555  122.096 1.00 55.20  ? 20  SER G OG    1 
ATOM   4501  N N     . ARG G 3  24  ? 136.852 80.962  118.760 1.00 46.73  ? 21  ARG G N     1 
ATOM   4502  C CA    . ARG G 3  24  ? 137.606 80.983  117.520 1.00 45.30  ? 21  ARG G CA    1 
ATOM   4503  C C     . ARG G 3  24  ? 137.676 82.348  116.909 1.00 42.09  ? 21  ARG G C     1 
ATOM   4504  O O     . ARG G 3  24  ? 138.720 82.774  116.435 1.00 42.66  ? 21  ARG G O     1 
ATOM   4505  C CB    . ARG G 3  24  ? 136.985 80.113  116.485 1.00 51.71  ? 21  ARG G CB    1 
ATOM   4506  C CG    . ARG G 3  24  ? 137.125 78.710  116.666 1.00 59.19  ? 21  ARG G CG    1 
ATOM   4507  C CD    . ARG G 3  24  ? 136.638 78.030  115.494 1.00 64.95  ? 21  ARG G CD    1 
ATOM   4508  N NE    . ARG G 3  24  ? 136.837 76.655  115.603 1.00 76.85  ? 21  ARG G NE    1 
ATOM   4509  C CZ    . ARG G 3  24  ? 135.957 75.795  116.150 1.00 84.49  ? 21  ARG G CZ    1 
ATOM   4510  N NH1   . ARG G 3  24  ? 134.834 76.247  116.629 1.00 74.61  ? 21  ARG G NH1   1 
ATOM   4511  N NH2   . ARG G 3  24  ? 136.240 74.513  116.217 1.00 90.15  ? 21  ARG G NH2   1 
ATOM   4512  N N     . ALA G 3  25  ? 136.580 83.063  116.968 1.00 36.36  ? 22  ALA G N     1 
ATOM   4513  C CA    . ALA G 3  25  ? 136.509 84.376  116.387 1.00 31.04  ? 22  ALA G CA    1 
ATOM   4514  C C     . ALA G 3  25  ? 137.131 85.449  117.272 1.00 34.54  ? 22  ALA G C     1 
ATOM   4515  O O     . ALA G 3  25  ? 137.175 86.614  116.879 1.00 36.07  ? 22  ALA G O     1 
ATOM   4516  C CB    . ALA G 3  25  ? 135.071 84.703  116.112 1.00 30.79  ? 22  ALA G CB    1 
ATOM   4517  N N     . GLY G 3  26  ? 137.541 85.100  118.493 1.00 38.64  ? 23  GLY G N     1 
ATOM   4518  C CA    . GLY G 3  26  ? 138.111 86.048  119.447 1.00 43.23  ? 23  GLY G CA    1 
ATOM   4519  C C     . GLY G 3  26  ? 137.074 86.981  120.063 1.00 44.09  ? 23  GLY G C     1 
ATOM   4520  O O     . GLY G 3  26  ? 137.405 88.104  120.435 1.00 50.62  ? 23  GLY G O     1 
ATOM   4521  N N     . LEU G 3  27  ? 135.826 86.547  120.126 1.00 37.65  ? 24  LEU G N     1 
ATOM   4522  C CA    . LEU G 3  27  ? 134.727 87.354  120.605 1.00 35.33  ? 24  LEU G CA    1 
ATOM   4523  C C     . LEU G 3  27  ? 134.233 86.999  121.983 1.00 42.21  ? 24  LEU G C     1 
ATOM   4524  O O     . LEU G 3  27  ? 134.460 85.898  122.476 1.00 44.19  ? 24  LEU G O     1 
ATOM   4525  C CB    . LEU G 3  27  ? 133.569 87.220  119.640 1.00 32.72  ? 24  LEU G CB    1 
ATOM   4526  C CG    . LEU G 3  27  ? 133.848 87.583  118.206 1.00 26.85  ? 24  LEU G CG    1 
ATOM   4527  C CD1   . LEU G 3  27  ? 132.618 87.324  117.421 1.00 24.76  ? 24  LEU G CD1   1 
ATOM   4528  C CD2   . LEU G 3  27  ? 134.246 89.003  118.092 1.00 37.95  ? 24  LEU G CD2   1 
ATOM   4529  N N     . GLN G 3  28  ? 133.553 87.951  122.616 1.00 42.30  ? 25  GLN G N     1 
ATOM   4530  C CA    . GLN G 3  28  ? 132.907 87.688  123.885 1.00 37.16  ? 25  GLN G CA    1 
ATOM   4531  C C     . GLN G 3  28  ? 131.437 87.422  123.662 1.00 35.89  ? 25  GLN G C     1 
ATOM   4532  O O     . GLN G 3  28  ? 130.831 86.643  124.385 1.00 43.27  ? 25  GLN G O     1 
ATOM   4533  C CB    . GLN G 3  28  ? 133.067 88.864  124.803 1.00 39.22  ? 25  GLN G CB    1 
ATOM   4534  C CG    . GLN G 3  28  ? 134.464 89.179  125.076 1.00 46.43  ? 25  GLN G CG    1 
ATOM   4535  C CD    . GLN G 3  28  ? 135.121 88.078  125.713 1.00 54.21  ? 25  GLN G CD    1 
ATOM   4536  O OE1   . GLN G 3  28  ? 134.649 87.588  126.726 1.00 60.60  ? 25  GLN G OE1   1 
ATOM   4537  N NE2   . GLN G 3  28  ? 136.222 87.640  125.158 1.00 58.41  ? 25  GLN G NE2   1 
ATOM   4538  N N     . PHE G 3  29  ? 130.873 88.034  122.636 1.00 31.10  ? 26  PHE G N     1 
ATOM   4539  C CA    . PHE G 3  29  ? 129.476 87.808  122.314 1.00 30.51  ? 26  PHE G CA    1 
ATOM   4540  C C     . PHE G 3  29  ? 129.319 86.428  121.727 1.00 35.42  ? 26  PHE G C     1 
ATOM   4541  O O     . PHE G 3  29  ? 130.281 85.904  121.168 1.00 39.89  ? 26  PHE G O     1 
ATOM   4542  C CB    . PHE G 3  29  ? 128.936 88.907  121.422 1.00 28.62  ? 26  PHE G CB    1 
ATOM   4543  C CG    . PHE G 3  29  ? 128.454 90.064  122.216 1.00 29.12  ? 26  PHE G CG    1 
ATOM   4544  C CD1   . PHE G 3  29  ? 129.282 90.895  122.881 1.00 30.51  ? 26  PHE G CD1   1 
ATOM   4545  C CD2   . PHE G 3  29  ? 127.109 90.312  122.282 1.00 29.44  ? 26  PHE G CD2   1 
ATOM   4546  C CE1   . PHE G 3  29  ? 128.776 91.929  123.607 1.00 27.42  ? 26  PHE G CE1   1 
ATOM   4547  C CE2   . PHE G 3  29  ? 126.620 91.347  122.999 1.00 26.82  ? 26  PHE G CE2   1 
ATOM   4548  C CZ    . PHE G 3  29  ? 127.453 92.147  123.662 1.00 24.26  ? 26  PHE G CZ    1 
ATOM   4549  N N     . PRO G 3  30  ? 128.174 85.772  121.912 1.00 36.07  ? 27  PRO G N     1 
ATOM   4550  C CA    . PRO G 3  30  ? 127.895 84.463  121.421 1.00 34.05  ? 27  PRO G CA    1 
ATOM   4551  C C     . PRO G 3  30  ? 127.782 84.511  119.945 1.00 42.35  ? 27  PRO G C     1 
ATOM   4552  O O     . PRO G 3  30  ? 127.207 85.452  119.420 1.00 43.18  ? 27  PRO G O     1 
ATOM   4553  C CB    . PRO G 3  30  ? 126.555 84.155  122.044 1.00 38.83  ? 27  PRO G CB    1 
ATOM   4554  C CG    . PRO G 3  30  ? 125.937 85.488  122.248 1.00 40.38  ? 27  PRO G CG    1 
ATOM   4555  C CD    . PRO G 3  30  ? 127.054 86.399  122.565 1.00 40.18  ? 27  PRO G CD    1 
ATOM   4556  N N     . VAL G 3  31  ? 128.220 83.474  119.283 1.00 41.60  ? 28  VAL G N     1 
ATOM   4557  C CA    . VAL G 3  31  ? 128.071 83.402  117.851 1.00 30.35  ? 28  VAL G CA    1 
ATOM   4558  C C     . VAL G 3  31  ? 126.899 82.533  117.512 1.00 35.27  ? 28  VAL G C     1 
ATOM   4559  O O     . VAL G 3  31  ? 126.095 82.874  116.650 1.00 36.90  ? 28  VAL G O     1 
ATOM   4560  C CB    . VAL G 3  31  ? 129.342 82.884  117.204 1.00 34.37  ? 28  VAL G CB    1 
ATOM   4561  C CG1   . VAL G 3  31  ? 129.144 82.685  115.730 1.00 38.06  ? 28  VAL G CG1   1 
ATOM   4562  C CG2   . VAL G 3  31  ? 130.435 83.887  117.419 1.00 31.44  ? 28  VAL G CG2   1 
ATOM   4563  N N     . GLY G 3  32  ? 126.787 81.398  118.182 1.00 38.42  ? 29  GLY G N     1 
ATOM   4564  C CA    . GLY G 3  32  ? 125.723 80.466  117.878 1.00 40.07  ? 29  GLY G CA    1 
ATOM   4565  C C     . GLY G 3  32  ? 124.366 81.094  118.092 1.00 35.12  ? 29  GLY G C     1 
ATOM   4566  O O     . GLY G 3  32  ? 123.436 80.851  117.324 1.00 39.45  ? 29  GLY G O     1 
ATOM   4567  N N     . ARG G 3  33  ? 124.250 81.944  119.097 1.00 34.49  ? 30  ARG G N     1 
ATOM   4568  C CA    . ARG G 3  33  ? 122.984 82.584  119.341 1.00 34.28  ? 30  ARG G CA    1 
ATOM   4569  C C     . ARG G 3  33  ? 122.638 83.536  118.239 1.00 33.29  ? 30  ARG G C     1 
ATOM   4570  O O     . ARG G 3  33  ? 121.479 83.658  117.861 1.00 40.42  ? 30  ARG G O     1 
ATOM   4571  C CB    . ARG G 3  33  ? 122.971 83.341  120.619 1.00 39.99  ? 30  ARG G CB    1 
ATOM   4572  C CG    . ARG G 3  33  ? 121.651 83.976  120.900 1.00 47.75  ? 30  ARG G CG    1 
ATOM   4573  C CD    . ARG G 3  33  ? 121.598 84.637  122.201 1.00 52.39  ? 30  ARG G CD    1 
ATOM   4574  N NE    . ARG G 3  33  ? 121.638 83.710  123.264 1.00 70.85  ? 30  ARG G NE    1 
ATOM   4575  C CZ    . ARG G 3  33  ? 121.902 84.004  124.533 1.00 71.62  ? 30  ARG G CZ    1 
ATOM   4576  N NH1   . ARG G 3  33  ? 122.150 85.220  124.891 1.00 57.95  ? 30  ARG G NH1   1 
ATOM   4577  N NH2   . ARG G 3  33  ? 121.897 83.050  125.420 1.00 84.82  ? 30  ARG G NH2   1 
ATOM   4578  N N     . VAL G 3  34  ? 123.624 84.240  117.738 1.00 33.66  ? 31  VAL G N     1 
ATOM   4579  C CA    . VAL G 3  34  ? 123.379 85.208  116.713 1.00 25.91  ? 31  VAL G CA    1 
ATOM   4580  C C     . VAL G 3  34  ? 122.915 84.467  115.491 1.00 28.11  ? 31  VAL G C     1 
ATOM   4581  O O     . VAL G 3  34  ? 122.000 84.918  114.812 1.00 30.36  ? 31  VAL G O     1 
ATOM   4582  C CB    . VAL G 3  34  ? 124.621 86.046  116.465 1.00 24.84  ? 31  VAL G CB    1 
ATOM   4583  C CG1   . VAL G 3  34  ? 124.458 86.923  115.283 1.00 29.57  ? 31  VAL G CG1   1 
ATOM   4584  C CG2   . VAL G 3  34  ? 124.859 86.894  117.670 1.00 27.38  ? 31  VAL G CG2   1 
ATOM   4585  N N     . HIS G 3  35  ? 123.544 83.336  115.193 1.00 30.91  ? 32  HIS G N     1 
ATOM   4586  C CA    . HIS G 3  35  ? 123.142 82.564  114.035 1.00 28.84  ? 32  HIS G CA    1 
ATOM   4587  C C     . HIS G 3  35  ? 121.702 82.136  114.203 1.00 30.30  ? 32  HIS G C     1 
ATOM   4588  O O     . HIS G 3  35  ? 120.887 82.311  113.299 1.00 38.40  ? 32  HIS G O     1 
ATOM   4589  C CB    . HIS G 3  35  ? 124.042 81.352  113.873 1.00 32.62  ? 32  HIS G CB    1 
ATOM   4590  C CG    . HIS G 3  35  ? 123.854 80.559  112.624 1.00 35.34  ? 32  HIS G CG    1 
ATOM   4591  N ND1   . HIS G 3  35  ? 123.122 79.397  112.566 1.00 42.33  ? 32  HIS G ND1   1 
ATOM   4592  C CD2   . HIS G 3  35  ? 124.321 80.761  111.380 1.00 41.43  ? 32  HIS G CD2   1 
ATOM   4593  C CE1   . HIS G 3  35  ? 123.187 78.920  111.340 1.00 43.08  ? 32  HIS G CE1   1 
ATOM   4594  N NE2   . HIS G 3  35  ? 123.898 79.729  110.618 1.00 43.78  ? 32  HIS G NE2   1 
ATOM   4595  N N     . ARG G 3  36  ? 121.342 81.654  115.380 1.00 31.52  ? 33  ARG G N     1 
ATOM   4596  C CA    . ARG G 3  36  ? 119.980 81.226  115.597 1.00 31.55  ? 33  ARG G CA    1 
ATOM   4597  C C     . ARG G 3  36  ? 118.980 82.341  115.405 1.00 28.40  ? 33  ARG G C     1 
ATOM   4598  O O     . ARG G 3  36  ? 117.934 82.136  114.783 1.00 32.59  ? 33  ARG G O     1 
ATOM   4599  C CB    . ARG G 3  36  ? 119.834 80.677  116.977 1.00 39.10  ? 33  ARG G CB    1 
ATOM   4600  C CG    . ARG G 3  36  ? 118.496 80.158  117.291 1.00 45.86  ? 33  ARG G CG    1 
ATOM   4601  C CD    . ARG G 3  36  ? 118.454 79.430  118.614 1.00 54.03  ? 33  ARG G CD    1 
ATOM   4602  N NE    . ARG G 3  36  ? 118.639 80.276  119.764 1.00 60.57  ? 33  ARG G NE    1 
ATOM   4603  C CZ    . ARG G 3  36  ? 117.689 81.047  120.300 1.00 66.73  ? 33  ARG G CZ    1 
ATOM   4604  N NH1   . ARG G 3  36  ? 116.497 81.097  119.770 1.00 61.09  ? 33  ARG G NH1   1 
ATOM   4605  N NH2   . ARG G 3  36  ? 117.943 81.756  121.370 1.00 72.10  ? 33  ARG G NH2   1 
ATOM   4606  N N     . LEU G 3  37  ? 119.302 83.520  115.907 1.00 28.14  ? 34  LEU G N     1 
ATOM   4607  C CA    . LEU G 3  37  ? 118.422 84.651  115.776 1.00 23.67  ? 34  LEU G CA    1 
ATOM   4608  C C     . LEU G 3  37  ? 118.348 85.136  114.350 1.00 22.64  ? 34  LEU G C     1 
ATOM   4609  O O     . LEU G 3  37  ? 117.352 85.730  113.966 1.00 23.76  ? 34  LEU G O     1 
ATOM   4610  C CB    . LEU G 3  37  ? 118.890 85.785  116.658 1.00 23.93  ? 34  LEU G CB    1 
ATOM   4611  C CG    . LEU G 3  37  ? 118.808 85.566  118.155 1.00 27.48  ? 34  LEU G CG    1 
ATOM   4612  C CD1   . LEU G 3  37  ? 119.497 86.720  118.836 1.00 36.64  ? 34  LEU G CD1   1 
ATOM   4613  C CD2   . LEU G 3  37  ? 117.377 85.471  118.607 1.00 43.34  ? 34  LEU G CD2   1 
ATOM   4614  N N     . LEU G 3  38  ? 119.400 84.959  113.563 1.00 22.61  ? 35  LEU G N     1 
ATOM   4615  C CA    . LEU G 3  38  ? 119.298 85.343  112.177 1.00 20.30  ? 35  LEU G CA    1 
ATOM   4616  C C     . LEU G 3  38  ? 118.470 84.337  111.401 1.00 25.32  ? 35  LEU G C     1 
ATOM   4617  O O     . LEU G 3  38  ? 117.775 84.724  110.468 1.00 27.82  ? 35  LEU G O     1 
ATOM   4618  C CB    . LEU G 3  38  ? 120.667 85.484  111.518 1.00 17.41  ? 35  LEU G CB    1 
ATOM   4619  C CG    . LEU G 3  38  ? 121.533 86.639  111.943 1.00 16.43  ? 35  LEU G CG    1 
ATOM   4620  C CD1   . LEU G 3  38  ? 122.913 86.458  111.360 1.00 25.14  ? 35  LEU G CD1   1 
ATOM   4621  C CD2   . LEU G 3  38  ? 120.941 87.939  111.434 1.00 21.05  ? 35  LEU G CD2   1 
ATOM   4622  N N     . ARG G 3  39  ? 118.552 83.043  111.734 1.00 27.86  ? 36  ARG G N     1 
ATOM   4623  C CA    . ARG G 3  39  ? 117.774 82.060  110.987 1.00 27.79  ? 36  ARG G CA    1 
ATOM   4624  C C     . ARG G 3  39  ? 116.301 82.189  111.225 1.00 27.51  ? 36  ARG G C     1 
ATOM   4625  O O     . ARG G 3  39  ? 115.493 81.994  110.319 1.00 37.57  ? 36  ARG G O     1 
ATOM   4626  C CB    . ARG G 3  39  ? 118.154 80.638  111.307 1.00 32.75  ? 36  ARG G CB    1 
ATOM   4627  C CG    . ARG G 3  39  ? 119.432 80.196  110.722 1.00 37.53  ? 36  ARG G CG    1 
ATOM   4628  C CD    . ARG G 3  39  ? 119.683 78.761  110.892 1.00 44.52  ? 36  ARG G CD    1 
ATOM   4629  N NE    . ARG G 3  39  ? 120.125 78.406  112.234 1.00 52.72  ? 36  ARG G NE    1 
ATOM   4630  C CZ    . ARG G 3  39  ? 119.409 77.742  113.186 1.00 62.27  ? 36  ARG G CZ    1 
ATOM   4631  N NH1   . ARG G 3  39  ? 118.172 77.341  112.973 1.00 57.19  ? 36  ARG G NH1   1 
ATOM   4632  N NH2   . ARG G 3  39  ? 119.977 77.489  114.351 1.00 52.33  ? 36  ARG G NH2   1 
ATOM   4633  N N     . LYS G 3  40  ? 115.938 82.320  112.499 1.00 25.77  ? 37  LYS G N     1 
ATOM   4634  C CA    . LYS G 3  40  ? 114.571 82.618  112.914 1.00 24.28  ? 37  LYS G CA    1 
ATOM   4635  C C     . LYS G 3  40  ? 114.296 84.078  112.653 1.00 24.64  ? 37  LYS G C     1 
ATOM   4636  O O     . LYS G 3  40  ? 115.233 84.858  112.701 1.00 28.05  ? 37  LYS G O     1 
ATOM   4637  C CB    . LYS G 3  40  ? 114.392 82.347  114.407 1.00 25.87  ? 37  LYS G CB    1 
ATOM   4638  C CG    . LYS G 3  40  ? 113.004 82.693  114.928 1.00 27.79  ? 37  LYS G CG    1 
ATOM   4639  C CD    . LYS G 3  40  ? 112.852 82.403  116.407 1.00 35.99  ? 37  LYS G CD    1 
ATOM   4640  C CE    . LYS G 3  40  ? 111.481 82.857  116.878 1.00 48.66  ? 37  LYS G CE    1 
ATOM   4641  N NZ    . LYS G 3  40  ? 111.321 82.732  118.353 1.00 51.92  ? 37  LYS G NZ    1 
ATOM   4642  N N     . GLY G 3  41  ? 113.064 84.518  112.401 1.00 25.72  ? 38  GLY G N     1 
ATOM   4643  C CA    . GLY G 3  41  ? 112.910 85.947  112.238 1.00 25.33  ? 38  GLY G CA    1 
ATOM   4644  C C     . GLY G 3  41  ? 112.728 86.311  110.790 1.00 26.99  ? 38  GLY G C     1 
ATOM   4645  O O     . GLY G 3  41  ? 112.517 87.474  110.462 1.00 29.01  ? 38  GLY G O     1 
ATOM   4646  N N     . ASN G 3  42  ? 112.793 85.324  109.913 1.00 27.65  ? 39  ASN G N     1 
ATOM   4647  C CA    . ASN G 3  42  ? 112.557 85.546  108.502 1.00 28.62  ? 39  ASN G CA    1 
ATOM   4648  C C     . ASN G 3  42  ? 113.383 86.650  107.865 1.00 29.78  ? 39  ASN G C     1 
ATOM   4649  O O     . ASN G 3  42  ? 112.828 87.536  107.224 1.00 31.86  ? 39  ASN G O     1 
ATOM   4650  C CB    . ASN G 3  42  ? 111.088 85.818  108.289 1.00 32.15  ? 39  ASN G CB    1 
ATOM   4651  C CG    . ASN G 3  42  ? 110.243 84.682  108.699 1.00 39.02  ? 39  ASN G CG    1 
ATOM   4652  O OD1   . ASN G 3  42  ? 110.591 83.513  108.487 1.00 37.24  ? 39  ASN G OD1   1 
ATOM   4653  N ND2   . ASN G 3  42  ? 109.117 84.990  109.293 1.00 44.98  ? 39  ASN G ND2   1 
ATOM   4654  N N     . TYR G 3  43  ? 114.685 86.663  108.088 1.00 25.20  ? 40  TYR G N     1 
ATOM   4655  C CA    . TYR G 3  43  ? 115.497 87.689  107.460 1.00 22.02  ? 40  TYR G CA    1 
ATOM   4656  C C     . TYR G 3  43  ? 115.894 87.221  106.072 1.00 25.42  ? 40  TYR G C     1 
ATOM   4657  O O     . TYR G 3  43  ? 116.037 88.006  105.137 1.00 29.44  ? 40  TYR G O     1 
ATOM   4658  C CB    . TYR G 3  43  ? 116.718 87.993  108.306 1.00 18.12  ? 40  TYR G CB    1 
ATOM   4659  C CG    . TYR G 3  43  ? 116.386 88.672  109.590 1.00 18.84  ? 40  TYR G CG    1 
ATOM   4660  C CD1   . TYR G 3  43  ? 116.433 87.989  110.760 1.00 21.49  ? 40  TYR G CD1   1 
ATOM   4661  C CD2   . TYR G 3  43  ? 116.030 89.977  109.597 1.00 22.22  ? 40  TYR G CD2   1 
ATOM   4662  C CE1   . TYR G 3  43  ? 116.132 88.608  111.932 1.00 19.74  ? 40  TYR G CE1   1 
ATOM   4663  C CE2   . TYR G 3  43  ? 115.724 90.596  110.770 1.00 19.64  ? 40  TYR G CE2   1 
ATOM   4664  C CZ    . TYR G 3  43  ? 115.777 89.913  111.929 1.00 13.27  ? 40  TYR G CZ    1 
ATOM   4665  O OH    . TYR G 3  43  ? 115.471 90.537  113.104 1.00 21.44  ? 40  TYR G OH    1 
ATOM   4666  N N     . SER G 3  44  ? 116.074 85.933  105.942 1.00 26.37  ? 41  SER G N     1 
ATOM   4667  C CA    . SER G 3  44  ? 116.443 85.311  104.694 1.00 26.18  ? 41  SER G CA    1 
ATOM   4668  C C     . SER G 3  44  ? 116.179 83.848  104.802 1.00 31.72  ? 41  SER G C     1 
ATOM   4669  O O     . SER G 3  44  ? 116.045 83.325  105.909 1.00 34.99  ? 41  SER G O     1 
ATOM   4670  C CB    . SER G 3  44  ? 117.883 85.498  104.399 1.00 28.16  ? 41  SER G CB    1 
ATOM   4671  O OG    . SER G 3  44  ? 118.635 84.811  105.349 1.00 30.81  ? 41  SER G OG    1 
ATOM   4672  N N     . GLU G 3  45  ? 116.153 83.167  103.680 1.00 33.79  ? 42  GLU G N     1 
ATOM   4673  C CA    . GLU G 3  45  ? 116.085 81.730  103.690 1.00 35.87  ? 42  GLU G CA    1 
ATOM   4674  C C     . GLU G 3  45  ? 117.356 81.106  104.224 1.00 34.78  ? 42  GLU G C     1 
ATOM   4675  O O     . GLU G 3  45  ? 117.308 80.078  104.895 1.00 44.84  ? 42  GLU G O     1 
ATOM   4676  C CB    . GLU G 3  45  ? 115.825 81.209  102.302 1.00 42.50  ? 42  GLU G CB    1 
ATOM   4677  C CG    . GLU G 3  45  ? 114.454 81.529  101.747 1.00 49.88  ? 42  GLU G CG    1 
ATOM   4678  C CD    . GLU G 3  45  ? 114.298 82.920  101.182 1.00 70.24  ? 42  GLU G CD    1 
ATOM   4679  O OE1   . GLU G 3  45  ? 115.115 83.773  101.459 1.00 63.31  ? 42  GLU G OE1   1 
ATOM   4680  O OE2   . GLU G 3  45  ? 113.361 83.135  100.455 1.00 82.91  ? 42  GLU G OE2   1 
ATOM   4681  N N     . ARG G 3  46  ? 118.491 81.716  103.916 1.00 29.37  ? 43  ARG G N     1 
ATOM   4682  C CA    . ARG G 3  46  ? 119.773 81.183  104.322 1.00 28.60  ? 43  ARG G CA    1 
ATOM   4683  C C     . ARG G 3  46  ? 120.663 82.178  105.034 1.00 28.05  ? 43  ARG G C     1 
ATOM   4684  O O     . ARG G 3  46  ? 120.707 83.360  104.674 1.00 31.12  ? 43  ARG G O     1 
ATOM   4685  C CB    . ARG G 3  46  ? 120.507 80.767  103.106 1.00 34.65  ? 43  ARG G CB    1 
ATOM   4686  C CG    . ARG G 3  46  ? 119.927 79.699  102.355 1.00 40.19  ? 43  ARG G CG    1 
ATOM   4687  C CD    . ARG G 3  46  ? 120.676 79.458  101.121 1.00 39.36  ? 43  ARG G CD    1 
ATOM   4688  N NE    . ARG G 3  46  ? 120.117 78.388  100.453 1.00 48.99  ? 43  ARG G NE    1 
ATOM   4689  C CZ    . ARG G 3  46  ? 120.492 77.134  100.617 1.00 62.24  ? 43  ARG G CZ    1 
ATOM   4690  N NH1   . ARG G 3  46  ? 121.492 76.840  101.376 1.00 58.92  ? 43  ARG G NH1   1 
ATOM   4691  N NH2   . ARG G 3  46  ? 119.840 76.166  100.025 1.00 88.00  ? 43  ARG G NH2   1 
ATOM   4692  N N     . VAL G 3  47  ? 121.442 81.680  105.979 1.00 24.96  ? 44  VAL G N     1 
ATOM   4693  C CA    . VAL G 3  47  ? 122.414 82.501  106.680 1.00 21.65  ? 44  VAL G CA    1 
ATOM   4694  C C     . VAL G 3  47  ? 123.788 81.927  106.501 1.00 23.37  ? 44  VAL G C     1 
ATOM   4695  O O     . VAL G 3  47  ? 124.026 80.784  106.855 1.00 34.63  ? 44  VAL G O     1 
ATOM   4696  C CB    . VAL G 3  47  ? 122.052 82.588  108.158 1.00 25.50  ? 44  VAL G CB    1 
ATOM   4697  C CG1   . VAL G 3  47  ? 123.067 83.396  108.915 1.00 31.21  ? 44  VAL G CG1   1 
ATOM   4698  C CG2   . VAL G 3  47  ? 120.688 83.221  108.285 1.00 27.78  ? 44  VAL G CG2   1 
ATOM   4699  N N     . GLY G 3  48  ? 124.694 82.720  105.981 1.00 22.27  ? 45  GLY G N     1 
ATOM   4700  C CA    . GLY G 3  48  ? 126.035 82.271  105.687 1.00 24.32  ? 45  GLY G CA    1 
ATOM   4701  C C     . GLY G 3  48  ? 126.848 82.081  106.928 1.00 27.59  ? 45  GLY G C     1 
ATOM   4702  O O     . GLY G 3  48  ? 126.596 82.688  107.962 1.00 33.42  ? 45  GLY G O     1 
ATOM   4703  N N     . ALA G 3  49  ? 127.892 81.299  106.811 1.00 28.06  ? 46  ALA G N     1 
ATOM   4704  C CA    . ALA G 3  49  ? 128.735 80.973  107.942 1.00 29.23  ? 46  ALA G CA    1 
ATOM   4705  C C     . ALA G 3  49  ? 129.391 82.160  108.587 1.00 30.89  ? 46  ALA G C     1 
ATOM   4706  O O     . ALA G 3  49  ? 129.560 82.179  109.800 1.00 37.79  ? 46  ALA G O     1 
ATOM   4707  C CB    . ALA G 3  49  ? 129.808 80.012  107.516 1.00 45.84  ? 46  ALA G CB    1 
ATOM   4708  N N     . GLY G 3  50  ? 129.778 83.154  107.816 1.00 28.49  ? 47  GLY G N     1 
ATOM   4709  C CA    . GLY G 3  50  ? 130.434 84.287  108.428 1.00 22.11  ? 47  GLY G CA    1 
ATOM   4710  C C     . GLY G 3  50  ? 129.452 85.339  108.891 1.00 18.98  ? 47  GLY G C     1 
ATOM   4711  O O     . GLY G 3  50  ? 129.832 86.283  109.573 1.00 21.49  ? 47  GLY G O     1 
ATOM   4712  N N     . ALA G 3  51  ? 128.179 85.206  108.574 1.00 15.57  ? 48  ALA G N     1 
ATOM   4713  C CA    . ALA G 3  51  ? 127.273 86.267  108.928 1.00 11.56  ? 48  ALA G CA    1 
ATOM   4714  C C     . ALA G 3  51  ? 127.196 86.514  110.424 1.00 21.02  ? 48  ALA G C     1 
ATOM   4715  O O     . ALA G 3  51  ? 127.285 87.672  110.819 1.00 14.59  ? 48  ALA G O     1 
ATOM   4716  C CB    . ALA G 3  51  ? 125.906 86.016  108.365 1.00 20.55  ? 48  ALA G CB    1 
ATOM   4717  N N     . PRO G 3  52  ? 127.057 85.520  111.325 1.00 21.61  ? 49  PRO G N     1 
ATOM   4718  C CA    . PRO G 3  52  ? 126.981 85.734  112.736 1.00 15.42  ? 49  PRO G CA    1 
ATOM   4719  C C     . PRO G 3  52  ? 128.314 86.058  113.352 1.00 18.53  ? 49  PRO G C     1 
ATOM   4720  O O     . PRO G 3  52  ? 128.372 86.459  114.504 1.00 22.12  ? 49  PRO G O     1 
ATOM   4721  C CB    . PRO G 3  52  ? 126.482 84.419  113.238 1.00 24.31  ? 49  PRO G CB    1 
ATOM   4722  C CG    . PRO G 3  52  ? 126.998 83.472  112.286 1.00 27.44  ? 49  PRO G CG    1 
ATOM   4723  C CD    . PRO G 3  52  ? 126.914 84.121  110.977 1.00 27.18  ? 49  PRO G CD    1 
ATOM   4724  N N     . VAL G 3  53  ? 129.395 85.876  112.629 1.00 18.49  ? 50  VAL G N     1 
ATOM   4725  C CA    . VAL G 3  53  ? 130.674 86.133  113.223 1.00 14.52  ? 50  VAL G CA    1 
ATOM   4726  C C     . VAL G 3  53  ? 130.928 87.579  113.023 1.00 16.30  ? 50  VAL G C     1 
ATOM   4727  O O     . VAL G 3  53  ? 131.399 88.281  113.914 1.00 22.65  ? 50  VAL G O     1 
ATOM   4728  C CB    . VAL G 3  53  ? 131.763 85.302  112.588 1.00 19.82  ? 50  VAL G CB    1 
ATOM   4729  C CG1   . VAL G 3  53  ? 133.090 85.686  113.140 1.00 24.97  ? 50  VAL G CG1   1 
ATOM   4730  C CG2   . VAL G 3  53  ? 131.497 83.882  112.861 1.00 30.18  ? 50  VAL G CG2   1 
ATOM   4731  N N     . TYR G 3  54  ? 130.654 88.028  111.824 1.00 16.23  ? 51  TYR G N     1 
ATOM   4732  C CA    . TYR G 3  54  ? 130.863 89.396  111.503 1.00 11.20  ? 51  TYR G CA    1 
ATOM   4733  C C     . TYR G 3  54  ? 129.928 90.205  112.366 1.00 8.86   ? 51  TYR G C     1 
ATOM   4734  O O     . TYR G 3  54  ? 130.340 91.169  113.003 1.00 12.05  ? 51  TYR G O     1 
ATOM   4735  C CB    . TYR G 3  54  ? 130.566 89.631  110.044 1.00 14.03  ? 51  TYR G CB    1 
ATOM   4736  C CG    . TYR G 3  54  ? 130.974 90.923  109.569 1.00 11.77  ? 51  TYR G CG    1 
ATOM   4737  C CD1   . TYR G 3  54  ? 132.142 91.028  108.925 1.00 15.30  ? 51  TYR G CD1   1 
ATOM   4738  C CD2   . TYR G 3  54  ? 130.248 91.999  109.800 1.00 9.77   ? 51  TYR G CD2   1 
ATOM   4739  C CE1   . TYR G 3  54  ? 132.571 92.206  108.502 1.00 11.56  ? 51  TYR G CE1   1 
ATOM   4740  C CE2   . TYR G 3  54  ? 130.681 93.188  109.384 1.00 10.72  ? 51  TYR G CE2   1 
ATOM   4741  C CZ    . TYR G 3  54  ? 131.835 93.277  108.735 1.00 14.39  ? 51  TYR G CZ    1 
ATOM   4742  O OH    . TYR G 3  54  ? 132.277 94.457  108.331 1.00 21.89  ? 51  TYR G OH    1 
ATOM   4743  N N     . LEU G 3  55  ? 128.659 89.807  112.430 1.00 9.06   ? 52  LEU G N     1 
ATOM   4744  C CA    . LEU G 3  55  ? 127.708 90.563  113.207 1.00 5.56   ? 52  LEU G CA    1 
ATOM   4745  C C     . LEU G 3  55  ? 127.995 90.529  114.680 1.00 5.71   ? 52  LEU G C     1 
ATOM   4746  O O     . LEU G 3  55  ? 127.838 91.552  115.340 1.00 7.15   ? 52  LEU G O     1 
ATOM   4747  C CB    . LEU G 3  55  ? 126.300 90.079  112.943 1.00 5.84   ? 52  LEU G CB    1 
ATOM   4748  C CG    . LEU G 3  55  ? 125.167 90.784  113.657 1.00 3.54   ? 52  LEU G CG    1 
ATOM   4749  C CD1   . LEU G 3  55  ? 125.168 92.230  113.353 1.00 0.74   ? 52  LEU G CD1   1 
ATOM   4750  C CD2   . LEU G 3  55  ? 123.877 90.199  113.163 1.00 4.86   ? 52  LEU G CD2   1 
ATOM   4751  N N     . ALA G 3  56  ? 128.391 89.397  115.246 1.00 12.64  ? 53  ALA G N     1 
ATOM   4752  C CA    . ALA G 3  56  ? 128.668 89.422  116.655 1.00 8.76   ? 53  ALA G CA    1 
ATOM   4753  C C     . ALA G 3  56  ? 129.799 90.385  116.947 1.00 10.59  ? 53  ALA G C     1 
ATOM   4754  O O     . ALA G 3  56  ? 129.724 91.124  117.924 1.00 15.29  ? 53  ALA G O     1 
ATOM   4755  C CB    . ALA G 3  56  ? 129.009 88.049  117.141 1.00 18.21  ? 53  ALA G CB    1 
ATOM   4756  N N     . ALA G 3  57  ? 130.814 90.454  116.084 1.00 13.19  ? 54  ALA G N     1 
ATOM   4757  C CA    . ALA G 3  57  ? 131.917 91.376  116.300 1.00 8.82   ? 54  ALA G CA    1 
ATOM   4758  C C     . ALA G 3  57  ? 131.483 92.818  116.306 1.00 7.02   ? 54  ALA G C     1 
ATOM   4759  O O     . ALA G 3  57  ? 132.043 93.630  117.044 1.00 13.84  ? 54  ALA G O     1 
ATOM   4760  C CB    . ALA G 3  57  ? 132.943 91.193  115.238 1.00 18.11  ? 54  ALA G CB    1 
ATOM   4761  N N     . VAL G 3  58  ? 130.515 93.160  115.477 1.00 6.59   ? 55  VAL G N     1 
ATOM   4762  C CA    . VAL G 3  58  ? 130.035 94.525  115.425 1.00 5.82   ? 55  VAL G CA    1 
ATOM   4763  C C     . VAL G 3  58  ? 129.274 94.889  116.667 1.00 6.26   ? 55  VAL G C     1 
ATOM   4764  O O     . VAL G 3  58  ? 129.445 95.989  117.196 1.00 11.06  ? 55  VAL G O     1 
ATOM   4765  C CB    . VAL G 3  58  ? 129.168 94.760  114.213 1.00 5.12   ? 55  VAL G CB    1 
ATOM   4766  C CG1   . VAL G 3  58  ? 128.516 96.135  114.275 1.00 2.41   ? 55  VAL G CG1   1 
ATOM   4767  C CG2   . VAL G 3  58  ? 130.033 94.646  113.006 1.00 3.56   ? 55  VAL G CG2   1 
ATOM   4768  N N     . LEU G 3  59  ? 128.410 93.997  117.134 1.00 6.02   ? 56  LEU G N     1 
ATOM   4769  C CA    . LEU G 3  59  ? 127.639 94.291  118.323 1.00 5.79   ? 56  LEU G CA    1 
ATOM   4770  C C     . LEU G 3  59  ? 128.563 94.441  119.494 1.00 9.19   ? 56  LEU G C     1 
ATOM   4771  O O     . LEU G 3  59  ? 128.333 95.287  120.364 1.00 16.05  ? 56  LEU G O     1 
ATOM   4772  C CB    . LEU G 3  59  ? 126.655 93.174  118.606 1.00 6.41   ? 56  LEU G CB    1 
ATOM   4773  C CG    . LEU G 3  59  ? 125.525 93.001  117.609 1.00 3.44   ? 56  LEU G CG    1 
ATOM   4774  C CD1   . LEU G 3  59  ? 124.803 91.745  117.925 1.00 1.78   ? 56  LEU G CD1   1 
ATOM   4775  C CD2   . LEU G 3  59  ? 124.572 94.168  117.650 1.00 2.94   ? 56  LEU G CD2   1 
ATOM   4776  N N     . GLU G 3  60  ? 129.611 93.641  119.540 1.00 12.75  ? 57  GLU G N     1 
ATOM   4777  C CA    . GLU G 3  60  ? 130.542 93.755  120.621 1.00 9.87   ? 57  GLU G CA    1 
ATOM   4778  C C     . GLU G 3  60  ? 131.269 95.055  120.583 1.00 13.18  ? 57  GLU G C     1 
ATOM   4779  O O     . GLU G 3  60  ? 131.447 95.685  121.621 1.00 20.30  ? 57  GLU G O     1 
ATOM   4780  C CB    . GLU G 3  60  ? 131.523 92.650  120.601 1.00 14.56  ? 57  GLU G CB    1 
ATOM   4781  C CG    . GLU G 3  60  ? 132.457 92.692  121.699 1.00 22.99  ? 57  GLU G CG    1 
ATOM   4782  C CD    . GLU G 3  60  ? 133.223 91.462  121.794 1.00 34.46  ? 57  GLU G CD    1 
ATOM   4783  O OE1   . GLU G 3  60  ? 132.641 90.388  121.656 1.00 38.39  ? 57  GLU G OE1   1 
ATOM   4784  O OE2   . GLU G 3  60  ? 134.391 91.538  122.014 1.00 36.11  ? 57  GLU G OE2   1 
ATOM   4785  N N     . TYR G 3  61  ? 131.689 95.489  119.410 1.00 14.77  ? 58  TYR G N     1 
ATOM   4786  C CA    . TYR G 3  61  ? 132.370 96.753  119.311 1.00 13.51  ? 58  TYR G CA    1 
ATOM   4787  C C     . TYR G 3  61  ? 131.522 97.884  119.830 1.00 15.83  ? 58  TYR G C     1 
ATOM   4788  O O     . TYR G 3  61  ? 131.977 98.695  120.635 1.00 17.41  ? 58  TYR G O     1 
ATOM   4789  C CB    . TYR G 3  61  ? 132.769 97.037  117.883 1.00 12.91  ? 58  TYR G CB    1 
ATOM   4790  C CG    . TYR G 3  61  ? 133.307 98.361  117.729 1.00 12.70  ? 58  TYR G CG    1 
ATOM   4791  C CD1   . TYR G 3  61  ? 134.554 98.619  118.136 1.00 13.49  ? 58  TYR G CD1   1 
ATOM   4792  C CD2   . TYR G 3  61  ? 132.540 99.341  117.173 1.00 17.90  ? 58  TYR G CD2   1 
ATOM   4793  C CE1   . TYR G 3  61  ? 135.048 99.869  118.009 1.00 14.53  ? 58  TYR G CE1   1 
ATOM   4794  C CE2   . TYR G 3  61  ? 133.030 100.582 117.043 1.00 15.75  ? 58  TYR G CE2   1 
ATOM   4795  C CZ    . TYR G 3  61  ? 134.272 100.847 117.465 1.00 13.68  ? 58  TYR G CZ    1 
ATOM   4796  O OH    . TYR G 3  61  ? 134.760 102.098 117.331 1.00 22.13  ? 58  TYR G OH    1 
ATOM   4797  N N     . LEU G 3  62  ? 130.283 97.967  119.383 1.00 14.76  ? 59  LEU G N     1 
ATOM   4798  C CA    . LEU G 3  62  ? 129.461 99.073  119.816 1.00 9.23   ? 59  LEU G CA    1 
ATOM   4799  C C     . LEU G 3  62  ? 129.165 99.012  121.303 1.00 15.53  ? 59  LEU G C     1 
ATOM   4800  O O     . LEU G 3  62  ? 129.131 100.048 121.972 1.00 19.74  ? 59  LEU G O     1 
ATOM   4801  C CB    . LEU G 3  62  ? 128.178 99.072  119.031 1.00 9.11   ? 59  LEU G CB    1 
ATOM   4802  C CG    . LEU G 3  62  ? 128.303 99.373  117.559 1.00 8.49   ? 59  LEU G CG    1 
ATOM   4803  C CD1   . LEU G 3  62  ? 127.002 99.101  116.928 1.00 6.98   ? 59  LEU G CD1   1 
ATOM   4804  C CD2   . LEU G 3  62  ? 128.706 100.812 117.318 1.00 10.12  ? 59  LEU G CD2   1 
ATOM   4805  N N     . THR G 3  63  ? 128.975 97.815  121.841 1.00 17.83  ? 60  THR G N     1 
ATOM   4806  C CA    . THR G 3  63  ? 128.714 97.658  123.254 1.00 10.55  ? 60  THR G CA    1 
ATOM   4807  C C     . THR G 3  63  ? 129.888 98.151  124.044 1.00 17.72  ? 60  THR G C     1 
ATOM   4808  O O     . THR G 3  63  ? 129.726 98.878  125.023 1.00 24.19  ? 60  THR G O     1 
ATOM   4809  C CB    . THR G 3  63  ? 128.476 96.188  123.601 1.00 15.39  ? 60  THR G CB    1 
ATOM   4810  O OG1   . THR G 3  63  ? 127.325 95.726  122.909 1.00 23.11  ? 60  THR G OG1   1 
ATOM   4811  C CG2   . THR G 3  63  ? 128.288 95.997  125.080 1.00 26.13  ? 60  THR G CG2   1 
ATOM   4812  N N     . ALA G 3  64  ? 131.086 97.773  123.631 1.00 18.01  ? 61  ALA G N     1 
ATOM   4813  C CA    . ALA G 3  64  ? 132.267 98.199  124.333 1.00 13.76  ? 61  ALA G CA    1 
ATOM   4814  C C     . ALA G 3  64  ? 132.432 99.677  124.293 1.00 20.55  ? 61  ALA G C     1 
ATOM   4815  O O     . ALA G 3  64  ? 132.849 100.269 125.284 1.00 26.70  ? 61  ALA G O     1 
ATOM   4816  C CB    . ALA G 3  64  ? 133.482 97.559  123.741 1.00 21.42  ? 61  ALA G CB    1 
ATOM   4817  N N     . GLU G 3  65  ? 132.078 100.300 123.185 1.00 22.32  ? 62  GLU G N     1 
ATOM   4818  C CA    . GLU G 3  65  ? 132.273 101.726 123.072 1.00 20.30  ? 62  GLU G CA    1 
ATOM   4819  C C     . GLU G 3  65  ? 131.376 102.494 124.026 1.00 22.80  ? 62  GLU G C     1 
ATOM   4820  O O     . GLU G 3  65  ? 131.823 103.410 124.723 1.00 27.12  ? 62  GLU G O     1 
ATOM   4821  C CB    . GLU G 3  65  ? 131.954 102.130 121.653 1.00 9.71   ? 62  GLU G CB    1 
ATOM   4822  C CG    . GLU G 3  65  ? 132.257 103.478 121.302 1.00 14.95  ? 62  GLU G CG    1 
ATOM   4823  C CD    . GLU G 3  65  ? 133.689 103.704 121.319 1.00 32.37  ? 62  GLU G CD    1 
ATOM   4824  O OE1   . GLU G 3  65  ? 134.421 102.756 121.348 1.00 27.00  ? 62  GLU G OE1   1 
ATOM   4825  O OE2   . GLU G 3  65  ? 134.089 104.834 121.282 1.00 43.09  ? 62  GLU G OE2   1 
ATOM   4826  N N     . ILE G 3  66  ? 130.128 102.086 124.141 1.00 21.63  ? 63  ILE G N     1 
ATOM   4827  C CA    . ILE G 3  66  ? 129.258 102.803 125.040 1.00 16.56  ? 63  ILE G CA    1 
ATOM   4828  C C     . ILE G 3  66  ? 129.683 102.613 126.454 1.00 21.46  ? 63  ILE G C     1 
ATOM   4829  O O     . ILE G 3  66  ? 129.680 103.566 127.229 1.00 26.38  ? 63  ILE G O     1 
ATOM   4830  C CB    . ILE G 3  66  ? 127.806 102.425 124.889 1.00 16.51  ? 63  ILE G CB    1 
ATOM   4831  C CG1   . ILE G 3  66  ? 127.359 102.898 123.568 1.00 18.75  ? 63  ILE G CG1   1 
ATOM   4832  C CG2   . ILE G 3  66  ? 126.987 103.054 126.018 1.00 24.55  ? 63  ILE G CG2   1 
ATOM   4833  C CD1   . ILE G 3  66  ? 126.066 102.373 123.133 1.00 23.67  ? 63  ILE G CD1   1 
ATOM   4834  N N     . LEU G 3  67  ? 130.014 101.397 126.831 1.00 23.35  ? 64  LEU G N     1 
ATOM   4835  C CA    . LEU G 3  67  ? 130.395 101.189 128.196 1.00 21.16  ? 64  LEU G CA    1 
ATOM   4836  C C     . LEU G 3  67  ? 131.651 101.930 128.536 1.00 25.21  ? 64  LEU G C     1 
ATOM   4837  O O     . LEU G 3  67  ? 131.773 102.436 129.649 1.00 34.74  ? 64  LEU G O     1 
ATOM   4838  C CB    . LEU G 3  67  ? 130.599 99.729  128.467 1.00 21.02  ? 64  LEU G CB    1 
ATOM   4839  C CG    . LEU G 3  67  ? 129.374 98.872  128.427 1.00 22.78  ? 64  LEU G CG    1 
ATOM   4840  C CD1   . LEU G 3  67  ? 129.827 97.471  128.506 1.00 30.19  ? 64  LEU G CD1   1 
ATOM   4841  C CD2   . LEU G 3  67  ? 128.429 99.191  129.567 1.00 30.76  ? 64  LEU G CD2   1 
ATOM   4842  N N     . GLU G 3  68  ? 132.610 102.027 127.631 1.00 24.69  ? 65  GLU G N     1 
ATOM   4843  C CA    . GLU G 3  68  ? 133.786 102.763 128.015 1.00 26.63  ? 65  GLU G CA    1 
ATOM   4844  C C     . GLU G 3  68  ? 133.463 104.204 128.306 1.00 29.43  ? 65  GLU G C     1 
ATOM   4845  O O     . GLU G 3  68  ? 133.928 104.756 129.312 1.00 39.66  ? 65  GLU G O     1 
ATOM   4846  C CB    . GLU G 3  68  ? 134.854 102.718 126.966 1.00 32.00  ? 65  GLU G CB    1 
ATOM   4847  C CG    . GLU G 3  68  ? 136.097 103.426 127.404 1.00 43.36  ? 65  GLU G CG    1 
ATOM   4848  C CD    . GLU G 3  68  ? 137.242 103.273 126.471 1.00 65.08  ? 65  GLU G CD    1 
ATOM   4849  O OE1   . GLU G 3  68  ? 137.112 102.602 125.488 1.00 52.08  ? 65  GLU G OE1   1 
ATOM   4850  O OE2   . GLU G 3  68  ? 138.266 103.840 126.744 1.00 73.53  ? 65  GLU G OE2   1 
ATOM   4851  N N     . LEU G 3  69  ? 132.646 104.824 127.466 1.00 28.35  ? 66  LEU G N     1 
ATOM   4852  C CA    . LEU G 3  69  ? 132.313 106.214 127.697 1.00 28.04  ? 66  LEU G CA    1 
ATOM   4853  C C     . LEU G 3  69  ? 131.474 106.396 128.953 1.00 29.07  ? 66  LEU G C     1 
ATOM   4854  O O     . LEU G 3  69  ? 131.665 107.362 129.699 1.00 35.66  ? 66  LEU G O     1 
ATOM   4855  C CB    . LEU G 3  69  ? 131.537 106.743 126.515 1.00 23.52  ? 66  LEU G CB    1 
ATOM   4856  C CG    . LEU G 3  69  ? 132.266 106.869 125.217 1.00 24.04  ? 66  LEU G CG    1 
ATOM   4857  C CD1   . LEU G 3  69  ? 131.259 107.180 124.159 1.00 26.07  ? 66  LEU G CD1   1 
ATOM   4858  C CD2   . LEU G 3  69  ? 133.289 107.948 125.283 1.00 34.56  ? 66  LEU G CD2   1 
ATOM   4859  N N     . ALA G 3  70  ? 130.544 105.483 129.209 1.00 24.86  ? 67  ALA G N     1 
ATOM   4860  C CA    . ALA G 3  70  ? 129.731 105.595 130.395 1.00 20.59  ? 67  ALA G CA    1 
ATOM   4861  C C     . ALA G 3  70  ? 130.570 105.420 131.625 1.00 24.47  ? 67  ALA G C     1 
ATOM   4862  O O     . ALA G 3  70  ? 130.335 106.086 132.629 1.00 36.86  ? 67  ALA G O     1 
ATOM   4863  C CB    . ALA G 3  70  ? 128.624 104.603 130.357 1.00 29.76  ? 67  ALA G CB    1 
ATOM   4864  N N     . GLY G 3  71  ? 131.554 104.542 131.575 1.00 25.84  ? 68  GLY G N     1 
ATOM   4865  C CA    . GLY G 3  71  ? 132.422 104.349 132.712 1.00 29.71  ? 68  GLY G CA    1 
ATOM   4866  C C     . GLY G 3  71  ? 133.206 105.615 133.004 1.00 35.85  ? 68  GLY G C     1 
ATOM   4867  O O     . GLY G 3  71  ? 133.398 105.971 134.173 1.00 48.68  ? 68  GLY G O     1 
ATOM   4868  N N     . ASN G 3  72  ? 133.635 106.333 131.962 1.00 35.19  ? 69  ASN G N     1 
ATOM   4869  C CA    . ASN G 3  72  ? 134.352 107.563 132.224 1.00 37.64  ? 69  ASN G CA    1 
ATOM   4870  C C     . ASN G 3  72  ? 133.430 108.575 132.854 1.00 42.36  ? 69  ASN G C     1 
ATOM   4871  O O     . ASN G 3  72  ? 133.833 109.292 133.771 1.00 51.52  ? 69  ASN G O     1 
ATOM   4872  C CB    . ASN G 3  72  ? 134.951 108.134 130.971 1.00 38.59  ? 69  ASN G CB    1 
ATOM   4873  C CG    . ASN G 3  72  ? 136.141 107.405 130.529 1.00 52.09  ? 69  ASN G CG    1 
ATOM   4874  O OD1   . ASN G 3  72  ? 136.791 106.720 131.319 1.00 66.13  ? 69  ASN G OD1   1 
ATOM   4875  N ND2   . ASN G 3  72  ? 136.477 107.529 129.277 1.00 51.83  ? 69  ASN G ND2   1 
ATOM   4876  N N     . ALA G 3  73  ? 132.176 108.610 132.415 1.00 35.57  ? 70  ALA G N     1 
ATOM   4877  C CA    . ALA G 3  73  ? 131.253 109.542 133.018 1.00 35.57  ? 70  ALA G CA    1 
ATOM   4878  C C     . ALA G 3  73  ? 131.064 109.212 134.486 1.00 42.46  ? 70  ALA G C     1 
ATOM   4879  O O     . ALA G 3  73  ? 130.985 110.116 135.322 1.00 54.39  ? 70  ALA G O     1 
ATOM   4880  C CB    . ALA G 3  73  ? 129.924 109.511 132.301 1.00 29.44  ? 70  ALA G CB    1 
ATOM   4881  N N     . ALA G 3  74  ? 131.012 107.924 134.817 1.00 38.70  ? 71  ALA G N     1 
ATOM   4882  C CA    . ALA G 3  74  ? 130.831 107.564 136.198 1.00 42.21  ? 71  ALA G CA    1 
ATOM   4883  C C     . ALA G 3  74  ? 131.976 108.044 137.032 1.00 52.81  ? 71  ALA G C     1 
ATOM   4884  O O     . ALA G 3  74  ? 131.732 108.621 138.090 1.00 64.06  ? 71  ALA G O     1 
ATOM   4885  C CB    . ALA G 3  74  ? 130.673 106.073 136.350 1.00 44.24  ? 71  ALA G CB    1 
ATOM   4886  N N     . ARG G 3  75  ? 133.204 107.942 136.536 1.00 50.03  ? 72  ARG G N     1 
ATOM   4887  C CA    . ARG G 3  75  ? 134.320 108.423 137.332 1.00 54.05  ? 72  ARG G CA    1 
ATOM   4888  C C     . ARG G 3  75  ? 134.315 109.936 137.455 1.00 60.63  ? 72  ARG G C     1 
ATOM   4889  O O     . ARG G 3  75  ? 134.609 110.467 138.522 1.00 66.25  ? 72  ARG G O     1 
ATOM   4890  C CB    . ARG G 3  75  ? 135.639 107.958 136.790 1.00 60.67  ? 72  ARG G CB    1 
ATOM   4891  C CG    . ARG G 3  75  ? 135.902 106.460 136.981 1.00 67.47  ? 72  ARG G CG    1 
ATOM   4892  C CD    . ARG G 3  75  ? 137.193 106.027 136.350 1.00 82.12  ? 72  ARG G CD    1 
ATOM   4893  N NE    . ARG G 3  75  ? 137.439 104.563 136.468 1.00 78.98  ? 72  ARG G NE    1 
ATOM   4894  C CZ    . ARG G 3  75  ? 138.383 103.889 135.756 1.00 79.07  ? 72  ARG G CZ    1 
ATOM   4895  N NH1   . ARG G 3  75  ? 139.142 104.547 134.911 1.00 85.24  ? 72  ARG G NH1   1 
ATOM   4896  N NH2   . ARG G 3  75  ? 138.563 102.580 135.881 1.00 68.78  ? 72  ARG G NH2   1 
ATOM   4897  N N     . ASP G 3  76  ? 133.902 110.658 136.416 1.00 59.78  ? 73  ASP G N     1 
ATOM   4898  C CA    . ASP G 3  76  ? 133.866 112.119 136.506 1.00 59.60  ? 73  ASP G CA    1 
ATOM   4899  C C     . ASP G 3  76  ? 132.887 112.577 137.576 1.00 64.45  ? 73  ASP G C     1 
ATOM   4900  O O     . ASP G 3  76  ? 133.102 113.591 138.241 1.00 68.90  ? 73  ASP G O     1 
ATOM   4901  C CB    . ASP G 3  76  ? 133.476 112.766 135.185 1.00 58.55  ? 73  ASP G CB    1 
ATOM   4902  C CG    . ASP G 3  76  ? 134.561 112.733 134.119 1.00 61.23  ? 73  ASP G CG    1 
ATOM   4903  O OD1   . ASP G 3  76  ? 135.695 112.436 134.419 1.00 63.54  ? 73  ASP G OD1   1 
ATOM   4904  O OD2   . ASP G 3  76  ? 134.242 113.046 132.998 1.00 65.11  ? 73  ASP G OD2   1 
ATOM   4905  N N     . ASN G 3  77  ? 131.838 111.791 137.798 1.00 63.94  ? 74  ASN G N     1 
ATOM   4906  C CA    . ASN G 3  77  ? 130.843 112.096 138.808 1.00 64.09  ? 74  ASN G CA    1 
ATOM   4907  C C     . ASN G 3  77  ? 131.177 111.430 140.132 1.00 70.16  ? 74  ASN G C     1 
ATOM   4908  O O     . ASN G 3  77  ? 130.366 111.447 141.058 1.00 83.45  ? 74  ASN G O     1 
ATOM   4909  C CB    . ASN G 3  77  ? 129.466 111.693 138.346 1.00 64.96  ? 74  ASN G CB    1 
ATOM   4910  C CG    . ASN G 3  77  ? 128.956 112.585 137.264 1.00 65.65  ? 74  ASN G CG    1 
ATOM   4911  O OD1   . ASN G 3  77  ? 129.217 113.790 137.266 1.00 81.31  ? 74  ASN G OD1   1 
ATOM   4912  N ND2   . ASN G 3  77  ? 128.225 112.038 136.334 1.00 62.15  ? 74  ASN G ND2   1 
ATOM   4913  N N     . LYS G 3  78  ? 132.387 110.885 140.214 1.00 69.59  ? 75  LYS G N     1 
ATOM   4914  C CA    . LYS G 3  78  ? 132.966 110.219 141.355 1.00 75.81  ? 75  LYS G CA    1 
ATOM   4915  C C     . LYS G 3  78  ? 132.225 109.004 141.844 1.00 79.36  ? 75  LYS G C     1 
ATOM   4916  O O     . LYS G 3  78  ? 132.108 108.794 143.050 1.00 85.20  ? 75  LYS G O     1 
ATOM   4917  C CB    . LYS G 3  78  ? 133.096 111.211 142.482 1.00 88.23  ? 75  LYS G CB    1 
ATOM   4918  C CG    . LYS G 3  78  ? 133.918 112.408 142.109 1.00 94.46  ? 75  LYS G CG    1 
ATOM   4919  C CD    . LYS G 3  78  ? 134.129 113.325 143.292 1.00 116.35 ? 75  LYS G CD    1 
ATOM   4920  C CE    . LYS G 3  78  ? 134.893 114.580 142.897 1.00 165.10 ? 75  LYS G CE    1 
ATOM   4921  N NZ    . LYS G 3  78  ? 135.097 115.481 144.060 1.00 196.86 ? 75  LYS G NZ    1 
ATOM   4922  N N     . LYS G 3  79  ? 131.761 108.186 140.918 1.00 76.42  ? 76  LYS G N     1 
ATOM   4923  C CA    . LYS G 3  79  ? 131.059 106.968 141.233 1.00 82.39  ? 76  LYS G CA    1 
ATOM   4924  C C     . LYS G 3  79  ? 131.774 105.734 140.705 1.00 85.19  ? 76  LYS G C     1 
ATOM   4925  O O     . LYS G 3  79  ? 132.618 105.815 139.816 1.00 83.91  ? 76  LYS G O     1 
ATOM   4926  C CB    . LYS G 3  79  ? 129.653 107.075 140.732 1.00 80.70  ? 76  LYS G CB    1 
ATOM   4927  C CG    . LYS G 3  79  ? 128.901 108.163 141.443 1.00 94.33  ? 76  LYS G CG    1 
ATOM   4928  C CD    . LYS G 3  79  ? 127.454 108.230 141.017 1.00 100.16 ? 76  LYS G CD    1 
ATOM   4929  C CE    . LYS G 3  79  ? 126.694 109.398 141.687 1.00 135.05 ? 76  LYS G CE    1 
ATOM   4930  N NZ    . LYS G 3  79  ? 126.453 109.161 143.128 1.00 162.75 ? 76  LYS G NZ    1 
ATOM   4931  N N     . THR G 3  80  ? 131.422 104.587 141.274 1.00 92.96  ? 77  THR G N     1 
ATOM   4932  C CA    . THR G 3  80  ? 131.985 103.271 140.965 1.00 91.13  ? 77  THR G CA    1 
ATOM   4933  C C     . THR G 3  80  ? 131.064 102.453 140.072 1.00 74.30  ? 77  THR G C     1 
ATOM   4934  O O     . THR G 3  80  ? 131.369 101.318 139.703 1.00 74.15  ? 77  THR G O     1 
ATOM   4935  C CB    . THR G 3  80  ? 132.322 102.550 142.294 1.00 105.37 ? 77  THR G CB    1 
ATOM   4936  O OG1   . THR G 3  80  ? 133.306 103.332 142.974 1.00 122.38 ? 77  THR G OG1   1 
ATOM   4937  C CG2   . THR G 3  80  ? 132.870 101.130 142.126 1.00 107.04 ? 77  THR G CG2   1 
ATOM   4938  N N     . ARG G 3  81  ? 129.885 102.973 139.839 1.00 72.21  ? 78  ARG G N     1 
ATOM   4939  C CA    . ARG G 3  81  ? 128.879 102.257 139.104 1.00 61.98  ? 78  ARG G CA    1 
ATOM   4940  C C     . ARG G 3  81  ? 128.188 103.058 138.017 1.00 48.68  ? 78  ARG G C     1 
ATOM   4941  O O     . ARG G 3  81  ? 127.934 104.246 138.186 1.00 54.37  ? 78  ARG G O     1 
ATOM   4942  C CB    . ARG G 3  81  ? 127.890 101.803 140.099 1.00 73.53  ? 78  ARG G CB    1 
ATOM   4943  C CG    . ARG G 3  81  ? 126.795 101.106 139.586 1.00 75.38  ? 78  ARG G CG    1 
ATOM   4944  C CD    . ARG G 3  81  ? 125.945 100.675 140.635 1.00 91.72  ? 78  ARG G CD    1 
ATOM   4945  N NE    . ARG G 3  81  ? 126.539 99.675  141.419 1.00 127.90 ? 78  ARG G NE    1 
ATOM   4946  C CZ    . ARG G 3  81  ? 125.999 99.196  142.513 1.00 155.38 ? 78  ARG G CZ    1 
ATOM   4947  N NH1   . ARG G 3  81  ? 124.846 99.656  142.925 1.00 172.35 ? 78  ARG G NH1   1 
ATOM   4948  N NH2   . ARG G 3  81  ? 126.616 98.257  143.186 1.00 196.90 ? 78  ARG G NH2   1 
ATOM   4949  N N     . ILE G 3  82  ? 127.840 102.380 136.932 1.00 44.66  ? 79  ILE G N     1 
ATOM   4950  C CA    . ILE G 3  82  ? 127.071 102.952 135.844 1.00 37.16  ? 79  ILE G CA    1 
ATOM   4951  C C     . ILE G 3  82  ? 125.574 102.858 136.101 1.00 42.52  ? 79  ILE G C     1 
ATOM   4952  O O     . ILE G 3  82  ? 125.049 101.785 136.405 1.00 50.87  ? 79  ILE G O     1 
ATOM   4953  C CB    . ILE G 3  82  ? 127.431 102.251 134.522 1.00 35.31  ? 79  ILE G CB    1 
ATOM   4954  C CG1   . ILE G 3  82  ? 128.898 102.529 134.206 1.00 36.93  ? 79  ILE G CG1   1 
ATOM   4955  C CG2   . ILE G 3  82  ? 126.497 102.671 133.384 1.00 42.81  ? 79  ILE G CG2   1 
ATOM   4956  C CD1   . ILE G 3  82  ? 129.475 101.700 133.080 1.00 43.92  ? 79  ILE G CD1   1 
ATOM   4957  N N     . ILE G 3  83  ? 124.879 103.983 135.973 1.00 43.62  ? 80  ILE G N     1 
ATOM   4958  C CA    . ILE G 3  83  ? 123.427 104.019 136.124 1.00 38.58  ? 80  ILE G CA    1 
ATOM   4959  C C     . ILE G 3  83  ? 122.904 104.613 134.805 1.00 35.28  ? 80  ILE G C     1 
ATOM   4960  O O     . ILE G 3  83  ? 123.704 105.218 134.089 1.00 37.03  ? 80  ILE G O     1 
ATOM   4961  C CB    . ILE G 3  83  ? 122.997 104.815 137.381 1.00 42.04  ? 80  ILE G CB    1 
ATOM   4962  C CG1   . ILE G 3  83  ? 123.372 106.254 137.272 1.00 45.39  ? 80  ILE G CG1   1 
ATOM   4963  C CG2   . ILE G 3  83  ? 123.720 104.183 138.572 1.00 56.93  ? 80  ILE G CG2   1 
ATOM   4964  C CD1   . ILE G 3  83  ? 122.747 107.154 138.280 1.00 49.98  ? 80  ILE G CD1   1 
ATOM   4965  N N     . PRO G 3  84  ? 121.600 104.561 134.476 1.00 30.28  ? 81  PRO G N     1 
ATOM   4966  C CA    . PRO G 3  84  ? 121.019 105.083 133.254 1.00 24.11  ? 81  PRO G CA    1 
ATOM   4967  C C     . PRO G 3  84  ? 121.437 106.487 132.930 1.00 29.81  ? 81  PRO G C     1 
ATOM   4968  O O     . PRO G 3  84  ? 121.608 106.833 131.762 1.00 33.64  ? 81  PRO G O     1 
ATOM   4969  C CB    . PRO G 3  84  ? 119.549 105.028 133.563 1.00 21.84  ? 81  PRO G CB    1 
ATOM   4970  C CG    . PRO G 3  84  ? 119.430 103.884 134.476 1.00 32.40  ? 81  PRO G CG    1 
ATOM   4971  C CD    . PRO G 3  84  ? 120.623 103.960 135.350 1.00 36.29  ? 81  PRO G CD    1 
ATOM   4972  N N     . ARG G 3  85  ? 121.671 107.302 133.928 1.00 32.67  ? 82  ARG G N     1 
ATOM   4973  C CA    . ARG G 3  85  ? 122.098 108.630 133.623 1.00 28.88  ? 82  ARG G CA    1 
ATOM   4974  C C     . ARG G 3  85  ? 123.453 108.669 132.953 1.00 33.26  ? 82  ARG G C     1 
ATOM   4975  O O     . ARG G 3  85  ? 123.712 109.529 132.116 1.00 36.42  ? 82  ARG G O     1 
ATOM   4976  C CB    . ARG G 3  85  ? 122.184 109.456 134.856 1.00 33.75  ? 82  ARG G CB    1 
ATOM   4977  C CG    . ARG G 3  85  ? 122.671 110.815 134.657 1.00 35.12  ? 82  ARG G CG    1 
ATOM   4978  C CD    . ARG G 3  85  ? 121.796 111.542 133.806 1.00 35.03  ? 82  ARG G CD    1 
ATOM   4979  N NE    . ARG G 3  85  ? 122.219 112.832 133.558 1.00 39.71  ? 82  ARG G NE    1 
ATOM   4980  C CZ    . ARG G 3  85  ? 122.044 113.830 134.352 1.00 39.59  ? 82  ARG G CZ    1 
ATOM   4981  N NH1   . ARG G 3  85  ? 121.480 113.637 135.488 1.00 37.84  ? 82  ARG G NH1   1 
ATOM   4982  N NH2   . ARG G 3  85  ? 122.443 115.015 133.997 1.00 38.29  ? 82  ARG G NH2   1 
ATOM   4983  N N     . HIS G 3  86  ? 124.355 107.774 133.304 1.00 32.88  ? 83  HIS G N     1 
ATOM   4984  C CA    . HIS G 3  86  ? 125.662 107.880 132.732 1.00 26.79  ? 83  HIS G CA    1 
ATOM   4985  C C     . HIS G 3  86  ? 125.588 107.425 131.322 1.00 32.29  ? 83  HIS G C     1 
ATOM   4986  O O     . HIS G 3  86  ? 126.319 107.921 130.468 1.00 34.49  ? 83  HIS G O     1 
ATOM   4987  C CB    . HIS G 3  86  ? 126.654 107.023 133.436 1.00 28.91  ? 83  HIS G CB    1 
ATOM   4988  C CG    . HIS G 3  86  ? 126.875 107.396 134.767 1.00 34.59  ? 83  HIS G CG    1 
ATOM   4989  N ND1   . HIS G 3  86  ? 126.485 106.616 135.792 1.00 42.78  ? 83  HIS G ND1   1 
ATOM   4990  C CD2   . HIS G 3  86  ? 127.447 108.473 135.308 1.00 38.86  ? 83  HIS G CD2   1 
ATOM   4991  C CE1   . HIS G 3  86  ? 126.821 107.194 136.928 1.00 43.88  ? 83  HIS G CE1   1 
ATOM   4992  N NE2   . HIS G 3  86  ? 127.399 108.313 136.662 1.00 46.69  ? 83  HIS G NE2   1 
ATOM   4993  N N     . LEU G 3  87  ? 124.692 106.492 131.047 1.00 33.92  ? 84  LEU G N     1 
ATOM   4994  C CA    . LEU G 3  87  ? 124.586 106.041 129.678 1.00 28.91  ? 84  LEU G CA    1 
ATOM   4995  C C     . LEU G 3  87  ? 124.090 107.208 128.836 1.00 31.15  ? 84  LEU G C     1 
ATOM   4996  O O     . LEU G 3  87  ? 124.604 107.437 127.745 1.00 34.77  ? 84  LEU G O     1 
ATOM   4997  C CB    . LEU G 3  87  ? 123.634 104.853 129.562 1.00 27.02  ? 84  LEU G CB    1 
ATOM   4998  C CG    . LEU G 3  87  ? 124.088 103.534 130.234 1.00 26.92  ? 84  LEU G CG    1 
ATOM   4999  C CD1   . LEU G 3  87  ? 122.966 102.561 130.197 1.00 31.20  ? 84  LEU G CD1   1 
ATOM   5000  C CD2   . LEU G 3  87  ? 125.257 102.944 129.537 1.00 30.29  ? 84  LEU G CD2   1 
ATOM   5001  N N     . GLN G 3  88  ? 123.154 108.005 129.359 1.00 30.50  ? 85  GLN G N     1 
ATOM   5002  C CA    . GLN G 3  88  ? 122.667 109.158 128.605 1.00 25.78  ? 85  GLN G CA    1 
ATOM   5003  C C     . GLN G 3  88  ? 123.730 110.195 128.377 1.00 25.85  ? 85  GLN G C     1 
ATOM   5004  O O     . GLN G 3  88  ? 123.804 110.796 127.308 1.00 31.64  ? 85  GLN G O     1 
ATOM   5005  C CB    . GLN G 3  88  ? 121.576 109.855 129.378 1.00 29.56  ? 85  GLN G CB    1 
ATOM   5006  C CG    . GLN G 3  88  ? 120.901 111.052 128.766 1.00 27.22  ? 85  GLN G CG    1 
ATOM   5007  C CD    . GLN G 3  88  ? 120.090 110.784 127.649 1.00 31.61  ? 85  GLN G CD    1 
ATOM   5008  O OE1   . GLN G 3  88  ? 120.454 110.068 126.744 1.00 36.55  ? 85  GLN G OE1   1 
ATOM   5009  N NE2   . GLN G 3  88  ? 118.899 111.348 127.659 1.00 34.63  ? 85  GLN G NE2   1 
ATOM   5010  N N     . LEU G 3  89  ? 124.576 110.428 129.357 1.00 29.33  ? 86  LEU G N     1 
ATOM   5011  C CA    . LEU G 3  89  ? 125.590 111.429 129.142 1.00 27.60  ? 86  LEU G CA    1 
ATOM   5012  C C     . LEU G 3  89  ? 126.607 110.925 128.145 1.00 29.37  ? 86  LEU G C     1 
ATOM   5013  O O     . LEU G 3  89  ? 127.057 111.658 127.265 1.00 34.89  ? 86  LEU G O     1 
ATOM   5014  C CB    . LEU G 3  89  ? 126.303 111.744 130.446 1.00 30.67  ? 86  LEU G CB    1 
ATOM   5015  C CG    . LEU G 3  89  ? 125.469 112.407 131.549 1.00 34.15  ? 86  LEU G CG    1 
ATOM   5016  C CD1   . LEU G 3  89  ? 126.299 112.482 132.811 1.00 42.49  ? 86  LEU G CD1   1 
ATOM   5017  C CD2   . LEU G 3  89  ? 125.003 113.760 131.132 1.00 35.46  ? 86  LEU G CD2   1 
ATOM   5018  N N     . ALA G 3  90  ? 126.944 109.646 128.224 1.00 31.47  ? 87  ALA G N     1 
ATOM   5019  C CA    . ALA G 3  90  ? 127.927 109.092 127.322 1.00 28.37  ? 87  ALA G CA    1 
ATOM   5020  C C     . ALA G 3  90  ? 127.499 109.209 125.887 1.00 23.93  ? 87  ALA G C     1 
ATOM   5021  O O     . ALA G 3  90  ? 128.292 109.566 125.024 1.00 27.71  ? 87  ALA G O     1 
ATOM   5022  C CB    . ALA G 3  90  ? 128.135 107.641 127.645 1.00 38.59  ? 87  ALA G CB    1 
ATOM   5023  N N     . ILE G 3  91  ? 126.226 109.007 125.644 1.00 22.78  ? 88  ILE G N     1 
ATOM   5024  C CA    . ILE G 3  91  ? 125.704 109.099 124.315 1.00 16.60  ? 88  ILE G CA    1 
ATOM   5025  C C     . ILE G 3  91  ? 125.566 110.520 123.854 1.00 22.07  ? 88  ILE G C     1 
ATOM   5026  O O     . ILE G 3  91  ? 125.952 110.858 122.748 1.00 28.91  ? 88  ILE G O     1 
ATOM   5027  C CB    . ILE G 3  91  ? 124.355 108.424 124.254 1.00 14.46  ? 88  ILE G CB    1 
ATOM   5028  C CG1   . ILE G 3  91  ? 124.555 106.956 124.504 1.00 28.25  ? 88  ILE G CG1   1 
ATOM   5029  C CG2   . ILE G 3  91  ? 123.718 108.678 122.877 1.00 20.02  ? 88  ILE G CG2   1 
ATOM   5030  C CD1   . ILE G 3  91  ? 123.304 106.223 124.824 1.00 31.31  ? 88  ILE G CD1   1 
ATOM   5031  N N     . ARG G 3  92  ? 124.999 111.383 124.660 1.00 24.10  ? 89  ARG G N     1 
ATOM   5032  C CA    . ARG G 3  92  ? 124.753 112.715 124.164 1.00 21.87  ? 89  ARG G CA    1 
ATOM   5033  C C     . ARG G 3  92  ? 125.981 113.577 124.012 1.00 25.91  ? 89  ARG G C     1 
ATOM   5034  O O     . ARG G 3  92  ? 125.986 114.501 123.205 1.00 29.43  ? 89  ARG G O     1 
ATOM   5035  C CB    . ARG G 3  92  ? 123.753 113.382 125.022 1.00 24.23  ? 89  ARG G CB    1 
ATOM   5036  C CG    . ARG G 3  92  ? 122.410 112.727 125.030 1.00 28.54  ? 89  ARG G CG    1 
ATOM   5037  C CD    . ARG G 3  92  ? 121.706 112.828 123.774 1.00 30.51  ? 89  ARG G CD    1 
ATOM   5038  N NE    . ARG G 3  92  ? 120.331 112.376 123.895 1.00 38.19  ? 89  ARG G NE    1 
ATOM   5039  C CZ    . ARG G 3  92  ? 119.828 111.168 123.542 1.00 36.97  ? 89  ARG G CZ    1 
ATOM   5040  N NH1   . ARG G 3  92  ? 120.552 110.248 123.001 1.00 29.32  ? 89  ARG G NH1   1 
ATOM   5041  N NH2   . ARG G 3  92  ? 118.549 110.940 123.760 1.00 41.73  ? 89  ARG G NH2   1 
ATOM   5042  N N     . ASN G 3  93  ? 127.050 113.265 124.713 1.00 26.62  ? 90  ASN G N     1 
ATOM   5043  C CA    . ASN G 3  93  ? 128.254 114.053 124.586 1.00 26.58  ? 90  ASN G CA    1 
ATOM   5044  C C     . ASN G 3  93  ? 129.197 113.498 123.518 1.00 31.06  ? 90  ASN G C     1 
ATOM   5045  O O     . ASN G 3  93  ? 130.343 113.937 123.420 1.00 40.25  ? 90  ASN G O     1 
ATOM   5046  C CB    . ASN G 3  93  ? 128.966 114.156 125.903 1.00 27.14  ? 90  ASN G CB    1 
ATOM   5047  C CG    . ASN G 3  93  ? 128.252 115.004 126.876 1.00 37.09  ? 90  ASN G CG    1 
ATOM   5048  O OD1   . ASN G 3  93  ? 127.601 115.991 126.528 1.00 46.81  ? 90  ASN G OD1   1 
ATOM   5049  N ND2   . ASN G 3  93  ? 128.373 114.656 128.121 1.00 40.19  ? 90  ASN G ND2   1 
ATOM   5050  N N     . ASP G 3  94  ? 128.728 112.541 122.714 1.00 30.17  ? 91  ASP G N     1 
ATOM   5051  C CA    . ASP G 3  94  ? 129.512 111.925 121.648 1.00 27.64  ? 91  ASP G CA    1 
ATOM   5052  C C     . ASP G 3  94  ? 128.705 111.971 120.359 1.00 27.48  ? 91  ASP G C     1 
ATOM   5053  O O     . ASP G 3  94  ? 127.638 111.373 120.263 1.00 30.10  ? 91  ASP G O     1 
ATOM   5054  C CB    . ASP G 3  94  ? 129.855 110.498 122.036 1.00 25.86  ? 91  ASP G CB    1 
ATOM   5055  C CG    . ASP G 3  94  ? 130.675 109.796 121.025 1.00 35.20  ? 91  ASP G CG    1 
ATOM   5056  O OD1   . ASP G 3  94  ? 131.876 109.767 121.171 1.00 48.78  ? 91  ASP G OD1   1 
ATOM   5057  O OD2   . ASP G 3  94  ? 130.100 109.262 120.076 1.00 32.49  ? 91  ASP G OD2   1 
ATOM   5058  N N     . GLU G 3  95  ? 129.179 112.703 119.368 1.00 28.96  ? 92  GLU G N     1 
ATOM   5059  C CA    . GLU G 3  95  ? 128.371 112.926 118.180 1.00 28.90  ? 92  GLU G CA    1 
ATOM   5060  C C     . GLU G 3  95  ? 128.009 111.703 117.400 1.00 32.03  ? 92  GLU G C     1 
ATOM   5061  O O     . GLU G 3  95  ? 126.907 111.606 116.862 1.00 34.44  ? 92  GLU G O     1 
ATOM   5062  C CB    . GLU G 3  95  ? 129.098 113.836 117.222 1.00 35.52  ? 92  GLU G CB    1 
ATOM   5063  C CG    . GLU G 3  95  ? 129.278 115.216 117.704 1.00 47.72  ? 92  GLU G CG    1 
ATOM   5064  C CD    . GLU G 3  95  ? 130.411 115.344 118.644 1.00 66.32  ? 92  GLU G CD    1 
ATOM   5065  O OE1   . GLU G 3  95  ? 131.073 114.355 118.889 1.00 48.55  ? 92  GLU G OE1   1 
ATOM   5066  O OE2   . GLU G 3  95  ? 130.633 116.422 119.128 1.00 63.89  ? 92  GLU G OE2   1 
ATOM   5067  N N     . GLU G 3  96  ? 128.923 110.783 117.275 1.00 26.94  ? 93  GLU G N     1 
ATOM   5068  C CA    . GLU G 3  96  ? 128.611 109.640 116.471 1.00 20.77  ? 93  GLU G CA    1 
ATOM   5069  C C     . GLU G 3  96  ? 127.590 108.757 117.143 1.00 19.36  ? 93  GLU G C     1 
ATOM   5070  O O     . GLU G 3  96  ? 126.648 108.287 116.490 1.00 22.35  ? 93  GLU G O     1 
ATOM   5071  C CB    . GLU G 3  96  ? 129.887 108.957 116.151 1.00 21.92  ? 93  GLU G CB    1 
ATOM   5072  C CG    . GLU G 3  96  ? 130.708 109.808 115.226 1.00 27.06  ? 93  GLU G CG    1 
ATOM   5073  C CD    . GLU G 3  96  ? 132.048 109.291 114.996 0.00 43.44  ? 93  GLU G CD    1 
ATOM   5074  O OE1   . GLU G 3  96  ? 132.567 108.675 115.885 0.00 43.16  ? 93  GLU G OE1   1 
ATOM   5075  O OE2   . GLU G 3  96  ? 132.563 109.470 113.905 0.00 38.43  ? 93  GLU G OE2   1 
ATOM   5076  N N     . LEU G 3  97  ? 127.704 108.571 118.456 1.00 18.97  ? 94  LEU G N     1 
ATOM   5077  C CA    . LEU G 3  97  ? 126.680 107.783 119.084 1.00 14.05  ? 94  LEU G CA    1 
ATOM   5078  C C     . LEU G 3  97  ? 125.392 108.547 119.098 1.00 16.27  ? 94  LEU G C     1 
ATOM   5079  O O     . LEU G 3  97  ? 124.337 107.967 118.861 1.00 23.86  ? 94  LEU G O     1 
ATOM   5080  C CB    . LEU G 3  97  ? 127.035 107.403 120.493 1.00 9.22   ? 94  LEU G CB    1 
ATOM   5081  C CG    . LEU G 3  97  ? 128.136 106.418 120.680 1.00 9.15   ? 94  LEU G CG    1 
ATOM   5082  C CD1   . LEU G 3  97  ? 128.433 106.362 122.130 1.00 24.04  ? 94  LEU G CD1   1 
ATOM   5083  C CD2   . LEU G 3  97  ? 127.721 105.031 120.182 1.00 21.99  ? 94  LEU G CD2   1 
ATOM   5084  N N     . ASN G 3  98  ? 125.448 109.855 119.297 1.00 17.37  ? 95  ASN G N     1 
ATOM   5085  C CA    . ASN G 3  98  ? 124.232 110.610 119.331 1.00 17.08  ? 95  ASN G CA    1 
ATOM   5086  C C     . ASN G 3  98  ? 123.469 110.472 118.045 1.00 20.53  ? 95  ASN G C     1 
ATOM   5087  O O     . ASN G 3  98  ? 122.258 110.364 118.069 1.00 27.43  ? 95  ASN G O     1 
ATOM   5088  C CB    . ASN G 3  98  ? 124.494 112.052 119.607 1.00 19.94  ? 95  ASN G CB    1 
ATOM   5089  C CG    . ASN G 3  98  ? 123.257 112.796 119.729 1.00 24.20  ? 95  ASN G CG    1 
ATOM   5090  O OD1   . ASN G 3  98  ? 122.448 112.539 120.606 1.00 30.81  ? 95  ASN G OD1   1 
ATOM   5091  N ND2   . ASN G 3  98  ? 123.057 113.726 118.851 1.00 35.70  ? 95  ASN G ND2   1 
ATOM   5092  N N     . LYS G 3  99  ? 124.139 110.436 116.908 1.00 20.54  ? 96  LYS G N     1 
ATOM   5093  C CA    . LYS G 3  99  ? 123.384 110.258 115.688 1.00 20.38  ? 96  LYS G CA    1 
ATOM   5094  C C     . LYS G 3  99  ? 122.742 108.889 115.617 1.00 23.49  ? 96  LYS G C     1 
ATOM   5095  O O     . LYS G 3  99  ? 121.551 108.754 115.336 1.00 31.47  ? 96  LYS G O     1 
ATOM   5096  C CB    . LYS G 3  99  ? 124.280 110.401 114.502 1.00 22.29  ? 96  LYS G CB    1 
ATOM   5097  C CG    . LYS G 3  99  ? 124.746 111.755 114.240 1.00 27.99  ? 96  LYS G CG    1 
ATOM   5098  C CD    . LYS G 3  99  ? 125.695 111.783 113.044 1.00 34.15  ? 96  LYS G CD    1 
ATOM   5099  C CE    . LYS G 3  99  ? 126.231 113.184 112.772 1.00 46.30  ? 96  LYS G CE    1 
ATOM   5100  N NZ    . LYS G 3  99  ? 127.183 113.223 111.626 1.00 27.19  ? 96  LYS G NZ    1 
ATOM   5101  N N     . LEU G 3  100 ? 123.489 107.866 115.997 1.00 21.34  ? 97  LEU G N     1 
ATOM   5102  C CA    . LEU G 3  100 ? 123.007 106.499 115.927 1.00 19.31  ? 97  LEU G CA    1 
ATOM   5103  C C     . LEU G 3  100 ? 121.779 106.301 116.808 1.00 22.23  ? 97  LEU G C     1 
ATOM   5104  O O     . LEU G 3  100 ? 120.845 105.560 116.467 1.00 28.13  ? 97  LEU G O     1 
ATOM   5105  C CB    . LEU G 3  100 ? 124.153 105.577 116.362 1.00 17.00  ? 97  LEU G CB    1 
ATOM   5106  C CG    . LEU G 3  100 ? 123.946 104.084 116.340 1.00 15.16  ? 97  LEU G CG    1 
ATOM   5107  C CD1   . LEU G 3  100 ? 123.637 103.624 114.955 1.00 18.26  ? 97  LEU G CD1   1 
ATOM   5108  C CD2   . LEU G 3  100 ? 125.213 103.425 116.863 1.00 16.61  ? 97  LEU G CD2   1 
ATOM   5109  N N     . LEU G 3  101 ? 121.802 106.945 117.963 1.00 22.37  ? 98  LEU G N     1 
ATOM   5110  C CA    . LEU G 3  101 ? 120.769 106.884 118.969 1.00 19.96  ? 98  LEU G CA    1 
ATOM   5111  C C     . LEU G 3  101 ? 119.992 108.188 119.107 1.00 21.37  ? 98  LEU G C     1 
ATOM   5112  O O     . LEU G 3  101 ? 119.411 108.474 120.153 1.00 24.68  ? 98  LEU G O     1 
ATOM   5113  C CB    . LEU G 3  101 ? 121.431 106.498 120.270 1.00 15.63  ? 98  LEU G CB    1 
ATOM   5114  C CG    . LEU G 3  101 ? 122.152 105.152 120.216 1.00 15.93  ? 98  LEU G CG    1 
ATOM   5115  C CD1   . LEU G 3  101 ? 122.893 104.953 121.469 1.00 20.05  ? 98  LEU G CD1   1 
ATOM   5116  C CD2   . LEU G 3  101 ? 121.157 104.018 120.009 1.00 22.65  ? 98  LEU G CD2   1 
ATOM   5117  N N     . GLY G 3  102 ? 119.946 108.984 118.054 1.00 22.42  ? 99  GLY G N     1 
ATOM   5118  C CA    . GLY G 3  102 ? 119.310 110.294 118.098 1.00 20.96  ? 99  GLY G CA    1 
ATOM   5119  C C     . GLY G 3  102 ? 117.855 110.326 118.511 1.00 17.36  ? 99  GLY G C     1 
ATOM   5120  O O     . GLY G 3  102 ? 117.399 111.308 119.093 1.00 22.70  ? 99  GLY G O     1 
ATOM   5121  N N     . ARG G 3  103 ? 117.100 109.280 118.223 1.00 18.55  ? 100 ARG G N     1 
ATOM   5122  C CA    . ARG G 3  103 ? 115.693 109.276 118.594 1.00 20.45  ? 100 ARG G CA    1 
ATOM   5123  C C     . ARG G 3  103 ? 115.373 108.450 119.813 1.00 20.91  ? 100 ARG G C     1 
ATOM   5124  O O     . ARG G 3  103 ? 114.208 108.240 120.128 1.00 20.28  ? 100 ARG G O     1 
ATOM   5125  C CB    . ARG G 3  103 ? 114.852 108.761 117.478 1.00 22.02  ? 100 ARG G CB    1 
ATOM   5126  C CG    . ARG G 3  103 ? 114.796 109.641 116.309 1.00 32.00  ? 100 ARG G CG    1 
ATOM   5127  C CD    . ARG G 3  103 ? 114.083 108.999 115.201 1.00 37.29  ? 100 ARG G CD    1 
ATOM   5128  N NE    . ARG G 3  103 ? 113.928 109.878 114.082 1.00 41.77  ? 100 ARG G NE    1 
ATOM   5129  C CZ    . ARG G 3  103 ? 114.865 110.131 113.160 1.00 48.27  ? 100 ARG G CZ    1 
ATOM   5130  N NH1   . ARG G 3  103 ? 116.039 109.550 113.216 1.00 56.50  ? 100 ARG G NH1   1 
ATOM   5131  N NH2   . ARG G 3  103 ? 114.601 110.972 112.181 1.00 31.80  ? 100 ARG G NH2   1 
ATOM   5132  N N     . VAL G 3  104 ? 116.379 107.961 120.486 1.00 19.86  ? 101 VAL G N     1 
ATOM   5133  C CA    . VAL G 3  104 ? 116.136 107.106 121.611 1.00 11.75  ? 101 VAL G CA    1 
ATOM   5134  C C     . VAL G 3  104 ? 115.888 107.808 122.917 1.00 18.45  ? 101 VAL G C     1 
ATOM   5135  O O     . VAL G 3  104 ? 116.654 108.665 123.368 1.00 27.17  ? 101 VAL G O     1 
ATOM   5136  C CB    . VAL G 3  104 ? 117.295 106.157 121.761 1.00 12.90  ? 101 VAL G CB    1 
ATOM   5137  C CG1   . VAL G 3  104 ? 117.155 105.338 122.978 1.00 23.08  ? 101 VAL G CG1   1 
ATOM   5138  C CG2   . VAL G 3  104 ? 117.320 105.273 120.572 1.00 17.24  ? 101 VAL G CG2   1 
ATOM   5139  N N     . THR G 3  105 ? 114.826 107.387 123.565 1.00 18.34  ? 102 THR G N     1 
ATOM   5140  C CA    . THR G 3  105 ? 114.466 107.886 124.864 1.00 15.76  ? 102 THR G CA    1 
ATOM   5141  C C     . THR G 3  105 ? 114.974 106.897 125.875 1.00 15.76  ? 102 THR G C     1 
ATOM   5142  O O     . THR G 3  105 ? 114.701 105.706 125.774 1.00 18.32  ? 102 THR G O     1 
ATOM   5143  C CB    . THR G 3  105 ? 112.943 108.027 125.004 1.00 17.83  ? 102 THR G CB    1 
ATOM   5144  O OG1   . THR G 3  105 ? 112.466 108.950 124.036 1.00 25.52  ? 102 THR G OG1   1 
ATOM   5145  C CG2   . THR G 3  105 ? 112.570 108.510 126.393 1.00 19.14  ? 102 THR G CG2   1 
ATOM   5146  N N     . ILE G 3  106 ? 115.709 107.366 126.847 1.00 17.50  ? 103 ILE G N     1 
ATOM   5147  C CA    . ILE G 3  106 ? 116.208 106.481 127.870 1.00 15.11  ? 103 ILE G CA    1 
ATOM   5148  C C     . ILE G 3  106 ? 115.429 106.660 129.134 1.00 18.54  ? 103 ILE G C     1 
ATOM   5149  O O     . ILE G 3  106 ? 115.320 107.775 129.652 1.00 24.05  ? 103 ILE G O     1 
ATOM   5150  C CB    . ILE G 3  106 ? 117.705 106.695 128.094 1.00 14.08  ? 103 ILE G CB    1 
ATOM   5151  C CG1   . ILE G 3  106 ? 118.426 106.318 126.814 1.00 17.76  ? 103 ILE G CG1   1 
ATOM   5152  C CG2   . ILE G 3  106 ? 118.180 105.957 129.287 1.00 18.70  ? 103 ILE G CG2   1 
ATOM   5153  C CD1   . ILE G 3  106 ? 119.885 106.608 126.795 1.00 28.38  ? 103 ILE G CD1   1 
ATOM   5154  N N     . ALA G 3  107 ? 114.834 105.585 129.621 1.00 15.01  ? 104 ALA G N     1 
ATOM   5155  C CA    . ALA G 3  107 ? 114.073 105.732 130.826 1.00 12.85  ? 104 ALA G CA    1 
ATOM   5156  C C     . ALA G 3  107 ? 115.024 106.195 131.882 1.00 19.38  ? 104 ALA G C     1 
ATOM   5157  O O     . ALA G 3  107 ? 116.066 105.575 132.056 1.00 23.32  ? 104 ALA G O     1 
ATOM   5158  C CB    . ALA G 3  107 ? 113.435 104.421 131.198 1.00 13.42  ? 104 ALA G CB    1 
ATOM   5159  N N     . GLN G 3  108 ? 114.646 107.225 132.639 1.00 20.35  ? 105 GLN G N     1 
ATOM   5160  C CA    . GLN G 3  108 ? 115.484 107.791 133.708 1.00 18.16  ? 105 GLN G CA    1 
ATOM   5161  C C     . GLN G 3  108 ? 116.796 108.391 133.228 1.00 21.12  ? 105 GLN G C     1 
ATOM   5162  O O     . GLN G 3  108 ? 117.729 108.534 134.015 1.00 24.08  ? 105 GLN G O     1 
ATOM   5163  C CB    . GLN G 3  108 ? 115.866 106.716 134.711 1.00 14.69  ? 105 GLN G CB    1 
ATOM   5164  C CG    . GLN G 3  108 ? 114.743 106.073 135.326 1.00 19.74  ? 105 GLN G CG    1 
ATOM   5165  C CD    . GLN G 3  108 ? 114.127 106.967 136.245 1.00 29.21  ? 105 GLN G CD    1 
ATOM   5166  O OE1   . GLN G 3  108 ? 114.765 107.297 137.242 1.00 25.51  ? 105 GLN G OE1   1 
ATOM   5167  N NE2   . GLN G 3  108 ? 112.913 107.433 135.978 1.00 32.23  ? 105 GLN G NE2   1 
ATOM   5168  N N     . GLY G 3  109 ? 116.889 108.726 131.952 1.00 22.39  ? 106 GLY G N     1 
ATOM   5169  C CA    . GLY G 3  109 ? 118.107 109.279 131.401 1.00 27.28  ? 106 GLY G CA    1 
ATOM   5170  C C     . GLY G 3  109 ? 118.458 110.687 131.819 1.00 30.80  ? 106 GLY G C     1 
ATOM   5171  O O     . GLY G 3  109 ? 119.628 111.009 131.925 1.00 37.06  ? 106 GLY G O     1 
ATOM   5172  N N     . GLY G 3  110 ? 117.484 111.555 132.001 1.00 28.52  ? 107 GLY G N     1 
ATOM   5173  C CA    . GLY G 3  110 ? 117.809 112.945 132.315 1.00 32.05  ? 107 GLY G CA    1 
ATOM   5174  C C     . GLY G 3  110 ? 118.181 113.703 131.035 1.00 37.12  ? 107 GLY G C     1 
ATOM   5175  O O     . GLY G 3  110 ? 118.009 113.187 129.924 1.00 41.94  ? 107 GLY G O     1 
ATOM   5176  N N     . VAL G 3  111 ? 118.662 114.940 131.183 1.00 34.90  ? 108 VAL G N     1 
ATOM   5177  C CA    . VAL G 3  111 ? 119.030 115.795 130.047 1.00 34.67  ? 108 VAL G CA    1 
ATOM   5178  C C     . VAL G 3  111 ? 120.411 116.404 130.252 1.00 38.51  ? 108 VAL G C     1 
ATOM   5179  O O     . VAL G 3  111 ? 120.921 116.402 131.367 1.00 39.74  ? 108 VAL G O     1 
ATOM   5180  C CB    . VAL G 3  111 ? 118.018 116.928 129.840 1.00 31.59  ? 108 VAL G CB    1 
ATOM   5181  C CG1   . VAL G 3  111 ? 116.662 116.367 129.557 1.00 31.51  ? 108 VAL G CG1   1 
ATOM   5182  C CG2   . VAL G 3  111 ? 117.980 117.808 131.062 1.00 30.32  ? 108 VAL G CG2   1 
ATOM   5183  N N     . LEU G 3  112 ? 121.018 116.948 129.199 1.00 39.27  ? 109 LEU G N     1 
ATOM   5184  C CA    . LEU G 3  112 ? 122.274 117.655 129.405 1.00 39.53  ? 109 LEU G CA    1 
ATOM   5185  C C     . LEU G 3  112 ? 121.976 119.028 129.990 1.00 42.29  ? 109 LEU G C     1 
ATOM   5186  O O     . LEU G 3  112 ? 120.992 119.653 129.587 1.00 45.51  ? 109 LEU G O     1 
ATOM   5187  C CB    . LEU G 3  112 ? 123.035 117.857 128.093 1.00 43.31  ? 109 LEU G CB    1 
ATOM   5188  C CG    . LEU G 3  112 ? 123.536 116.636 127.332 1.00 43.18  ? 109 LEU G CG    1 
ATOM   5189  C CD1   . LEU G 3  112 ? 124.220 117.122 126.067 1.00 48.49  ? 109 LEU G CD1   1 
ATOM   5190  C CD2   . LEU G 3  112 ? 124.495 115.848 128.162 1.00 40.02  ? 109 LEU G CD2   1 
ATOM   5191  N N     . PRO G 3  113 ? 122.858 119.596 130.826 1.00 37.02  ? 110 PRO G N     1 
ATOM   5192  C CA    . PRO G 3  113 ? 122.710 120.883 131.480 1.00 41.21  ? 110 PRO G CA    1 
ATOM   5193  C C     . PRO G 3  113 ? 122.963 122.091 130.595 1.00 46.27  ? 110 PRO G C     1 
ATOM   5194  O O     . PRO G 3  113 ? 123.934 122.821 130.788 1.00 45.90  ? 110 PRO G O     1 
ATOM   5195  C CB    . PRO G 3  113 ? 123.743 120.785 132.593 1.00 37.80  ? 110 PRO G CB    1 
ATOM   5196  C CG    . PRO G 3  113 ? 124.806 119.925 132.021 1.00 36.47  ? 110 PRO G CG    1 
ATOM   5197  C CD    . PRO G 3  113 ? 124.077 118.891 131.206 1.00 39.25  ? 110 PRO G CD    1 
ATOM   5198  N N     . ASN G 3  114 ? 122.091 122.269 129.616 1.00 48.38  ? 111 ASN G N     1 
ATOM   5199  C CA    . ASN G 3  114 ? 122.174 123.367 128.664 1.00 52.10  ? 111 ASN G CA    1 
ATOM   5200  C C     . ASN G 3  114 ? 121.329 124.595 129.024 1.00 53.09  ? 111 ASN G C     1 
ATOM   5201  O O     . ASN G 3  114 ? 120.099 124.521 129.116 1.00 47.84  ? 111 ASN G O     1 
ATOM   5202  C CB    . ASN G 3  114 ? 121.784 122.888 127.290 1.00 52.61  ? 111 ASN G CB    1 
ATOM   5203  C CG    . ASN G 3  114 ? 122.739 121.896 126.737 1.00 55.78  ? 111 ASN G CG    1 
ATOM   5204  O OD1   . ASN G 3  114 ? 123.962 122.043 126.851 1.00 56.24  ? 111 ASN G OD1   1 
ATOM   5205  N ND2   . ASN G 3  114 ? 122.210 120.880 126.114 1.00 59.04  ? 111 ASN G ND2   1 
ATOM   5206  N N     . ILE G 3  115 ? 121.995 125.724 129.251 1.00 52.87  ? 112 ILE G N     1 
ATOM   5207  C CA    . ILE G 3  115 ? 121.327 126.979 129.586 1.00 53.83  ? 112 ILE G CA    1 
ATOM   5208  C C     . ILE G 3  115 ? 121.699 127.985 128.515 1.00 54.51  ? 112 ILE G C     1 
ATOM   5209  O O     . ILE G 3  115 ? 122.879 128.150 128.215 1.00 54.04  ? 112 ILE G O     1 
ATOM   5210  C CB    . ILE G 3  115 ? 121.723 127.521 130.984 1.00 58.93  ? 112 ILE G CB    1 
ATOM   5211  C CG1   . ILE G 3  115 ? 121.346 126.481 132.065 1.00 55.13  ? 112 ILE G CG1   1 
ATOM   5212  C CG2   . ILE G 3  115 ? 121.004 128.877 131.249 1.00 55.89  ? 112 ILE G CG2   1 
ATOM   5213  C CD1   . ILE G 3  115 ? 121.850 126.779 133.472 1.00 62.19  ? 112 ILE G CD1   1 
ATOM   5214  N N     . GLN G 3  116 ? 120.715 128.649 127.928 1.00 54.10  ? 113 GLN G N     1 
ATOM   5215  C CA    . GLN G 3  116 ? 121.016 129.627 126.893 1.00 55.53  ? 113 GLN G CA    1 
ATOM   5216  C C     . GLN G 3  116 ? 121.619 130.876 127.507 1.00 55.52  ? 113 GLN G C     1 
ATOM   5217  O O     . GLN G 3  116 ? 121.118 131.404 128.495 1.00 54.39  ? 113 GLN G O     1 
ATOM   5218  C CB    . GLN G 3  116 ? 119.760 129.979 126.102 1.00 51.24  ? 113 GLN G CB    1 
ATOM   5219  C CG    . GLN G 3  116 ? 119.188 128.858 125.302 1.00 48.76  ? 113 GLN G CG    1 
ATOM   5220  C CD    . GLN G 3  116 ? 120.056 128.514 124.174 1.00 51.85  ? 113 GLN G CD    1 
ATOM   5221  O OE1   . GLN G 3  116 ? 120.455 129.396 123.413 1.00 48.10  ? 113 GLN G OE1   1 
ATOM   5222  N NE2   . GLN G 3  116 ? 120.371 127.245 124.034 1.00 50.77  ? 113 GLN G NE2   1 
ATOM   5223  N N     . ALA G 3  117 ? 122.616 131.436 126.837 1.00 57.47  ? 114 ALA G N     1 
ATOM   5224  C CA    . ALA G 3  117 ? 123.316 132.623 127.328 1.00 60.57  ? 114 ALA G CA    1 
ATOM   5225  C C     . ALA G 3  117 ? 122.412 133.821 127.557 1.00 55.64  ? 114 ALA G C     1 
ATOM   5226  O O     . ALA G 3  117 ? 122.631 134.602 128.478 1.00 55.55  ? 114 ALA G O     1 
ATOM   5227  C CB    . ALA G 3  117 ? 124.401 133.018 126.356 1.00 58.60  ? 114 ALA G CB    1 
ATOM   5228  N N     . VAL G 3  118 ? 121.365 133.949 126.764 1.00 54.75  ? 115 VAL G N     1 
ATOM   5229  C CA    . VAL G 3  118 ? 120.457 135.084 126.859 1.00 53.42  ? 115 VAL G CA    1 
ATOM   5230  C C     . VAL G 3  118 ? 119.648 135.089 128.151 1.00 50.99  ? 115 VAL G C     1 
ATOM   5231  O O     . VAL G 3  118 ? 118.938 136.051 128.437 1.00 41.84  ? 115 VAL G O     1 
ATOM   5232  C CB    . VAL G 3  118 ? 119.477 135.097 125.668 1.00 58.25  ? 115 VAL G CB    1 
ATOM   5233  C CG1   . VAL G 3  118 ? 120.251 135.183 124.355 1.00 52.22  ? 115 VAL G CG1   1 
ATOM   5234  C CG2   . VAL G 3  118 ? 118.595 133.856 125.695 1.00 47.00  ? 115 VAL G CG2   1 
ATOM   5235  N N     . LEU G 3  119 ? 119.678 133.984 128.885 1.00 52.52  ? 116 LEU G N     1 
ATOM   5236  C CA    . LEU G 3  119 ? 118.936 133.863 130.111 1.00 51.16  ? 116 LEU G CA    1 
ATOM   5237  C C     . LEU G 3  119 ? 119.785 134.220 131.326 1.00 54.59  ? 116 LEU G C     1 
ATOM   5238  O O     . LEU G 3  119 ? 119.260 134.392 132.436 1.00 54.26  ? 116 LEU G O     1 
ATOM   5239  C CB    . LEU G 3  119 ? 118.481 132.415 130.225 1.00 49.11  ? 116 LEU G CB    1 
ATOM   5240  C CG    . LEU G 3  119 ? 117.673 131.895 129.032 1.00 49.34  ? 116 LEU G CG    1 
ATOM   5241  C CD1   . LEU G 3  119 ? 117.341 130.439 129.293 1.00 45.85  ? 116 LEU G CD1   1 
ATOM   5242  C CD2   . LEU G 3  119 ? 116.440 132.742 128.767 1.00 41.77  ? 116 LEU G CD2   1 
ATOM   5243  N N     . LEU G 3  120 ? 121.089 134.345 131.123 1.00 56.18  ? 117 LEU G N     1 
ATOM   5244  C CA    . LEU G 3  120 ? 122.023 134.578 132.203 1.00 59.85  ? 117 LEU G CA    1 
ATOM   5245  C C     . LEU G 3  120 ? 122.082 136.062 132.559 1.00 61.84  ? 117 LEU G C     1 
ATOM   5246  O O     . LEU G 3  120 ? 121.765 136.909 131.727 1.00 60.36  ? 117 LEU G O     1 
ATOM   5247  C CB    . LEU G 3  120 ? 123.399 134.055 131.780 1.00 60.99  ? 117 LEU G CB    1 
ATOM   5248  C CG    . LEU G 3  120 ? 123.490 132.538 131.456 1.00 60.35  ? 117 LEU G CG    1 
ATOM   5249  C CD1   . LEU G 3  120 ? 124.901 132.235 130.983 1.00 58.45  ? 117 LEU G CD1   1 
ATOM   5250  C CD2   . LEU G 3  120 ? 123.133 131.687 132.686 1.00 64.02  ? 117 LEU G CD2   1 
ATOM   5251  N N     . PRO G 3  121 ? 122.466 136.427 133.794 1.00 64.83  ? 118 PRO G N     1 
ATOM   5252  C CA    . PRO G 3  121 ? 122.623 137.793 134.242 1.00 66.96  ? 118 PRO G CA    1 
ATOM   5253  C C     . PRO G 3  121 ? 123.981 138.321 133.810 1.00 64.27  ? 118 PRO G C     1 
ATOM   5254  O O     . PRO G 3  121 ? 124.948 137.559 133.812 1.00 67.65  ? 118 PRO G O     1 
ATOM   5255  C CB    . PRO G 3  121 ? 122.553 137.648 135.765 1.00 70.28  ? 118 PRO G CB    1 
ATOM   5256  C CG    . PRO G 3  121 ? 123.122 136.264 136.035 1.00 69.40  ? 118 PRO G CG    1 
ATOM   5257  C CD    . PRO G 3  121 ? 122.724 135.421 134.847 1.00 65.47  ? 118 PRO G CD    1 
ATOM   5258  N N     . SER H 4  36  ? 109.276 78.762  131.905 1.00 149.05 ? 33  SER H N     1 
ATOM   5259  C CA    . SER H 4  36  ? 109.514 80.132  131.456 1.00 147.42 ? 33  SER H CA    1 
ATOM   5260  C C     . SER H 4  36  ? 110.991 80.461  131.437 1.00 153.11 ? 33  SER H C     1 
ATOM   5261  O O     . SER H 4  36  ? 111.641 80.514  132.486 1.00 156.40 ? 33  SER H O     1 
ATOM   5262  C CB    . SER H 4  36  ? 108.791 81.123  132.339 1.00 152.27 ? 33  SER H CB    1 
ATOM   5263  O OG    . SER H 4  36  ? 109.106 82.441  131.972 1.00 135.55 ? 33  SER H OG    1 
ATOM   5264  N N     . ARG H 4  37  ? 111.538 80.658  130.239 1.00 151.78 ? 34  ARG H N     1 
ATOM   5265  C CA    . ARG H 4  37  ? 112.948 80.983  130.099 1.00 144.39 ? 34  ARG H CA    1 
ATOM   5266  C C     . ARG H 4  37  ? 113.111 82.130  129.120 1.00 137.06 ? 34  ARG H C     1 
ATOM   5267  O O     . ARG H 4  37  ? 112.510 82.133  128.044 1.00 134.64 ? 34  ARG H O     1 
ATOM   5268  C CB    . ARG H 4  37  ? 113.738 79.786  129.591 1.00 149.99 ? 34  ARG H CB    1 
ATOM   5269  C CG    . ARG H 4  37  ? 113.722 78.565  130.500 1.00 156.76 ? 34  ARG H CG    1 
ATOM   5270  C CD    . ARG H 4  37  ? 114.479 78.746  131.758 1.00 171.25 ? 34  ARG H CD    1 
ATOM   5271  N NE    . ARG H 4  37  ? 114.464 77.523  132.535 0.00 177.99 ? 34  ARG H NE    1 
ATOM   5272  C CZ    . ARG H 4  37  ? 113.491 77.161  133.409 0.00 176.68 ? 34  ARG H CZ    1 
ATOM   5273  N NH1   . ARG H 4  37  ? 112.435 77.929  133.641 0.00 178.22 ? 34  ARG H NH1   1 
ATOM   5274  N NH2   . ARG H 4  37  ? 113.609 76.003  134.039 0.00 165.64 ? 34  ARG H NH2   1 
ATOM   5275  N N     . LYS H 4  38  ? 113.938 83.089  129.498 1.00 133.45 ? 35  LYS H N     1 
ATOM   5276  C CA    . LYS H 4  38  ? 114.227 84.258  128.686 1.00 120.47 ? 35  LYS H CA    1 
ATOM   5277  C C     . LYS H 4  38  ? 115.699 84.351  128.403 1.00 113.75 ? 35  LYS H C     1 
ATOM   5278  O O     . LYS H 4  38  ? 116.509 83.819  129.153 1.00 119.47 ? 35  LYS H O     1 
ATOM   5279  C CB    . LYS H 4  38  ? 113.783 85.532  129.397 1.00 119.97 ? 35  LYS H CB    1 
ATOM   5280  C CG    . LYS H 4  38  ? 112.308 85.611  129.734 1.00 126.72 ? 35  LYS H CG    1 
ATOM   5281  C CD    . LYS H 4  38  ? 111.446 85.727  128.479 1.00 131.85 ? 35  LYS H CD    1 
ATOM   5282  C CE    . LYS H 4  38  ? 109.982 85.905  128.826 1.00 140.28 ? 35  LYS H CE    1 
ATOM   5283  N NZ    . LYS H 4  38  ? 109.122 85.971  127.604 1.00 123.95 ? 35  LYS H NZ    1 
ATOM   5284  N N     . GLU H 4  39  ? 116.053 85.030  127.325 1.00 103.97 ? 36  GLU H N     1 
ATOM   5285  C CA    . GLU H 4  39  ? 117.453 85.249  127.017 1.00 95.36  ? 36  GLU H CA    1 
ATOM   5286  C C     . GLU H 4  39  ? 117.759 86.730  126.944 1.00 85.05  ? 36  GLU H C     1 
ATOM   5287  O O     . GLU H 4  39  ? 116.921 87.537  126.537 1.00 85.01  ? 36  GLU H O     1 
ATOM   5288  C CB    . GLU H 4  39  ? 117.845 84.533  125.733 1.00 94.00  ? 36  GLU H CB    1 
ATOM   5289  C CG    . GLU H 4  39  ? 117.765 83.021  125.845 1.00 94.91  ? 36  GLU H CG    1 
ATOM   5290  C CD    . GLU H 4  39  ? 118.220 82.300  124.614 1.00 90.84  ? 36  GLU H CD    1 
ATOM   5291  O OE1   . GLU H 4  39  ? 118.472 82.933  123.611 1.00 83.99  ? 36  GLU H OE1   1 
ATOM   5292  O OE2   . GLU H 4  39  ? 118.329 81.107  124.661 1.00 95.00  ? 36  GLU H OE2   1 
ATOM   5293  N N     . SER H 4  40  ? 118.966 87.074  127.337 1.00 72.00  ? 37  SER H N     1 
ATOM   5294  C CA    . SER H 4  40  ? 119.431 88.434  127.340 1.00 53.22  ? 37  SER H CA    1 
ATOM   5295  C C     . SER H 4  40  ? 120.914 88.375  127.179 1.00 46.38  ? 37  SER H C     1 
ATOM   5296  O O     . SER H 4  40  ? 121.505 87.296  127.204 1.00 54.19  ? 37  SER H O     1 
ATOM   5297  C CB    . SER H 4  40  ? 119.137 89.093  128.643 1.00 57.01  ? 37  SER H CB    1 
ATOM   5298  O OG    . SER H 4  40  ? 120.011 88.611  129.615 1.00 60.15  ? 37  SER H OG    1 
ATOM   5299  N N     . TYR H 4  41  ? 121.534 89.519  127.054 1.00 41.63  ? 38  TYR H N     1 
ATOM   5300  C CA    . TYR H 4  41  ? 122.953 89.608  126.871 1.00 37.70  ? 38  TYR H CA    1 
ATOM   5301  C C     . TYR H 4  41  ? 123.637 90.085  128.119 1.00 39.41  ? 38  TYR H C     1 
ATOM   5302  O O     . TYR H 4  41  ? 124.786 90.514  128.070 1.00 42.32  ? 38  TYR H O     1 
ATOM   5303  C CB    . TYR H 4  41  ? 123.265 90.557  125.735 1.00 31.87  ? 38  TYR H CB    1 
ATOM   5304  C CG    . TYR H 4  41  ? 122.787 90.105  124.432 1.00 30.00  ? 38  TYR H CG    1 
ATOM   5305  C CD1   . TYR H 4  41  ? 121.596 90.530  123.972 1.00 30.99  ? 38  TYR H CD1   1 
ATOM   5306  C CD2   . TYR H 4  41  ? 123.557 89.280  123.675 1.00 36.50  ? 38  TYR H CD2   1 
ATOM   5307  C CE1   . TYR H 4  41  ? 121.163 90.126  122.751 1.00 32.60  ? 38  TYR H CE1   1 
ATOM   5308  C CE2   . TYR H 4  41  ? 123.128 88.877  122.452 1.00 35.33  ? 38  TYR H CE2   1 
ATOM   5309  C CZ    . TYR H 4  41  ? 121.933 89.301  121.993 1.00 28.98  ? 38  TYR H CZ    1 
ATOM   5310  O OH    . TYR H 4  41  ? 121.496 88.907  120.767 1.00 31.12  ? 38  TYR H OH    1 
ATOM   5311  N N     . SER H 4  42  ? 122.984 89.996  129.270 1.00 39.37  ? 39  SER H N     1 
ATOM   5312  C CA    . SER H 4  42  ? 123.607 90.562  130.454 1.00 37.45  ? 39  SER H CA    1 
ATOM   5313  C C     . SER H 4  42  ? 124.946 89.949  130.805 1.00 40.49  ? 39  SER H C     1 
ATOM   5314  O O     . SER H 4  42  ? 125.827 90.640  131.317 1.00 47.62  ? 39  SER H O     1 
ATOM   5315  C CB    . SER H 4  42  ? 122.708 90.392  131.629 1.00 43.54  ? 39  SER H CB    1 
ATOM   5316  O OG    . SER H 4  42  ? 122.601 89.042  131.950 1.00 58.75  ? 39  SER H OG    1 
ATOM   5317  N N     . ILE H 4  43  ? 125.172 88.698  130.463 1.00 40.34  ? 40  ILE H N     1 
ATOM   5318  C CA    . ILE H 4  43  ? 126.464 88.106  130.743 1.00 40.77  ? 40  ILE H CA    1 
ATOM   5319  C C     . ILE H 4  43  ? 127.543 88.722  129.910 1.00 40.65  ? 40  ILE H C     1 
ATOM   5320  O O     . ILE H 4  43  ? 128.667 88.920  130.372 1.00 44.98  ? 40  ILE H O     1 
ATOM   5321  C CB    . ILE H 4  43  ? 126.487 86.612  130.483 1.00 43.60  ? 40  ILE H CB    1 
ATOM   5322  C CG1   . ILE H 4  43  ? 125.625 85.948  131.477 1.00 54.52  ? 40  ILE H CG1   1 
ATOM   5323  C CG2   . ILE H 4  43  ? 127.946 86.085  130.514 1.00 54.40  ? 40  ILE H CG2   1 
ATOM   5324  C CD1   . ILE H 4  43  ? 125.343 84.524  131.166 1.00 99.30  ? 40  ILE H CD1   1 
ATOM   5325  N N     . TYR H 4  44  ? 127.233 88.924  128.650 1.00 38.63  ? 41  TYR H N     1 
ATOM   5326  C CA    . TYR H 4  44  ? 128.205 89.387  127.708 1.00 33.72  ? 41  TYR H CA    1 
ATOM   5327  C C     . TYR H 4  44  ? 128.466 90.852  127.905 1.00 36.79  ? 41  TYR H C     1 
ATOM   5328  O O     . TYR H 4  44  ? 129.603 91.300  127.773 1.00 40.08  ? 41  TYR H O     1 
ATOM   5329  C CB    . TYR H 4  44  ? 127.685 89.082  126.342 1.00 33.88  ? 41  TYR H CB    1 
ATOM   5330  C CG    . TYR H 4  44  ? 127.396 87.641  126.264 1.00 37.57  ? 41  TYR H CG    1 
ATOM   5331  C CD1   . TYR H 4  44  ? 126.114 87.250  126.137 1.00 41.87  ? 41  TYR H CD1   1 
ATOM   5332  C CD2   . TYR H 4  44  ? 128.377 86.711  126.384 1.00 38.60  ? 41  TYR H CD2   1 
ATOM   5333  C CE1   . TYR H 4  44  ? 125.786 85.936  126.116 1.00 46.07  ? 41  TYR H CE1   1 
ATOM   5334  C CE2   . TYR H 4  44  ? 128.055 85.372  126.372 1.00 37.87  ? 41  TYR H CE2   1 
ATOM   5335  C CZ    . TYR H 4  44  ? 126.758 84.987  126.238 1.00 44.68  ? 41  TYR H CZ    1 
ATOM   5336  O OH    . TYR H 4  44  ? 126.393 83.648  126.239 1.00 79.30  ? 41  TYR H OH    1 
ATOM   5337  N N     . VAL H 4  45  ? 127.444 91.602  128.285 1.00 36.07  ? 42  VAL H N     1 
ATOM   5338  C CA    . VAL H 4  45  ? 127.634 93.011  128.520 1.00 30.40  ? 42  VAL H CA    1 
ATOM   5339  C C     . VAL H 4  45  ? 128.542 93.153  129.702 1.00 31.99  ? 42  VAL H C     1 
ATOM   5340  O O     . VAL H 4  45  ? 129.454 93.975  129.700 1.00 36.52  ? 42  VAL H O     1 
ATOM   5341  C CB    . VAL H 4  45  ? 126.313 93.716  128.791 1.00 27.87  ? 42  VAL H CB    1 
ATOM   5342  C CG1   . VAL H 4  45  ? 126.552 95.133  129.238 1.00 39.35  ? 42  VAL H CG1   1 
ATOM   5343  C CG2   . VAL H 4  45  ? 125.485 93.737  127.534 1.00 27.71  ? 42  VAL H CG2   1 
ATOM   5344  N N     . TYR H 4  46  ? 128.294 92.365  130.725 1.00 36.78  ? 43  TYR H N     1 
ATOM   5345  C CA    . TYR H 4  46  ? 129.100 92.408  131.899 1.00 42.90  ? 43  TYR H CA    1 
ATOM   5346  C C     . TYR H 4  46  ? 130.556 92.091  131.608 1.00 42.01  ? 43  TYR H C     1 
ATOM   5347  O O     . TYR H 4  46  ? 131.439 92.774  132.130 1.00 57.94  ? 43  TYR H O     1 
ATOM   5348  C CB    . TYR H 4  46  ? 128.535 91.509  132.949 1.00 50.70  ? 43  TYR H CB    1 
ATOM   5349  C CG    . TYR H 4  46  ? 129.314 91.563  134.139 1.00 67.93  ? 43  TYR H CG    1 
ATOM   5350  C CD1   . TYR H 4  46  ? 129.180 92.644  134.974 1.00 80.47  ? 43  TYR H CD1   1 
ATOM   5351  C CD2   . TYR H 4  46  ? 130.183 90.548  134.430 1.00 80.34  ? 43  TYR H CD2   1 
ATOM   5352  C CE1   . TYR H 4  46  ? 129.929 92.712  136.118 1.00 109.45 ? 43  TYR H CE1   1 
ATOM   5353  C CE2   . TYR H 4  46  ? 130.930 90.602  135.572 1.00 93.95  ? 43  TYR H CE2   1 
ATOM   5354  C CZ    . TYR H 4  46  ? 130.812 91.683  136.422 1.00 103.97 ? 43  TYR H CZ    1 
ATOM   5355  O OH    . TYR H 4  46  ? 131.556 91.739  137.588 1.00 148.69 ? 43  TYR H OH    1 
ATOM   5356  N N     . LYS H 4  47  ? 130.798 91.060  130.799 1.00 38.73  ? 44  LYS H N     1 
ATOM   5357  C CA    . LYS H 4  47  ? 132.155 90.659  130.446 1.00 34.45  ? 44  LYS H CA    1 
ATOM   5358  C C     . LYS H 4  47  ? 132.871 91.771  129.694 1.00 33.07  ? 44  LYS H C     1 
ATOM   5359  O O     . LYS H 4  47  ? 134.072 91.979  129.867 1.00 43.24  ? 44  LYS H O     1 
ATOM   5360  C CB    . LYS H 4  47  ? 132.129 89.397  129.583 1.00 35.58  ? 44  LYS H CB    1 
ATOM   5361  C CG    . LYS H 4  47  ? 131.588 88.154  130.278 1.00 43.87  ? 44  LYS H CG    1 
ATOM   5362  C CD    . LYS H 4  47  ? 132.625 87.450  131.138 1.00 45.98  ? 44  LYS H CD    1 
ATOM   5363  C CE    . LYS H 4  47  ? 132.045 86.159  131.703 1.00 52.88  ? 44  LYS H CE    1 
ATOM   5364  N NZ    . LYS H 4  47  ? 133.031 85.373  132.497 1.00 56.14  ? 44  LYS H NZ    1 
ATOM   5365  N N     . VAL H 4  48  ? 132.161 92.480  128.830 1.00 31.49  ? 45  VAL H N     1 
ATOM   5366  C CA    . VAL H 4  48  ? 132.789 93.563  128.125 1.00 29.49  ? 45  VAL H CA    1 
ATOM   5367  C C     . VAL H 4  48  ? 133.133 94.658  129.099 1.00 30.74  ? 45  VAL H C     1 
ATOM   5368  O O     . VAL H 4  48  ? 134.214 95.245  129.006 1.00 37.79  ? 45  VAL H O     1 
ATOM   5369  C CB    . VAL H 4  48  ? 131.903 94.111  127.023 1.00 21.38  ? 45  VAL H CB    1 
ATOM   5370  C CG1   . VAL H 4  48  ? 132.484 95.356  126.467 1.00 30.76  ? 45  VAL H CG1   1 
ATOM   5371  C CG2   . VAL H 4  48  ? 131.793 93.112  125.935 1.00 24.95  ? 45  VAL H CG2   1 
ATOM   5372  N N     . LEU H 4  49  ? 132.229 94.965  130.033 1.00 32.26  ? 46  LEU H N     1 
ATOM   5373  C CA    . LEU H 4  49  ? 132.486 96.029  130.975 1.00 29.66  ? 46  LEU H CA    1 
ATOM   5374  C C     . LEU H 4  49  ? 133.740 95.770  131.735 1.00 31.33  ? 46  LEU H C     1 
ATOM   5375  O O     . LEU H 4  49  ? 134.522 96.694  131.940 1.00 45.98  ? 46  LEU H O     1 
ATOM   5376  C CB    . LEU H 4  49  ? 131.333 96.211  131.955 1.00 29.29  ? 46  LEU H CB    1 
ATOM   5377  C CG    . LEU H 4  49  ? 131.497 97.307  133.019 1.00 29.22  ? 46  LEU H CG    1 
ATOM   5378  C CD1   . LEU H 4  49  ? 131.738 98.663  132.392 1.00 38.76  ? 46  LEU H CD1   1 
ATOM   5379  C CD2   . LEU H 4  49  ? 130.220 97.370  133.797 1.00 49.63  ? 46  LEU H CD2   1 
ATOM   5380  N N     . LYS H 4  50  ? 133.971 94.539  132.159 1.00 30.91  ? 47  LYS H N     1 
ATOM   5381  C CA    . LYS H 4  50  ? 135.186 94.310  132.922 1.00 33.19  ? 47  LYS H CA    1 
ATOM   5382  C C     . LYS H 4  50  ? 136.434 94.427  132.052 1.00 33.43  ? 47  LYS H C     1 
ATOM   5383  O O     . LYS H 4  50  ? 137.506 94.708  132.584 1.00 42.75  ? 47  LYS H O     1 
ATOM   5384  C CB    . LYS H 4  50  ? 135.164 92.974  133.659 1.00 38.48  ? 47  LYS H CB    1 
ATOM   5385  C CG    . LYS H 4  50  ? 135.344 91.754  132.774 1.00 56.06  ? 47  LYS H CG    1 
ATOM   5386  C CD    . LYS H 4  50  ? 135.351 90.480  133.599 1.00 70.38  ? 47  LYS H CD    1 
ATOM   5387  C CE    . LYS H 4  50  ? 135.711 89.277  132.744 1.00 80.92  ? 47  LYS H CE    1 
ATOM   5388  N NZ    . LYS H 4  50  ? 135.654 88.014  133.529 1.00 75.00  ? 47  LYS H NZ    1 
ATOM   5389  N N     . GLN H 4  51  ? 136.381 94.246  130.722 1.00 32.63  ? 48  GLN H N     1 
ATOM   5390  C CA    . GLN H 4  51  ? 137.587 94.506  129.972 1.00 34.21  ? 48  GLN H CA    1 
ATOM   5391  C C     . GLN H 4  51  ? 137.882 95.981  129.825 1.00 32.35  ? 48  GLN H C     1 
ATOM   5392  O O     . GLN H 4  51  ? 139.047 96.383  129.856 1.00 32.52  ? 48  GLN H O     1 
ATOM   5393  C CB    . GLN H 4  51  ? 137.506 93.894  128.601 1.00 41.14  ? 48  GLN H CB    1 
ATOM   5394  C CG    . GLN H 4  51  ? 137.527 92.404  128.598 1.00 45.04  ? 48  GLN H CG    1 
ATOM   5395  C CD    . GLN H 4  51  ? 137.441 91.896  127.239 1.00 52.55  ? 48  GLN H CD    1 
ATOM   5396  O OE1   . GLN H 4  51  ? 137.006 92.622  126.353 1.00 50.90  ? 48  GLN H OE1   1 
ATOM   5397  N NE2   . GLN H 4  51  ? 137.853 90.670  127.027 1.00 62.79  ? 48  GLN H NE2   1 
ATOM   5398  N N     . VAL H 4  52  ? 136.848 96.796  129.657 1.00 30.04  ? 49  VAL H N     1 
ATOM   5399  C CA    . VAL H 4  52  ? 137.111 98.216  129.487 1.00 28.37  ? 49  VAL H CA    1 
ATOM   5400  C C     . VAL H 4  52  ? 137.351 98.934  130.826 1.00 36.45  ? 49  VAL H C     1 
ATOM   5401  O O     . VAL H 4  52  ? 138.224 99.793  130.918 1.00 37.48  ? 49  VAL H O     1 
ATOM   5402  C CB    . VAL H 4  52  ? 136.003 98.905  128.652 1.00 25.62  ? 49  VAL H CB    1 
ATOM   5403  C CG1   . VAL H 4  52  ? 135.932 98.282  127.291 1.00 26.44  ? 49  VAL H CG1   1 
ATOM   5404  C CG2   . VAL H 4  52  ? 134.657 98.781  129.284 1.00 28.49  ? 49  VAL H CG2   1 
ATOM   5405  N N     . HIS H 4  53  ? 136.590 98.585  131.854 1.00 35.41  ? 50  HIS H N     1 
ATOM   5406  C CA    . HIS H 4  53  ? 136.679 99.166  133.182 1.00 33.86  ? 50  HIS H CA    1 
ATOM   5407  C C     . HIS H 4  53  ? 136.591 98.115  134.273 1.00 36.25  ? 50  HIS H C     1 
ATOM   5408  O O     . HIS H 4  53  ? 135.504 97.886  134.801 1.00 45.78  ? 50  HIS H O     1 
ATOM   5409  C CB    . HIS H 4  53  ? 135.603 100.200 133.431 1.00 37.09  ? 50  HIS H CB    1 
ATOM   5410  C CG    . HIS H 4  53  ? 135.734 101.404 132.670 1.00 37.05  ? 50  HIS H CG    1 
ATOM   5411  N ND1   . HIS H 4  53  ? 136.670 102.344 132.968 1.00 42.97  ? 50  HIS H ND1   1 
ATOM   5412  C CD2   . HIS H 4  53  ? 135.040 101.882 131.648 1.00 34.37  ? 50  HIS H CD2   1 
ATOM   5413  C CE1   . HIS H 4  53  ? 136.547 103.353 132.150 1.00 44.65  ? 50  HIS H CE1   1 
ATOM   5414  N NE2   . HIS H 4  53  ? 135.567 103.104 131.342 1.00 38.26  ? 50  HIS H NE2   1 
ATOM   5415  N N     . PRO H 4  54  ? 137.684 97.458  134.630 1.00 35.48  ? 51  PRO H N     1 
ATOM   5416  C CA    . PRO H 4  54  ? 137.760 96.357  135.566 1.00 39.77  ? 51  PRO H CA    1 
ATOM   5417  C C     . PRO H 4  54  ? 137.156 96.599  136.947 1.00 46.52  ? 51  PRO H C     1 
ATOM   5418  O O     . PRO H 4  54  ? 136.791 95.646  137.632 1.00 47.03  ? 51  PRO H O     1 
ATOM   5419  C CB    . PRO H 4  54  ? 139.266 96.173  135.698 1.00 38.38  ? 51  PRO H CB    1 
ATOM   5420  C CG    . PRO H 4  54  ? 139.813 96.664  134.409 1.00 35.29  ? 51  PRO H CG    1 
ATOM   5421  C CD    . PRO H 4  54  ? 138.961 97.817  134.036 1.00 34.54  ? 51  PRO H CD    1 
ATOM   5422  N N     . ASP H 4  55  ? 137.094 97.849  137.404 1.00 53.04  ? 52  ASP H N     1 
ATOM   5423  C CA    . ASP H 4  55  ? 136.557 98.145  138.707 1.00 53.16  ? 52  ASP H CA    1 
ATOM   5424  C C     . ASP H 4  55  ? 135.225 98.869  138.692 1.00 53.11  ? 52  ASP H C     1 
ATOM   5425  O O     . ASP H 4  55  ? 134.826 99.436  139.705 1.00 64.17  ? 52  ASP H O     1 
ATOM   5426  C CB    . ASP H 4  55  ? 137.593 98.939  139.462 1.00 61.19  ? 52  ASP H CB    1 
ATOM   5427  C CG    . ASP H 4  55  ? 137.963 100.192 138.717 1.00 65.56  ? 52  ASP H CG    1 
ATOM   5428  O OD1   . ASP H 4  55  ? 137.527 100.362 137.570 1.00 59.90  ? 52  ASP H OD1   1 
ATOM   5429  O OD2   . ASP H 4  55  ? 138.710 100.963 139.261 1.00 81.74  ? 52  ASP H OD2   1 
ATOM   5430  N N     . THR H 4  56  ? 134.526 98.844  137.575 1.00 48.53  ? 53  THR H N     1 
ATOM   5431  C CA    . THR H 4  56  ? 133.244 99.523  137.490 1.00 48.31  ? 53  THR H CA    1 
ATOM   5432  C C     . THR H 4  56  ? 132.108 98.538  137.407 1.00 45.20  ? 53  THR H C     1 
ATOM   5433  O O     . THR H 4  56  ? 132.172 97.550  136.686 1.00 51.01  ? 53  THR H O     1 
ATOM   5434  C CB    . THR H 4  56  ? 133.247 100.491 136.311 1.00 45.85  ? 53  THR H CB    1 
ATOM   5435  O OG1   . THR H 4  56  ? 134.250 101.476 136.546 1.00 53.66  ? 53  THR H OG1   1 
ATOM   5436  C CG2   . THR H 4  56  ? 131.927 101.181 136.115 1.00 46.91  ? 53  THR H CG2   1 
ATOM   5437  N N     . GLY H 4  57  ? 131.084 98.755  138.204 1.00 48.60  ? 54  GLY H N     1 
ATOM   5438  C CA    . GLY H 4  57  ? 129.928 97.875  138.153 1.00 47.06  ? 54  GLY H CA    1 
ATOM   5439  C C     . GLY H 4  57  ? 128.824 98.505  137.342 1.00 48.27  ? 54  GLY H C     1 
ATOM   5440  O O     . GLY H 4  57  ? 128.960 99.629  136.858 1.00 52.09  ? 54  GLY H O     1 
ATOM   5441  N N     . ILE H 4  58  ? 127.736 97.793  137.172 1.00 46.73  ? 55  ILE H N     1 
ATOM   5442  C CA    . ILE H 4  58  ? 126.615 98.324  136.419 1.00 43.69  ? 55  ILE H CA    1 
ATOM   5443  C C     . ILE H 4  58  ? 125.312 98.030  137.135 1.00 47.61  ? 55  ILE H C     1 
ATOM   5444  O O     . ILE H 4  58  ? 125.096 96.905  137.564 1.00 74.49  ? 55  ILE H O     1 
ATOM   5445  C CB    . ILE H 4  58  ? 126.688 97.771  134.985 1.00 50.73  ? 55  ILE H CB    1 
ATOM   5446  C CG1   . ILE H 4  58  ? 125.606 98.360  134.113 1.00 49.99  ? 55  ILE H CG1   1 
ATOM   5447  C CG2   . ILE H 4  58  ? 126.661 96.270  134.995 1.00 69.74  ? 55  ILE H CG2   1 
ATOM   5448  C CD1   . ILE H 4  58  ? 125.790 98.151  132.612 1.00 43.44  ? 55  ILE H CD1   1 
ATOM   5449  N N     . SER H 4  59  ? 124.420 99.006  137.228 1.00 50.12  ? 56  SER H N     1 
ATOM   5450  C CA    . SER H 4  59  ? 123.139 98.778  137.890 1.00 55.86  ? 56  SER H CA    1 
ATOM   5451  C C     . SER H 4  59  ? 122.231 97.934  137.036 1.00 52.53  ? 56  SER H C     1 
ATOM   5452  O O     . SER H 4  59  ? 122.444 97.814  135.827 1.00 51.23  ? 56  SER H O     1 
ATOM   5453  C CB    . SER H 4  59  ? 122.429 100.073 138.170 1.00 51.06  ? 56  SER H CB    1 
ATOM   5454  O OG    . SER H 4  59  ? 121.952 100.665 136.994 1.00 51.04  ? 56  SER H OG    1 
ATOM   5455  N N     . SER H 4  60  ? 121.180 97.374  137.634 1.00 65.44  ? 57  SER H N     1 
ATOM   5456  C CA    . SER H 4  60  ? 120.254 96.557  136.860 1.00 57.25  ? 57  SER H CA    1 
ATOM   5457  C C     . SER H 4  60  ? 119.447 97.358  135.879 1.00 50.03  ? 57  SER H C     1 
ATOM   5458  O O     . SER H 4  60  ? 119.075 96.847  134.821 1.00 52.77  ? 57  SER H O     1 
ATOM   5459  C CB    . SER H 4  60  ? 119.287 95.862  137.755 1.00 80.25  ? 57  SER H CB    1 
ATOM   5460  O OG    . SER H 4  60  ? 118.399 96.781  138.301 1.00 101.74 ? 57  SER H OG    1 
ATOM   5461  N N     . LYS H 4  61  ? 119.221 98.625  136.166 1.00 51.30  ? 58  LYS H N     1 
ATOM   5462  C CA    . LYS H 4  61  ? 118.493 99.429  135.215 1.00 47.13  ? 58  LYS H CA    1 
ATOM   5463  C C     . LYS H 4  61  ? 119.402 99.762  134.060 1.00 41.62  ? 58  LYS H C     1 
ATOM   5464  O O     . LYS H 4  61  ? 118.958 99.814  132.913 1.00 43.71  ? 58  LYS H O     1 
ATOM   5465  C CB    . LYS H 4  61  ? 117.970 100.686 135.846 1.00 54.39  ? 58  LYS H CB    1 
ATOM   5466  C CG    . LYS H 4  61  ? 116.880 100.503 136.892 1.00 57.85  ? 58  LYS H CG    1 
ATOM   5467  C CD    . LYS H 4  61  ? 115.560 100.039 136.280 1.00 74.50  ? 58  LYS H CD    1 
ATOM   5468  C CE    . LYS H 4  61  ? 114.405 100.021 137.320 1.00 75.99  ? 58  LYS H CE    1 
ATOM   5469  N NZ    . LYS H 4  61  ? 113.089 99.529  136.721 1.00 9.41   ? 58  LYS H NZ    1 
ATOM   5470  N N     . ALA H 4  62  ? 120.677 99.997  134.342 1.00 38.80  ? 59  ALA H N     1 
ATOM   5471  C CA    . ALA H 4  62  ? 121.595 100.270 133.269 1.00 31.34  ? 59  ALA H CA    1 
ATOM   5472  C C     . ALA H 4  62  ? 121.708 99.047  132.395 1.00 35.74  ? 59  ALA H C     1 
ATOM   5473  O O     . ALA H 4  62  ? 121.818 99.165  131.177 1.00 33.93  ? 59  ALA H O     1 
ATOM   5474  C CB    . ALA H 4  62  ? 122.927 100.664 133.799 1.00 39.42  ? 59  ALA H CB    1 
ATOM   5475  N N     . MET H 4  63  ? 121.653 97.864  132.996 1.00 39.27  ? 60  MET H N     1 
ATOM   5476  C CA    . MET H 4  63  ? 121.733 96.650  132.224 1.00 30.74  ? 60  MET H CA    1 
ATOM   5477  C C     . MET H 4  63  ? 120.501 96.498  131.362 1.00 27.19  ? 60  MET H C     1 
ATOM   5478  O O     . MET H 4  63  ? 120.595 96.116  130.197 1.00 33.58  ? 60  MET H O     1 
ATOM   5479  C CB    . MET H 4  63  ? 121.898 95.458  133.128 1.00 34.92  ? 60  MET H CB    1 
ATOM   5480  C CG    . MET H 4  63  ? 122.142 94.212  132.395 1.00 36.98  ? 60  MET H CG    1 
ATOM   5481  S SD    . MET H 4  63  ? 123.605 94.298  131.446 1.00 40.51  ? 60  MET H SD    1 
ATOM   5482  C CE    . MET H 4  63  ? 124.866 93.913  132.610 1.00 49.23  ? 60  MET H CE    1 
ATOM   5483  N N     . GLY H 4  64  ? 119.339 96.876  131.875 1.00 30.60  ? 61  GLY H N     1 
ATOM   5484  C CA    . GLY H 4  64  ? 118.125 96.794  131.083 1.00 25.21  ? 61  GLY H CA    1 
ATOM   5485  C C     . GLY H 4  64  ? 118.258 97.638  129.826 1.00 24.90  ? 61  GLY H C     1 
ATOM   5486  O O     . GLY H 4  64  ? 117.745 97.269  128.764 1.00 28.52  ? 61  GLY H O     1 
ATOM   5487  N N     . ILE H 4  65  ? 118.953 98.762  129.940 1.00 27.41  ? 62  ILE H N     1 
ATOM   5488  C CA    . ILE H 4  65  ? 119.192 99.628  128.808 1.00 21.73  ? 62  ILE H CA    1 
ATOM   5489  C C     . ILE H 4  65  ? 120.157 98.997  127.852 1.00 22.65  ? 62  ILE H C     1 
ATOM   5490  O O     . ILE H 4  65  ? 119.918 99.007  126.647 1.00 23.55  ? 62  ILE H O     1 
ATOM   5491  C CB    . ILE H 4  65  ? 119.695 100.981 129.234 1.00 20.84  ? 62  ILE H CB    1 
ATOM   5492  C CG1   . ILE H 4  65  ? 118.605 101.661 129.963 1.00 24.09  ? 62  ILE H CG1   1 
ATOM   5493  C CG2   . ILE H 4  65  ? 120.100 101.775 127.996 1.00 26.95  ? 62  ILE H CG2   1 
ATOM   5494  C CD1   . ILE H 4  65  ? 119.041 102.824 130.725 1.00 33.48  ? 62  ILE H CD1   1 
ATOM   5495  N N     . MET H 4  66  ? 121.236 98.422  128.353 1.00 25.53  ? 63  MET H N     1 
ATOM   5496  C CA    . MET H 4  66  ? 122.177 97.816  127.438 1.00 20.80  ? 63  MET H CA    1 
ATOM   5497  C C     . MET H 4  66  ? 121.525 96.682  126.667 1.00 23.04  ? 63  MET H C     1 
ATOM   5498  O O     . MET H 4  66  ? 121.840 96.492  125.495 1.00 23.24  ? 63  MET H O     1 
ATOM   5499  C CB    . MET H 4  66  ? 123.393 97.318  128.166 1.00 22.64  ? 63  MET H CB    1 
ATOM   5500  C CG    . MET H 4  66  ? 124.262 98.399  128.723 1.00 23.84  ? 63  MET H CG    1 
ATOM   5501  S SD    . MET H 4  66  ? 124.828 99.547  127.522 1.00 20.75  ? 63  MET H SD    1 
ATOM   5502  C CE    . MET H 4  66  ? 125.879 98.600  126.494 1.00 29.13  ? 63  MET H CE    1 
ATOM   5503  N N     . ASN H 4  67  ? 120.583 95.963  127.263 1.00 24.95  ? 64  ASN H N     1 
ATOM   5504  C CA    . ASN H 4  67  ? 119.920 94.933  126.494 1.00 16.98  ? 64  ASN H CA    1 
ATOM   5505  C C     . ASN H 4  67  ? 118.991 95.515  125.458 1.00 20.02  ? 64  ASN H C     1 
ATOM   5506  O O     . ASN H 4  67  ? 118.932 94.989  124.346 1.00 19.29  ? 64  ASN H O     1 
ATOM   5507  C CB    . ASN H 4  67  ? 119.176 93.975  127.356 1.00 18.95  ? 64  ASN H CB    1 
ATOM   5508  C CG    . ASN H 4  67  ? 120.047 93.032  127.959 1.00 32.18  ? 64  ASN H CG    1 
ATOM   5509  O OD1   . ASN H 4  67  ? 120.463 92.094  127.268 1.00 43.78  ? 64  ASN H OD1   1 
ATOM   5510  N ND2   . ASN H 4  67  ? 120.360 93.205  129.194 1.00 38.83  ? 64  ASN H ND2   1 
ATOM   5511  N N     . SER H 4  68  ? 118.321 96.633  125.735 1.00 20.21  ? 65  SER H N     1 
ATOM   5512  C CA    . SER H 4  68  ? 117.492 97.197  124.689 1.00 10.39  ? 65  SER H CA    1 
ATOM   5513  C C     . SER H 4  68  ? 118.378 97.652  123.556 1.00 14.83  ? 65  SER H C     1 
ATOM   5514  O O     . SER H 4  68  ? 118.027 97.490  122.387 1.00 15.87  ? 65  SER H O     1 
ATOM   5515  C CB    . SER H 4  68  ? 116.687 98.366  125.174 1.00 17.36  ? 65  SER H CB    1 
ATOM   5516  O OG    . SER H 4  68  ? 115.714 97.994  126.103 1.00 21.42  ? 65  SER H OG    1 
ATOM   5517  N N     . PHE H 4  69  ? 119.539 98.202  123.885 1.00 15.78  ? 66  PHE H N     1 
ATOM   5518  C CA    . PHE H 4  69  ? 120.469 98.663  122.882 1.00 10.38  ? 66  PHE H CA    1 
ATOM   5519  C C     . PHE H 4  69  ? 120.935 97.560  121.979 1.00 14.20  ? 66  PHE H C     1 
ATOM   5520  O O     . PHE H 4  69  ? 120.860 97.688  120.758 1.00 8.51   ? 66  PHE H O     1 
ATOM   5521  C CB    . PHE H 4  69  ? 121.660 99.322  123.515 1.00 10.72  ? 66  PHE H CB    1 
ATOM   5522  C CG    . PHE H 4  69  ? 122.689 99.658  122.577 1.00 6.71   ? 66  PHE H CG    1 
ATOM   5523  C CD1   . PHE H 4  69  ? 122.573 100.719 121.758 1.00 10.48  ? 66  PHE H CD1   1 
ATOM   5524  C CD2   . PHE H 4  69  ? 123.806 98.909  122.514 1.00 10.19  ? 66  PHE H CD2   1 
ATOM   5525  C CE1   . PHE H 4  69  ? 123.563 101.021 120.884 1.00 8.09   ? 66  PHE H CE1   1 
ATOM   5526  C CE2   . PHE H 4  69  ? 124.789 99.208  121.645 1.00 9.37   ? 66  PHE H CE2   1 
ATOM   5527  C CZ    . PHE H 4  69  ? 124.659 100.272 120.830 1.00 7.84   ? 66  PHE H CZ    1 
ATOM   5528  N N     . VAL H 4  70  ? 121.383 96.449  122.544 1.00 16.98  ? 67  VAL H N     1 
ATOM   5529  C CA    . VAL H 4  70  ? 121.886 95.388  121.705 1.00 10.24  ? 67  VAL H CA    1 
ATOM   5530  C C     . VAL H 4  70  ? 120.790 94.851  120.834 1.00 9.07   ? 67  VAL H C     1 
ATOM   5531  O O     . VAL H 4  70  ? 121.026 94.583  119.661 1.00 14.49  ? 67  VAL H O     1 
ATOM   5532  C CB    . VAL H 4  70  ? 122.518 94.263  122.510 1.00 15.67  ? 67  VAL H CB    1 
ATOM   5533  C CG1   . VAL H 4  70  ? 122.855 93.105  121.613 1.00 21.78  ? 67  VAL H CG1   1 
ATOM   5534  C CG2   . VAL H 4  70  ? 123.768 94.760  123.160 1.00 16.82  ? 67  VAL H CG2   1 
ATOM   5535  N N     . ASN H 4  71  ? 119.594 94.669  121.368 1.00 13.67  ? 68  ASN H N     1 
ATOM   5536  C CA    . ASN H 4  71  ? 118.542 94.155  120.528 1.00 8.95   ? 68  ASN H CA    1 
ATOM   5537  C C     . ASN H 4  71  ? 118.181 95.109  119.418 1.00 13.87  ? 68  ASN H C     1 
ATOM   5538  O O     . ASN H 4  71  ? 117.914 94.665  118.303 1.00 14.48  ? 68  ASN H O     1 
ATOM   5539  C CB    . ASN H 4  71  ? 117.319 93.854  121.337 1.00 6.70   ? 68  ASN H CB    1 
ATOM   5540  C CG    . ASN H 4  71  ? 117.452 92.650  122.117 1.00 10.35  ? 68  ASN H CG    1 
ATOM   5541  O OD1   . ASN H 4  71  ? 118.207 91.751  121.764 1.00 24.64  ? 68  ASN H OD1   1 
ATOM   5542  N ND2   . ASN H 4  71  ? 116.744 92.569  123.193 1.00 12.88  ? 68  ASN H ND2   1 
ATOM   5543  N N     . ASP H 4  72  ? 118.253 96.413  119.660 1.00 14.68  ? 69  ASP H N     1 
ATOM   5544  C CA    . ASP H 4  72  ? 117.908 97.374  118.632 1.00 7.35   ? 69  ASP H CA    1 
ATOM   5545  C C     . ASP H 4  72  ? 118.954 97.389  117.534 1.00 10.85  ? 69  ASP H C     1 
ATOM   5546  O O     . ASP H 4  72  ? 118.619 97.365  116.349 1.00 12.81  ? 69  ASP H O     1 
ATOM   5547  C CB    . ASP H 4  72  ? 117.773 98.745  119.265 1.00 11.60  ? 69  ASP H CB    1 
ATOM   5548  C CG    . ASP H 4  72  ? 117.173 99.789  118.395 1.00 15.18  ? 69  ASP H CG    1 
ATOM   5549  O OD1   . ASP H 4  72  ? 116.538 99.460  117.433 1.00 16.13  ? 69  ASP H OD1   1 
ATOM   5550  O OD2   . ASP H 4  72  ? 117.313 100.951 118.729 1.00 17.32  ? 69  ASP H OD2   1 
ATOM   5551  N N     . ILE H 4  73  ? 120.227 97.362  117.889 1.00 11.71  ? 70  ILE H N     1 
ATOM   5552  C CA    . ILE H 4  73  ? 121.216 97.380  116.836 1.00 6.88   ? 70  ILE H CA    1 
ATOM   5553  C C     . ILE H 4  73  ? 121.128 96.102  116.037 1.00 11.76  ? 70  ILE H C     1 
ATOM   5554  O O     . ILE H 4  73  ? 121.229 96.135  114.810 1.00 10.31  ? 70  ILE H O     1 
ATOM   5555  C CB    . ILE H 4  73  ? 122.636 97.572  117.350 1.00 7.43   ? 70  ILE H CB    1 
ATOM   5556  C CG1   . ILE H 4  73  ? 122.813 98.931  118.035 1.00 8.80   ? 70  ILE H CG1   1 
ATOM   5557  C CG2   . ILE H 4  73  ? 123.607 97.416  116.229 1.00 5.27   ? 70  ILE H CG2   1 
ATOM   5558  C CD1   . ILE H 4  73  ? 122.564 100.179 117.202 1.00 13.27  ? 70  ILE H CD1   1 
ATOM   5559  N N     . PHE H 4  74  ? 120.964 94.966  116.697 1.00 11.79  ? 71  PHE H N     1 
ATOM   5560  C CA    . PHE H 4  74  ? 120.869 93.720  115.978 1.00 6.28   ? 71  PHE H CA    1 
ATOM   5561  C C     . PHE H 4  74  ? 119.772 93.787  114.968 1.00 8.30   ? 71  PHE H C     1 
ATOM   5562  O O     . PHE H 4  74  ? 119.973 93.438  113.808 1.00 14.10  ? 71  PHE H O     1 
ATOM   5563  C CB    . PHE H 4  74  ? 120.548 92.571  116.912 1.00 13.20  ? 71  PHE H CB    1 
ATOM   5564  C CG    . PHE H 4  74  ? 120.304 91.273  116.231 1.00 12.64  ? 71  PHE H CG    1 
ATOM   5565  C CD1   . PHE H 4  74  ? 121.297 90.423  115.960 1.00 13.45  ? 71  PHE H CD1   1 
ATOM   5566  C CD2   . PHE H 4  74  ? 119.051 90.921  115.835 1.00 17.79  ? 71  PHE H CD2   1 
ATOM   5567  C CE1   . PHE H 4  74  ? 121.049 89.266  115.325 1.00 17.30  ? 71  PHE H CE1   1 
ATOM   5568  C CE2   . PHE H 4  74  ? 118.819 89.767  115.196 1.00 18.21  ? 71  PHE H CE2   1 
ATOM   5569  C CZ    . PHE H 4  74  ? 119.822 88.946  114.947 1.00 19.50  ? 71  PHE H CZ    1 
ATOM   5570  N N     . GLU H 4  75  ? 118.590 94.215  115.374 1.00 10.40  ? 72  GLU H N     1 
ATOM   5571  C CA    . GLU H 4  75  ? 117.513 94.237  114.426 1.00 5.60   ? 72  GLU H CA    1 
ATOM   5572  C C     . GLU H 4  75  ? 117.766 95.149  113.265 1.00 11.27  ? 72  GLU H C     1 
ATOM   5573  O O     . GLU H 4  75  ? 117.416 94.805  112.139 1.00 14.67  ? 72  GLU H O     1 
ATOM   5574  C CB    . GLU H 4  75  ? 116.217 94.618  115.071 1.00 1.51   ? 72  GLU H CB    1 
ATOM   5575  C CG    . GLU H 4  75  ? 115.053 94.611  114.114 1.00 0.64   ? 72  GLU H CG    1 
ATOM   5576  C CD    . GLU H 4  75  ? 113.708 94.865  114.794 0.00 8.40   ? 72  GLU H CD    1 
ATOM   5577  O OE1   . GLU H 4  75  ? 113.680 94.949  115.992 0.00 8.72   ? 72  GLU H OE1   1 
ATOM   5578  O OE2   . GLU H 4  75  ? 112.708 94.990  114.103 0.00 3.44   ? 72  GLU H OE2   1 
ATOM   5579  N N     . ARG H 4  76  ? 118.337 96.319  113.486 1.00 12.54  ? 73  ARG H N     1 
ATOM   5580  C CA    . ARG H 4  76  ? 118.533 97.189  112.350 1.00 7.76   ? 73  ARG H CA    1 
ATOM   5581  C C     . ARG H 4  76  ? 119.517 96.629  111.360 1.00 12.45  ? 73  ARG H C     1 
ATOM   5582  O O     . ARG H 4  76  ? 119.288 96.715  110.153 1.00 16.28  ? 73  ARG H O     1 
ATOM   5583  C CB    . ARG H 4  76  ? 119.113 98.482  112.753 1.00 9.20   ? 73  ARG H CB    1 
ATOM   5584  C CG    . ARG H 4  76  ? 118.302 99.359  113.513 1.00 9.57   ? 73  ARG H CG    1 
ATOM   5585  C CD    . ARG H 4  76  ? 119.085 100.524 113.851 1.00 7.84   ? 73  ARG H CD    1 
ATOM   5586  N NE    . ARG H 4  76  ? 118.436 101.341 114.762 1.00 11.52  ? 73  ARG H NE    1 
ATOM   5587  C CZ    . ARG H 4  76  ? 118.944 102.447 115.291 1.00 13.55  ? 73  ARG H CZ    1 
ATOM   5588  N NH1   . ARG H 4  76  ? 120.109 102.893 114.953 1.00 19.77  ? 73  ARG H NH1   1 
ATOM   5589  N NH2   . ARG H 4  76  ? 118.262 103.116 116.165 1.00 16.34  ? 73  ARG H NH2   1 
ATOM   5590  N N     . ILE H 4  77  ? 120.607 96.036  111.839 1.00 12.44  ? 74  ILE H N     1 
ATOM   5591  C CA    . ILE H 4  77  ? 121.578 95.525  110.905 1.00 7.74   ? 74  ILE H CA    1 
ATOM   5592  C C     . ILE H 4  77  ? 121.005 94.354  110.176 1.00 12.25  ? 74  ILE H C     1 
ATOM   5593  O O     . ILE H 4  77  ? 121.162 94.244  108.964 1.00 16.39  ? 74  ILE H O     1 
ATOM   5594  C CB    . ILE H 4  77  ? 122.894 95.138  111.557 1.00 9.36   ? 74  ILE H CB    1 
ATOM   5595  C CG1   . ILE H 4  77  ? 123.567 96.369  112.086 1.00 7.30   ? 74  ILE H CG1   1 
ATOM   5596  C CG2   . ILE H 4  77  ? 123.773 94.478  110.523 1.00 3.52   ? 74  ILE H CG2   1 
ATOM   5597  C CD1   . ILE H 4  77  ? 124.732 96.107  112.984 1.00 1.89   ? 74  ILE H CD1   1 
ATOM   5598  N N     . ALA H 4  78  ? 120.374 93.442  110.891 1.00 14.15  ? 75  ALA H N     1 
ATOM   5599  C CA    . ALA H 4  78  ? 119.796 92.292  110.245 1.00 9.55   ? 75  ALA H CA    1 
ATOM   5600  C C     . ALA H 4  78  ? 118.713 92.704  109.276 1.00 13.25  ? 75  ALA H C     1 
ATOM   5601  O O     . ALA H 4  78  ? 118.558 92.090  108.222 1.00 21.84  ? 75  ALA H O     1 
ATOM   5602  C CB    . ALA H 4  78  ? 119.244 91.351  111.273 1.00 20.10  ? 75  ALA H CB    1 
ATOM   5603  N N     . GLY H 4  79  ? 117.941 93.723  109.618 1.00 14.05  ? 76  GLY H N     1 
ATOM   5604  C CA    . GLY H 4  79  ? 116.881 94.203  108.765 1.00 14.30  ? 76  GLY H CA    1 
ATOM   5605  C C     . GLY H 4  79  ? 117.422 94.761  107.466 1.00 16.57  ? 76  GLY H C     1 
ATOM   5606  O O     . GLY H 4  79  ? 116.917 94.443  106.387 1.00 24.45  ? 76  GLY H O     1 
ATOM   5607  N N     . GLU H 4  80  ? 118.454 95.585  107.541 1.00 15.35  ? 77  GLU H N     1 
ATOM   5608  C CA    . GLU H 4  80  ? 118.992 96.135  106.324 1.00 8.11   ? 77  GLU H CA    1 
ATOM   5609  C C     . GLU H 4  80  ? 119.668 95.050  105.513 1.00 17.70  ? 77  GLU H C     1 
ATOM   5610  O O     . GLU H 4  80  ? 119.542 95.027  104.290 1.00 16.95  ? 77  GLU H O     1 
ATOM   5611  C CB    . GLU H 4  80  ? 119.962 97.239  106.623 1.00 7.62   ? 77  GLU H CB    1 
ATOM   5612  C CG    . GLU H 4  80  ? 120.510 97.954  105.421 1.00 8.27   ? 77  GLU H CG    1 
ATOM   5613  C CD    . GLU H 4  80  ? 119.482 98.734  104.657 1.00 16.00  ? 77  GLU H CD    1 
ATOM   5614  O OE1   . GLU H 4  80  ? 118.481 99.051  105.232 1.00 21.46  ? 77  GLU H OE1   1 
ATOM   5615  O OE2   . GLU H 4  80  ? 119.706 99.037  103.495 1.00 20.40  ? 77  GLU H OE2   1 
ATOM   5616  N N     . ALA H 4  81  ? 120.372 94.123  106.156 1.00 17.73  ? 78  ALA H N     1 
ATOM   5617  C CA    . ALA H 4  81  ? 121.018 93.076  105.395 1.00 11.82  ? 78  ALA H CA    1 
ATOM   5618  C C     . ALA H 4  81  ? 119.983 92.249  104.660 1.00 15.60  ? 78  ALA H C     1 
ATOM   5619  O O     . ALA H 4  81  ? 120.217 91.841  103.522 1.00 23.79  ? 78  ALA H O     1 
ATOM   5620  C CB    . ALA H 4  81  ? 121.855 92.224  106.286 1.00 17.20  ? 78  ALA H CB    1 
ATOM   5621  N N     . SER H 4  82  ? 118.822 92.035  105.268 1.00 16.60  ? 79  SER H N     1 
ATOM   5622  C CA    . SER H 4  82  ? 117.760 91.307  104.611 1.00 15.00  ? 79  SER H CA    1 
ATOM   5623  C C     . SER H 4  82  ? 117.316 92.005  103.367 1.00 20.22  ? 79  SER H C     1 
ATOM   5624  O O     . SER H 4  82  ? 117.149 91.378  102.315 1.00 27.22  ? 79  SER H O     1 
ATOM   5625  C CB    . SER H 4  82  ? 116.568 91.193  105.498 1.00 20.54  ? 79  SER H CB    1 
ATOM   5626  O OG    . SER H 4  82  ? 115.536 90.565  104.826 1.00 28.67  ? 79  SER H OG    1 
ATOM   5627  N N     . ARG H 4  83  ? 117.125 93.308  103.466 1.00 20.85  ? 80  ARG H N     1 
ATOM   5628  C CA    . ARG H 4  83  ? 116.709 94.088  102.330 1.00 13.54  ? 80  ARG H CA    1 
ATOM   5629  C C     . ARG H 4  83  ? 117.719 94.053  101.216 1.00 16.58  ? 80  ARG H C     1 
ATOM   5630  O O     . ARG H 4  83  ? 117.333 93.975  100.053 1.00 22.17  ? 80  ARG H O     1 
ATOM   5631  C CB    . ARG H 4  83  ? 116.495 95.494  102.716 1.00 15.25  ? 80  ARG H CB    1 
ATOM   5632  C CG    . ARG H 4  83  ? 115.944 96.338  101.674 1.00 23.15  ? 80  ARG H CG    1 
ATOM   5633  C CD    . ARG H 4  83  ? 115.805 97.763  102.131 1.00 25.22  ? 80  ARG H CD    1 
ATOM   5634  N NE    . ARG H 4  83  ? 114.812 97.960  103.154 1.00 19.62  ? 80  ARG H NE    1 
ATOM   5635  C CZ    . ARG H 4  83  ? 113.494 98.158  102.948 1.00 31.74  ? 80  ARG H CZ    1 
ATOM   5636  N NH1   . ARG H 4  83  ? 112.980 98.189  101.740 1.00 23.48  ? 80  ARG H NH1   1 
ATOM   5637  N NH2   . ARG H 4  83  ? 112.710 98.328  103.980 1.00 31.13  ? 80  ARG H NH2   1 
ATOM   5638  N N     . LEU H 4  84  ? 119.007 94.129  101.537 1.00 19.44  ? 81  LEU H N     1 
ATOM   5639  C CA    . LEU H 4  84  ? 120.008 94.085  100.488 1.00 16.42  ? 81  LEU H CA    1 
ATOM   5640  C C     . LEU H 4  84  ? 119.972 92.764  99.766  1.00 19.30  ? 81  LEU H C     1 
ATOM   5641  O O     . LEU H 4  84  ? 120.086 92.722  98.536  1.00 22.94  ? 81  LEU H O     1 
ATOM   5642  C CB    . LEU H 4  84  ? 121.404 94.243  101.073 1.00 15.99  ? 81  LEU H CB    1 
ATOM   5643  C CG    . LEU H 4  84  ? 121.791 95.577  101.599 1.00 12.39  ? 81  LEU H CG    1 
ATOM   5644  C CD1   . LEU H 4  84  ? 123.050 95.446  102.379 1.00 15.89  ? 81  LEU H CD1   1 
ATOM   5645  C CD2   . LEU H 4  84  ? 122.055 96.495  100.474 1.00 18.26  ? 81  LEU H CD2   1 
ATOM   5646  N N     . ALA H 4  85  ? 119.805 91.672  100.500 1.00 20.77  ? 82  ALA H N     1 
ATOM   5647  C CA    . ALA H 4  85  ? 119.747 90.403  99.832  1.00 14.47  ? 82  ALA H CA    1 
ATOM   5648  C C     . ALA H 4  85  ? 118.547 90.364  98.922  1.00 19.20  ? 82  ALA H C     1 
ATOM   5649  O O     . ALA H 4  85  ? 118.636 89.901  97.791  1.00 28.69  ? 82  ALA H O     1 
ATOM   5650  C CB    . ALA H 4  85  ? 119.681 89.281  100.837 1.00 25.13  ? 82  ALA H CB    1 
ATOM   5651  N N     . HIS H 4  86  ? 117.429 90.913  99.355  1.00 20.67  ? 83  HIS H N     1 
ATOM   5652  C CA    . HIS H 4  86  ? 116.253 90.899  98.509  1.00 23.04  ? 83  HIS H CA    1 
ATOM   5653  C C     . HIS H 4  86  ? 116.458 91.735  97.265  1.00 23.31  ? 83  HIS H C     1 
ATOM   5654  O O     . HIS H 4  86  ? 116.178 91.306  96.155  1.00 31.63  ? 83  HIS H O     1 
ATOM   5655  C CB    . HIS H 4  86  ? 115.039 91.390  99.260  1.00 27.68  ? 83  HIS H CB    1 
ATOM   5656  C CG    . HIS H 4  86  ? 113.812 91.362  98.458  1.00 36.78  ? 83  HIS H CG    1 
ATOM   5657  N ND1   . HIS H 4  86  ? 113.166 90.198  98.120  1.00 42.20  ? 83  HIS H ND1   1 
ATOM   5658  C CD2   . HIS H 4  86  ? 113.095 92.362  97.914  1.00 47.30  ? 83  HIS H CD2   1 
ATOM   5659  C CE1   . HIS H 4  86  ? 112.098 90.488  97.396  1.00 46.06  ? 83  HIS H CE1   1 
ATOM   5660  N NE2   . HIS H 4  86  ? 112.033 91.795  97.264  1.00 51.68  ? 83  HIS H NE2   1 
ATOM   5661  N N     . TYR H 4  87  ? 116.982 92.933  97.424  1.00 23.94  ? 84  TYR H N     1 
ATOM   5662  C CA    . TYR H 4  87  ? 117.207 93.844  96.314  1.00 21.85  ? 84  TYR H CA    1 
ATOM   5663  C C     . TYR H 4  87  ? 118.044 93.221  95.217  1.00 22.04  ? 84  TYR H C     1 
ATOM   5664  O O     . TYR H 4  87  ? 117.775 93.404  94.033  1.00 27.16  ? 84  TYR H O     1 
ATOM   5665  C CB    . TYR H 4  87  ? 117.805 95.162  96.819  1.00 21.26  ? 84  TYR H CB    1 
ATOM   5666  C CG    . TYR H 4  87  ? 118.227 96.145  95.740  1.00 24.64  ? 84  TYR H CG    1 
ATOM   5667  C CD1   . TYR H 4  87  ? 117.473 96.322  94.611  1.00 32.11  ? 84  TYR H CD1   1 
ATOM   5668  C CD2   . TYR H 4  87  ? 119.361 96.906  95.909  1.00 23.49  ? 84  TYR H CD2   1 
ATOM   5669  C CE1   . TYR H 4  87  ? 117.860 97.209  93.652  1.00 21.68  ? 84  TYR H CE1   1 
ATOM   5670  C CE2   . TYR H 4  87  ? 119.739 97.816  94.940  1.00 13.89  ? 84  TYR H CE2   1 
ATOM   5671  C CZ    . TYR H 4  87  ? 118.989 97.954  93.817  1.00 11.98  ? 84  TYR H CZ    1 
ATOM   5672  O OH    . TYR H 4  87  ? 119.332 98.843  92.833  1.00 19.18  ? 84  TYR H OH    1 
ATOM   5673  N N     . ASN H 4  88  ? 119.053 92.466  95.593  1.00 22.31  ? 85  ASN H N     1 
ATOM   5674  C CA    . ASN H 4  88  ? 119.944 91.880  94.623  1.00 20.94  ? 85  ASN H CA    1 
ATOM   5675  C C     . ASN H 4  88  ? 119.525 90.480  94.216  1.00 25.16  ? 85  ASN H C     1 
ATOM   5676  O O     . ASN H 4  88  ? 120.259 89.784  93.506  1.00 31.22  ? 85  ASN H O     1 
ATOM   5677  C CB    . ASN H 4  88  ? 121.328 91.907  95.174  1.00 15.57  ? 85  ASN H CB    1 
ATOM   5678  C CG    . ASN H 4  88  ? 121.795 93.272  95.239  1.00 21.93  ? 85  ASN H CG    1 
ATOM   5679  O OD1   . ASN H 4  88  ? 122.215 93.852  94.238  1.00 35.25  ? 85  ASN H OD1   1 
ATOM   5680  N ND2   . ASN H 4  88  ? 121.713 93.848  96.395  1.00 24.44  ? 85  ASN H ND2   1 
ATOM   5681  N N     . LYS H 4  89  ? 118.311 90.109  94.626  1.00 25.92  ? 86  LYS H N     1 
ATOM   5682  C CA    . LYS H 4  89  ? 117.686 88.842  94.278  1.00 27.52  ? 86  LYS H CA    1 
ATOM   5683  C C     . LYS H 4  89  ? 118.483 87.645  94.778  1.00 29.39  ? 86  LYS H C     1 
ATOM   5684  O O     . LYS H 4  89  ? 118.684 86.678  94.044  1.00 34.42  ? 86  LYS H O     1 
ATOM   5685  C CB    . LYS H 4  89  ? 117.488 88.762  92.765  1.00 32.08  ? 86  LYS H CB    1 
ATOM   5686  C CG    . LYS H 4  89  ? 116.622 89.881  92.204  1.00 36.12  ? 86  LYS H CG    1 
ATOM   5687  C CD    . LYS H 4  89  ? 116.508 89.790  90.690  1.00 41.97  ? 86  LYS H CD    1 
ATOM   5688  C CE    . LYS H 4  89  ? 115.672 90.930  90.122  1.00 47.74  ? 86  LYS H CE    1 
ATOM   5689  N NZ    . LYS H 4  89  ? 114.213 90.688  90.299  1.00 49.63  ? 86  LYS H NZ    1 
ATOM   5690  N N     . ARG H 4  90  ? 118.917 87.696  96.036  1.00 26.95  ? 87  ARG H N     1 
ATOM   5691  C CA    . ARG H 4  90  ? 119.646 86.605  96.631  1.00 27.37  ? 87  ARG H CA    1 
ATOM   5692  C C     . ARG H 4  90  ? 118.885 86.106  97.820  1.00 30.59  ? 87  ARG H C     1 
ATOM   5693  O O     . ARG H 4  90  ? 118.043 86.810  98.369  1.00 36.15  ? 87  ARG H O     1 
ATOM   5694  C CB    . ARG H 4  90  ? 120.994 87.044  97.089  1.00 28.93  ? 87  ARG H CB    1 
ATOM   5695  C CG    . ARG H 4  90  ? 121.801 87.695  96.091  1.00 34.12  ? 87  ARG H CG    1 
ATOM   5696  C CD    . ARG H 4  90  ? 122.091 86.847  95.022  1.00 40.62  ? 87  ARG H CD    1 
ATOM   5697  N NE    . ARG H 4  90  ? 122.891 87.480  94.065  1.00 50.27  ? 87  ARG H NE    1 
ATOM   5698  C CZ    . ARG H 4  90  ? 124.215 87.428  94.003  1.00 63.78  ? 87  ARG H CZ    1 
ATOM   5699  N NH1   . ARG H 4  90  ? 124.911 86.761  94.885  1.00 59.01  ? 87  ARG H NH1   1 
ATOM   5700  N NH2   . ARG H 4  90  ? 124.816 88.046  93.022  1.00 81.25  ? 87  ARG H NH2   1 
ATOM   5701  N N     . SER H 4  91  ? 119.151 84.876  98.229  1.00 32.83  ? 88  SER H N     1 
ATOM   5702  C CA    . SER H 4  91  ? 118.460 84.328  99.373  1.00 28.72  ? 88  SER H CA    1 
ATOM   5703  C C     . SER H 4  91  ? 119.375 84.122  100.559 1.00 30.56  ? 88  SER H C     1 
ATOM   5704  O O     . SER H 4  91  ? 118.955 83.589  101.592 1.00 38.24  ? 88  SER H O     1 
ATOM   5705  C CB    . SER H 4  91  ? 117.827 83.034  98.975  1.00 40.32  ? 88  SER H CB    1 
ATOM   5706  O OG    . SER H 4  91  ? 118.797 82.122  98.589  1.00 40.03  ? 88  SER H OG    1 
ATOM   5707  N N     . THR H 4  92  ? 120.622 84.550  100.433 1.00 28.33  ? 89  THR H N     1 
ATOM   5708  C CA    . THR H 4  92  ? 121.589 84.297  101.480 1.00 25.02  ? 89  THR H CA    1 
ATOM   5709  C C     . THR H 4  92  ? 122.181 85.562  102.043 1.00 26.38  ? 89  THR H C     1 
ATOM   5710  O O     . THR H 4  92  ? 122.621 86.425  101.297 1.00 30.23  ? 89  THR H O     1 
ATOM   5711  C CB    . THR H 4  92  ? 122.772 83.483  100.931 1.00 26.37  ? 89  THR H CB    1 
ATOM   5712  O OG1   . THR H 4  92  ? 122.303 82.287  100.340 1.00 38.46  ? 89  THR H OG1   1 
ATOM   5713  C CG2   . THR H 4  92  ? 123.695 83.089  102.071 1.00 31.14  ? 89  THR H CG2   1 
ATOM   5714  N N     . ILE H 4  93  ? 122.249 85.644  103.359 1.00 24.67  ? 90  ILE H N     1 
ATOM   5715  C CA    . ILE H 4  93  ? 122.936 86.745  104.013 1.00 14.05  ? 90  ILE H CA    1 
ATOM   5716  C C     . ILE H 4  93  ? 124.336 86.305  104.316 1.00 13.64  ? 90  ILE H C     1 
ATOM   5717  O O     . ILE H 4  93  ? 124.546 85.313  104.998 1.00 22.04  ? 90  ILE H O     1 
ATOM   5718  C CB    . ILE H 4  93  ? 122.231 87.186  105.291 1.00 17.82  ? 90  ILE H CB    1 
ATOM   5719  C CG1   . ILE H 4  93  ? 120.873 87.721  104.930 1.00 21.01  ? 90  ILE H CG1   1 
ATOM   5720  C CG2   . ILE H 4  93  ? 123.067 88.178  106.049 1.00 17.46  ? 90  ILE H CG2   1 
ATOM   5721  C CD1   . ILE H 4  93  ? 119.955 87.991  106.102 1.00 27.57  ? 90  ILE H CD1   1 
ATOM   5722  N N     . THR H 4  94  ? 125.309 87.017  103.824 1.00 8.21   ? 91  THR H N     1 
ATOM   5723  C CA    . THR H 4  94  ? 126.684 86.633  104.033 1.00 7.25   ? 91  THR H CA    1 
ATOM   5724  C C     . THR H 4  94  ? 127.366 87.754  104.737 1.00 10.20  ? 91  THR H C     1 
ATOM   5725  O O     . THR H 4  94  ? 126.734 88.755  105.080 1.00 8.63   ? 91  THR H O     1 
ATOM   5726  C CB    . THR H 4  94  ? 127.424 86.377  102.740 1.00 4.06   ? 91  THR H CB    1 
ATOM   5727  O OG1   . THR H 4  94  ? 127.652 87.614  102.076 1.00 2.64   ? 91  THR H OG1   1 
ATOM   5728  C CG2   . THR H 4  94  ? 126.633 85.476  101.852 1.00 0.07   ? 91  THR H CG2   1 
ATOM   5729  N N     . SER H 4  95  ? 128.652 87.615  104.985 1.00 9.77   ? 92  SER H N     1 
ATOM   5730  C CA    . SER H 4  95  ? 129.348 88.679  105.655 1.00 6.66   ? 92  SER H CA    1 
ATOM   5731  C C     . SER H 4  95  ? 129.388 89.933  104.813 1.00 8.38   ? 92  SER H C     1 
ATOM   5732  O O     . SER H 4  95  ? 129.589 91.020  105.343 1.00 8.59   ? 92  SER H O     1 
ATOM   5733  C CB    . SER H 4  95  ? 130.748 88.264  105.992 1.00 10.69  ? 92  SER H CB    1 
ATOM   5734  O OG    . SER H 4  95  ? 131.501 88.091  104.843 1.00 10.76  ? 92  SER H OG    1 
ATOM   5735  N N     . ARG H 4  96  ? 129.174 89.836  103.511 1.00 10.51  ? 93  ARG H N     1 
ATOM   5736  C CA    . ARG H 4  96  ? 129.231 91.029  102.711 1.00 3.66   ? 93  ARG H CA    1 
ATOM   5737  C C     . ARG H 4  96  ? 128.014 91.889  102.965 1.00 7.78   ? 93  ARG H C     1 
ATOM   5738  O O     . ARG H 4  96  ? 128.136 93.101  103.067 1.00 6.79   ? 93  ARG H O     1 
ATOM   5739  C CB    . ARG H 4  96  ? 129.328 90.670  101.271 1.00 4.21   ? 93  ARG H CB    1 
ATOM   5740  C CG    . ARG H 4  96  ? 129.571 91.799  100.325 1.00 12.53  ? 93  ARG H CG    1 
ATOM   5741  C CD    . ARG H 4  96  ? 129.712 91.304  98.885  1.00 19.03  ? 93  ARG H CD    1 
ATOM   5742  N NE    . ARG H 4  96  ? 129.904 92.399  97.908  1.00 14.75  ? 93  ARG H NE    1 
ATOM   5743  C CZ    . ARG H 4  96  ? 131.062 92.984  97.568  1.00 13.67  ? 93  ARG H CZ    1 
ATOM   5744  N NH1   . ARG H 4  96  ? 132.217 92.649  98.067  1.00 4.51   ? 93  ARG H NH1   1 
ATOM   5745  N NH2   . ARG H 4  96  ? 130.970 93.915  96.700  1.00 18.94  ? 93  ARG H NH2   1 
ATOM   5746  N N     . GLU H 4  97  ? 126.836 91.298  103.088 1.00 7.64   ? 94  GLU H N     1 
ATOM   5747  C CA    . GLU H 4  97  ? 125.647 92.076  103.368 1.00 4.30   ? 94  GLU H CA    1 
ATOM   5748  C C     . GLU H 4  97  ? 125.703 92.656  104.730 1.00 9.27   ? 94  GLU H C     1 
ATOM   5749  O O     . GLU H 4  97  ? 125.220 93.762  104.944 1.00 9.11   ? 94  GLU H O     1 
ATOM   5750  C CB    . GLU H 4  97  ? 124.394 91.282  103.248 1.00 6.86   ? 94  GLU H CB    1 
ATOM   5751  C CG    . GLU H 4  97  ? 124.034 90.948  101.909 1.00 9.76   ? 94  GLU H CG    1 
ATOM   5752  C CD    . GLU H 4  97  ? 124.812 89.885  101.382 1.00 10.71  ? 94  GLU H CD    1 
ATOM   5753  O OE1   . GLU H 4  97  ? 125.549 89.298  102.135 1.00 12.61  ? 94  GLU H OE1   1 
ATOM   5754  O OE2   . GLU H 4  97  ? 124.724 89.625  100.221 1.00 5.14   ? 94  GLU H OE2   1 
ATOM   5755  N N     . ILE H 4  98  ? 126.258 91.932  105.676 1.00 10.28  ? 95  ILE H N     1 
ATOM   5756  C CA    . ILE H 4  98  ? 126.298 92.514  106.983 1.00 5.92   ? 95  ILE H CA    1 
ATOM   5757  C C     . ILE H 4  98  ? 127.206 93.723  106.893 1.00 8.08   ? 95  ILE H C     1 
ATOM   5758  O O     . ILE H 4  98  ? 126.880 94.761  107.449 1.00 9.13   ? 95  ILE H O     1 
ATOM   5759  C CB    . ILE H 4  98  ? 126.794 91.568  108.073 1.00 5.27   ? 95  ILE H CB    1 
ATOM   5760  C CG1   . ILE H 4  98  ? 125.873 90.320  108.230 1.00 6.72   ? 95  ILE H CG1   1 
ATOM   5761  C CG2   . ILE H 4  98  ? 126.826 92.336  109.372 1.00 2.30   ? 95  ILE H CG2   1 
ATOM   5762  C CD1   . ILE H 4  98  ? 124.434 90.546  108.654 1.00 3.13   ? 95  ILE H CD1   1 
ATOM   5763  N N     . GLN H 4  99  ? 128.339 93.621  106.208 1.00 9.22   ? 96  GLN H N     1 
ATOM   5764  C CA    . GLN H 4  99  ? 129.233 94.754  106.093 1.00 5.89   ? 96  GLN H CA    1 
ATOM   5765  C C     . GLN H 4  99  ? 128.619 95.950  105.411 1.00 7.78   ? 96  GLN H C     1 
ATOM   5766  O O     . GLN H 4  99  ? 128.805 97.080  105.864 1.00 8.58   ? 96  GLN H O     1 
ATOM   5767  C CB    . GLN H 4  99  ? 130.433 94.343  105.325 1.00 5.67   ? 96  GLN H CB    1 
ATOM   5768  C CG    . GLN H 4  99  ? 131.405 95.306  105.189 1.00 5.47   ? 96  GLN H CG    1 
ATOM   5769  C CD    . GLN H 4  99  ? 132.493 94.747  104.517 1.00 7.06   ? 96  GLN H CD    1 
ATOM   5770  O OE1   . GLN H 4  99  ? 132.586 94.741  103.300 1.00 0.36   ? 96  GLN H OE1   1 
ATOM   5771  N NE2   . GLN H 4  99  ? 133.376 94.213  105.278 1.00 8.87   ? 96  GLN H NE2   1 
ATOM   5772  N N     . THR H 4  100 ? 127.888 95.736  104.334 1.00 8.91   ? 97  THR H N     1 
ATOM   5773  C CA    . THR H 4  100 ? 127.249 96.846  103.672 1.00 6.15   ? 97  THR H CA    1 
ATOM   5774  C C     . THR H 4  100 ? 126.218 97.446  104.591 1.00 9.43   ? 97  THR H C     1 
ATOM   5775  O O     . THR H 4  100 ? 126.079 98.668  104.643 1.00 8.50   ? 97  THR H O     1 
ATOM   5776  C CB    . THR H 4  100 ? 126.646 96.461  102.327 1.00 8.50   ? 97  THR H CB    1 
ATOM   5777  O OG1   . THR H 4  100 ? 127.688 96.042  101.436 1.00 13.01  ? 97  THR H OG1   1 
ATOM   5778  C CG2   . THR H 4  100 ? 125.932 97.632  101.727 1.00 9.19   ? 97  THR H CG2   1 
ATOM   5779  N N     . ALA H 4  101 ? 125.453 96.620  105.296 1.00 8.65   ? 98  ALA H N     1 
ATOM   5780  C CA    . ALA H 4  101 ? 124.459 97.151  106.199 1.00 5.38   ? 98  ALA H CA    1 
ATOM   5781  C C     . ALA H 4  101 ? 125.113 97.996  107.275 1.00 6.65   ? 98  ALA H C     1 
ATOM   5782  O O     . ALA H 4  101 ? 124.591 99.051  107.622 1.00 10.95  ? 98  ALA H O     1 
ATOM   5783  C CB    . ALA H 4  101 ? 123.680 96.036  106.820 1.00 7.85   ? 98  ALA H CB    1 
ATOM   5784  N N     . VAL H 4  102 ? 126.283 97.600  107.755 1.00 7.75   ? 99  VAL H N     1 
ATOM   5785  C CA    . VAL H 4  102 ? 126.969 98.392  108.751 1.00 6.91   ? 99  VAL H CA    1 
ATOM   5786  C C     . VAL H 4  102 ? 127.339 99.733  108.193 1.00 9.78   ? 99  VAL H C     1 
ATOM   5787  O O     . VAL H 4  102 ? 127.137 100.748 108.846 1.00 9.47   ? 99  VAL H O     1 
ATOM   5788  C CB    . VAL H 4  102 ? 128.216 97.680  109.255 1.00 8.26   ? 99  VAL H CB    1 
ATOM   5789  C CG1   . VAL H 4  102 ? 129.052 98.565  110.092 1.00 10.62  ? 99  VAL H CG1   1 
ATOM   5790  C CG2   . VAL H 4  102 ? 127.792 96.547  110.091 1.00 2.08   ? 99  VAL H CG2   1 
ATOM   5791  N N     . ARG H 4  103 ? 127.859 99.789  106.982 1.00 9.86   ? 100 ARG H N     1 
ATOM   5792  C CA    . ARG H 4  103 ? 128.199 101.091 106.430 1.00 7.37   ? 100 ARG H CA    1 
ATOM   5793  C C     . ARG H 4  103 ? 127.014 102.004 106.225 1.00 6.84   ? 100 ARG H C     1 
ATOM   5794  O O     . ARG H 4  103 ? 127.125 103.212 106.391 1.00 14.36  ? 100 ARG H O     1 
ATOM   5795  C CB    . ARG H 4  103 ? 128.832 100.971 105.110 1.00 7.18   ? 100 ARG H CB    1 
ATOM   5796  C CG    . ARG H 4  103 ? 130.125 100.438 105.108 1.00 6.62   ? 100 ARG H CG    1 
ATOM   5797  C CD    . ARG H 4  103 ? 130.639 100.456 103.773 1.00 4.58   ? 100 ARG H CD    1 
ATOM   5798  N NE    . ARG H 4  103 ? 131.865 99.786  103.673 1.00 5.50   ? 100 ARG H NE    1 
ATOM   5799  C CZ    . ARG H 4  103 ? 133.041 100.286 104.007 1.00 11.98  ? 100 ARG H CZ    1 
ATOM   5800  N NH1   . ARG H 4  103 ? 133.138 101.495 104.488 1.00 18.06  ? 100 ARG H NH1   1 
ATOM   5801  N NH2   . ARG H 4  103 ? 134.121 99.560  103.852 1.00 10.13  ? 100 ARG H NH2   1 
ATOM   5802  N N     . LEU H 4  104 ? 125.889 101.460 105.817 1.00 7.83   ? 101 LEU H N     1 
ATOM   5803  C CA    . LEU H 4  104 ? 124.726 102.291 105.612 1.00 4.37   ? 101 LEU H CA    1 
ATOM   5804  C C     . LEU H 4  104 ? 124.141 102.796 106.927 1.00 5.96   ? 101 LEU H C     1 
ATOM   5805  O O     . LEU H 4  104 ? 123.569 103.888 106.985 1.00 10.48  ? 101 LEU H O     1 
ATOM   5806  C CB    . LEU H 4  104 ? 123.662 101.509 104.861 1.00 5.02   ? 101 LEU H CB    1 
ATOM   5807  C CG    . LEU H 4  104 ? 123.951 101.146 103.413 1.00 7.11   ? 101 LEU H CG    1 
ATOM   5808  C CD1   . LEU H 4  104 ? 122.911 100.205 102.941 1.00 8.40   ? 101 LEU H CD1   1 
ATOM   5809  C CD2   . LEU H 4  104 ? 123.910 102.363 102.539 1.00 7.49   ? 101 LEU H CD2   1 
ATOM   5810  N N     . LEU H 4  105 ? 124.238 102.003 107.984 1.00 7.80   ? 102 LEU H N     1 
ATOM   5811  C CA    . LEU H 4  105 ? 123.664 102.386 109.264 1.00 5.89   ? 102 LEU H CA    1 
ATOM   5812  C C     . LEU H 4  105 ? 124.565 103.138 110.235 1.00 9.26   ? 102 LEU H C     1 
ATOM   5813  O O     . LEU H 4  105 ? 124.073 104.009 110.949 1.00 19.36  ? 102 LEU H O     1 
ATOM   5814  C CB    . LEU H 4  105 ? 123.178 101.131 109.959 1.00 4.24   ? 102 LEU H CB    1 
ATOM   5815  C CG    . LEU H 4  105 ? 122.073 100.362 109.259 1.00 3.09   ? 102 LEU H CG    1 
ATOM   5816  C CD1   . LEU H 4  105 ? 121.890 99.082  109.950 1.00 0.48   ? 102 LEU H CD1   1 
ATOM   5817  C CD2   . LEU H 4  105 ? 120.781 101.122 109.290 1.00 3.07   ? 102 LEU H CD2   1 
ATOM   5818  N N     . LEU H 4  106 ? 125.854 102.842 110.310 1.00 10.62  ? 103 LEU H N     1 
ATOM   5819  C CA    . LEU H 4  106 ? 126.632 103.532 111.310 1.00 9.85   ? 103 LEU H CA    1 
ATOM   5820  C C     . LEU H 4  106 ? 127.290 104.757 110.705 1.00 15.53  ? 103 LEU H C     1 
ATOM   5821  O O     . LEU H 4  106 ? 127.766 104.700 109.582 1.00 20.41  ? 103 LEU H O     1 
ATOM   5822  C CB    . LEU H 4  106 ? 127.733 102.647 111.883 1.00 12.75  ? 103 LEU H CB    1 
ATOM   5823  C CG    . LEU H 4  106 ? 127.357 101.338 112.532 1.00 10.58  ? 103 LEU H CG    1 
ATOM   5824  C CD1   . LEU H 4  106 ? 128.629 100.712 113.055 1.00 14.84  ? 103 LEU H CD1   1 
ATOM   5825  C CD2   . LEU H 4  106 ? 126.370 101.519 113.617 1.00 15.32  ? 103 LEU H CD2   1 
ATOM   5826  N N     . PRO H 4  107 ? 127.308 105.896 111.395 1.00 15.25  ? 104 PRO H N     1 
ATOM   5827  C CA    . PRO H 4  107 ? 127.945 107.121 110.994 1.00 14.49  ? 104 PRO H CA    1 
ATOM   5828  C C     . PRO H 4  107 ? 129.441 107.180 111.223 1.00 17.97  ? 104 PRO H C     1 
ATOM   5829  O O     . PRO H 4  107 ? 129.980 106.498 112.106 1.00 21.12  ? 104 PRO H O     1 
ATOM   5830  C CB    . PRO H 4  107 ? 127.255 108.133 111.881 1.00 21.70  ? 104 PRO H CB    1 
ATOM   5831  C CG    . PRO H 4  107 ? 126.960 107.380 113.120 1.00 19.70  ? 104 PRO H CG    1 
ATOM   5832  C CD    . PRO H 4  107 ? 126.614 105.998 112.663 1.00 18.89  ? 104 PRO H CD    1 
ATOM   5833  N N     . GLY H 4  108 ? 130.081 108.077 110.496 1.00 15.59  ? 105 GLY H N     1 
ATOM   5834  C CA    . GLY H 4  108 ? 131.427 108.515 110.817 1.00 14.08  ? 105 GLY H CA    1 
ATOM   5835  C C     . GLY H 4  108 ? 132.433 107.418 110.896 1.00 14.87  ? 105 GLY H C     1 
ATOM   5836  O O     . GLY H 4  108 ? 132.544 106.576 110.010 1.00 18.83  ? 105 GLY H O     1 
ATOM   5837  N N     . GLU H 4  109 ? 133.172 107.425 111.990 1.00 19.92  ? 106 GLU H N     1 
ATOM   5838  C CA    . GLU H 4  109 ? 134.178 106.429 112.199 1.00 21.53  ? 106 GLU H CA    1 
ATOM   5839  C C     . GLU H 4  109 ? 133.660 105.203 112.880 1.00 19.68  ? 106 GLU H C     1 
ATOM   5840  O O     . GLU H 4  109 ? 134.416 104.246 113.043 1.00 21.42  ? 106 GLU H O     1 
ATOM   5841  C CB    . GLU H 4  109 ? 135.348 106.955 112.989 1.00 25.74  ? 106 GLU H CB    1 
ATOM   5842  C CG    . GLU H 4  109 ? 136.145 107.970 112.281 1.00 30.84  ? 106 GLU H CG    1 
ATOM   5843  C CD    . GLU H 4  109 ? 137.371 108.384 113.044 0.00 61.74  ? 106 GLU H CD    1 
ATOM   5844  O OE1   . GLU H 4  109 ? 137.496 108.035 114.195 0.00 47.83  ? 106 GLU H OE1   1 
ATOM   5845  O OE2   . GLU H 4  109 ? 138.200 109.039 112.464 0.00 37.17  ? 106 GLU H OE2   1 
ATOM   5846  N N     . LEU H 4  110 ? 132.403 105.189 113.293 1.00 16.41  ? 107 LEU H N     1 
ATOM   5847  C CA    . LEU H 4  110 ? 131.948 103.974 113.908 1.00 13.55  ? 107 LEU H CA    1 
ATOM   5848  C C     . LEU H 4  110 ? 131.905 102.967 112.802 1.00 16.52  ? 107 LEU H C     1 
ATOM   5849  O O     . LEU H 4  110 ? 132.250 101.804 112.986 1.00 18.30  ? 107 LEU H O     1 
ATOM   5850  C CB    . LEU H 4  110 ? 130.568 104.103 114.532 1.00 14.75  ? 107 LEU H CB    1 
ATOM   5851  C CG    . LEU H 4  110 ? 130.427 104.936 115.759 1.00 11.95  ? 107 LEU H CG    1 
ATOM   5852  C CD1   . LEU H 4  110 ? 128.951 105.090 116.058 1.00 15.59  ? 107 LEU H CD1   1 
ATOM   5853  C CD2   . LEU H 4  110 ? 131.113 104.265 116.930 1.00 22.35  ? 107 LEU H CD2   1 
ATOM   5854  N N     . ALA H 4  111 ? 131.504 103.409 111.624 1.00 14.59  ? 108 ALA H N     1 
ATOM   5855  C CA    . ALA H 4  111 ? 131.454 102.489 110.522 1.00 10.22  ? 108 ALA H CA    1 
ATOM   5856  C C     . ALA H 4  111 ? 132.822 101.931 110.202 1.00 13.15  ? 108 ALA H C     1 
ATOM   5857  O O     . ALA H 4  111 ? 132.953 100.747 109.940 1.00 19.57  ? 108 ALA H O     1 
ATOM   5858  C CB    . ALA H 4  111 ? 130.903 103.162 109.313 1.00 14.07  ? 108 ALA H CB    1 
ATOM   5859  N N     . LYS H 4  112 ? 133.863 102.733 110.258 1.00 14.60  ? 109 LYS H N     1 
ATOM   5860  C CA    . LYS H 4  112 ? 135.166 102.188 109.922 1.00 12.39  ? 109 LYS H CA    1 
ATOM   5861  C C     . LYS H 4  112 ? 135.693 101.235 110.928 1.00 17.34  ? 109 LYS H C     1 
ATOM   5862  O O     . LYS H 4  112 ? 136.299 100.222 110.568 1.00 23.37  ? 109 LYS H O     1 
ATOM   5863  C CB    . LYS H 4  112 ? 136.201 103.242 109.787 1.00 17.94  ? 109 LYS H CB    1 
ATOM   5864  C CG    . LYS H 4  112 ? 136.046 104.090 108.614 1.00 31.58  ? 109 LYS H CG    1 
ATOM   5865  C CD    . LYS H 4  112 ? 137.147 105.150 108.558 1.00 41.09  ? 109 LYS H CD    1 
ATOM   5866  C CE    . LYS H 4  112 ? 136.976 106.079 107.351 1.00 62.26  ? 109 LYS H CE    1 
ATOM   5867  N NZ    . LYS H 4  112 ? 138.027 107.155 107.295 1.00 39.60  ? 109 LYS H NZ    1 
ATOM   5868  N N     . HIS H 4  113 ? 135.506 101.534 112.192 1.00 17.41  ? 110 HIS H N     1 
ATOM   5869  C CA    . HIS H 4  113 ? 136.061 100.644 113.163 1.00 15.98  ? 110 HIS H CA    1 
ATOM   5870  C C     . HIS H 4  113 ? 135.240 99.389  113.230 1.00 17.31  ? 110 HIS H C     1 
ATOM   5871  O O     . HIS H 4  113 ? 135.792 98.306  113.404 1.00 22.97  ? 110 HIS H O     1 
ATOM   5872  C CB    . HIS H 4  113 ? 136.156 101.308 114.515 1.00 21.24  ? 110 HIS H CB    1 
ATOM   5873  C CG    . HIS H 4  113 ? 137.199 102.374 114.582 1.00 24.70  ? 110 HIS H CG    1 
ATOM   5874  N ND1   . HIS H 4  113 ? 138.546 102.110 114.467 1.00 33.75  ? 110 HIS H ND1   1 
ATOM   5875  C CD2   . HIS H 4  113 ? 137.096 103.700 114.761 1.00 22.41  ? 110 HIS H CD2   1 
ATOM   5876  C CE1   . HIS H 4  113 ? 139.219 103.237 114.566 1.00 23.34  ? 110 HIS H CE1   1 
ATOM   5877  N NE2   . HIS H 4  113 ? 138.366 104.213 114.747 1.00 22.58  ? 110 HIS H NE2   1 
ATOM   5878  N N     . ALA H 4  114 ? 133.926 99.494  113.072 1.00 15.95  ? 111 ALA H N     1 
ATOM   5879  C CA    . ALA H 4  114 ? 133.114 98.311  113.119 1.00 13.41  ? 111 ALA H CA    1 
ATOM   5880  C C     . ALA H 4  114 ? 133.465 97.394  111.967 1.00 20.22  ? 111 ALA H C     1 
ATOM   5881  O O     . ALA H 4  114 ? 133.552 96.179  112.143 1.00 22.91  ? 111 ALA H O     1 
ATOM   5882  C CB    . ALA H 4  114 ? 131.664 98.684  113.077 1.00 15.87  ? 111 ALA H CB    1 
ATOM   5883  N N     . VAL H 4  115 ? 133.731 97.956  110.789 1.00 20.03  ? 112 VAL H N     1 
ATOM   5884  C CA    . VAL H 4  115 ? 134.085 97.139  109.658 1.00 11.45  ? 112 VAL H CA    1 
ATOM   5885  C C     . VAL H 4  115 ? 135.417 96.470  109.864 1.00 17.71  ? 112 VAL H C     1 
ATOM   5886  O O     . VAL H 4  115 ? 135.562 95.293  109.519 1.00 24.42  ? 112 VAL H O     1 
ATOM   5887  C CB    . VAL H 4  115 ? 134.019 97.931  108.365 1.00 11.01  ? 112 VAL H CB    1 
ATOM   5888  C CG1   . VAL H 4  115 ? 134.591 97.141  107.238 1.00 21.71  ? 112 VAL H CG1   1 
ATOM   5889  C CG2   . VAL H 4  115 ? 132.556 98.223  108.055 1.00 13.18  ? 112 VAL H CG2   1 
ATOM   5890  N N     . SER H 4  116 ? 136.397 97.183  110.396 1.00 19.23  ? 113 SER H N     1 
ATOM   5891  C CA    . SER H 4  116 ? 137.680 96.567  110.643 1.00 17.90  ? 113 SER H CA    1 
ATOM   5892  C C     . SER H 4  116 ? 137.565 95.413  111.624 1.00 25.57  ? 113 SER H C     1 
ATOM   5893  O O     . SER H 4  116 ? 138.137 94.339  111.394 1.00 32.37  ? 113 SER H O     1 
ATOM   5894  C CB    . SER H 4  116 ? 138.638 97.577  111.187 1.00 25.38  ? 113 SER H CB    1 
ATOM   5895  O OG    . SER H 4  116 ? 139.878 96.995  111.433 1.00 37.73  ? 113 SER H OG    1 
ATOM   5896  N N     . GLU H 4  117 ? 136.795 95.586  112.699 1.00 26.13  ? 114 GLU H N     1 
ATOM   5897  C CA    . GLU H 4  117 ? 136.672 94.513  113.669 1.00 24.04  ? 114 GLU H CA    1 
ATOM   5898  C C     . GLU H 4  117 ? 135.934 93.321  113.119 1.00 22.72  ? 114 GLU H C     1 
ATOM   5899  O O     . GLU H 4  117 ? 136.309 92.176  113.382 1.00 31.11  ? 114 GLU H O     1 
ATOM   5900  C CB    . GLU H 4  117 ? 135.949 94.994  114.900 1.00 19.57  ? 114 GLU H CB    1 
ATOM   5901  C CG    . GLU H 4  117 ? 136.725 95.972  115.738 1.00 29.13  ? 114 GLU H CG    1 
ATOM   5902  C CD    . GLU H 4  117 ? 137.966 95.390  116.286 1.00 49.09  ? 114 GLU H CD    1 
ATOM   5903  O OE1   . GLU H 4  117 ? 137.895 94.305  116.781 1.00 57.18  ? 114 GLU H OE1   1 
ATOM   5904  O OE2   . GLU H 4  117 ? 139.015 96.011  116.207 1.00 41.48  ? 114 GLU H OE2   1 
ATOM   5905  N N     . GLY H 4  118 ? 134.913 93.561  112.321 1.00 18.80  ? 115 GLY H N     1 
ATOM   5906  C CA    . GLY H 4  118 ? 134.186 92.463  111.741 1.00 20.25  ? 115 GLY H CA    1 
ATOM   5907  C C     . GLY H 4  118 ? 135.098 91.670  110.827 1.00 23.48  ? 115 GLY H C     1 
ATOM   5908  O O     . GLY H 4  118 ? 135.119 90.437  110.867 1.00 27.71  ? 115 GLY H O     1 
ATOM   5909  N N     . THR H 4  119 ? 135.917 92.365  110.054 1.00 23.96  ? 116 THR H N     1 
ATOM   5910  C CA    . THR H 4  119 ? 136.807 91.705  109.136 1.00 21.63  ? 116 THR H CA    1 
ATOM   5911  C C     . THR H 4  119 ? 137.759 90.800  109.872 1.00 25.65  ? 116 THR H C     1 
ATOM   5912  O O     . THR H 4  119 ? 138.003 89.664  109.442 1.00 35.90  ? 116 THR H O     1 
ATOM   5913  C CB    . THR H 4  119 ? 137.581 92.725  108.320 1.00 23.95  ? 116 THR H CB    1 
ATOM   5914  O OG1   . THR H 4  119 ? 136.660 93.500  107.560 1.00 27.08  ? 116 THR H OG1   1 
ATOM   5915  C CG2   . THR H 4  119 ? 138.521 92.029  107.397 1.00 42.00  ? 116 THR H CG2   1 
ATOM   5916  N N     . LYS H 4  120 ? 138.330 91.269  110.969 1.00 27.20  ? 117 LYS H N     1 
ATOM   5917  C CA    . LYS H 4  120 ? 139.217 90.397  111.705 1.00 29.40  ? 117 LYS H CA    1 
ATOM   5918  C C     . LYS H 4  120 ? 138.517 89.197  112.279 1.00 28.80  ? 117 LYS H C     1 
ATOM   5919  O O     . LYS H 4  120 ? 139.043 88.087  112.228 1.00 33.77  ? 117 LYS H O     1 
ATOM   5920  C CB    . LYS H 4  120 ? 139.849 91.114  112.840 1.00 33.50  ? 117 LYS H CB    1 
ATOM   5921  C CG    . LYS H 4  120 ? 140.863 92.071  112.444 1.00 42.84  ? 117 LYS H CG    1 
ATOM   5922  C CD    . LYS H 4  120 ? 141.577 92.653  113.647 1.00 54.52  ? 117 LYS H CD    1 
ATOM   5923  C CE    . LYS H 4  120 ? 140.673 93.660  114.372 0.00 53.36  ? 117 LYS H CE    1 
ATOM   5924  N NZ    . LYS H 4  120 ? 141.369 94.440  115.445 0.00 52.75  ? 117 LYS H NZ    1 
ATOM   5925  N N     . ALA H 4  121 ? 137.321 89.372  112.820 1.00 25.92  ? 118 ALA H N     1 
ATOM   5926  C CA    . ALA H 4  121 ? 136.668 88.224  113.414 1.00 22.21  ? 118 ALA H CA    1 
ATOM   5927  C C     . ALA H 4  121 ? 136.419 87.152  112.387 1.00 24.63  ? 118 ALA H C     1 
ATOM   5928  O O     . ALA H 4  121 ? 136.627 85.970  112.654 1.00 34.40  ? 118 ALA H O     1 
ATOM   5929  C CB    . ALA H 4  121 ? 135.369 88.637  114.042 1.00 29.15  ? 118 ALA H CB    1 
ATOM   5930  N N     . VAL H 4  122 ? 136.032 87.542  111.185 1.00 24.78  ? 119 VAL H N     1 
ATOM   5931  C CA    . VAL H 4  122 ? 135.783 86.555  110.161 1.00 22.00  ? 119 VAL H CA    1 
ATOM   5932  C C     . VAL H 4  122 ? 137.061 85.904  109.719 1.00 27.15  ? 119 VAL H C     1 
ATOM   5933  O O     . VAL H 4  122 ? 137.095 84.691  109.491 1.00 38.63  ? 119 VAL H O     1 
ATOM   5934  C CB    . VAL H 4  122 ? 135.037 87.139  108.986 1.00 18.08  ? 119 VAL H CB    1 
ATOM   5935  C CG1   . VAL H 4  122 ? 134.956 86.142  107.888 1.00 38.84  ? 119 VAL H CG1   1 
ATOM   5936  C CG2   . VAL H 4  122 ? 133.652 87.494  109.434 1.00 26.97  ? 119 VAL H CG2   1 
ATOM   5937  N N     . THR H 4  123 ? 138.108 86.694  109.550 1.00 27.93  ? 120 THR H N     1 
ATOM   5938  C CA    . THR H 4  123 ? 139.384 86.173  109.118 1.00 28.34  ? 120 THR H CA    1 
ATOM   5939  C C     . THR H 4  123 ? 139.919 85.150  110.094 1.00 33.02  ? 120 THR H C     1 
ATOM   5940  O O     . THR H 4  123 ? 140.357 84.064  109.699 1.00 40.68  ? 120 THR H O     1 
ATOM   5941  C CB    . THR H 4  123 ? 140.396 87.323  109.035 1.00 31.42  ? 120 THR H CB    1 
ATOM   5942  O OG1   . THR H 4  123 ? 139.951 88.272  108.062 1.00 37.78  ? 120 THR H OG1   1 
ATOM   5943  C CG2   . THR H 4  123 ? 141.767 86.822  108.682 1.00 41.45  ? 120 THR H CG2   1 
ATOM   5944  N N     . LYS H 4  124 ? 139.876 85.477  111.373 1.00 33.53  ? 121 LYS H N     1 
ATOM   5945  C CA    . LYS H 4  124 ? 140.399 84.582  112.370 1.00 34.69  ? 121 LYS H CA    1 
ATOM   5946  C C     . LYS H 4  124 ? 139.560 83.351  112.494 1.00 39.60  ? 121 LYS H C     1 
ATOM   5947  O O     . LYS H 4  124 ? 140.080 82.253  112.641 1.00 49.22  ? 121 LYS H O     1 
ATOM   5948  C CB    . LYS H 4  124 ? 140.452 85.237  113.705 1.00 36.00  ? 121 LYS H CB    1 
ATOM   5949  C CG    . LYS H 4  124 ? 141.117 84.404  114.723 1.00 46.12  ? 121 LYS H CG    1 
ATOM   5950  C CD    . LYS H 4  124 ? 141.135 85.077  116.045 1.00 64.49  ? 121 LYS H CD    1 
ATOM   5951  C CE    . LYS H 4  124 ? 141.863 84.219  117.068 1.00 65.13  ? 121 LYS H CE    1 
ATOM   5952  N NZ    . LYS H 4  124 ? 141.692 84.719  118.458 1.00 66.38  ? 121 LYS H NZ    1 
ATOM   5953  N N     . TYR H 4  125 ? 138.258 83.518  112.466 1.00 35.40  ? 122 TYR H N     1 
ATOM   5954  C CA    . TYR H 4  125 ? 137.366 82.406  112.582 1.00 35.47  ? 122 TYR H CA    1 
ATOM   5955  C C     . TYR H 4  125 ? 137.636 81.403  111.504 1.00 40.15  ? 122 TYR H C     1 
ATOM   5956  O O     . TYR H 4  125 ? 137.737 80.209  111.760 1.00 51.74  ? 122 TYR H O     1 
ATOM   5957  C CB    . TYR H 4  125 ? 135.955 82.891  112.481 1.00 34.15  ? 122 TYR H CB    1 
ATOM   5958  C CG    . TYR H 4  125 ? 134.995 81.861  112.522 1.00 33.66  ? 122 TYR H CG    1 
ATOM   5959  C CD1   . TYR H 4  125 ? 134.646 81.350  113.705 1.00 43.17  ? 122 TYR H CD1   1 
ATOM   5960  C CD2   . TYR H 4  125 ? 134.438 81.420  111.382 1.00 33.14  ? 122 TYR H CD2   1 
ATOM   5961  C CE1   . TYR H 4  125 ? 133.728 80.388  113.769 1.00 46.98  ? 122 TYR H CE1   1 
ATOM   5962  C CE2   . TYR H 4  125 ? 133.516 80.452  111.434 1.00 40.91  ? 122 TYR H CE2   1 
ATOM   5963  C CZ    . TYR H 4  125 ? 133.157 79.937  112.627 1.00 46.39  ? 122 TYR H CZ    1 
ATOM   5964  O OH    . TYR H 4  125 ? 132.219 78.953  112.690 1.00 59.05  ? 122 TYR H OH    1 
ATOM   5965  N N     . THR H 4  126 ? 137.754 81.881  110.276 1.00 42.96  ? 123 THR H N     1 
ATOM   5966  C CA    . THR H 4  126 ? 137.944 81.031  109.119 1.00 45.61  ? 123 THR H CA    1 
ATOM   5967  C C     . THR H 4  126 ? 139.185 80.182  109.265 1.00 53.39  ? 123 THR H C     1 
ATOM   5968  O O     . THR H 4  126 ? 139.171 78.992  108.954 1.00 63.63  ? 123 THR H O     1 
ATOM   5969  C CB    . THR H 4  126 ? 138.040 81.871  107.840 1.00 44.75  ? 123 THR H CB    1 
ATOM   5970  O OG1   . THR H 4  126 ? 136.823 82.612  107.664 1.00 38.19  ? 123 THR H OG1   1 
ATOM   5971  C CG2   . THR H 4  126 ? 138.243 80.970  106.643 1.00 49.16  ? 123 THR H CG2   1 
ATOM   5972  N N     . SER H 4  127 ? 140.252 80.776  109.767 1.00 52.33  ? 124 SER H N     1 
ATOM   5973  C CA    . SER H 4  127 ? 141.525 80.095  109.943 1.00 61.40  ? 124 SER H CA    1 
ATOM   5974  C C     . SER H 4  127 ? 141.698 79.342  111.275 1.00 67.68  ? 124 SER H C     1 
ATOM   5975  O O     . SER H 4  127 ? 142.786 78.815  111.531 1.00 69.25  ? 124 SER H O     1 
ATOM   5976  C CB    . SER H 4  127 ? 142.658 81.095  109.813 1.00 59.09  ? 124 SER H CB    1 
ATOM   5977  O OG    . SER H 4  127 ? 142.727 81.642  108.520 1.00 60.40  ? 124 SER H OG    1 
ATOM   5978  N N     . ALA H 4  128 ? 140.687 79.350  112.154 1.00 67.90  ? 125 ALA H N     1 
ATOM   5979  C CA    . ALA H 4  128 ? 140.803 78.717  113.472 1.00 77.42  ? 125 ALA H CA    1 
ATOM   5980  C C     . ALA H 4  128 ? 139.912 77.475  113.589 1.00 86.58  ? 125 ALA H C     1 
ATOM   5981  O O     . ALA H 4  128 ? 139.639 77.012  114.702 1.00 86.95  ? 125 ALA H O     1 
ATOM   5982  C CB    . ALA H 4  128 ? 140.445 79.721  114.564 1.00 67.31  ? 125 ALA H CB    1 
ATOM   5983  O "O5'" . DG  I 6  6   ? 100.712 157.645 51.798  1.00 600.00 ? 3   DG  I "O5'" 1 
ATOM   5984  C "C5'" . DG  I 6  6   ? 101.637 157.074 50.845  1.00 600.00 ? 3   DG  I "C5'" 1 
ATOM   5985  C "C4'" . DG  I 6  6   ? 101.965 155.629 51.174  1.00 600.00 ? 3   DG  I "C4'" 1 
ATOM   5986  O "O4'" . DG  I 6  6   ? 102.727 155.564 52.408  1.00 600.00 ? 3   DG  I "O4'" 1 
ATOM   5987  C "C3'" . DG  I 6  6   ? 100.771 154.680 51.339  1.00 600.00 ? 3   DG  I "C3'" 1 
ATOM   5988  O "O3'" . DG  I 6  6   ? 100.947 153.564 50.433  1.00 600.00 ? 3   DG  I "O3'" 1 
ATOM   5989  C "C2'" . DG  I 6  6   ? 100.839 154.251 52.806  1.00 600.00 ? 3   DG  I "C2'" 1 
ATOM   5990  C "C1'" . DG  I 6  6   ? 102.289 154.470 53.193  1.00 600.00 ? 3   DG  I "C1'" 1 
ATOM   5991  N N9    . DG  I 6  6   ? 102.494 154.809 54.608  1.00 600.00 ? 3   DG  I N9    1 
ATOM   5992  C C8    . DG  I 6  6   ? 101.917 155.842 55.305  1.00 600.00 ? 3   DG  I C8    1 
ATOM   5993  N N7    . DG  I 6  6   ? 102.288 155.902 56.553  1.00 600.00 ? 3   DG  I N7    1 
ATOM   5994  C C5    . DG  I 6  6   ? 103.166 154.845 56.696  1.00 600.00 ? 3   DG  I C5    1 
ATOM   5995  C C6    . DG  I 6  6   ? 103.883 154.413 57.835  1.00 600.00 ? 3   DG  I C6    1 
ATOM   5996  O O6    . DG  I 6  6   ? 103.875 154.912 58.969  1.00 600.00 ? 3   DG  I O6    1 
ATOM   5997  N N1    . DG  I 6  6   ? 104.662 153.298 57.551  1.00 600.00 ? 3   DG  I N1    1 
ATOM   5998  C C2    . DG  I 6  6   ? 104.738 152.678 56.327  1.00 600.00 ? 3   DG  I C2    1 
ATOM   5999  N N2    . DG  I 6  6   ? 105.551 151.609 56.247  1.00 600.00 ? 3   DG  I N2    1 
ATOM   6000  N N3    . DG  I 6  6   ? 104.068 153.076 55.254  1.00 600.00 ? 3   DG  I N3    1 
ATOM   6001  C C4    . DG  I 6  6   ? 103.305 154.157 55.509  1.00 600.00 ? 3   DG  I C4    1 
ATOM   6002  P P     . DG  I 6  7   ? 99.803  152.454 50.119  1.00 600.00 ? 4   DG  I P     1 
ATOM   6003  O OP1   . DG  I 6  7   ? 100.015 151.952 48.736  1.00 600.00 ? 4   DG  I OP1   1 
ATOM   6004  O OP2   . DG  I 6  7   ? 98.478  153.008 50.505  1.00 600.00 ? 4   DG  I OP2   1 
ATOM   6005  O "O5'" . DG  I 6  7   ? 100.167 151.286 51.148  1.00 600.00 ? 4   DG  I "O5'" 1 
ATOM   6006  C "C5'" . DG  I 6  7   ? 101.263 150.395 50.865  1.00 600.00 ? 4   DG  I "C5'" 1 
ATOM   6007  C "C4'" . DG  I 6  7   ? 101.770 149.700 52.117  1.00 600.00 ? 4   DG  I "C4'" 1 
ATOM   6008  O "O4'" . DG  I 6  7   ? 101.796 150.631 53.219  1.00 600.00 ? 4   DG  I "O4'" 1 
ATOM   6009  C "C3'" . DG  I 6  7   ? 100.922 148.533 52.654  1.00 600.00 ? 4   DG  I "C3'" 1 
ATOM   6010  O "O3'" . DG  I 6  7   ? 101.263 147.213 52.107  1.00 600.00 ? 4   DG  I "O3'" 1 
ATOM   6011  C "C2'" . DG  I 6  7   ? 101.063 148.638 54.180  1.00 600.00 ? 4   DG  I "C2'" 1 
ATOM   6012  C "C1'" . DG  I 6  7   ? 101.885 149.884 54.418  1.00 600.00 ? 4   DG  I "C1'" 1 
ATOM   6013  N N9    . DG  I 6  7   ? 101.431 150.730 55.519  1.00 600.00 ? 4   DG  I N9    1 
ATOM   6014  C C8    . DG  I 6  7   ? 100.448 151.685 55.468  1.00 600.00 ? 4   DG  I C8    1 
ATOM   6015  N N7    . DG  I 6  7   ? 100.255 152.292 56.601  1.00 600.00 ? 4   DG  I N7    1 
ATOM   6016  C C5    . DG  I 6  7   ? 101.165 151.701 57.458  1.00 600.00 ? 4   DG  I C5    1 
ATOM   6017  C C6    . DG  I 6  7   ? 101.409 151.959 58.822  1.00 600.00 ? 4   DG  I C6    1 
ATOM   6018  O O6    . DG  I 6  7   ? 100.839 152.790 59.538  1.00 600.00 ? 4   DG  I O6    1 
ATOM   6019  N N1    . DG  I 6  7   ? 102.413 151.148 59.328  1.00 600.00 ? 4   DG  I N1    1 
ATOM   6020  C C2    . DG  I 6  7   ? 103.098 150.202 58.608  1.00 600.00 ? 4   DG  I C2    1 
ATOM   6021  N N2    . DG  I 6  7   ? 104.035 149.514 59.275  1.00 600.00 ? 4   DG  I N2    1 
ATOM   6022  N N3    . DG  I 6  7   ? 102.878 149.952 57.322  1.00 600.00 ? 4   DG  I N3    1 
ATOM   6023  C C4    . DG  I 6  7   ? 101.901 150.734 56.814  1.00 600.00 ? 4   DG  I C4    1 
ATOM   6024  P P     . DA  I 6  8   ? 102.690 146.409 52.116  1.00 600.00 ? 5   DA  I P     1 
ATOM   6025  O OP1   . DA  I 6  8   ? 103.745 147.230 52.768  1.00 600.00 ? 5   DA  I OP1   1 
ATOM   6026  O OP2   . DA  I 6  8   ? 102.923 145.955 50.720  1.00 600.00 ? 5   DA  I OP2   1 
ATOM   6027  O "O5'" . DA  I 6  8   ? 102.476 145.083 52.993  1.00 600.00 ? 5   DA  I "O5'" 1 
ATOM   6028  C "C5'" . DA  I 6  8   ? 101.439 144.873 53.981  1.00 600.00 ? 5   DA  I "C5'" 1 
ATOM   6029  C "C4'" . DA  I 6  8   ? 102.068 144.690 55.347  1.00 600.00 ? 5   DA  I "C4'" 1 
ATOM   6030  O "O4'" . DA  I 6  8   ? 101.896 145.904 56.113  1.00 600.00 ? 5   DA  I "O4'" 1 
ATOM   6031  C "C3'" . DA  I 6  8   ? 101.490 143.555 56.199  1.00 600.00 ? 5   DA  I "C3'" 1 
ATOM   6032  O "O3'" . DA  I 6  8   ? 102.574 142.757 56.729  1.00 600.00 ? 5   DA  I "O3'" 1 
ATOM   6033  C "C2'" . DA  I 6  8   ? 100.729 144.287 57.302  1.00 600.00 ? 5   DA  I "C2'" 1 
ATOM   6034  C "C1'" . DA  I 6  8   ? 101.419 145.629 57.410  1.00 600.00 ? 5   DA  I "C1'" 1 
ATOM   6035  N N9    . DA  I 6  8   ? 100.545 146.736 57.809  1.00 600.00 ? 5   DA  I N9    1 
ATOM   6036  C C8    . DA  I 6  8   ? 99.492  147.268 57.113  1.00 600.00 ? 5   DA  I C8    1 
ATOM   6037  N N7    . DA  I 6  8   ? 98.892  148.257 57.724  1.00 600.00 ? 5   DA  I N7    1 
ATOM   6038  C C5    . DA  I 6  8   ? 99.593  148.389 58.908  1.00 600.00 ? 5   DA  I C5    1 
ATOM   6039  C C6    . DA  I 6  8   ? 99.455  149.268 59.994  1.00 600.00 ? 5   DA  I C6    1 
ATOM   6040  N N6    . DA  I 6  8   ? 98.517  150.209 60.065  1.00 600.00 ? 5   DA  I N6    1 
ATOM   6041  N N1    . DA  I 6  8   ? 100.320 149.141 61.023  1.00 600.00 ? 5   DA  I N1    1 
ATOM   6042  C C2    . DA  I 6  8   ? 101.259 148.193 60.952  1.00 600.00 ? 5   DA  I C2    1 
ATOM   6043  N N3    . DA  I 6  8   ? 101.487 147.316 59.982  1.00 600.00 ? 5   DA  I N3    1 
ATOM   6044  C C4    . DA  I 6  8   ? 100.615 147.464 58.974  1.00 600.00 ? 5   DA  I C4    1 
ATOM   6045  P P     . DG  I 6  9   ? 102.364 141.290 57.386  1.00 600.00 ? 6   DG  I P     1 
ATOM   6046  O OP1   . DG  I 6  9   ? 103.662 140.570 57.348  1.00 600.00 ? 6   DG  I OP1   1 
ATOM   6047  O OP2   . DG  I 6  9   ? 101.155 140.674 56.776  1.00 600.00 ? 6   DG  I OP2   1 
ATOM   6048  O "O5'" . DG  I 6  9   ? 102.034 141.633 58.909  1.00 600.00 ? 6   DG  I "O5'" 1 
ATOM   6049  C "C5'" . DG  I 6  9   ? 102.984 142.386 59.690  1.00 600.00 ? 6   DG  I "C5'" 1 
ATOM   6050  C "C4'" . DG  I 6  9   ? 102.492 142.599 61.101  1.00 600.00 ? 6   DG  I "C4'" 1 
ATOM   6051  O "O4'" . DG  I 6  9   ? 101.653 143.780 61.165  1.00 600.00 ? 6   DG  I "O4'" 1 
ATOM   6052  C "C3'" . DG  I 6  9   ? 101.672 141.465 61.708  1.00 600.00 ? 6   DG  I "C3'" 1 
ATOM   6053  O "O3'" . DG  I 6  9   ? 102.124 141.332 63.068  1.00 600.00 ? 6   DG  I "O3'" 1 
ATOM   6054  C "C2'" . DG  I 6  9   ? 100.244 141.991 61.595  1.00 600.00 ? 6   DG  I "C2'" 1 
ATOM   6055  C "C1'" . DG  I 6  9   ? 100.448 143.474 61.849  1.00 600.00 ? 6   DG  I "C1'" 1 
ATOM   6056  N N9    . DG  I 6  9   ? 99.418  144.392 61.346  1.00 600.00 ? 6   DG  I N9    1 
ATOM   6057  C C8    . DG  I 6  9   ? 98.772  144.361 60.136  1.00 600.00 ? 6   DG  I C8    1 
ATOM   6058  N N7    . DG  I 6  9   ? 97.905  145.320 59.979  1.00 600.00 ? 6   DG  I N7    1 
ATOM   6059  C C5    . DG  I 6  9   ? 97.978  146.034 61.159  1.00 600.00 ? 6   DG  I C5    1 
ATOM   6060  C C6    . DG  I 6  9   ? 97.266  147.189 61.568  1.00 600.00 ? 6   DG  I C6    1 
ATOM   6061  O O6    . DG  I 6  9   ? 96.405  147.817 60.931  1.00 600.00 ? 6   DG  I O6    1 
ATOM   6062  N N1    . DG  I 6  9   ? 97.642  147.592 62.842  1.00 600.00 ? 6   DG  I N1    1 
ATOM   6063  C C2    . DG  I 6  9   ? 98.583  146.962 63.620  1.00 600.00 ? 6   DG  I C2    1 
ATOM   6064  N N2    . DG  I 6  9   ? 98.812  147.501 64.823  1.00 600.00 ? 6   DG  I N2    1 
ATOM   6065  N N3    . DG  I 6  9   ? 99.254  145.884 63.244  1.00 600.00 ? 6   DG  I N3    1 
ATOM   6066  C C4    . DG  I 6  9   ? 98.903  145.478 62.012  1.00 600.00 ? 6   DG  I C4    1 
ATOM   6067  P P     . DA  I 6  10  ? 101.753 140.119 64.066  1.00 600.00 ? 7   DA  I P     1 
ATOM   6068  O OP1   . DA  I 6  10  ? 103.019 139.535 64.579  1.00 600.00 ? 7   DA  I OP1   1 
ATOM   6069  O OP2   . DA  I 6  10  ? 100.736 139.244 63.421  1.00 600.00 ? 7   DA  I OP2   1 
ATOM   6070  O "O5'" . DA  I 6  10  ? 101.036 140.907 65.258  1.00 600.00 ? 7   DA  I "O5'" 1 
ATOM   6071  C "C5'" . DA  I 6  10  ? 101.659 142.081 65.822  1.00 600.00 ? 7   DA  I "C5'" 1 
ATOM   6072  C "C4'" . DA  I 6  10  ? 100.861 142.629 66.984  1.00 600.00 ? 7   DA  I "C4'" 1 
ATOM   6073  O "O4'" . DA  I 6  10  ? 99.855  143.534 66.490  1.00 600.00 ? 7   DA  I "O4'" 1 
ATOM   6074  C "C3'" . DA  I 6  10  ? 100.129 141.592 67.831  1.00 600.00 ? 7   DA  I "C3'" 1 
ATOM   6075  O "O3'" . DA  I 6  10  ? 100.190 142.074 69.187  1.00 600.00 ? 7   DA  I "O3'" 1 
ATOM   6076  C "C2'" . DA  I 6  10  ? 98.714  141.617 67.245  1.00 600.00 ? 7   DA  I "C2'" 1 
ATOM   6077  C "C1'" . DA  I 6  10  ? 98.561  143.069 66.813  1.00 600.00 ? 7   DA  I "C1'" 1 
ATOM   6078  N N9    . DA  I 6  10  ? 97.755  143.344 65.631  1.00 600.00 ? 7   DA  I N9    1 
ATOM   6079  C C8    . DA  I 6  10  ? 97.670  142.649 64.424  1.00 600.00 ? 7   DA  I C8    1 
ATOM   6080  N N7    . DA  I 6  10  ? 96.837  143.196 63.578  1.00 600.00 ? 7   DA  I N7    1 
ATOM   6081  C C5    . DA  I 6  10  ? 96.332  144.332 64.276  1.00 600.00 ? 7   DA  I C5    1 
ATOM   6082  C C6    . DA  I 6  10  ? 95.406  145.269 63.881  1.00 600.00 ? 7   DA  I C6    1 
ATOM   6083  N N6    . DA  I 6  10  ? 94.776  145.335 62.725  1.00 600.00 ? 7   DA  I N6    1 
ATOM   6084  N N1    . DA  I 6  10  ? 95.134  146.243 64.806  1.00 600.00 ? 7   DA  I N1    1 
ATOM   6085  C C2    . DA  I 6  10  ? 95.755  146.212 65.983  1.00 600.00 ? 7   DA  I C2    1 
ATOM   6086  N N3    . DA  I 6  10  ? 96.645  145.333 66.424  1.00 600.00 ? 7   DA  I N3    1 
ATOM   6087  C C4    . DA  I 6  10  ? 96.893  144.396 65.508  1.00 600.00 ? 7   DA  I C4    1 
ATOM   6088  P P     . DC  I 6  11  ? 99.879  141.169 70.482  1.00 600.00 ? 8   DC  I P     1 
ATOM   6089  O OP1   . DC  I 6  11  ? 100.592 141.750 71.647  1.00 600.00 ? 8   DC  I OP1   1 
ATOM   6090  O OP2   . DC  I 6  11  ? 100.055 139.738 70.126  1.00 600.00 ? 8   DC  I OP2   1 
ATOM   6091  O "O5'" . DC  I 6  11  ? 98.313  141.358 70.687  1.00 600.00 ? 8   DC  I "O5'" 1 
ATOM   6092  C "C5'" . DC  I 6  11  ? 97.768  142.674 70.895  1.00 600.00 ? 8   DC  I "C5'" 1 
ATOM   6093  C "C4'" . DC  I 6  11  ? 96.269  142.682 70.719  1.00 600.00 ? 8   DC  I "C4'" 1 
ATOM   6094  O "O4'" . DC  I 6  11  ? 95.915  143.088 69.385  1.00 600.00 ? 8   DC  I "O4'" 1 
ATOM   6095  C "C3'" . DC  I 6  11  ? 95.570  141.340 70.892  1.00 600.00 ? 8   DC  I "C3'" 1 
ATOM   6096  O "O3'" . DC  I 6  11  ? 95.314  141.123 72.294  1.00 600.00 ? 8   DC  I "O3'" 1 
ATOM   6097  C "C2'" . DC  I 6  11  ? 94.286  141.539 70.089  1.00 600.00 ? 8   DC  I "C2'" 1 
ATOM   6098  C "C1'" . DC  I 6  11  ? 94.556  142.748 69.210  1.00 600.00 ? 8   DC  I "C1'" 1 
ATOM   6099  N N1    . DC  I 6  11  ? 94.284  142.520 67.782  1.00 600.00 ? 8   DC  I N1    1 
ATOM   6100  C C2    . DC  I 6  11  ? 93.372  143.351 67.134  1.00 600.00 ? 8   DC  I C2    1 
ATOM   6101  O O2    . DC  I 6  11  ? 92.821  144.252 67.774  1.00 600.00 ? 8   DC  I O2    1 
ATOM   6102  N N3    . DC  I 6  11  ? 93.101  143.169 65.833  1.00 600.00 ? 8   DC  I N3    1 
ATOM   6103  C C4    . DC  I 6  11  ? 93.708  142.193 65.164  1.00 600.00 ? 8   DC  I C4    1 
ATOM   6104  N N4    . DC  I 6  11  ? 93.404  142.051 63.871  1.00 600.00 ? 8   DC  I N4    1 
ATOM   6105  C C5    . DC  I 6  11  ? 94.646  141.323 65.794  1.00 600.00 ? 8   DC  I C5    1 
ATOM   6106  C C6    . DC  I 6  11  ? 94.902  141.521 67.091  1.00 600.00 ? 8   DC  I C6    1 
ATOM   6107  P P     . DT  I 6  12  ? 94.699  139.748 72.885  1.00 598.83 ? 9   DT  I P     1 
ATOM   6108  O OP1   . DT  I 6  12  ? 94.775  139.807 74.368  1.00 600.00 ? 9   DT  I OP1   1 
ATOM   6109  O OP2   . DT  I 6  12  ? 95.307  138.600 72.162  1.00 600.00 ? 9   DT  I OP2   1 
ATOM   6110  O "O5'" . DT  I 6  12  ? 93.169  139.812 72.442  1.00 600.00 ? 9   DT  I "O5'" 1 
ATOM   6111  C "C5'" . DT  I 6  12  ? 92.233  140.701 73.073  1.00 600.00 ? 9   DT  I "C5'" 1 
ATOM   6112  C "C4'" . DT  I 6  12  ? 90.873  140.523 72.441  1.00 600.00 ? 9   DT  I "C4'" 1 
ATOM   6113  O "O4'" . DT  I 6  12  ? 90.845  141.075 71.106  1.00 600.00 ? 9   DT  I "O4'" 1 
ATOM   6114  C "C3'" . DT  I 6  12  ? 90.443  139.079 72.256  1.00 600.00 ? 9   DT  I "C3'" 1 
ATOM   6115  O "O3'" . DT  I 6  12  ? 89.848  138.617 73.481  1.00 600.00 ? 9   DT  I "O3'" 1 
ATOM   6116  C "C2'" . DT  I 6  12  ? 89.430  139.182 71.122  1.00 600.00 ? 9   DT  I "C2'" 1 
ATOM   6117  C "C1'" . DT  I 6  12  ? 89.828  140.433 70.354  1.00 600.00 ? 9   DT  I "C1'" 1 
ATOM   6118  N N1    . DT  I 6  12  ? 90.350  140.179 68.997  1.00 600.00 ? 9   DT  I N1    1 
ATOM   6119  C C2    . DT  I 6  12  ? 89.692  140.709 67.903  1.00 600.00 ? 9   DT  I C2    1 
ATOM   6120  O O2    . DT  I 6  12  ? 88.674  141.391 67.984  1.00 600.00 ? 9   DT  I O2    1 
ATOM   6121  N N3    . DT  I 6  12  ? 90.270  140.410 66.690  1.00 600.00 ? 9   DT  I N3    1 
ATOM   6122  C C4    . DT  I 6  12  ? 91.404  139.660 66.460  1.00 600.00 ? 9   DT  I C4    1 
ATOM   6123  O O4    . DT  I 6  12  ? 91.826  139.460 65.308  1.00 600.00 ? 9   DT  I O4    1 
ATOM   6124  C C5    . DT  I 6  12  ? 92.030  139.141 67.648  1.00 600.00 ? 9   DT  I C5    1 
ATOM   6125  C C7    . DT  I 6  12  ? 93.258  138.310 67.505  1.00 600.00 ? 9   DT  I C7    1 
ATOM   6126  C C6    . DT  I 6  12  ? 91.484  139.422 68.834  1.00 600.00 ? 9   DT  I C6    1 
ATOM   6127  P P     . DT  I 6  13  ? 89.526  137.062 73.786  1.00 600.00 ? 10  DT  I P     1 
ATOM   6128  O OP1   . DT  I 6  13  ? 89.202  136.937 75.228  1.00 600.00 ? 10  DT  I OP1   1 
ATOM   6129  O OP2   . DT  I 6  13  ? 90.598  136.218 73.198  1.00 600.00 ? 10  DT  I OP2   1 
ATOM   6130  O "O5'" . DT  I 6  13  ? 88.207  136.803 72.933  1.00 600.00 ? 10  DT  I "O5'" 1 
ATOM   6131  C "C5'" . DT  I 6  13  ? 86.958  137.403 73.306  1.00 600.00 ? 10  DT  I "C5'" 1 
ATOM   6132  C "C4'" . DT  I 6  13  ? 85.896  136.999 72.318  1.00 600.00 ? 10  DT  I "C4'" 1 
ATOM   6133  O "O4'" . DT  I 6  13  ? 86.121  137.674 71.069  1.00 600.00 ? 10  DT  I "O4'" 1 
ATOM   6134  C "C3'" . DT  I 6  13  ? 85.859  135.524 71.964  1.00 600.00 ? 10  DT  I "C3'" 1 
ATOM   6135  O "O3'" . DT  I 6  13  ? 85.030  134.858 72.930  1.00 600.00 ? 10  DT  I "O3'" 1 
ATOM   6136  C "C2'" . DT  I 6  13  ? 85.249  135.540 70.563  1.00 600.00 ? 10  DT  I "C2'" 1 
ATOM   6137  C "C1'" . DT  I 6  13  ? 85.654  136.895 69.989  1.00 600.00 ? 10  DT  I "C1'" 1 
ATOM   6138  N N1    . DT  I 6  13  ? 86.747  136.883 68.994  1.00 600.00 ? 10  DT  I N1    1 
ATOM   6139  C C2    . DT  I 6  13  ? 86.519  137.389 67.733  1.00 600.00 ? 10  DT  I C2    1 
ATOM   6140  O O2    . DT  I 6  13  ? 85.443  137.855 67.387  1.00 600.00 ? 10  DT  I O2    1 
ATOM   6141  N N3    . DT  I 6  13  ? 87.603  137.331 66.888  1.00 600.00 ? 10  DT  I N3    1 
ATOM   6142  C C4    . DT  I 6  13  ? 88.858  136.828 67.176  1.00 600.00 ? 10  DT  I C4    1 
ATOM   6143  O O4    . DT  I 6  13  ? 89.756  136.827 66.332  1.00 600.00 ? 10  DT  I O4    1 
ATOM   6144  C C5    . DT  I 6  13  ? 89.015  136.320 68.509  1.00 596.23 ? 10  DT  I C5    1 
ATOM   6145  C C7    . DT  I 6  13  ? 90.333  135.760 68.920  1.00 600.00 ? 10  DT  I C7    1 
ATOM   6146  C C6    . DT  I 6  13  ? 87.974  136.371 69.335  1.00 600.00 ? 10  DT  I C6    1 
ATOM   6147  P P     . DT  I 6  14  ? 85.078  133.264 73.183  1.00 600.00 ? 11  DT  I P     1 
ATOM   6148  O OP1   . DT  I 6  14  ? 84.242  132.978 74.375  1.00 600.00 ? 11  DT  I OP1   1 
ATOM   6149  O OP2   . DT  I 6  14  ? 86.488  132.793 73.146  1.00 600.00 ? 11  DT  I OP2   1 
ATOM   6150  O "O5'" . DT  I 6  14  ? 84.343  132.703 71.883  1.00 600.00 ? 11  DT  I "O5'" 1 
ATOM   6151  C "C5'" . DT  I 6  14  ? 82.918  132.803 71.729  1.00 600.00 ? 11  DT  I "C5'" 1 
ATOM   6152  C "C4'" . DT  I 6  14  ? 82.485  132.184 70.420  1.00 600.00 ? 11  DT  I "C4'" 1 
ATOM   6153  O "O4'" . DT  I 6  14  ? 83.327  132.687 69.358  1.00 600.00 ? 11  DT  I "O4'" 1 
ATOM   6154  C "C3'" . DT  I 6  14  ? 82.550  130.656 70.346  1.00 600.00 ? 11  DT  I "C3'" 1 
ATOM   6155  O "O3'" . DT  I 6  14  ? 81.309  130.169 69.797  1.00 600.00 ? 11  DT  I "O3'" 1 
ATOM   6156  C "C2'" . DT  I 6  14  ? 83.728  130.384 69.414  1.00 593.32 ? 11  DT  I "C2'" 1 
ATOM   6157  C "C1'" . DT  I 6  14  ? 83.813  131.630 68.556  1.00 600.00 ? 11  DT  I "C1'" 1 
ATOM   6158  N N1    . DT  I 6  14  ? 85.167  132.034 68.132  1.00 600.00 ? 11  DT  I N1    1 
ATOM   6159  C C2    . DT  I 6  14  ? 85.424  132.262 66.794  1.00 600.00 ? 11  DT  I C2    1 
ATOM   6160  O O2    . DT  I 6  14  ? 84.589  132.144 65.913  1.00 583.33 ? 11  DT  I O2    1 
ATOM   6161  N N3    . DT  I 6  14  ? 86.714  132.636 66.522  1.00 581.34 ? 11  DT  I N3    1 
ATOM   6162  C C4    . DT  I 6  14  ? 87.744  132.802 67.420  1.00 588.24 ? 11  DT  I C4    1 
ATOM   6163  O O4    . DT  I 6  14  ? 88.856  133.147 67.029  1.00 582.47 ? 11  DT  I O4    1 
ATOM   6164  C C5    . DT  I 6  14  ? 87.399  132.546 68.790  1.00 590.30 ? 11  DT  I C5    1 
ATOM   6165  C C7    . DT  I 6  14  ? 88.433  132.694 69.846  1.00 600.00 ? 11  DT  I C7    1 
ATOM   6166  C C6    . DT  I 6  14  ? 86.153  132.183 69.071  1.00 600.00 ? 11  DT  I C6    1 
ATOM   6167  P P     . DG  I 6  15  ? 80.870  128.610 69.778  1.00 600.00 ? 12  DG  I P     1 
ATOM   6168  O OP1   . DG  I 6  15  ? 79.375  128.605 69.707  1.00 600.00 ? 12  DG  I OP1   1 
ATOM   6169  O OP2   . DG  I 6  15  ? 81.581  127.904 70.872  1.00 600.00 ? 12  DG  I OP2   1 
ATOM   6170  O "O5'" . DG  I 6  15  ? 81.430  128.095 68.375  1.00 600.00 ? 12  DG  I "O5'" 1 
ATOM   6171  C "C5'" . DG  I 6  15  ? 81.032  128.770 67.164  1.00 600.00 ? 12  DG  I "C5'" 1 
ATOM   6172  C "C4'" . DG  I 6  15  ? 81.604  128.109 65.933  1.00 586.86 ? 12  DG  I "C4'" 1 
ATOM   6173  O "O4'" . DG  I 6  15  ? 82.949  128.590 65.713  1.00 581.97 ? 12  DG  I "O4'" 1 
ATOM   6174  C "C3'" . DG  I 6  15  ? 81.689  126.589 65.950  1.00 595.53 ? 12  DG  I "C3'" 1 
ATOM   6175  O "O3'" . DG  I 6  15  ? 81.311  126.124 64.643  1.00 582.67 ? 12  DG  I "O3'" 1 
ATOM   6176  C "C2'" . DG  I 6  15  ? 83.159  126.321 66.238  1.00 588.38 ? 12  DG  I "C2'" 1 
ATOM   6177  C "C1'" . DG  I 6  15  ? 83.852  127.508 65.586  1.00 575.42 ? 12  DG  I "C1'" 1 
ATOM   6178  N N9    . DG  I 6  15  ? 85.098  127.973 66.191  1.00 600.00 ? 12  DG  I N9    1 
ATOM   6179  C C8    . DG  I 6  15  ? 85.427  128.014 67.522  1.00 579.96 ? 12  DG  I C8    1 
ATOM   6180  N N7    . DG  I 6  15  ? 86.615  128.481 67.748  1.00 579.21 ? 12  DG  I N7    1 
ATOM   6181  C C5    . DG  I 6  15  ? 87.106  128.784 66.494  1.00 574.13 ? 12  DG  I C5    1 
ATOM   6182  C C6    . DG  I 6  15  ? 88.356  129.330 66.117  1.00 584.92 ? 12  DG  I C6    1 
ATOM   6183  O O6    . DG  I 6  15  ? 89.295  129.664 66.857  1.00 571.95 ? 12  DG  I O6    1 
ATOM   6184  N N1    . DG  I 6  15  ? 88.446  129.477 64.739  1.00 564.35 ? 12  DG  I N1    1 
ATOM   6185  C C2    . DG  I 6  15  ? 87.465  129.135 63.846  1.00 600.00 ? 12  DG  I C2    1 
ATOM   6186  N N2    . DG  I 6  15  ? 87.741  129.348 62.548  1.00 575.53 ? 12  DG  I N2    1 
ATOM   6187  N N3    . DG  I 6  15  ? 86.295  128.622 64.188  1.00 576.30 ? 12  DG  I N3    1 
ATOM   6188  C C4    . DG  I 6  15  ? 86.184  128.476 65.521  1.00 575.91 ? 12  DG  I C4    1 
ATOM   6189  P P     . DT  I 6  16  ? 80.878  124.601 64.321  1.00 568.61 ? 13  DT  I P     1 
ATOM   6190  O OP1   . DT  I 6  16  ? 79.553  124.648 63.645  1.00 594.99 ? 13  DT  I OP1   1 
ATOM   6191  O OP2   . DT  I 6  16  ? 81.059  123.768 65.540  1.00 596.03 ? 13  DT  I OP2   1 
ATOM   6192  O "O5'" . DT  I 6  16  ? 81.993  124.159 63.265  1.00 590.17 ? 13  DT  I "O5'" 1 
ATOM   6193  C "C5'" . DT  I 6  16  ? 82.056  124.778 61.967  1.00 590.36 ? 13  DT  I "C5'" 1 
ATOM   6194  C "C4'" . DT  I 6  16  ? 83.423  124.604 61.343  1.00 583.92 ? 13  DT  I "C4'" 1 
ATOM   6195  O "O4'" . DT  I 6  16  ? 84.422  125.236 62.179  1.00 575.78 ? 13  DT  I "O4'" 1 
ATOM   6196  C "C3'" . DT  I 6  16  ? 83.895  123.159 61.135  1.00 580.86 ? 13  DT  I "C3'" 1 
ATOM   6197  O "O3'" . DT  I 6  16  ? 84.159  122.958 59.728  1.00 578.95 ? 13  DT  I "O3'" 1 
ATOM   6198  C "C2'" . DT  I 6  16  ? 85.150  123.083 62.009  1.00 576.29 ? 13  DT  I "C2'" 1 
ATOM   6199  C "C1'" . DT  I 6  16  ? 85.620  124.519 62.039  1.00 575.22 ? 13  DT  I "C1'" 1 
ATOM   6200  N N1    . DT  I 6  16  ? 86.523  124.890 63.155  1.00 574.91 ? 13  DT  I N1    1 
ATOM   6201  C C2    . DT  I 6  16  ? 87.729  125.499 62.868  1.00 600.00 ? 13  DT  I C2    1 
ATOM   6202  O O2    . DT  I 6  16  ? 88.096  125.749 61.738  1.00 572.83 ? 13  DT  I O2    1 
ATOM   6203  N N3    . DT  I 6  16  ? 88.500  125.808 63.958  1.00 563.10 ? 13  DT  I N3    1 
ATOM   6204  C C4    . DT  I 6  16  ? 88.194  125.576 65.275  1.00 566.56 ? 13  DT  I C4    1 
ATOM   6205  O O4    . DT  I 6  16  ? 88.965  125.900 66.175  1.00 562.99 ? 13  DT  I O4    1 
ATOM   6206  C C5    . DT  I 6  16  ? 86.930  124.942 65.500  1.00 572.11 ? 13  DT  I C5    1 
ATOM   6207  C C7    . DT  I 6  16  ? 86.544  124.655 66.902  1.00 578.46 ? 13  DT  I C7    1 
ATOM   6208  C C6    . DT  I 6  16  ? 86.167  124.635 64.454  1.00 571.15 ? 13  DT  I C6    1 
ATOM   6209  P P     . DT  I 6  17  ? 84.702  121.577 59.078  1.00 566.94 ? 14  DT  I P     1 
ATOM   6210  O OP1   . DT  I 6  17  ? 84.269  121.498 57.650  1.00 574.65 ? 14  DT  I OP1   1 
ATOM   6211  O OP2   . DT  I 6  17  ? 84.385  120.417 59.988  1.00 583.82 ? 14  DT  I OP2   1 
ATOM   6212  O "O5'" . DT  I 6  17  ? 86.276  121.811 59.091  1.00 569.92 ? 14  DT  I "O5'" 1 
ATOM   6213  C "C5'" . DT  I 6  17  ? 86.947  122.212 57.888  1.00 568.58 ? 14  DT  I "C5'" 1 
ATOM   6214  C "C4'" . DT  I 6  17  ? 88.429  122.374 58.110  1.00 567.37 ? 14  DT  I "C4'" 1 
ATOM   6215  O "O4'" . DT  I 6  17  ? 88.671  123.025 59.379  1.00 568.54 ? 14  DT  I "O4'" 1 
ATOM   6216  C "C3'" . DT  I 6  17  ? 89.199  121.063 58.132  1.00 565.49 ? 14  DT  I "C3'" 1 
ATOM   6217  O "O3'" . DT  I 6  17  ? 89.929  120.891 56.896  1.00 570.88 ? 14  DT  I "O3'" 1 
ATOM   6218  C "C2'" . DT  I 6  17  ? 90.121  121.201 59.330  1.00 557.70 ? 14  DT  I "C2'" 1 
ATOM   6219  C "C1'" . DT  I 6  17  ? 89.895  122.573 59.900  1.00 562.69 ? 14  DT  I "C1'" 1 
ATOM   6220  N N1    . DT  I 6  17  ? 89.815  122.557 61.365  1.00 555.49 ? 14  DT  I N1    1 
ATOM   6221  C C2    . DT  I 6  17  ? 90.833  123.148 62.078  1.00 548.68 ? 14  DT  I C2    1 
ATOM   6222  O O2    . DT  I 6  17  ? 91.794  123.680 61.543  1.00 551.18 ? 14  DT  I O2    1 
ATOM   6223  N N3    . DT  I 6  17  ? 90.676  123.088 63.437  1.00 545.90 ? 14  DT  I N3    1 
ATOM   6224  C C4    . DT  I 6  17  ? 89.633  122.511 64.133  1.00 550.24 ? 14  DT  I C4    1 
ATOM   6225  O O4    . DT  I 6  17  ? 89.595  122.515 65.370  1.00 547.98 ? 14  DT  I O4    1 
ATOM   6226  C C5    . DT  I 6  17  ? 88.612  121.914 63.320  1.00 558.48 ? 14  DT  I C5    1 
ATOM   6227  C C7    . DT  I 6  17  ? 87.467  121.261 64.015  1.00 563.89 ? 14  DT  I C7    1 
ATOM   6228  C C6    . DT  I 6  17  ? 88.746  121.963 61.992  1.00 560.22 ? 14  DT  I C6    1 
ATOM   6229  P P     . DA  I 6  18  ? 90.698  119.518 56.506  1.00 564.69 ? 15  DA  I P     1 
ATOM   6230  O OP1   . DA  I 6  18  ? 90.855  119.456 55.033  1.00 578.33 ? 15  DA  I OP1   1 
ATOM   6231  O OP2   . DA  I 6  18  ? 90.049  118.376 57.221  1.00 576.97 ? 15  DA  I OP2   1 
ATOM   6232  O "O5'" . DA  I 6  18  ? 92.136  119.700 57.181  1.00 565.67 ? 15  DA  I "O5'" 1 
ATOM   6233  C "C5'" . DA  I 6  18  ? 92.984  120.818 56.845  1.00 565.79 ? 15  DA  I "C5'" 1 
ATOM   6234  C "C4'" . DA  I 6  18  ? 94.171  120.927 57.780  1.00 553.09 ? 15  DA  I "C4'" 1 
ATOM   6235  O "O4'" . DA  I 6  18  ? 93.732  121.179 59.138  1.00 549.33 ? 15  DA  I "O4'" 1 
ATOM   6236  C "C3'" . DA  I 6  18  ? 95.081  119.705 57.854  1.00 540.59 ? 15  DA  I "C3'" 1 
ATOM   6237  O "O3'" . DA  I 6  18  ? 96.447  120.154 57.807  1.00 531.04 ? 15  DA  I "O3'" 1 
ATOM   6238  C "C2'" . DA  I 6  18  ? 94.732  119.097 59.210  1.00 521.13 ? 15  DA  I "C2'" 1 
ATOM   6239  C "C1'" . DA  I 6  18  ? 94.423  120.327 60.033  1.00 522.98 ? 15  DA  I "C1'" 1 
ATOM   6240  N N9    . DA  I 6  18  ? 93.554  120.141 61.203  1.00 521.08 ? 15  DA  I N9    1 
ATOM   6241  C C8    . DA  I 6  18  ? 92.305  119.634 61.246  1.00 530.65 ? 15  DA  I C8    1 
ATOM   6242  N N7    . DA  I 6  18  ? 91.780  119.604 62.452  1.00 527.97 ? 15  DA  I N7    1 
ATOM   6243  C C5    . DA  I 6  18  ? 92.760  120.130 63.264  1.00 512.86 ? 15  DA  I C5    1 
ATOM   6244  C C6    . DA  I 6  18  ? 92.841  120.374 64.621  1.00 501.49 ? 15  DA  I C6    1 
ATOM   6245  N N6    . DA  I 6  18  ? 91.872  120.107 65.476  1.00 503.63 ? 15  DA  I N6    1 
ATOM   6246  N N1    . DA  I 6  18  ? 93.974  120.908 65.099  1.00 492.67 ? 15  DA  I N1    1 
ATOM   6247  C C2    . DA  I 6  18  ? 94.958  121.181 64.239  1.00 495.06 ? 15  DA  I C2    1 
ATOM   6248  N N3    . DA  I 6  18  ? 94.986  120.995 62.930  1.00 501.02 ? 15  DA  I N3    1 
ATOM   6249  C C4    . DA  I 6  18  ? 93.854  120.463 62.500  1.00 510.32 ? 15  DA  I C4    1 
ATOM   6250  P P     . DT  I 6  19  ? 97.692  119.167 57.530  1.00 508.52 ? 16  DT  I P     1 
ATOM   6251  O OP1   . DT  I 6  19  ? 98.668  119.878 56.672  1.00 526.87 ? 16  DT  I OP1   1 
ATOM   6252  O OP2   . DT  I 6  19  ? 97.163  117.850 57.090  1.00 518.23 ? 16  DT  I OP2   1 
ATOM   6253  O "O5'" . DT  I 6  19  ? 98.299  118.968 58.987  1.00 483.76 ? 16  DT  I "O5'" 1 
ATOM   6254  C "C5'" . DT  I 6  19  ? 98.692  120.086 59.791  1.00 466.80 ? 16  DT  I "C5'" 1 
ATOM   6255  C "C4'" . DT  I 6  19  ? 99.458  119.604 61.000  1.00 453.71 ? 16  DT  I "C4'" 1 
ATOM   6256  O "O4'" . DT  I 6  19  ? 98.560  119.449 62.124  1.00 464.56 ? 16  DT  I "O4'" 1 
ATOM   6257  C "C3'" . DT  I 6  19  ? 100.158 118.262 60.839  1.00 440.99 ? 16  DT  I "C3'" 1 
ATOM   6258  O "O3'" . DT  I 6  19  ? 101.399 118.335 61.539  1.00 421.07 ? 16  DT  I "O3'" 1 
ATOM   6259  C "C2'" . DT  I 6  19  ? 99.184  117.293 61.492  1.00 438.75 ? 16  DT  I "C2'" 1 
ATOM   6260  C "C1'" . DT  I 6  19  ? 98.628  118.128 62.633  1.00 434.02 ? 16  DT  I "C1'" 1 
ATOM   6261  N N1    . DT  I 6  19  ? 97.274  117.830 63.169  1.00 448.44 ? 16  DT  I N1    1 
ATOM   6262  C C2    . DT  I 6  19  ? 97.056  118.143 64.488  1.00 439.72 ? 16  DT  I C2    1 
ATOM   6263  O O2    . DT  I 6  19  ? 97.924  118.635 65.187  1.00 427.40 ? 16  DT  I O2    1 
ATOM   6264  N N3    . DT  I 6  19  ? 95.801  117.865 64.959  1.00 447.82 ? 16  DT  I N3    1 
ATOM   6265  C C4    . DT  I 6  19  ? 94.757  117.310 64.257  1.00 459.61 ? 16  DT  I C4    1 
ATOM   6266  O O4    . DT  I 6  19  ? 93.663  117.108 64.785  1.00 466.36 ? 16  DT  I O4    1 
ATOM   6267  C C5    . DT  I 6  19  ? 95.046  117.003 62.885  1.00 469.78 ? 16  DT  I C5    1 
ATOM   6268  C C7    . DT  I 6  19  ? 93.976  116.394 62.045  1.00 501.91 ? 16  DT  I C7    1 
ATOM   6269  C C6    . DT  I 6  19  ? 96.264  117.272 62.415  1.00 459.87 ? 16  DT  I C6    1 
ATOM   6270  P P     . DG  I 6  20  ? 102.583 117.255 61.391  1.00 419.74 ? 17  DG  I P     1 
ATOM   6271  O OP1   . DG  I 6  20  ? 103.731 117.913 60.725  1.00 401.68 ? 17  DG  I OP1   1 
ATOM   6272  O OP2   . DG  I 6  20  ? 102.031 115.986 60.844  1.00 406.19 ? 17  DG  I OP2   1 
ATOM   6273  O "O5'" . DG  I 6  20  ? 102.962 117.007 62.920  1.00 386.77 ? 17  DG  I "O5'" 1 
ATOM   6274  C "C5'" . DG  I 6  20  ? 103.175 118.148 63.774  1.00 389.19 ? 17  DG  I "C5'" 1 
ATOM   6275  C "C4'" . DG  I 6  20  ? 103.591 117.759 65.172  1.00 369.19 ? 17  DG  I "C4'" 1 
ATOM   6276  O "O4'" . DG  I 6  20  ? 102.411 117.565 65.978  1.00 365.26 ? 17  DG  I "O4'" 1 
ATOM   6277  C "C3'" . DG  I 6  20  ? 104.435 116.505 65.341  1.00 358.23 ? 17  DG  I "C3'" 1 
ATOM   6278  O "O3'" . DG  I 6  20  ? 105.329 116.737 66.447  1.00 351.95 ? 17  DG  I "O3'" 1 
ATOM   6279  C "C2'" . DG  I 6  20  ? 103.398 115.435 65.634  1.00 350.67 ? 17  DG  I "C2'" 1 
ATOM   6280  C "C1'" . DG  I 6  20  ? 102.269 116.195 66.308  1.00 350.57 ? 17  DG  I "C1'" 1 
ATOM   6281  N N9    . DG  I 6  20  ? 100.933 115.751 65.929  1.00 352.04 ? 17  DG  I N9    1 
ATOM   6282  C C8    . DG  I 6  20  ? 100.482 115.369 64.691  1.00 370.17 ? 17  DG  I C8    1 
ATOM   6283  N N7    . DG  I 6  20  ? 99.223  115.024 64.685  1.00 379.40 ? 17  DG  I N7    1 
ATOM   6284  C C5    . DG  I 6  20  ? 98.828  115.193 65.996  1.00 368.08 ? 17  DG  I C5    1 
ATOM   6285  C C6    . DG  I 6  20  ? 97.576  114.978 66.595  1.00 373.13 ? 17  DG  I C6    1 
ATOM   6286  O O6    . DG  I 6  20  ? 96.540  114.583 66.052  1.00 385.69 ? 17  DG  I O6    1 
ATOM   6287  N N1    . DG  I 6  20  ? 97.597  115.268 67.948  1.00 364.38 ? 17  DG  I N1    1 
ATOM   6288  C C2    . DG  I 6  20  ? 98.690  115.708 68.634  1.00 353.32 ? 17  DG  I C2    1 
ATOM   6289  N N2    . DG  I 6  20  ? 98.513  115.937 69.943  1.00 362.11 ? 17  DG  I N2    1 
ATOM   6290  N N3    . DG  I 6  20  ? 99.871  115.915 68.082  1.00 346.44 ? 17  DG  I N3    1 
ATOM   6291  C C4    . DG  I 6  20  ? 99.866  115.637 66.770  1.00 353.36 ? 17  DG  I C4    1 
ATOM   6292  P P     . DC  I 6  21  ? 106.521 115.735 66.877  1.00 353.07 ? 18  DC  I P     1 
ATOM   6293  O OP1   . DC  I 6  21  ? 107.616 116.525 67.494  1.00 358.68 ? 18  DC  I OP1   1 
ATOM   6294  O OP2   . DC  I 6  21  ? 106.804 114.786 65.768  1.00 355.14 ? 18  DC  I OP2   1 
ATOM   6295  O "O5'" . DC  I 6  21  ? 105.848 114.833 68.001  1.00 331.55 ? 18  DC  I "O5'" 1 
ATOM   6296  C "C5'" . DC  I 6  21  ? 105.334 115.453 69.191  1.00 324.64 ? 18  DC  I "C5'" 1 
ATOM   6297  C "C4'" . DC  I 6  21  ? 104.384 114.538 69.921  1.00 301.21 ? 18  DC  I "C4'" 1 
ATOM   6298  O "O4'" . DC  I 6  21  ? 103.248 114.249 69.104  1.00 310.81 ? 18  DC  I "O4'" 1 
ATOM   6299  C "C3'" . DC  I 6  21  ? 104.943 113.185 70.338  1.00 274.86 ? 18  DC  I "C3'" 1 
ATOM   6300  O "O3'" . DC  I 6  21  ? 105.291 113.320 71.732  1.00 267.23 ? 18  DC  I "O3'" 1 
ATOM   6301  C "C2'" . DC  I 6  21  ? 103.784 112.215 70.051  1.00 260.90 ? 18  DC  I "C2'" 1 
ATOM   6302  C "C1'" . DC  I 6  21  ? 102.635 113.112 69.636  1.00 278.33 ? 18  DC  I "C1'" 1 
ATOM   6303  N N1    . DC  I 6  21  ? 101.738 112.606 68.594  1.00 290.36 ? 18  DC  I N1    1 
ATOM   6304  C C2    . DC  I 6  21  ? 100.363 112.533 68.832  1.00 290.94 ? 18  DC  I C2    1 
ATOM   6305  O O2    . DC  I 6  21  ? 99.896  112.889 69.918  1.00 285.01 ? 18  DC  I O2    1 
ATOM   6306  N N3    . DC  I 6  21  ? 99.539  112.073 67.879  1.00 297.58 ? 18  DC  I N3    1 
ATOM   6307  C C4    . DC  I 6  21  ? 100.044 111.692 66.715  1.00 301.90 ? 18  DC  I C4    1 
ATOM   6308  N N4    . DC  I 6  21  ? 99.203  111.242 65.791  1.00 314.67 ? 18  DC  I N4    1 
ATOM   6309  C C5    . DC  I 6  21  ? 101.433 111.754 66.442  1.00 304.10 ? 18  DC  I C5    1 
ATOM   6310  C C6    . DC  I 6  21  ? 102.235 112.213 67.399  1.00 293.22 ? 18  DC  I C6    1 
ATOM   6311  P P     . DA  I 6  22  ? 105.861 112.146 72.680  1.00 252.16 ? 19  DA  I P     1 
ATOM   6312  O OP1   . DA  I 6  22  ? 106.635 112.769 73.782  1.00 250.28 ? 19  DA  I OP1   1 
ATOM   6313  O OP2   . DA  I 6  22  ? 106.488 111.102 71.826  1.00 257.13 ? 19  DA  I OP2   1 
ATOM   6314  O "O5'" . DA  I 6  22  ? 104.523 111.550 73.301  1.00 229.61 ? 19  DA  I "O5'" 1 
ATOM   6315  C "C5'" . DA  I 6  22  ? 103.549 112.434 73.888  1.00 224.42 ? 19  DA  I "C5'" 1 
ATOM   6316  C "C4'" . DA  I 6  22  ? 102.281 111.696 74.230  1.00 189.65 ? 19  DA  I "C4'" 1 
ATOM   6317  O "O4'" . DA  I 6  22  ? 101.577 111.323 73.021  1.00 209.39 ? 19  DA  I "O4'" 1 
ATOM   6318  C "C3'" . DA  I 6  22  ? 102.478 110.419 75.030  1.00 167.46 ? 19  DA  I "C3'" 1 
ATOM   6319  O "O3'" . DA  I 6  22  ? 101.444 110.367 76.024  1.00 142.15 ? 19  DA  I "O3'" 1 
ATOM   6320  C "C2'" . DA  I 6  22  ? 102.356 109.352 73.957  1.00 169.44 ? 19  DA  I "C2'" 1 
ATOM   6321  C "C1'" . DA  I 6  22  ? 101.314 109.937 73.032  1.00 181.60 ? 19  DA  I "C1'" 1 
ATOM   6322  N N9    . DA  I 6  22  ? 101.345 109.436 71.661  1.00 202.19 ? 19  DA  I N9    1 
ATOM   6323  C C8    . DA  I 6  22  ? 102.416 109.036 70.903  1.00 217.58 ? 19  DA  I C8    1 
ATOM   6324  N N7    . DA  I 6  22  ? 102.106 108.634 69.706  1.00 225.28 ? 19  DA  I N7    1 
ATOM   6325  C C5    . DA  I 6  22  ? 100.740 108.777 69.674  1.00 218.10 ? 19  DA  I C5    1 
ATOM   6326  C C6    . DA  I 6  22  ? 99.808  108.517 68.682  1.00 227.03 ? 19  DA  I C6    1 
ATOM   6327  N N6    . DA  I 6  22  ? 100.130 108.045 67.482  1.00 230.09 ? 19  DA  I N6    1 
ATOM   6328  N N1    . DA  I 6  22  ? 98.518  108.759 68.950  1.00 236.53 ? 19  DA  I N1    1 
ATOM   6329  C C2    . DA  I 6  22  ? 98.216  109.228 70.154  1.00 228.45 ? 19  DA  I C2    1 
ATOM   6330  N N3    . DA  I 6  22  ? 99.003  109.516 71.173  1.00 206.98 ? 19  DA  I N3    1 
ATOM   6331  C C4    . DA  I 6  22  ? 100.267 109.263 70.864  1.00 206.06 ? 19  DA  I C4    1 
ATOM   6332  P P     . DA  I 6  23  ? 101.307 109.199 77.117  1.00 93.25  ? 20  DA  I P     1 
ATOM   6333  O OP1   . DA  I 6  23  ? 101.144 109.801 78.474  1.00 75.97  ? 20  DA  I OP1   1 
ATOM   6334  O OP2   . DA  I 6  23  ? 102.358 108.177 76.878  1.00 102.64 ? 20  DA  I OP2   1 
ATOM   6335  O "O5'" . DA  I 6  23  ? 99.908  108.561 76.725  1.00 104.73 ? 20  DA  I "O5'" 1 
ATOM   6336  C "C5'" . DA  I 6  23  ? 98.743  109.403 76.752  1.00 100.55 ? 20  DA  I "C5'" 1 
ATOM   6337  C "C4'" . DA  I 6  23  ? 97.508  108.683 76.292  1.00 89.26  ? 20  DA  I "C4'" 1 
ATOM   6338  O "O4'" . DA  I 6  23  ? 97.619  108.367 74.889  1.00 114.60 ? 20  DA  I "O4'" 1 
ATOM   6339  C "C3'" . DA  I 6  23  ? 97.208  107.388 77.006  1.00 82.42  ? 20  DA  I "C3'" 1 
ATOM   6340  O "O3'" . DA  I 6  23  ? 95.788  107.196 77.053  1.00 78.95  ? 20  DA  I "O3'" 1 
ATOM   6341  C "C2'" . DA  I 6  23  ? 97.861  106.398 76.082  1.00 98.35  ? 20  DA  I "C2'" 1 
ATOM   6342  C "C1'" . DA  I 6  23  ? 97.504  106.975 74.730  1.00 104.70 ? 20  DA  I "C1'" 1 
ATOM   6343  N N9    . DA  I 6  23  ? 98.375  106.540 73.650  1.00 129.30 ? 20  DA  I N9    1 
ATOM   6344  C C8    . DA  I 6  23  ? 99.734  106.372 73.659  1.00 138.26 ? 20  DA  I C8    1 
ATOM   6345  N N7    . DA  I 6  23  ? 100.223 105.962 72.517  1.00 155.08 ? 20  DA  I N7    1 
ATOM   6346  C C5    . DA  I 6  23  ? 99.112  105.861 71.709  1.00 153.14 ? 20  DA  I C5    1 
ATOM   6347  C C6    . DA  I 6  23  ? 98.963  105.474 70.382  1.00 163.23 ? 20  DA  I C6    1 
ATOM   6348  N N6    . DA  I 6  23  ? 99.974  105.110 69.604  1.00 170.94 ? 20  DA  I N6    1 
ATOM   6349  N N1    . DA  I 6  23  ? 97.729  105.474 69.865  1.00 174.51 ? 20  DA  I N1    1 
ATOM   6350  C C2    . DA  I 6  23  ? 96.714  105.837 70.645  1.00 162.54 ? 20  DA  I C2    1 
ATOM   6351  N N3    . DA  I 6  23  ? 96.734  106.220 71.909  1.00 143.73 ? 20  DA  I N3    1 
ATOM   6352  C C4    . DA  I 6  23  ? 97.974  106.209 72.390  1.00 138.43 ? 20  DA  I C4    1 
ATOM   6353  P P     . DA  I 6  24  ? 95.083  106.131 78.033  1.00 63.27  ? 21  DA  I P     1 
ATOM   6354  O OP1   . DA  I 6  24  ? 94.197  106.871 78.989  1.00 54.40  ? 21  DA  I OP1   1 
ATOM   6355  O OP2   . DA  I 6  24  ? 96.124  105.205 78.543  1.00 66.85  ? 21  DA  I OP2   1 
ATOM   6356  O "O5'" . DA  I 6  24  ? 94.183  105.287 77.035  1.00 77.75  ? 21  DA  I "O5'" 1 
ATOM   6357  C "C5'" . DA  I 6  24  ? 93.139  105.906 76.270  1.00 78.45  ? 21  DA  I "C5'" 1 
ATOM   6358  C "C4'" . DA  I 6  24  ? 92.669  104.994 75.157  1.00 80.59  ? 21  DA  I "C4'" 1 
ATOM   6359  O "O4'" . DA  I 6  24  ? 93.728  104.783 74.196  1.00 91.23  ? 21  DA  I "O4'" 1 
ATOM   6360  C "C3'" . DA  I 6  24  ? 92.210  103.607 75.582  1.00 81.58  ? 21  DA  I "C3'" 1 
ATOM   6361  O "O3'" . DA  I 6  24  ? 91.037  103.271 74.822  1.00 84.99  ? 21  DA  I "O3'" 1 
ATOM   6362  C "C2'" . DA  I 6  24  ? 93.397  102.733 75.223  1.00 83.41  ? 21  DA  I "C2'" 1 
ATOM   6363  C "C1'" . DA  I 6  24  ? 93.912  103.400 73.974  1.00 89.49  ? 21  DA  I "C1'" 1 
ATOM   6364  N N9    . DA  I 6  24  ? 95.326  103.184 73.709  1.00 97.80  ? 21  DA  I N9    1 
ATOM   6365  C C8    . DA  I 6  24  ? 96.367  103.336 74.563  1.00 100.22 ? 21  DA  I C8    1 
ATOM   6366  N N7    . DA  I 6  24  ? 97.534  103.069 74.036  1.00 111.26 ? 21  DA  I N7    1 
ATOM   6367  C C5    . DA  I 6  24  ? 97.233  102.718 72.748  1.00 112.51 ? 21  DA  I C5    1 
ATOM   6368  C C6    . DA  I 6  24  ? 98.030  102.329 71.678  1.00 123.78 ? 21  DA  I C6    1 
ATOM   6369  N N6    . DA  I 6  24  ? 99.349  102.222 71.753  1.00 125.32 ? 21  DA  I N6    1 
ATOM   6370  N N1    . DA  I 6  24  ? 97.426  102.043 70.516  1.00 130.99 ? 21  DA  I N1    1 
ATOM   6371  C C2    . DA  I 6  24  ? 96.100  102.154 70.463  1.00 129.16 ? 21  DA  I C2    1 
ATOM   6372  N N3    . DA  I 6  24  ? 95.253  102.513 71.405  1.00 116.39 ? 21  DA  I N3    1 
ATOM   6373  C C4    . DA  I 6  24  ? 95.883  102.785 72.534  1.00 109.17 ? 21  DA  I C4    1 
ATOM   6374  P P     . DT  I 6  25  ? 90.088  102.009 75.150  1.00 92.60  ? 22  DT  I P     1 
ATOM   6375  O OP1   . DT  I 6  25  ? 88.697  102.362 74.779  1.00 83.29  ? 22  DT  I OP1   1 
ATOM   6376  O OP2   . DT  I 6  25  ? 90.383  101.527 76.537  1.00 79.94  ? 22  DT  I OP2   1 
ATOM   6377  O "O5'" . DT  I 6  25  ? 90.625  100.927 74.106  1.00 91.30  ? 22  DT  I "O5'" 1 
ATOM   6378  C "C5'" . DT  I 6  25  ? 90.442  101.171 72.699  1.00 89.43  ? 22  DT  I "C5'" 1 
ATOM   6379  C "C4'" . DT  I 6  25  ? 91.124  100.142 71.829  1.00 86.52  ? 22  DT  I "C4'" 1 
ATOM   6380  O "O4'" . DT  I 6  25  ? 92.557  100.285 71.905  1.00 92.58  ? 22  DT  I "O4'" 1 
ATOM   6381  C "C3'" . DT  I 6  25  ? 90.835  98.677  72.139  1.00 92.76  ? 22  DT  I "C3'" 1 
ATOM   6382  O "O3'" . DT  I 6  25  ? 90.314  98.076  70.942  1.00 94.62  ? 22  DT  I "O3'" 1 
ATOM   6383  C "C2'" . DT  I 6  25  ? 92.209  98.125  72.504  1.00 92.59  ? 22  DT  I "C2'" 1 
ATOM   6384  C "C1'" . DT  I 6  25  ? 93.117  99.017  71.698  1.00 91.12  ? 22  DT  I "C1'" 1 
ATOM   6385  N N1    . DT  I 6  25  ? 94.526  99.069  72.119  1.00 92.38  ? 22  DT  I N1    1 
ATOM   6386  C C2    . DT  I 6  25  ? 95.514  98.778  71.210  1.00 97.33  ? 22  DT  I C2    1 
ATOM   6387  O O2    . DT  I 6  25  ? 95.283  98.475  70.061  1.00 99.27  ? 22  DT  I O2    1 
ATOM   6388  N N3    . DT  I 6  25  ? 96.788  98.856  71.697  1.00 102.76 ? 22  DT  I N3    1 
ATOM   6389  C C4    . DT  I 6  25  ? 97.157  99.188  72.970  1.00 101.21 ? 22  DT  I C4    1 
ATOM   6390  O O4    . DT  I 6  25  ? 98.341  99.230  73.303  1.00 104.60 ? 22  DT  I O4    1 
ATOM   6391  C C5    . DT  I 6  25  ? 96.079  99.476  73.855  1.00 101.70 ? 22  DT  I C5    1 
ATOM   6392  C C7    . DT  I 6  25  ? 96.408  99.843  75.254  1.00 101.54 ? 22  DT  I C7    1 
ATOM   6393  C C6    . DT  I 6  25  ? 94.837  99.405  73.398  1.00 96.04  ? 22  DT  I C6    1 
ATOM   6394  P P     . DC  I 6  26  ? 89.684  96.591  70.879  1.00 96.34  ? 23  DC  I P     1 
ATOM   6395  O OP1   . DC  I 6  26  ? 88.467  96.628  70.036  1.00 94.32  ? 23  DC  I OP1   1 
ATOM   6396  O OP2   . DC  I 6  26  ? 89.641  96.010  72.245  1.00 94.60  ? 23  DC  I OP2   1 
ATOM   6397  O "O5'" . DC  I 6  26  ? 90.810  95.749  70.129  1.00 92.57  ? 23  DC  I "O5'" 1 
ATOM   6398  C "C5'" . DC  I 6  26  ? 91.070  96.025  68.744  1.00 90.68  ? 23  DC  I "C5'" 1 
ATOM   6399  C "C4'" . DC  I 6  26  ? 92.172  95.154  68.189  1.00 97.37  ? 23  DC  I "C4'" 1 
ATOM   6400  O "O4'" . DC  I 6  26  ? 93.435  95.565  68.754  1.00 92.92  ? 23  DC  I "O4'" 1 
ATOM   6401  C "C3'" . DC  I 6  26  ? 92.032  93.656  68.461  1.00 99.20  ? 23  DC  I "C3'" 1 
ATOM   6402  O "O3'" . DC  I 6  26  ? 92.119  92.939  67.211  1.00 98.98  ? 23  DC  I "O3'" 1 
ATOM   6403  C "C2'" . DC  I 6  26  ? 93.206  93.345  69.376  1.00 93.82  ? 23  DC  I "C2'" 1 
ATOM   6404  C "C1'" . DC  I 6  26  ? 94.208  94.434  69.071  1.00 88.57  ? 23  DC  I "C1'" 1 
ATOM   6405  N N1    . DC  I 6  26  ? 95.047  94.802  70.211  1.00 87.05  ? 23  DC  I N1    1 
ATOM   6406  C C2    . DC  I 6  26  ? 96.442  94.723  70.138  1.00 89.44  ? 23  DC  I C2    1 
ATOM   6407  O O2    . DC  I 6  26  ? 96.998  94.337  69.105  1.00 89.26  ? 23  DC  I O2    1 
ATOM   6408  N N3    . DC  I 6  26  ? 97.173  95.067  71.202  1.00 89.05  ? 23  DC  I N3    1 
ATOM   6409  C C4    . DC  I 6  26  ? 96.565  95.478  72.306  1.00 88.64  ? 23  DC  I C4    1 
ATOM   6410  N N4    . DC  I 6  26  ? 97.323  95.812  73.341  1.00 92.91  ? 23  DC  I N4    1 
ATOM   6411  C C5    . DC  I 6  26  ? 95.160  95.567  72.408  1.00 89.48  ? 23  DC  I C5    1 
ATOM   6412  C C6    . DC  I 6  26  ? 94.448  95.222  71.347  1.00 87.76  ? 23  DC  I C6    1 
ATOM   6413  P P     . DC  I 6  27  ? 91.848  91.349  67.062  1.00 88.66  ? 24  DC  I P     1 
ATOM   6414  O OP1   . DC  I 6  27  ? 91.228  91.090  65.740  1.00 102.77 ? 24  DC  I OP1   1 
ATOM   6415  O OP2   . DC  I 6  27  ? 91.226  90.833  68.308  1.00 100.90 ? 24  DC  I OP2   1 
ATOM   6416  O "O5'" . DC  I 6  27  ? 93.313  90.716  67.073  1.00 98.82  ? 24  DC  I "O5'" 1 
ATOM   6417  C "C5'" . DC  I 6  27  ? 94.294  91.186  66.132  1.00 95.14  ? 24  DC  I "C5'" 1 
ATOM   6418  C "C4'" . DC  I 6  27  ? 95.544  90.334  66.138  1.00 99.76  ? 24  DC  I "C4'" 1 
ATOM   6419  O "O4'" . DC  I 6  27  ? 96.472  90.902  67.086  1.00 93.13  ? 24  DC  I "O4'" 1 
ATOM   6420  C "C3'" . DC  I 6  27  ? 95.357  88.857  66.502  1.00 101.86 ? 24  DC  I "C3'" 1 
ATOM   6421  O "O3'" . DC  I 6  27  ? 95.920  88.034  65.457  1.00 99.50  ? 24  DC  I "O3'" 1 
ATOM   6422  C "C2'" . DC  I 6  27  ? 96.111  88.687  67.816  1.00 89.85  ? 24  DC  I "C2'" 1 
ATOM   6423  C "C1'" . DC  I 6  27  ? 96.967  89.923  67.975  1.00 87.77  ? 24  DC  I "C1'" 1 
ATOM   6424  N N1    . DC  I 6  27  ? 96.929  90.505  69.317  1.00 84.80  ? 24  DC  I N1    1 
ATOM   6425  C C2    . DC  I 6  27  ? 98.116  90.810  69.986  1.00 79.59  ? 24  DC  I C2    1 
ATOM   6426  O O2    . DC  I 6  27  ? 99.207  90.586  69.449  1.00 79.05  ? 24  DC  I O2    1 
ATOM   6427  N N3    . DC  I 6  27  ? 98.061  91.345  71.212  1.00 76.97  ? 24  DC  I N3    1 
ATOM   6428  C C4    . DC  I 6  27  ? 96.875  91.576  71.771  1.00 79.37  ? 24  DC  I C4    1 
ATOM   6429  N N4    . DC  I 6  27  ? 96.849  92.105  72.987  1.00 77.54  ? 24  DC  I N4    1 
ATOM   6430  C C5    . DC  I 6  27  ? 95.661  91.278  71.118  1.00 82.90  ? 24  DC  I C5    1 
ATOM   6431  C C6    . DC  I 6  27  ? 95.734  90.749  69.906  1.00 84.53  ? 24  DC  I C6    1 
ATOM   6432  P P     . DG  I 6  28  ? 95.794  86.420  65.413  1.00 88.53  ? 25  DG  I P     1 
ATOM   6433  O OP1   . DG  I 6  28  ? 95.917  85.981  64.001  1.00 109.05 ? 25  DG  I OP1   1 
ATOM   6434  O OP2   . DG  I 6  28  ? 94.614  86.010  66.218  1.00 99.87  ? 25  DG  I OP2   1 
ATOM   6435  O "O5'" . DG  I 6  28  ? 97.103  85.938  66.196  1.00 97.02  ? 25  DG  I "O5'" 1 
ATOM   6436  C "C5'" . DG  I 6  28  ? 98.407  86.456  65.847  1.00 95.87  ? 25  DG  I "C5'" 1 
ATOM   6437  C "C4'" . DG  I 6  28  ? 99.493  85.878  66.729  1.00 96.17  ? 25  DG  I "C4'" 1 
ATOM   6438  O "O4'" . DG  I 6  28  ? 99.554  86.599  67.989  1.00 88.08  ? 25  DG  I "O4'" 1 
ATOM   6439  C "C3'" . DG  I 6  28  ? 99.352  84.402  67.081  1.00 99.82  ? 25  DG  I "C3'" 1 
ATOM   6440  O "O3'" . DG  I 6  28  ? 100.663 83.818  66.988  1.00 97.56  ? 25  DG  I "O3'" 1 
ATOM   6441  C "C2'" . DG  I 6  28  ? 98.797  84.442  68.501  1.00 90.45  ? 25  DG  I "C2'" 1 
ATOM   6442  C "C1'" . DG  I 6  28  ? 99.417  85.702  69.085  1.00 84.44  ? 25  DG  I "C1'" 1 
ATOM   6443  N N9    . DG  I 6  28  ? 98.614  86.391  70.105  1.00 78.32  ? 25  DG  I N9    1 
ATOM   6444  C C8    . DG  I 6  28  ? 97.250  86.539  70.135  1.00 76.50  ? 25  DG  I C8    1 
ATOM   6445  N N7    . DG  I 6  28  ? 96.819  87.202  71.161  1.00 70.09  ? 25  DG  I N7    1 
ATOM   6446  C C5    . DG  I 6  28  ? 97.960  87.516  71.855  1.00 69.56  ? 25  DG  I C5    1 
ATOM   6447  C C6    . DG  I 6  28  ? 98.096  88.228  73.048  1.00 65.18  ? 25  DG  I C6    1 
ATOM   6448  O O6    . DG  I 6  28  ? 97.200  88.729  73.727  1.00 62.72  ? 25  DG  I O6    1 
ATOM   6449  N N1    . DG  I 6  28  ? 99.415  88.334  73.432  1.00 64.47  ? 25  DG  I N1    1 
ATOM   6450  C C2    . DG  I 6  28  ? 100.474 87.816  72.746  1.00 64.58  ? 25  DG  I C2    1 
ATOM   6451  N N2    . DG  I 6  28  ? 101.684 88.031  73.286  1.00 63.63  ? 25  DG  I N2    1 
ATOM   6452  N N3    . DG  I 6  28  ? 100.361 87.140  71.614  1.00 69.33  ? 25  DG  I N3    1 
ATOM   6453  C C4    . DG  I 6  28  ? 99.078  87.029  71.230  1.00 72.84  ? 25  DG  I C4    1 
ATOM   6454  P P     . DC  I 6  29  ? 100.987 82.252  67.208  1.00 91.47  ? 26  DC  I P     1 
ATOM   6455  O OP1   . DC  I 6  29  ? 102.006 81.834  66.213  1.00 103.38 ? 26  DC  I OP1   1 
ATOM   6456  O OP2   . DC  I 6  29  ? 99.722  81.487  67.370  1.00 99.21  ? 26  DC  I OP2   1 
ATOM   6457  O "O5'" . DC  I 6  29  ? 101.647 82.240  68.659  1.00 95.15  ? 26  DC  I "O5'" 1 
ATOM   6458  C "C5'" . DC  I 6  29  ? 102.778 83.094  68.918  1.00 92.57  ? 26  DC  I "C5'" 1 
ATOM   6459  C "C4'" . DC  I 6  29  ? 103.201 83.037  70.364  1.00 91.38  ? 26  DC  I "C4'" 1 
ATOM   6460  O "O4'" . DC  I 6  29  ? 102.296 83.832  71.159  1.00 82.85  ? 26  DC  I "O4'" 1 
ATOM   6461  C "C3'" . DC  I 6  29  ? 103.249 81.642  70.978  1.00 85.56  ? 26  DC  I "C3'" 1 
ATOM   6462  O "O3'" . DC  I 6  29  ? 104.608 81.417  71.402  1.00 85.23  ? 26  DC  I "O3'" 1 
ATOM   6463  C "C2'" . DC  I 6  29  ? 102.236 81.701  72.118  1.00 76.10  ? 26  DC  I "C2'" 1 
ATOM   6464  C "C1'" . DC  I 6  29  ? 101.990 83.176  72.367  1.00 73.96  ? 26  DC  I "C1'" 1 
ATOM   6465  N N1    . DC  I 6  29  ? 100.600 83.536  72.697  1.00 68.84  ? 26  DC  I N1    1 
ATOM   6466  C C2    . DC  I 6  29  ? 100.328 84.328  73.813  1.00 64.24  ? 26  DC  I C2    1 
ATOM   6467  O O2    . DC  I 6  29  ? 101.246 84.728  74.529  1.00 62.76  ? 26  DC  I O2    1 
ATOM   6468  N N3    . DC  I 6  29  ? 99.062  84.656  74.110  1.00 61.29  ? 26  DC  I N3    1 
ATOM   6469  C C4    . DC  I 6  29  ? 98.077  84.222  73.335  1.00 64.27  ? 26  DC  I C4    1 
ATOM   6470  N N4    . DC  I 6  29  ? 96.831  84.563  73.652  1.00 62.42  ? 26  DC  I N4    1 
ATOM   6471  C C5    . DC  I 6  29  ? 98.317  83.419  72.197  1.00 67.47  ? 26  DC  I C5    1 
ATOM   6472  C C6    . DC  I 6  29  ? 99.577  83.103  71.918  1.00 68.98  ? 26  DC  I C6    1 
ATOM   6473  P P     . DT  I 6  30  ? 105.134 80.134  72.228  1.00 83.31  ? 27  DT  I P     1 
ATOM   6474  O OP1   . DT  I 6  30  ? 106.538 79.864  71.834  1.00 92.86  ? 27  DT  I OP1   1 
ATOM   6475  O OP2   . DT  I 6  30  ? 104.108 79.061  72.151  1.00 86.69  ? 27  DT  I OP2   1 
ATOM   6476  O "O5'" . DT  I 6  30  ? 105.142 80.712  73.714  1.00 85.52  ? 27  DT  I "O5'" 1 
ATOM   6477  C "C5'" . DT  I 6  30  ? 105.767 81.991  73.949  1.00 84.29  ? 27  DT  I "C5'" 1 
ATOM   6478  C "C4'" . DT  I 6  30  ? 105.708 82.413  75.395  1.00 81.14  ? 27  DT  I "C4'" 1 
ATOM   6479  O "O4'" . DT  I 6  30  ? 104.369 82.819  75.735  1.00 71.14  ? 27  DT  I "O4'" 1 
ATOM   6480  C "C3'" . DT  I 6  30  ? 106.142 81.401  76.436  1.00 71.89  ? 27  DT  I "C3'" 1 
ATOM   6481  O "O3'" . DT  I 6  30  ? 106.979 82.140  77.338  1.00 71.30  ? 27  DT  I "O3'" 1 
ATOM   6482  C "C2'" . DT  I 6  30  ? 104.828 80.941  77.066  1.00 67.81  ? 27  DT  I "C2'" 1 
ATOM   6483  C "C1'" . DT  I 6  30  ? 103.912 82.135  76.880  1.00 63.48  ? 27  DT  I "C1'" 1 
ATOM   6484  N N1    . DT  I 6  30  ? 102.485 81.896  76.610  1.00 60.29  ? 27  DT  I N1    1 
ATOM   6485  C C2    . DT  I 6  30  ? 101.571 82.631  77.320  1.00 58.23  ? 27  DT  I C2    1 
ATOM   6486  O O2    . DT  I 6  30  ? 101.904 83.453  78.153  1.00 65.85  ? 27  DT  I O2    1 
ATOM   6487  N N3    . DT  I 6  30  ? 100.262 82.374  77.026  1.00 59.91  ? 27  DT  I N3    1 
ATOM   6488  C C4    . DT  I 6  30  ? 99.798  81.470  76.110  1.00 61.16  ? 27  DT  I C4    1 
ATOM   6489  O O4    . DT  I 6  30  ? 98.597  81.328  75.926  1.00 60.61  ? 27  DT  I O4    1 
ATOM   6490  C C5    . DT  I 6  30  ? 100.802 80.743  75.407  1.00 59.90  ? 27  DT  I C5    1 
ATOM   6491  C C7    . DT  I 6  30  ? 100.359 79.745  74.402  1.00 66.86  ? 27  DT  I C7    1 
ATOM   6492  C C6    . DT  I 6  30  ? 102.078 80.983  75.684  1.00 62.35  ? 27  DT  I C6    1 
ATOM   6493  P P     . DC  I 6  31  ? 107.877 81.474  78.491  1.00 85.81  ? 28  DC  I P     1 
ATOM   6494  O OP1   . DC  I 6  31  ? 109.059 82.337  78.735  1.00 78.66  ? 28  DC  I OP1   1 
ATOM   6495  O OP2   . DC  I 6  31  ? 108.029 80.022  78.213  1.00 77.01  ? 28  DC  I OP2   1 
ATOM   6496  O "O5'" . DC  I 6  31  ? 106.926 81.541  79.763  1.00 75.36  ? 28  DC  I "O5'" 1 
ATOM   6497  C "C5'" . DC  I 6  31  ? 106.341 82.793  80.174  1.00 74.24  ? 28  DC  I "C5'" 1 
ATOM   6498  C "C4'" . DC  I 6  31  ? 105.325 82.567  81.264  1.00 66.29  ? 28  DC  I "C4'" 1 
ATOM   6499  O "O4'" . DC  I 6  31  ? 104.106 82.008  80.711  1.00 60.30  ? 28  DC  I "O4'" 1 
ATOM   6500  C "C3'" . DC  I 6  31  ? 105.798 81.584  82.321  1.00 66.44  ? 28  DC  I "C3'" 1 
ATOM   6501  O "O3'" . DC  I 6  31  ? 105.327 81.977  83.614  1.00 62.88  ? 28  DC  I "O3'" 1 
ATOM   6502  C "C2'" . DC  I 6  31  ? 105.133 80.304  81.871  1.00 63.83  ? 28  DC  I "C2'" 1 
ATOM   6503  C "C1'" . DC  I 6  31  ? 103.788 80.819  81.396  1.00 55.85  ? 28  DC  I "C1'" 1 
ATOM   6504  N N1    . DC  I 6  31  ? 102.987 79.979  80.481  1.00 54.87  ? 28  DC  I N1    1 
ATOM   6505  C C2    . DC  I 6  31  ? 101.637 80.286  80.342  1.00 57.40  ? 28  DC  I C2    1 
ATOM   6506  O O2    . DC  I 6  31  ? 101.161 81.229  80.971  1.00 58.60  ? 28  DC  I O2    1 
ATOM   6507  N N3    . DC  I 6  31  ? 100.853 79.567  79.529  1.00 57.73  ? 28  DC  I N3    1 
ATOM   6508  C C4    . DC  I 6  31  ? 101.363 78.553  78.852  1.00 59.16  ? 28  DC  I C4    1 
ATOM   6509  N N4    . DC  I 6  31  ? 100.553 77.860  78.053  1.00 59.14  ? 28  DC  I N4    1 
ATOM   6510  C C5    . DC  I 6  31  ? 102.727 78.203  78.963  1.00 58.97  ? 28  DC  I C5    1 
ATOM   6511  C C6    . DC  I 6  31  ? 103.496 78.928  79.775  1.00 57.48  ? 28  DC  I C6    1 
ATOM   6512  P P     . DA  I 6  32  ? 106.227 82.809  84.656  1.00 66.93  ? 29  DA  I P     1 
ATOM   6513  O OP1   . DA  I 6  32  ? 106.659 84.081  84.029  1.00 69.35  ? 29  DA  I OP1   1 
ATOM   6514  O OP2   . DA  I 6  32  ? 107.246 81.889  85.215  1.00 69.04  ? 29  DA  I OP2   1 
ATOM   6515  O "O5'" . DA  I 6  32  ? 105.170 83.145  85.791  1.00 62.90  ? 29  DA  I "O5'" 1 
ATOM   6516  C "C5'" . DA  I 6  32  ? 104.384 84.339  85.679  1.00 64.62  ? 29  DA  I "C5'" 1 
ATOM   6517  C "C4'" . DA  I 6  32  ? 102.941 84.114  86.067  1.00 58.72  ? 29  DA  I "C4'" 1 
ATOM   6518  O "O4'" . DA  I 6  32  ? 102.332 83.105  85.234  1.00 58.04  ? 29  DA  I "O4'" 1 
ATOM   6519  C "C3'" . DA  I 6  32  ? 102.689 83.649  87.488  1.00 54.58  ? 29  DA  I "C3'" 1 
ATOM   6520  O "O3'" . DA  I 6  32  ? 101.400 84.135  87.881  1.00 50.55  ? 29  DA  I "O3'" 1 
ATOM   6521  C "C2'" . DA  I 6  32  ? 102.688 82.145  87.316  1.00 55.81  ? 29  DA  I "C2'" 1 
ATOM   6522  C "C1'" . DA  I 6  32  ? 101.904 82.021  86.034  1.00 50.66  ? 29  DA  I "C1'" 1 
ATOM   6523  N N9    . DA  I 6  32  ? 102.112 80.794  85.285  1.00 50.93  ? 29  DA  I N9    1 
ATOM   6524  C C8    . DA  I 6  32  ? 103.239 80.038  85.158  1.00 53.78  ? 29  DA  I C8    1 
ATOM   6525  N N7    . DA  I 6  32  ? 103.079 78.985  84.399  1.00 54.51  ? 29  DA  I N7    1 
ATOM   6526  C C5    . DA  I 6  32  ? 101.768 79.064  84.008  1.00 49.18  ? 29  DA  I C5    1 
ATOM   6527  C C6    . DA  I 6  32  ? 100.996 78.248  83.199  1.00 51.89  ? 29  DA  I C6    1 
ATOM   6528  N N6    . DA  I 6  32  ? 101.480 77.155  82.629  1.00 55.91  ? 29  DA  I N6    1 
ATOM   6529  N N1    . DA  I 6  32  ? 99.715  78.590  82.995  1.00 50.43  ? 29  DA  I N1    1 
ATOM   6530  C C2    . DA  I 6  32  ? 99.272  79.691  83.584  1.00 50.43  ? 29  DA  I C2    1 
ATOM   6531  N N3    . DA  I 6  32  ? 99.908  80.537  84.366  1.00 50.15  ? 29  DA  I N3    1 
ATOM   6532  C C4    . DA  I 6  32  ? 101.167 80.163  84.541  1.00 48.24  ? 29  DA  I C4    1 
ATOM   6533  P P     . DA  I 6  33  ? 100.901 84.128  89.403  1.00 49.20  ? 30  DA  I P     1 
ATOM   6534  O OP1   . DA  I 6  33  ? 101.069 85.503  89.938  1.00 40.99  ? 30  DA  I OP1   1 
ATOM   6535  O OP2   . DA  I 6  33  ? 101.605 83.016  90.085  1.00 45.80  ? 30  DA  I OP2   1 
ATOM   6536  O "O5'" . DA  I 6  33  ? 99.363  83.717  89.319  1.00 42.24  ? 30  DA  I "O5'" 1 
ATOM   6537  C "C5'" . DA  I 6  33  ? 98.462  84.284  88.356  1.00 43.30  ? 30  DA  I "C5'" 1 
ATOM   6538  C "C4'" . DA  I 6  33  ? 97.270  83.381  88.148  1.00 39.21  ? 30  DA  I "C4'" 1 
ATOM   6539  O "O4'" . DA  I 6  33  ? 97.665  82.250  87.339  1.00 42.19  ? 30  DA  I "O4'" 1 
ATOM   6540  C "C3'" . DA  I 6  33  ? 96.646  82.809  89.413  1.00 35.24  ? 30  DA  I "C3'" 1 
ATOM   6541  O "O3'" . DA  I 6  33  ? 95.207  82.815  89.299  1.00 31.97  ? 30  DA  I "O3'" 1 
ATOM   6542  C "C2'" . DA  I 6  33  ? 97.227  81.413  89.448  1.00 37.41  ? 30  DA  I "C2'" 1 
ATOM   6543  C "C1'" . DA  I 6  33  ? 97.316  81.046  87.988  1.00 37.24  ? 30  DA  I "C1'" 1 
ATOM   6544  N N9    . DA  I 6  33  ? 98.330  80.037  87.678  1.00 39.36  ? 30  DA  I N9    1 
ATOM   6545  C C8    . DA  I 6  33  ? 99.625  79.987  88.102  1.00 41.38  ? 30  DA  I C8    1 
ATOM   6546  N N7    . DA  I 6  33  ? 100.292 78.954  87.654  1.00 42.71  ? 30  DA  I N7    1 
ATOM   6547  C C5    . DA  I 6  33  ? 99.375  78.283  86.885  1.00 41.59  ? 30  DA  I C5    1 
ATOM   6548  C C6    . DA  I 6  33  ? 99.468  77.111  86.142  1.00 43.62  ? 30  DA  I C6    1 
ATOM   6549  N N6    . DA  I 6  33  ? 100.574 76.385  86.052  1.00 46.84  ? 30  DA  I N6    1 
ATOM   6550  N N1    . DA  I 6  33  ? 98.380  76.697  85.485  1.00 45.92  ? 30  DA  I N1    1 
ATOM   6551  C C2    . DA  I 6  33  ? 97.275  77.431  85.580  1.00 45.07  ? 30  DA  I C2    1 
ATOM   6552  N N3    . DA  I 6  33  ? 97.071  78.551  86.249  1.00 40.38  ? 30  DA  I N3    1 
ATOM   6553  C C4    . DA  I 6  33  ? 98.168  78.932  86.890  1.00 40.27  ? 30  DA  I C4    1 
ATOM   6554  P P     . DT  I 6  34  ? 94.235  82.462  90.534  1.00 30.91  ? 31  DT  I P     1 
ATOM   6555  O OP1   . DT  I 6  34  ? 93.080  83.426  90.599  1.00 32.35  ? 31  DT  I OP1   1 
ATOM   6556  O OP2   . DT  I 6  34  ? 95.080  82.276  91.735  1.00 31.13  ? 31  DT  I OP2   1 
ATOM   6557  O "O5'" . DT  I 6  34  ? 93.673  81.033  90.151  1.00 30.23  ? 31  DT  I "O5'" 1 
ATOM   6558  C "C5'" . DT  I 6  34  ? 92.994  80.872  88.903  1.00 33.04  ? 31  DT  I "C5'" 1 
ATOM   6559  C "C4'" . DT  I 6  34  ? 92.611  79.438  88.656  1.00 33.91  ? 31  DT  I "C4'" 1 
ATOM   6560  O "O4'" . DT  I 6  34  ? 93.789  78.716  88.266  1.00 36.22  ? 31  DT  I "O4'" 1 
ATOM   6561  C "C3'" . DT  I 6  34  ? 91.992  78.689  89.824  1.00 36.83  ? 31  DT  I "C3'" 1 
ATOM   6562  O "O3'" . DT  I 6  34  ? 90.667  78.274  89.437  1.00 44.23  ? 31  DT  I "O3'" 1 
ATOM   6563  C "C2'" . DT  I 6  34  ? 92.959  77.532  90.057  1.00 39.00  ? 31  DT  I "C2'" 1 
ATOM   6564  C "C1'" . DT  I 6  34  ? 93.715  77.415  88.762  1.00 35.91  ? 31  DT  I "C1'" 1 
ATOM   6565  N N1    . DT  I 6  34  ? 95.092  76.933  88.892  1.00 33.99  ? 31  DT  I N1    1 
ATOM   6566  C C2    . DT  I 6  34  ? 95.478  75.825  88.190  1.00 38.81  ? 31  DT  I C2    1 
ATOM   6567  O O2    . DT  I 6  34  ? 94.732  75.211  87.453  1.00 42.13  ? 31  DT  I O2    1 
ATOM   6568  N N3    . DT  I 6  34  ? 96.778  75.455  88.375  1.00 39.31  ? 31  DT  I N3    1 
ATOM   6569  C C4    . DT  I 6  34  ? 97.697  76.070  89.176  1.00 38.32  ? 31  DT  I C4    1 
ATOM   6570  O O4    . DT  I 6  34  ? 98.849  75.649  89.265  1.00 40.24  ? 31  DT  I O4    1 
ATOM   6571  C C5    . DT  I 6  34  ? 97.220  77.210  89.872  1.00 33.76  ? 31  DT  I C5    1 
ATOM   6572  C C7    . DT  I 6  34  ? 98.172  77.907  90.760  1.00 34.66  ? 31  DT  I C7    1 
ATOM   6573  C C6    . DT  I 6  34  ? 95.965  77.585  89.705  1.00 31.34  ? 31  DT  I C6    1 
ATOM   6574  P P     . DT  I 6  35  ? 89.714  77.382  90.388  1.00 55.94  ? 32  DT  I P     1 
ATOM   6575  O OP1   . DT  I 6  35  ? 88.265  77.729  90.272  1.00 56.30  ? 32  DT  I OP1   1 
ATOM   6576  O OP2   . DT  I 6  35  ? 90.336  77.283  91.730  1.00 50.29  ? 32  DT  I OP2   1 
ATOM   6577  O "O5'" . DT  I 6  35  ? 89.886  75.997  89.675  1.00 53.87  ? 32  DT  I "O5'" 1 
ATOM   6578  C "C5'" . DT  I 6  35  ? 89.584  74.829  90.415  1.00 60.49  ? 32  DT  I "C5'" 1 
ATOM   6579  C "C4'" . DT  I 6  35  ? 90.081  73.633  89.678  1.00 63.54  ? 32  DT  I "C4'" 1 
ATOM   6580  O "O4'" . DT  I 6  35  ? 91.507  73.741  89.481  1.00 53.68  ? 32  DT  I "O4'" 1 
ATOM   6581  C "C3'" . DT  I 6  35  ? 89.832  72.351  90.425  1.00 70.61  ? 32  DT  I "C3'" 1 
ATOM   6582  O "O3'" . DT  I 6  35  ? 89.225  71.416  89.525  1.00 80.05  ? 32  DT  I "O3'" 1 
ATOM   6583  C "C2'" . DT  I 6  35  ? 91.219  71.939  90.874  1.00 62.99  ? 32  DT  I "C2'" 1 
ATOM   6584  C "C1'" . DT  I 6  35  ? 92.120  72.531  89.835  1.00 52.19  ? 32  DT  I "C1'" 1 
ATOM   6585  N N1    . DT  I 6  35  ? 93.445  72.866  90.348  1.00 44.22  ? 32  DT  I N1    1 
ATOM   6586  C C2    . DT  I 6  35  ? 94.514  72.085  90.009  1.00 49.95  ? 32  DT  I C2    1 
ATOM   6587  O O2    . DT  I 6  35  ? 94.404  71.110  89.288  1.00 57.66  ? 32  DT  I O2    1 
ATOM   6588  N N3    . DT  I 6  35  ? 95.705  72.487  90.541  1.00 45.84  ? 32  DT  I N3    1 
ATOM   6589  C C4    . DT  I 6  35  ? 95.904  73.568  91.360  1.00 42.36  ? 32  DT  I C4    1 
ATOM   6590  O O4    . DT  I 6  35  ? 97.017  73.847  91.785  1.00 41.22  ? 32  DT  I O4    1 
ATOM   6591  C C5    . DT  I 6  35  ? 94.742  74.323  91.663  1.00 40.32  ? 32  DT  I C5    1 
ATOM   6592  C C7    . DT  I 6  35  ? 94.894  75.495  92.549  1.00 39.07  ? 32  DT  I C7    1 
ATOM   6593  C C6    . DT  I 6  35  ? 93.587  73.945  91.155  1.00 41.41  ? 32  DT  I C6    1 
ATOM   6594  P P     . DG  I 6  36  ? 88.171  70.323  90.056  1.00 91.66  ? 33  DG  I P     1 
ATOM   6595  O OP1   . DG  I 6  36  ? 87.594  69.615  88.889  1.00 99.51  ? 33  DG  I OP1   1 
ATOM   6596  O OP2   . DG  I 6  36  ? 87.271  70.979  91.040  1.00 92.10  ? 33  DG  I OP2   1 
ATOM   6597  O "O5'" . DG  I 6  36  ? 89.128  69.319  90.833  1.00 86.09  ? 33  DG  I "O5'" 1 
ATOM   6598  C "C5'" . DG  I 6  36  ? 90.034  68.481  90.093  1.00 84.63  ? 33  DG  I "C5'" 1 
ATOM   6599  C "C4'" . DG  I 6  36  ? 90.909  67.710  91.041  1.00 81.05  ? 33  DG  I "C4'" 1 
ATOM   6600  O "O4'" . DG  I 6  36  ? 92.108  68.460  91.341  1.00 69.31  ? 33  DG  I "O4'" 1 
ATOM   6601  C "C3'" . DG  I 6  36  ? 90.266  67.352  92.379  1.00 83.70  ? 33  DG  I "C3'" 1 
ATOM   6602  O "O3'" . DG  I 6  36  ? 90.353  65.920  92.479  1.00 86.82  ? 33  DG  I "O3'" 1 
ATOM   6603  C "C2'" . DG  I 6  36  ? 91.112  68.113  93.396  1.00 70.44  ? 33  DG  I "C2'" 1 
ATOM   6604  C "C1'" . DG  I 6  36  ? 92.445  68.250  92.692  1.00 64.47  ? 33  DG  I "C1'" 1 
ATOM   6605  N N9    . DG  I 6  36  ? 93.281  69.362  93.117  1.00 51.96  ? 33  DG  I N9    1 
ATOM   6606  C C8    . DG  I 6  36  ? 92.888  70.591  93.556  1.00 52.87  ? 33  DG  I C8    1 
ATOM   6607  N N7    . DG  I 6  36  ? 93.874  71.368  93.860  1.00 49.81  ? 33  DG  I N7    1 
ATOM   6608  C C5    . DG  I 6  36  ? 94.987  70.607  93.607  1.00 46.26  ? 33  DG  I C5    1 
ATOM   6609  C C6    . DG  I 6  36  ? 96.343  70.925  93.751  1.00 46.06  ? 33  DG  I C6    1 
ATOM   6610  O O6    . DG  I 6  36  ? 96.835  71.982  94.143  1.00 46.09  ? 33  DG  I O6    1 
ATOM   6611  N N1    . DG  I 6  36  ? 97.156  69.874  93.387  1.00 44.42  ? 33  DG  I N1    1 
ATOM   6612  C C2    . DG  I 6  36  ? 96.711  68.670  92.942  1.00 48.70  ? 33  DG  I C2    1 
ATOM   6613  N N2    . DG  I 6  36  ? 97.651  67.769  92.634  1.00 48.45  ? 33  DG  I N2    1 
ATOM   6614  N N3    . DG  I 6  36  ? 95.436  68.359  92.800  1.00 50.91  ? 33  DG  I N3    1 
ATOM   6615  C C4    . DG  I 6  36  ? 94.640  69.371  93.150  1.00 47.99  ? 33  DG  I C4    1 
ATOM   6616  P P     . DG  I 6  37  ? 89.821  65.023  93.706  1.00 91.18  ? 34  DG  I P     1 
ATOM   6617  O OP1   . DG  I 6  37  ? 89.229  63.785  93.144  1.00 92.85  ? 34  DG  I OP1   1 
ATOM   6618  O OP2   . DG  I 6  37  ? 89.037  65.864  94.647  1.00 92.04  ? 34  DG  I OP2   1 
ATOM   6619  O "O5'" . DG  I 6  37  ? 91.198  64.640  94.407  1.00 81.29  ? 34  DG  I "O5'" 1 
ATOM   6620  C "C5'" . DG  I 6  37  ? 92.248  64.055  93.611  1.00 78.45  ? 34  DG  I "C5'" 1 
ATOM   6621  C "C4'" . DG  I 6  37  ? 93.466  63.793  94.450  1.00 76.55  ? 34  DG  I "C4'" 1 
ATOM   6622  O "O4'" . DG  I 6  37  ? 94.211  65.027  94.572  1.00 62.71  ? 34  DG  I "O4'" 1 
ATOM   6623  C "C3'" . DG  I 6  37  ? 93.189  63.288  95.865  1.00 76.70  ? 34  DG  I "C3'" 1 
ATOM   6624  O "O3'" . DG  I 6  37  ? 94.010  62.133  96.109  1.00 76.10  ? 34  DG  I "O3'" 1 
ATOM   6625  C "C2'" . DG  I 6  37  ? 93.579  64.467  96.736  1.00 67.65  ? 34  DG  I "C2'" 1 
ATOM   6626  C "C1'" . DG  I 6  37  ? 94.622  65.182  95.909  1.00 59.09  ? 34  DG  I "C1'" 1 
ATOM   6627  N N9    . DG  I 6  37  ? 94.696  66.600  96.214  1.00 51.10  ? 34  DG  I N9    1 
ATOM   6628  C C8    . DG  I 6  37  ? 93.658  67.482  96.309  1.00 52.91  ? 34  DG  I C8    1 
ATOM   6629  N N7    . DG  I 6  37  ? 94.037  68.685  96.600  1.00 49.51  ? 34  DG  I N7    1 
ATOM   6630  C C5    . DG  I 6  37  ? 95.404  68.588  96.699  1.00 43.89  ? 34  DG  I C5    1 
ATOM   6631  C C6    . DG  I 6  37  ? 96.356  69.572  96.994  1.00 43.86  ? 34  DG  I C6    1 
ATOM   6632  O O6    . DG  I 6  37  ? 96.158  70.767  97.228  1.00 43.81  ? 34  DG  I O6    1 
ATOM   6633  N N1    . DG  I 6  37  ? 97.636  69.057  96.999  1.00 41.65  ? 34  DG  I N1    1 
ATOM   6634  C C2    . DG  I 6  37  ? 97.946  67.757  96.749  1.00 44.96  ? 34  DG  I C2    1 
ATOM   6635  N N2    . DG  I 6  37  ? 99.242  67.424  96.793  1.00 45.78  ? 34  DG  I N2    1 
ATOM   6636  N N3    . DG  I 6  37  ? 97.058  66.829  96.473  1.00 45.62  ? 34  DG  I N3    1 
ATOM   6637  C C4    . DG  I 6  37  ? 95.822  67.314  96.466  1.00 44.72  ? 34  DG  I C4    1 
ATOM   6638  P P     . DT  I 6  38  ? 93.880  61.197  97.420  1.00 85.16  ? 35  DT  I P     1 
ATOM   6639  O OP1   . DT  I 6  38  ? 94.012  59.783  96.996  1.00 78.97  ? 35  DT  I OP1   1 
ATOM   6640  O OP2   . DT  I 6  38  ? 92.705  61.624  98.222  1.00 75.40  ? 35  DT  I OP2   1 
ATOM   6641  O "O5'" . DT  I 6  38  ? 95.191  61.601  98.229  1.00 72.25  ? 35  DT  I "O5'" 1 
ATOM   6642  C "C5'" . DT  I 6  38  ? 96.480  61.368  97.633  1.00 69.61  ? 35  DT  I "C5'" 1 
ATOM   6643  C "C4'" . DT  I 6  38  ? 97.600  61.883  98.505  1.00 64.79  ? 35  DT  I "C4'" 1 
ATOM   6644  O "O4'" . DT  I 6  38  ? 97.577  63.329  98.494  1.00 56.93  ? 35  DT  I "O4'" 1 
ATOM   6645  C "C3'" . DT  I 6  38  ? 97.569  61.446  99.972  1.00 65.66  ? 35  DT  I "C3'" 1 
ATOM   6646  O "O3'" . DT  I 6  38  ? 98.862  60.927  100.343 1.00 66.27  ? 35  DT  I "O3'" 1 
ATOM   6647  C "C2'" . DT  I 6  38  ? 97.242  62.732  100.707 1.00 60.99  ? 35  DT  I "C2'" 1 
ATOM   6648  C "C1'" . DT  I 6  38  ? 97.802  63.800  99.795  1.00 52.86  ? 35  DT  I "C1'" 1 
ATOM   6649  N N1    . DT  I 6  38  ? 97.167  65.118  99.936  1.00 47.43  ? 35  DT  I N1    1 
ATOM   6650  C C2    . DT  I 6  38  ? 97.972  66.214  100.105 1.00 45.98  ? 35  DT  I C2    1 
ATOM   6651  O O2    . DT  I 6  38  ? 99.187  66.147  100.140 1.00 49.93  ? 35  DT  I O2    1 
ATOM   6652  N N3    . DT  I 6  38  ? 97.304  67.395  100.226 1.00 44.75  ? 35  DT  I N3    1 
ATOM   6653  C C4    . DT  I 6  38  ? 95.945  67.581  100.196 1.00 46.37  ? 35  DT  I C4    1 
ATOM   6654  O O4    . DT  I 6  38  ? 95.456  68.699  100.314 1.00 44.31  ? 35  DT  I O4    1 
ATOM   6655  C C5    . DT  I 6  38  ? 95.173  66.398  100.019 1.00 47.46  ? 35  DT  I C5    1 
ATOM   6656  C C7    . DT  I 6  38  ? 93.697  66.531  99.982  1.00 46.59  ? 35  DT  I C7    1 
ATOM   6657  C C6    . DT  I 6  38  ? 95.806  65.243  99.899  1.00 47.29  ? 35  DT  I C6    1 
ATOM   6658  P P     . DC  I 6  39  ? 99.180  60.246  101.779 1.00 78.15  ? 36  DC  I P     1 
ATOM   6659  O OP1   . DC  I 6  39  ? 100.179 59.167  101.591 1.00 69.25  ? 36  DC  I OP1   1 
ATOM   6660  O OP2   . DC  I 6  39  ? 97.905  59.985  102.494 1.00 68.02  ? 36  DC  I OP2   1 
ATOM   6661  O "O5'" . DC  I 6  39  ? 99.855  61.427  102.605 1.00 60.12  ? 36  DC  I "O5'" 1 
ATOM   6662  C "C5'" . DC  I 6  39  ? 101.045 62.043  102.084 1.00 62.68  ? 36  DC  I "C5'" 1 
ATOM   6663  C "C4'" . DC  I 6  39  ? 101.548 63.137  102.991 1.00 60.56  ? 36  DC  I "C4'" 1 
ATOM   6664  O "O4'" . DC  I 6  39  ? 100.724 64.303  102.822 1.00 57.13  ? 36  DC  I "O4'" 1 
ATOM   6665  C "C3'" . DC  I 6  39  ? 101.554 62.801  104.473 1.00 60.76  ? 36  DC  I "C3'" 1 
ATOM   6666  O "O3'" . DC  I 6  39  ? 102.918 62.893  104.926 1.00 60.17  ? 36  DC  I "O3'" 1 
ATOM   6667  C "C2'" . DC  I 6  39  ? 100.648 63.852  105.106 1.00 55.75  ? 36  DC  I "C2'" 1 
ATOM   6668  C "C1'" . DC  I 6  39  ? 100.487 64.926  104.059 1.00 50.15  ? 36  DC  I "C1'" 1 
ATOM   6669  N N1    . DC  I 6  39  ? 99.148  65.513  103.954 1.00 46.07  ? 36  DC  I N1    1 
ATOM   6670  C C2    . DC  I 6  39  ? 98.976  66.888  104.065 1.00 43.06  ? 36  DC  I C2    1 
ATOM   6671  O O2    . DC  I 6  39  ? 99.955  67.618  104.254 1.00 46.28  ? 36  DC  I O2    1 
ATOM   6672  N N3    . DC  I 6  39  ? 97.745  67.408  103.967 1.00 41.34  ? 36  DC  I N3    1 
ATOM   6673  C C4    . DC  I 6  39  ? 96.706  66.608  103.762 1.00 41.87  ? 36  DC  I C4    1 
ATOM   6674  N N4    . DC  I 6  39  ? 95.502  67.162  103.671 1.00 40.60  ? 36  DC  I N4    1 
ATOM   6675  C C5    . DC  I 6  39  ? 96.850  65.213  103.651 1.00 49.01  ? 36  DC  I C5    1 
ATOM   6676  C C6    . DC  I 6  39  ? 98.077  64.714  103.749 1.00 49.42  ? 36  DC  I C6    1 
ATOM   6677  P P     . DG  I 6  40  ? 103.420 62.454  106.394 1.00 70.56  ? 37  DG  I P     1 
ATOM   6678  O OP1   . DG  I 6  40  ? 104.841 62.048  106.291 1.00 65.68  ? 37  DG  I OP1   1 
ATOM   6679  O OP2   . DG  I 6  40  ? 102.421 61.541  107.004 1.00 63.38  ? 37  DG  I OP2   1 
ATOM   6680  O "O5'" . DG  I 6  40  ? 103.356 63.831  107.186 1.00 62.02  ? 37  DG  I "O5'" 1 
ATOM   6681  C "C5'" . DG  I 6  40  ? 103.958 65.007  106.616 1.00 62.16  ? 37  DG  I "C5'" 1 
ATOM   6682  C "C4'" . DG  I 6  40  ? 103.775 66.195  107.518 1.00 59.61  ? 37  DG  I "C4'" 1 
ATOM   6683  O "O4'" . DG  I 6  40  ? 102.462 66.757  107.338 1.00 54.73  ? 37  DG  I "O4'" 1 
ATOM   6684  C "C3'" . DG  I 6  40  ? 103.955 65.930  108.995 1.00 57.75  ? 37  DG  I "C3'" 1 
ATOM   6685  O "O3'" . DG  I 6  40  ? 104.878 66.936  109.424 1.00 60.87  ? 37  DG  I "O3'" 1 
ATOM   6686  C "C2'" . DG  I 6  40  ? 102.543 66.040  109.567 1.00 54.74  ? 37  DG  I "C2'" 1 
ATOM   6687  C "C1'" . DG  I 6  40  ? 101.799 66.909  108.574 1.00 50.20  ? 37  DG  I "C1'" 1 
ATOM   6688  N N9    . DG  I 6  40  ? 100.409 66.567  108.284 1.00 44.41  ? 37  DG  I N9    1 
ATOM   6689  C C8    . DG  I 6  40  ? 99.847  65.331  108.147 1.00 46.77  ? 37  DG  I C8    1 
ATOM   6690  N N7    . DG  I 6  40  ? 98.576  65.365  107.881 1.00 43.96  ? 37  DG  I N7    1 
ATOM   6691  C C5    . DG  I 6  40  ? 98.286  66.705  107.839 1.00 40.17  ? 37  DG  I C5    1 
ATOM   6692  C C6    . DG  I 6  40  ? 97.069  67.364  107.594 1.00 40.15  ? 37  DG  I C6    1 
ATOM   6693  O O6    . DG  I 6  40  ? 95.957  66.892  107.349 1.00 41.75  ? 37  DG  I O6    1 
ATOM   6694  N N1    . DG  I 6  40  ? 97.217  68.724  107.646 1.00 38.57  ? 37  DG  I N1    1 
ATOM   6695  C C2    . DG  I 6  40  ? 98.369  69.378  107.902 1.00 40.55  ? 37  DG  I C2    1 
ATOM   6696  N N2    . DG  I 6  40  ? 98.233  70.700  107.893 1.00 37.93  ? 37  DG  I N2    1 
ATOM   6697  N N3    . DG  I 6  40  ? 99.520  68.787  108.132 1.00 43.39  ? 37  DG  I N3    1 
ATOM   6698  C C4    . DG  I 6  40  ? 99.400  67.456  108.085 1.00 41.17  ? 37  DG  I C4    1 
ATOM   6699  P P     . DT  I 6  41  ? 105.409 67.147  110.922 1.00 69.71  ? 38  DT  I P     1 
ATOM   6700  O OP1   . DT  I 6  41  ? 106.846 67.505  110.873 1.00 72.41  ? 38  DT  I OP1   1 
ATOM   6701  O OP2   . DT  I 6  41  ? 104.942 66.022  111.769 1.00 65.39  ? 38  DT  I OP2   1 
ATOM   6702  O "O5'" . DT  I 6  41  ? 104.596 68.445  111.329 1.00 60.50  ? 38  DT  I "O5'" 1 
ATOM   6703  C "C5'" . DT  I 6  41  ? 104.501 69.561  110.421 1.00 59.70  ? 38  DT  I "C5'" 1 
ATOM   6704  C "C4'" . DT  I 6  41  ? 103.592 70.612  110.980 1.00 53.24  ? 38  DT  I "C4'" 1 
ATOM   6705  O "O4'" . DT  I 6  41  ? 102.222 70.224  110.730 1.00 48.71  ? 38  DT  I "O4'" 1 
ATOM   6706  C "C3'" . DT  I 6  41  ? 103.725 70.792  112.481 1.00 51.96  ? 38  DT  I "C3'" 1 
ATOM   6707  O "O3'" . DT  I 6  41  ? 103.446 72.137  112.865 1.00 49.94  ? 38  DT  I "O3'" 1 
ATOM   6708  C "C2'" . DT  I 6  41  ? 102.622 69.887  112.976 1.00 51.36  ? 38  DT  I "C2'" 1 
ATOM   6709  C "C1'" . DT  I 6  41  ? 101.542 70.177  111.951 1.00 42.60  ? 38  DT  I "C1'" 1 
ATOM   6710  N N1    . DT  I 6  41  ? 100.425 69.227  111.824 1.00 39.72  ? 38  DT  I N1    1 
ATOM   6711  C C2    . DT  I 6  41  ? 99.221  69.735  111.417 1.00 41.39  ? 38  DT  I C2    1 
ATOM   6712  O O2    . DT  I 6  41  ? 99.065  70.907  111.166 1.00 45.66  ? 38  DT  I O2    1 
ATOM   6713  N N3    . DT  I 6  41  ? 98.201  68.833  111.306 1.00 41.63  ? 38  DT  I N3    1 
ATOM   6714  C C4    . DT  I 6  41  ? 98.272  67.494  111.562 1.00 43.65  ? 38  DT  I C4    1 
ATOM   6715  O O4    . DT  I 6  41  ? 97.289  66.765  111.429 1.00 43.21  ? 38  DT  I O4    1 
ATOM   6716  C C5    . DT  I 6  41  ? 99.554  67.033  111.981 1.00 41.24  ? 38  DT  I C5    1 
ATOM   6717  C C7    . DT  I 6  41  ? 99.714  65.592  112.270 1.00 40.52  ? 38  DT  I C7    1 
ATOM   6718  C C6    . DT  I 6  41  ? 100.549 67.897  112.093 1.00 41.66  ? 38  DT  I C6    1 
ATOM   6719  P P     . DA  I 6  42  ? 104.557 73.292  113.022 1.00 56.28  ? 39  DA  I P     1 
ATOM   6720  O OP1   . DA  I 6  42  ? 105.419 73.329  111.821 1.00 59.33  ? 39  DA  I OP1   1 
ATOM   6721  O OP2   . DA  I 6  42  ? 105.161 73.161  114.367 1.00 63.03  ? 39  DA  I OP2   1 
ATOM   6722  O "O5'" . DA  I 6  42  ? 103.642 74.599  112.996 1.00 45.96  ? 39  DA  I "O5'" 1 
ATOM   6723  C "C5'" . DA  I 6  42  ? 102.880 74.865  111.806 1.00 44.21  ? 39  DA  I "C5'" 1 
ATOM   6724  C "C4'" . DA  I 6  42  ? 101.652 75.717  112.019 1.00 36.31  ? 39  DA  I "C4'" 1 
ATOM   6725  O "O4'" . DA  I 6  42  ? 100.481 74.917  112.236 1.00 34.07  ? 39  DA  I "O4'" 1 
ATOM   6726  C "C3'" . DA  I 6  42  ? 101.674 76.689  113.162 1.00 32.95  ? 39  DA  I "C3'" 1 
ATOM   6727  O "O3'" . DA  I 6  42  ? 100.748 77.730  112.835 1.00 30.86  ? 39  DA  I "O3'" 1 
ATOM   6728  C "C2'" . DA  I 6  42  ? 101.174 75.817  114.285 1.00 39.86  ? 39  DA  I "C2'" 1 
ATOM   6729  C "C1'" . DA  I 6  42  ? 100.126 74.974  113.596 1.00 34.08  ? 39  DA  I "C1'" 1 
ATOM   6730  N N9    . DA  I 6  42  ? 99.985  73.616  114.071 1.00 35.77  ? 39  DA  I N9    1 
ATOM   6731  C C8    . DA  I 6  42  ? 100.904 72.802  114.670 1.00 41.55  ? 39  DA  I C8    1 
ATOM   6732  N N7    . DA  I 6  42  ? 100.436 71.626  114.964 1.00 40.30  ? 39  DA  I N7    1 
ATOM   6733  C C5    . DA  I 6  42  ? 99.145  71.689  114.529 1.00 34.41  ? 39  DA  I C5    1 
ATOM   6734  C C6    . DA  I 6  42  ? 98.139  70.762  114.556 1.00 36.29  ? 39  DA  I C6    1 
ATOM   6735  N N6    . DA  I 6  42  ? 98.331  69.555  115.074 1.00 41.18  ? 39  DA  I N6    1 
ATOM   6736  N N1    . DA  I 6  42  ? 96.946  71.101  114.050 1.00 35.42  ? 39  DA  I N1    1 
ATOM   6737  C C2    . DA  I 6  42  ? 96.826  72.313  113.543 1.00 37.25  ? 39  DA  I C2    1 
ATOM   6738  N N3    . DA  I 6  42  ? 97.695  73.287  113.456 1.00 36.50  ? 39  DA  I N3    1 
ATOM   6739  C C4    . DA  I 6  42  ? 98.856  72.899  113.976 1.00 34.09  ? 39  DA  I C4    1 
ATOM   6740  P P     . DG  I 6  43  ? 100.540 79.043  113.723 1.00 29.23  ? 40  DG  I P     1 
ATOM   6741  O OP1   . DG  I 6  43  ? 100.726 80.204  112.819 1.00 30.72  ? 40  DG  I OP1   1 
ATOM   6742  O OP2   . DG  I 6  43  ? 101.437 78.937  114.884 1.00 32.06  ? 40  DG  I OP2   1 
ATOM   6743  O "O5'" . DG  I 6  43  ? 99.044  78.965  114.237 1.00 28.28  ? 40  DG  I "O5'" 1 
ATOM   6744  C "C5'" . DG  I 6  43  ? 97.980  78.515  113.392 1.00 28.92  ? 40  DG  I "C5'" 1 
ATOM   6745  C "C4'" . DG  I 6  43  ? 96.774  78.123  114.210 1.00 35.07  ? 40  DG  I "C4'" 1 
ATOM   6746  O "O4'" . DG  I 6  43  ? 96.898  76.779  114.731 1.00 36.21  ? 40  DG  I "O4'" 1 
ATOM   6747  C "C3'" . DG  I 6  43  ? 96.478  79.001  115.403 1.00 38.90  ? 40  DG  I "C3'" 1 
ATOM   6748  O "O3'" . DG  I 6  43  ? 95.068  79.195  115.392 1.00 42.33  ? 40  DG  I "O3'" 1 
ATOM   6749  C "C2'" . DG  I 6  43  ? 96.991  78.172  116.567 1.00 39.19  ? 40  DG  I "C2'" 1 
ATOM   6750  C "C1'" . DG  I 6  43  ? 96.651  76.767  116.122 1.00 37.15  ? 40  DG  I "C1'" 1 
ATOM   6751  N N9    . DG  I 6  43  ? 97.448  75.676  116.693 1.00 33.94  ? 40  DG  I N9    1 
ATOM   6752  C C8    . DG  I 6  43  ? 98.742  75.710  117.106 1.00 34.46  ? 40  DG  I C8    1 
ATOM   6753  N N7    . DG  I 6  43  ? 99.172  74.575  117.562 1.00 35.86  ? 40  DG  I N7    1 
ATOM   6754  C C5    . DG  I 6  43  ? 98.097  73.735  117.441 1.00 32.96  ? 40  DG  I C5    1 
ATOM   6755  C C6    . DG  I 6  43  ? 97.967  72.379  117.776 1.00 34.14  ? 40  DG  I C6    1 
ATOM   6756  O O6    . DG  I 6  43  ? 98.790  71.602  118.259 1.00 35.09  ? 40  DG  I O6    1 
ATOM   6757  N N1    . DG  I 6  43  ? 96.717  71.909  117.495 1.00 33.85  ? 40  DG  I N1    1 
ATOM   6758  C C2    . DG  I 6  43  ? 95.711  72.632  116.969 1.00 35.40  ? 40  DG  I C2    1 
ATOM   6759  N N2    . DG  I 6  43  ? 94.599  71.920  116.797 1.00 36.43  ? 40  DG  I N2    1 
ATOM   6760  N N3    . DG  I 6  43  ? 95.801  73.907  116.644 1.00 36.08  ? 40  DG  I N3    1 
ATOM   6761  C C4    . DG  I 6  43  ? 97.020  74.390  116.908 1.00 34.12  ? 40  DG  I C4    1 
ATOM   6762  P P     . DA  I 6  44  ? 94.237  80.173  116.359 1.00 54.54  ? 41  DA  I P     1 
ATOM   6763  O OP1   . DA  I 6  44  ? 94.345  81.558  115.826 1.00 60.30  ? 41  DA  I OP1   1 
ATOM   6764  O OP2   . DA  I 6  44  ? 94.679  79.955  117.755 1.00 49.24  ? 41  DA  I OP2   1 
ATOM   6765  O "O5'" . DA  I 6  44  ? 92.746  79.613  116.241 1.00 47.77  ? 41  DA  I "O5'" 1 
ATOM   6766  C "C5'" . DA  I 6  44  ? 92.533  78.289  115.698 1.00 46.58  ? 41  DA  I "C5'" 1 
ATOM   6767  C "C4'" . DA  I 6  44  ? 91.327  77.583  116.248 1.00 50.48  ? 41  DA  I "C4'" 1 
ATOM   6768  O "O4'" . DA  I 6  44  ? 91.773  76.323  116.794 1.00 47.67  ? 41  DA  I "O4'" 1 
ATOM   6769  C "C3'" . DA  I 6  44  ? 90.564  78.257  117.370 1.00 51.41  ? 41  DA  I "C3'" 1 
ATOM   6770  O "O3'" . DA  I 6  44  ? 89.221  77.734  117.403 1.00 54.06  ? 41  DA  I "O3'" 1 
ATOM   6771  C "C2'" . DA  I 6  44  ? 91.372  77.813  118.567 1.00 49.47  ? 41  DA  I "C2'" 1 
ATOM   6772  C "C1'" . DA  I 6  44  ? 91.735  76.385  118.208 1.00 44.00  ? 41  DA  I "C1'" 1 
ATOM   6773  N N9    . DA  I 6  44  ? 93.000  75.933  118.778 1.00 38.15  ? 41  DA  I N9    1 
ATOM   6774  C C8    . DA  I 6  44  ? 94.150  76.642  118.971 1.00 39.47  ? 41  DA  I C8    1 
ATOM   6775  N N7    . DA  I 6  44  ? 95.108  75.948  119.510 1.00 38.35  ? 41  DA  I N7    1 
ATOM   6776  C C5    . DA  I 6  44  ? 94.557  74.707  119.684 1.00 35.66  ? 41  DA  I C5    1 
ATOM   6777  C C6    . DA  I 6  44  ? 95.094  73.535  120.208 1.00 35.51  ? 41  DA  I C6    1 
ATOM   6778  N N6    . DA  I 6  44  ? 96.330  73.443  120.670 1.00 35.17  ? 41  DA  I N6    1 
ATOM   6779  N N1    . DA  I 6  44  ? 94.312  72.450  120.254 1.00 34.83  ? 41  DA  I N1    1 
ATOM   6780  C C2    . DA  I 6  44  ? 93.072  72.570  119.787 1.00 36.74  ? 41  DA  I C2    1 
ATOM   6781  N N3    . DA  I 6  44  ? 92.459  73.623  119.265 1.00 40.44  ? 41  DA  I N3    1 
ATOM   6782  C C4    . DA  I 6  44  ? 93.270  74.676  119.238 1.00 37.78  ? 41  DA  I C4    1 
ATOM   6783  P P     . DC  I 6  45  ? 88.058  78.322  118.358 1.00 61.04  ? 42  DC  I P     1 
ATOM   6784  O OP1   . DC  I 6  45  ? 86.752  78.149  117.680 1.00 60.23  ? 42  DC  I OP1   1 
ATOM   6785  O OP2   . DC  I 6  45  ? 88.475  79.651  118.873 1.00 59.24  ? 42  DC  I OP2   1 
ATOM   6786  O "O5'" . DC  I 6  45  ? 88.097  77.374  119.641 1.00 56.16  ? 42  DC  I "O5'" 1 
ATOM   6787  C "C5'" . DC  I 6  45  ? 87.821  75.970  119.501 1.00 55.48  ? 42  DC  I "C5'" 1 
ATOM   6788  C "C4'" . DC  I 6  45  ? 88.129  75.213  120.770 1.00 53.93  ? 42  DC  I "C4'" 1 
ATOM   6789  O "O4'" . DC  I 6  45  ? 89.547  75.103  120.941 1.00 48.84  ? 42  DC  I "O4'" 1 
ATOM   6790  C "C3'" . DC  I 6  45  ? 87.598  75.831  122.059 1.00 57.29  ? 42  DC  I "C3'" 1 
ATOM   6791  O "O3'" . DC  I 6  45  ? 86.571  74.961  122.565 1.00 62.73  ? 42  DC  I "O3'" 1 
ATOM   6792  C "C2'" . DC  I 6  45  ? 88.817  75.890  122.976 1.00 51.99  ? 42  DC  I "C2'" 1 
ATOM   6793  C "C1'" . DC  I 6  45  ? 89.813  74.981  122.308 1.00 44.47  ? 42  DC  I "C1'" 1 
ATOM   6794  N N1    . DC  I 6  45  ? 91.231  75.312  122.479 1.00 41.74  ? 42  DC  I N1    1 
ATOM   6795  C C2    . DC  I 6  45  ? 92.110  74.340  122.944 1.00 40.93  ? 42  DC  I C2    1 
ATOM   6796  O O2    . DC  I 6  45  ? 91.686  73.212  123.210 1.00 43.38  ? 42  DC  I O2    1 
ATOM   6797  N N3    . DC  I 6  45  ? 93.406  74.632  123.101 1.00 37.93  ? 42  DC  I N3    1 
ATOM   6798  C C4    . DC  I 6  45  ? 93.847  75.847  122.812 1.00 35.66  ? 42  DC  I C4    1 
ATOM   6799  N N4    . DC  I 6  45  ? 95.146  76.101  122.980 1.00 32.98  ? 42  DC  I N4    1 
ATOM   6800  C C5    . DC  I 6  45  ? 92.980  76.855  122.339 1.00 39.89  ? 42  DC  I C5    1 
ATOM   6801  C C6    . DC  I 6  45  ? 91.694  76.548  122.188 1.00 43.07  ? 42  DC  I C6    1 
ATOM   6802  P P     . DA  I 6  46  ? 85.623  75.306  123.823 1.00 74.18  ? 43  DA  I P     1 
ATOM   6803  O OP1   . DA  I 6  46  ? 84.301  74.683  123.583 1.00 68.73  ? 43  DA  I OP1   1 
ATOM   6804  O OP2   . DA  I 6  46  ? 85.718  76.755  124.127 1.00 67.87  ? 43  DA  I OP2   1 
ATOM   6805  O "O5'" . DA  I 6  46  ? 86.336  74.512  125.001 1.00 60.34  ? 43  DA  I "O5'" 1 
ATOM   6806  C "C5'" . DA  I 6  46  ? 86.534  73.096  124.861 1.00 64.83  ? 43  DA  I "C5'" 1 
ATOM   6807  C "C4'" . DA  I 6  46  ? 87.214  72.512  126.072 1.00 69.55  ? 43  DA  I "C4'" 1 
ATOM   6808  O "O4'" . DA  I 6  46  ? 88.636  72.764  125.990 1.00 59.67  ? 43  DA  I "O4'" 1 
ATOM   6809  C "C3'" . DA  I 6  46  ? 86.746  73.050  127.420 1.00 70.42  ? 43  DA  I "C3'" 1 
ATOM   6810  O "O3'" . DA  I 6  46  ? 86.583  71.934  128.316 1.00 74.45  ? 43  DA  I "O3'" 1 
ATOM   6811  C "C2'" . DA  I 6  46  ? 87.881  73.981  127.824 1.00 63.70  ? 43  DA  I "C2'" 1 
ATOM   6812  C "C1'" . DA  I 6  46  ? 89.095  73.337  127.192 1.00 52.65  ? 43  DA  I "C1'" 1 
ATOM   6813  N N9    . DA  I 6  46  ? 90.174  74.254  126.860 1.00 42.82  ? 43  DA  I N9    1 
ATOM   6814  C C8    . DA  I 6  46  ? 90.105  75.511  126.342 1.00 45.60  ? 43  DA  I C8    1 
ATOM   6815  N N7    . DA  I 6  46  ? 91.267  76.068  126.158 1.00 43.69  ? 43  DA  I N7    1 
ATOM   6816  C C5    . DA  I 6  46  ? 92.151  75.120  126.583 1.00 36.07  ? 43  DA  I C5    1 
ATOM   6817  C C6    . DA  I 6  46  ? 93.528  75.105  126.642 1.00 34.73  ? 43  DA  I C6    1 
ATOM   6818  N N6    . DA  I 6  46  ? 94.254  76.135  126.250 1.00 35.11  ? 43  DA  I N6    1 
ATOM   6819  N N1    . DA  I 6  46  ? 94.135  74.012  127.116 1.00 34.77  ? 43  DA  I N1    1 
ATOM   6820  C C2    . DA  I 6  46  ? 93.361  73.001  127.500 1.00 38.89  ? 43  DA  I C2    1 
ATOM   6821  N N3    . DA  I 6  46  ? 92.048  72.902  127.489 1.00 42.36  ? 43  DA  I N3    1 
ATOM   6822  C C4    . DA  I 6  46  ? 91.499  74.005  127.014 1.00 37.88  ? 43  DA  I C4    1 
ATOM   6823  P P     . DG  I 6  47  ? 85.995  72.056  129.816 1.00 83.37  ? 44  DG  I P     1 
ATOM   6824  O OP1   . DG  I 6  47  ? 85.303  70.787  130.146 1.00 86.22  ? 44  DG  I OP1   1 
ATOM   6825  O OP2   . DG  I 6  47  ? 85.279  73.351  129.960 1.00 80.54  ? 44  DG  I OP2   1 
ATOM   6826  O "O5'" . DG  I 6  47  ? 87.330  72.128  130.680 1.00 73.00  ? 44  DG  I "O5'" 1 
ATOM   6827  C "C5'" . DG  I 6  47  ? 88.289  71.058  130.593 1.00 67.62  ? 44  DG  I "C5'" 1 
ATOM   6828  C "C4'" . DG  I 6  47  ? 89.460  71.321  131.500 1.00 64.35  ? 44  DG  I "C4'" 1 
ATOM   6829  O "O4'" . DG  I 6  47  ? 90.381  72.224  130.840 1.00 56.85  ? 44  DG  I "O4'" 1 
ATOM   6830  C "C3'" . DG  I 6  47  ? 89.115  71.960  132.843 1.00 65.88  ? 44  DG  I "C3'" 1 
ATOM   6831  O "O3'" . DG  I 6  47  ? 89.875  71.299  133.867 1.00 63.47  ? 44  DG  I "O3'" 1 
ATOM   6832  C "C2'" . DG  I 6  47  ? 89.547  73.398  132.638 1.00 59.91  ? 44  DG  I "C2'" 1 
ATOM   6833  C "C1'" . DG  I 6  47  ? 90.756  73.227  131.753 1.00 50.46  ? 44  DG  I "C1'" 1 
ATOM   6834  N N9    . DG  I 6  47  ? 91.141  74.427  131.026 1.00 43.90  ? 44  DG  I N9    1 
ATOM   6835  C C8    . DG  I 6  47  ? 90.327  75.345  130.428 1.00 44.83  ? 44  DG  I C8    1 
ATOM   6836  N N7    . DG  I 6  47  ? 90.978  76.312  129.861 1.00 41.85  ? 44  DG  I N7    1 
ATOM   6837  C C5    . DG  I 6  47  ? 92.299  76.012  130.099 1.00 37.39  ? 44  DG  I C5    1 
ATOM   6838  C C6    . DG  I 6  47  ? 93.466  76.699  129.723 1.00 36.28  ? 44  DG  I C6    1 
ATOM   6839  O O6    . DG  I 6  47  ? 93.549  77.749  129.080 1.00 35.29  ? 44  DG  I O6    1 
ATOM   6840  N N1    . DG  I 6  47  ? 94.602  76.056  130.168 1.00 34.19  ? 44  DG  I N1    1 
ATOM   6841  C C2    . DG  I 6  47  ? 94.605  74.897  130.879 1.00 37.39  ? 44  DG  I C2    1 
ATOM   6842  N N2    . DG  I 6  47  ? 95.797  74.412  131.225 1.00 37.19  ? 44  DG  I N2    1 
ATOM   6843  N N3    . DG  I 6  47  ? 93.518  74.246  131.235 1.00 39.59  ? 44  DG  I N3    1 
ATOM   6844  C C4    . DG  I 6  47  ? 92.413  74.859  130.814 1.00 39.34  ? 44  DG  I C4    1 
ATOM   6845  P P     . DC  I 6  48  ? 89.660  71.536  135.449 1.00 74.46  ? 45  DC  I P     1 
ATOM   6846  O OP1   . DC  I 6  48  ? 89.519  70.217  136.110 1.00 68.49  ? 45  DC  I OP1   1 
ATOM   6847  O OP2   . DC  I 6  48  ? 88.664  72.612  135.683 1.00 65.32  ? 45  DC  I OP2   1 
ATOM   6848  O "O5'" . DC  I 6  48  ? 91.038  72.189  135.891 1.00 59.25  ? 45  DC  I "O5'" 1 
ATOM   6849  C "C5'" . DC  I 6  48  ? 92.251  71.446  135.698 1.00 62.73  ? 45  DC  I "C5'" 1 
ATOM   6850  C "C4'" . DC  I 6  48  ? 93.451  72.270  136.081 1.00 60.11  ? 45  DC  I "C4'" 1 
ATOM   6851  O "O4'" . DC  I 6  48  ? 93.706  73.228  135.037 1.00 51.76  ? 45  DC  I "O4'" 1 
ATOM   6852  C "C3'" . DC  I 6  48  ? 93.298  73.051  137.379 1.00 59.64  ? 45  DC  I "C3'" 1 
ATOM   6853  O "O3'" . DC  I 6  48  ? 94.242  72.546  138.337 1.00 61.84  ? 45  DC  I "O3'" 1 
ATOM   6854  C "C2'" . DC  I 6  48  ? 93.589  74.490  136.989 1.00 53.72  ? 45  DC  I "C2'" 1 
ATOM   6855  C "C1'" . DC  I 6  48  ? 94.153  74.431  135.598 1.00 45.65  ? 45  DC  I "C1'" 1 
ATOM   6856  N N1    . DC  I 6  48  ? 93.676  75.526  134.756 1.00 40.30  ? 45  DC  I N1    1 
ATOM   6857  C C2    . DC  I 6  48  ? 94.588  76.421  134.217 1.00 39.31  ? 45  DC  I C2    1 
ATOM   6858  O O2    . DC  I 6  48  ? 95.789  76.287  134.451 1.00 41.56  ? 45  DC  I O2    1 
ATOM   6859  N N3    . DC  I 6  48  ? 94.156  77.423  133.447 1.00 37.86  ? 45  DC  I N3    1 
ATOM   6860  C C4    . DC  I 6  48  ? 92.862  77.553  133.203 1.00 38.34  ? 45  DC  I C4    1 
ATOM   6861  N N4    . DC  I 6  48  ? 92.489  78.572  132.431 1.00 35.63  ? 45  DC  I N4    1 
ATOM   6862  C C5    . DC  I 6  48  ? 91.905  76.657  133.740 1.00 40.67  ? 45  DC  I C5    1 
ATOM   6863  C C6    . DC  I 6  48  ? 92.353  75.666  134.502 1.00 41.63  ? 45  DC  I C6    1 
ATOM   6864  P P     . DT  I 6  49  ? 94.338  73.073  139.860 1.00 74.36  ? 46  DT  I P     1 
ATOM   6865  O OP1   . DT  I 6  49  ? 94.838  71.959  140.699 1.00 76.86  ? 46  DT  I OP1   1 
ATOM   6866  O OP2   . DT  I 6  49  ? 93.074  73.768  140.219 1.00 64.88  ? 46  DT  I OP2   1 
ATOM   6867  O "O5'" . DT  I 6  49  ? 95.495  74.171  139.759 1.00 61.47  ? 46  DT  I "O5'" 1 
ATOM   6868  C "C5'" . DT  I 6  49  ? 96.784  73.786  139.238 1.00 61.07  ? 46  DT  I "C5'" 1 
ATOM   6869  C "C4'" . DT  I 6  49  ? 97.711  74.964  139.035 1.00 57.14  ? 46  DT  I "C4'" 1 
ATOM   6870  O "O4'" . DT  I 6  49  ? 97.165  75.861  138.045 1.00 52.53  ? 46  DT  I "O4'" 1 
ATOM   6871  C "C3'" . DT  I 6  49  ? 98.022  75.810  140.256 1.00 53.46  ? 46  DT  I "C3'" 1 
ATOM   6872  O "O3'" . DT  I 6  49  ? 99.439  76.045  140.245 1.00 55.53  ? 46  DT  I "O3'" 1 
ATOM   6873  C "C2'" . DT  I 6  49  ? 97.227  77.084  140.003 1.00 52.44  ? 46  DT  I "C2'" 1 
ATOM   6874  C "C1'" . DT  I 6  49  ? 97.271  77.187  138.495 1.00 44.55  ? 46  DT  I "C1'" 1 
ATOM   6875  N N1    . DT  I 6  49  ? 96.184  77.935  137.839 1.00 38.46  ? 46  DT  I N1    1 
ATOM   6876  C C2    . DT  I 6  49  ? 96.516  78.931  136.961 1.00 37.58  ? 46  DT  I C2    1 
ATOM   6877  O O2    . DT  I 6  49  ? 97.668  79.225  136.703 1.00 40.94  ? 46  DT  I O2    1 
ATOM   6878  N N3    . DT  I 6  49  ? 95.454  79.572  136.393 1.00 37.37  ? 46  DT  I N3    1 
ATOM   6879  C C4    . DT  I 6  49  ? 94.128  79.320  136.614 1.00 37.38  ? 46  DT  I C4    1 
ATOM   6880  O O4    . DT  I 6  49  ? 93.266  79.969  136.033 1.00 37.07  ? 46  DT  I O4    1 
ATOM   6881  C C5    . DT  I 6  49  ? 93.854  78.275  137.536 1.00 37.96  ? 46  DT  I C5    1 
ATOM   6882  C C7    . DT  I 6  49  ? 92.432  77.959  137.815 1.00 38.71  ? 46  DT  I C7    1 
ATOM   6883  C C6    . DT  I 6  49  ? 94.876  77.640  138.098 1.00 39.70  ? 46  DT  I C6    1 
ATOM   6884  P P     . DC  I 6  50  ? 100.267 76.517  141.542 1.00 63.04  ? 47  DC  I P     1 
ATOM   6885  O OP1   . DC  I 6  50  ? 101.687 76.139  141.363 1.00 64.56  ? 47  DC  I OP1   1 
ATOM   6886  O OP2   . DC  I 6  50  ? 99.525  76.130  142.766 1.00 63.01  ? 47  DC  I OP2   1 
ATOM   6887  O "O5'" . DC  I 6  50  ? 100.155 78.100  141.512 1.00 53.98  ? 47  DC  I "O5'" 1 
ATOM   6888  C "C5'" . DC  I 6  50  ? 100.683 78.866  140.419 1.00 53.19  ? 47  DC  I "C5'" 1 
ATOM   6889  C "C4'" . DC  I 6  50  ? 100.233 80.296  140.552 1.00 45.98  ? 47  DC  I "C4'" 1 
ATOM   6890  O "O4'" . DC  I 6  50  ? 98.883  80.449  140.042 1.00 42.36  ? 47  DC  I "O4'" 1 
ATOM   6891  C "C3'" . DC  I 6  50  ? 100.184 80.757  142.009 1.00 46.16  ? 47  DC  I "C3'" 1 
ATOM   6892  O "O3'" . DC  I 6  50  ? 100.656 82.098  142.175 1.00 45.22  ? 47  DC  I "O3'" 1 
ATOM   6893  C "C2'" . DC  I 6  50  ? 98.706  80.682  142.286 1.00 44.02  ? 47  DC  I "C2'" 1 
ATOM   6894  C "C1'" . DC  I 6  50  ? 98.176  81.210  140.979 1.00 37.44  ? 47  DC  I "C1'" 1 
ATOM   6895  N N1    . DC  I 6  50  ? 96.739  81.091  140.722 1.00 34.81  ? 47  DC  I N1    1 
ATOM   6896  C C2    . DC  I 6  50  ? 96.226  81.804  139.658 1.00 34.76  ? 47  DC  I C2    1 
ATOM   6897  O O2    . DC  I 6  50  ? 96.988  82.494  138.991 1.00 40.01  ? 47  DC  I O2    1 
ATOM   6898  N N3    . DC  I 6  50  ? 94.927  81.743  139.363 1.00 33.97  ? 47  DC  I N3    1 
ATOM   6899  C C4    . DC  I 6  50  ? 94.132  80.993  140.100 1.00 33.35  ? 47  DC  I C4    1 
ATOM   6900  N N4    . DC  I 6  50  ? 92.842  80.952  139.781 1.00 34.42  ? 47  DC  I N4    1 
ATOM   6901  C C5    . DC  I 6  50  ? 94.616  80.246  141.193 1.00 33.11  ? 47  DC  I C5    1 
ATOM   6902  C C6    . DC  I 6  50  ? 95.912  80.321  141.468 1.00 35.42  ? 47  DC  I C6    1 
ATOM   6903  P P     . DT  I 6  51  ? 102.213 82.463  142.330 1.00 50.69  ? 48  DT  I P     1 
ATOM   6904  O OP1   . DT  I 6  51  ? 103.010 81.429  141.643 1.00 50.42  ? 48  DT  I OP1   1 
ATOM   6905  O OP2   . DT  I 6  51  ? 102.462 82.795  143.751 1.00 56.56  ? 48  DT  I OP2   1 
ATOM   6906  O "O5'" . DT  I 6  51  ? 102.278 83.796  141.470 1.00 48.14  ? 48  DT  I "O5'" 1 
ATOM   6907  C "C5'" . DT  I 6  51  ? 102.667 83.689  140.093 1.00 57.32  ? 48  DT  I "C5'" 1 
ATOM   6908  C "C4'" . DT  I 6  51  ? 102.244 84.876  139.264 1.00 44.02  ? 48  DT  I "C4'" 1 
ATOM   6909  O "O4'" . DT  I 6  51  ? 100.812 84.925  139.069 1.00 38.12  ? 48  DT  I "O4'" 1 
ATOM   6910  C "C3'" . DT  I 6  51  ? 102.655 86.218  139.798 1.00 38.13  ? 48  DT  I "C3'" 1 
ATOM   6911  O "O3'" . DT  I 6  51  ? 103.024 87.020  138.667 1.00 41.02  ? 48  DT  I "O3'" 1 
ATOM   6912  C "C2'" . DT  I 6  51  ? 101.389 86.699  140.469 1.00 37.78  ? 48  DT  I "C2'" 1 
ATOM   6913  C "C1'" . DT  I 6  51  ? 100.286 86.107  139.621 1.00 33.49  ? 48  DT  I "C1'" 1 
ATOM   6914  N N1    . DT  I 6  51  ? 99.006  85.763  140.274 1.00 31.59  ? 48  DT  I N1    1 
ATOM   6915  C C2    . DT  I 6  51  ? 97.837  86.130  139.651 1.00 32.40  ? 48  DT  I C2    1 
ATOM   6916  O O2    . DT  I 6  51  ? 97.802  86.722  138.595 1.00 36.86  ? 48  DT  I O2    1 
ATOM   6917  N N3    . DT  I 6  51  ? 96.691  85.785  140.298 1.00 31.66  ? 48  DT  I N3    1 
ATOM   6918  C C4    . DT  I 6  51  ? 96.593  85.122  141.483 1.00 31.83  ? 48  DT  I C4    1 
ATOM   6919  O O4    . DT  I 6  51  ? 95.498  84.865  141.961 1.00 32.85  ? 48  DT  I O4    1 
ATOM   6920  C C5    . DT  I 6  51  ? 97.834  84.771  142.081 1.00 34.79  ? 48  DT  I C5    1 
ATOM   6921  C C7    . DT  I 6  51  ? 97.800  84.050  143.373 1.00 37.81  ? 48  DT  I C7    1 
ATOM   6922  C C6    . DT  I 6  51  ? 98.964  85.099  141.463 1.00 35.89  ? 48  DT  I C6    1 
ATOM   6923  P P     . DA  I 6  52  ? 103.809 88.420  138.777 1.00 45.09  ? 49  DA  I P     1 
ATOM   6924  O OP1   . DA  I 6  52  ? 104.572 88.621  137.528 1.00 51.59  ? 49  DA  I OP1   1 
ATOM   6925  O OP2   . DA  I 6  52  ? 104.509 88.461  140.083 1.00 52.51  ? 49  DA  I OP2   1 
ATOM   6926  O "O5'" . DA  I 6  52  ? 102.620 89.475  138.809 1.00 43.21  ? 49  DA  I "O5'" 1 
ATOM   6927  C "C5'" . DA  I 6  52  ? 101.651 89.492  137.745 1.00 44.53  ? 49  DA  I "C5'" 1 
ATOM   6928  C "C4'" . DA  I 6  52  ? 100.511 90.418  138.058 1.00 34.85  ? 49  DA  I "C4'" 1 
ATOM   6929  O "O4'" . DA  I 6  52  ? 99.593  89.752  138.949 1.00 34.00  ? 49  DA  I "O4'" 1 
ATOM   6930  C "C3'" . DA  I 6  52  ? 100.944 91.694  138.760 1.00 37.20  ? 49  DA  I "C3'" 1 
ATOM   6931  O "O3'" . DA  I 6  52  ? 100.116 92.799  138.399 1.00 38.62  ? 49  DA  I "O3'" 1 
ATOM   6932  C "C2'" . DA  I 6  52  ? 100.688 91.341  140.206 1.00 37.65  ? 49  DA  I "C2'" 1 
ATOM   6933  C "C1'" . DA  I 6  52  ? 99.404  90.555  140.077 1.00 30.32  ? 49  DA  I "C1'" 1 
ATOM   6934  N N9    . DA  I 6  52  ? 99.036  89.739  141.205 1.00 31.20  ? 49  DA  I N9    1 
ATOM   6935  C C8    . DA  I 6  52  ? 99.808  89.188  142.179 1.00 31.75  ? 49  DA  I C8    1 
ATOM   6936  N N7    . DA  I 6  52  ? 99.140  88.497  143.056 1.00 32.51  ? 49  DA  I N7    1 
ATOM   6937  C C5    . DA  I 6  52  ? 97.851  88.634  142.599 1.00 30.44  ? 49  DA  I C5    1 
ATOM   6938  C C6    . DA  I 6  52  ? 96.696  88.118  143.132 1.00 32.42  ? 49  DA  I C6    1 
ATOM   6939  N N6    . DA  I 6  52  ? 96.588  87.376  144.204 1.00 36.45  ? 49  DA  I N6    1 
ATOM   6940  N N1    . DA  I 6  52  ? 95.575  88.393  142.495 1.00 32.23  ? 49  DA  I N1    1 
ATOM   6941  C C2    . DA  I 6  52  ? 95.643  89.139  141.404 1.00 37.05  ? 49  DA  I C2    1 
ATOM   6942  N N3    . DA  I 6  52  ? 96.689  89.684  140.812 1.00 37.42  ? 49  DA  I N3    1 
ATOM   6943  C C4    . DA  I 6  52  ? 97.787  89.374  141.491 1.00 30.41  ? 49  DA  I C4    1 
ATOM   6944  P P     . DG  I 6  53  ? 100.366 93.694  137.099 1.00 25.99  ? 50  DG  I P     1 
ATOM   6945  O OP1   . DG  I 6  53  ? 100.526 92.835  135.913 1.00 30.36  ? 50  DG  I OP1   1 
ATOM   6946  O OP2   . DG  I 6  53  ? 101.399 94.705  137.404 1.00 21.90  ? 50  DG  I OP2   1 
ATOM   6947  O "O5'" . DG  I 6  53  ? 98.974  94.427  136.960 1.00 21.70  ? 50  DG  I "O5'" 1 
ATOM   6948  C "C5'" . DG  I 6  53  ? 97.861  93.667  136.460 1.00 25.63  ? 50  DG  I "C5'" 1 
ATOM   6949  C "C4'" . DG  I 6  53  ? 96.549  94.108  137.054 1.00 24.17  ? 50  DG  I "C4'" 1 
ATOM   6950  O "O4'" . DG  I 6  53  ? 96.226  93.318  138.225 1.00 30.40  ? 50  DG  I "O4'" 1 
ATOM   6951  C "C3'" . DG  I 6  53  ? 96.493  95.550  137.496 1.00 24.51  ? 50  DG  I "C3'" 1 
ATOM   6952  O "O3'" . DG  I 6  53  ? 95.183  96.063  137.256 1.00 24.39  ? 50  DG  I "O3'" 1 
ATOM   6953  C "C2'" . DG  I 6  53  ? 96.771  95.414  138.964 1.00 32.06  ? 50  DG  I "C2'" 1 
ATOM   6954  C "C1'" . DG  I 6  53  ? 95.963  94.193  139.293 1.00 26.06  ? 50  DG  I "C1'" 1 
ATOM   6955  N N9    . DG  I 6  53  ? 96.327  93.580  140.557 1.00 29.24  ? 50  DG  I N9    1 
ATOM   6956  C C8    . DG  I 6  53  ? 97.572  93.481  141.107 1.00 32.15  ? 50  DG  I C8    1 
ATOM   6957  N N7    . DG  I 6  53  ? 97.587  92.879  142.250 1.00 34.08  ? 50  DG  I N7    1 
ATOM   6958  C C5    . DG  I 6  53  ? 96.274  92.561  142.466 1.00 31.80  ? 50  DG  I C5    1 
ATOM   6959  C C6    . DG  I 6  53  ? 95.689  91.899  143.547 1.00 33.12  ? 50  DG  I C6    1 
ATOM   6960  O O6    . DG  I 6  53  ? 96.253  91.456  144.549 1.00 35.44  ? 50  DG  I O6    1 
ATOM   6961  N N1    . DG  I 6  53  ? 94.324  91.772  143.388 1.00 32.99  ? 50  DG  I N1    1 
ATOM   6962  C C2    . DG  I 6  53  ? 93.618  92.232  142.315 1.00 32.70  ? 50  DG  I C2    1 
ATOM   6963  N N2    . DG  I 6  53  ? 92.293  92.021  142.325 1.00 33.24  ? 50  DG  I N2    1 
ATOM   6964  N N3    . DG  I 6  53  ? 94.164  92.856  141.293 1.00 32.98  ? 50  DG  I N3    1 
ATOM   6965  C C4    . DG  I 6  53  ? 95.484  92.983  141.437 1.00 30.83  ? 50  DG  I C4    1 
ATOM   6966  P P     . DC  I 6  54  ? 94.871  97.630  137.364 1.00 21.88  ? 51  DC  I P     1 
ATOM   6967  O OP1   . DC  I 6  54  ? 94.479  98.164  136.027 1.00 25.68  ? 51  DC  I OP1   1 
ATOM   6968  O OP2   . DC  I 6  54  ? 95.947  98.312  138.111 1.00 35.04  ? 51  DC  I OP2   1 
ATOM   6969  O "O5'" . DC  I 6  54  ? 93.637  97.706  138.338 1.00 27.27  ? 51  DC  I "O5'" 1 
ATOM   6970  C "C5'" . DC  I 6  54  ? 92.411  97.094  137.967 1.00 30.67  ? 51  DC  I "C5'" 1 
ATOM   6971  C "C4'" . DC  I 6  54  ? 91.547  96.863  139.179 1.00 35.67  ? 51  DC  I "C4'" 1 
ATOM   6972  O "O4'" . DC  I 6  54  ? 92.218  96.040  140.155 1.00 31.56  ? 51  DC  I "O4'" 1 
ATOM   6973  C "C3'" . DC  I 6  54  ? 91.142  98.135  139.893 1.00 39.19  ? 51  DC  I "C3'" 1 
ATOM   6974  O "O3'" . DC  I 6  54  ? 89.717  98.252  139.815 1.00 47.35  ? 51  DC  I "O3'" 1 
ATOM   6975  C "C2'" . DC  I 6  54  ? 91.628  97.945  141.320 1.00 38.50  ? 51  DC  I "C2'" 1 
ATOM   6976  C "C1'" . DC  I 6  54  ? 91.878  96.468  141.447 1.00 31.81  ? 51  DC  I "C1'" 1 
ATOM   6977  N N1    . DC  I 6  54  ? 92.994  96.156  142.338 1.00 27.94  ? 51  DC  I N1    1 
ATOM   6978  C C2    . DC  I 6  54  ? 92.784  95.484  143.538 1.00 29.18  ? 51  DC  I C2    1 
ATOM   6979  O O2    . DC  I 6  54  ? 91.649  95.134  143.864 1.00 29.95  ? 51  DC  I O2    1 
ATOM   6980  N N3    . DC  I 6  54  ? 93.823  95.209  144.337 1.00 30.52  ? 51  DC  I N3    1 
ATOM   6981  C C4    . DC  I 6  54  ? 95.041  95.585  143.977 1.00 29.72  ? 51  DC  I C4    1 
ATOM   6982  N N4    . DC  I 6  54  ? 96.050  95.298  144.795 1.00 31.78  ? 51  DC  I N4    1 
ATOM   6983  C C5    . DC  I 6  54  ? 95.281  96.271  142.770 1.00 29.13  ? 51  DC  I C5    1 
ATOM   6984  C C6    . DC  I 6  54  ? 94.240  96.532  141.991 1.00 28.39  ? 51  DC  I C6    1 
ATOM   6985  P P     . DA  I 6  55  ? 88.939  99.625  140.128 1.00 55.12  ? 52  DA  I P     1 
ATOM   6986  O OP1   . DA  I 6  55  ? 87.621  99.576  139.454 1.00 68.33  ? 52  DA  I OP1   1 
ATOM   6987  O OP2   . DA  I 6  55  ? 89.852  100.764 139.877 1.00 58.79  ? 52  DA  I OP2   1 
ATOM   6988  O "O5'" . DA  I 6  55  ? 88.701  99.529  141.692 1.00 52.11  ? 52  DA  I "O5'" 1 
ATOM   6989  C "C5'" . DA  I 6  55  ? 87.949  98.438  142.241 1.00 51.27  ? 52  DA  I "C5'" 1 
ATOM   6990  C "C4'" . DA  I 6  55  ? 87.963  98.520  143.739 1.00 51.03  ? 52  DA  I "C4'" 1 
ATOM   6991  O "O4'" . DA  I 6  55  ? 89.156  97.907  144.254 1.00 42.40  ? 52  DA  I "O4'" 1 
ATOM   6992  C "C3'" . DA  I 6  55  ? 87.942  99.937  144.287 1.00 53.59  ? 52  DA  I "C3'" 1 
ATOM   6993  O "O3'" . DA  I 6  55  ? 86.650  100.158 144.868 1.00 58.39  ? 52  DA  I "O3'" 1 
ATOM   6994  C "C2'" . DA  I 6  55  ? 89.070  99.959  145.310 1.00 48.61  ? 52  DA  I "C2'" 1 
ATOM   6995  C "C1'" . DA  I 6  55  ? 89.458  98.513  145.477 1.00 38.74  ? 52  DA  I "C1'" 1 
ATOM   6996  N N9    . DA  I 6  55  ? 90.867  98.349  145.753 1.00 31.83  ? 52  DA  I N9    1 
ATOM   6997  C C8    . DA  I 6  55  ? 91.920  98.793  145.015 1.00 32.68  ? 52  DA  I C8    1 
ATOM   6998  N N7    . DA  I 6  55  ? 93.077  98.490  145.524 1.00 29.52  ? 52  DA  I N7    1 
ATOM   6999  C C5    . DA  I 6  55  ? 92.757  97.797  146.668 1.00 27.30  ? 52  DA  I C5    1 
ATOM   7000  C C6    . DA  I 6  55  ? 93.555  97.217  147.644 1.00 29.02  ? 52  DA  I C6    1 
ATOM   7001  N N6    . DA  I 6  55  ? 94.876  97.235  147.613 1.00 27.48  ? 52  DA  I N6    1 
ATOM   7002  N N1    . DA  I 6  55  ? 92.944  96.602  148.662 1.00 30.26  ? 52  DA  I N1    1 
ATOM   7003  C C2    . DA  I 6  55  ? 91.616  96.591  148.677 1.00 33.41  ? 52  DA  I C2    1 
ATOM   7004  N N3    . DA  I 6  55  ? 90.761  97.110  147.813 1.00 32.41  ? 52  DA  I N3    1 
ATOM   7005  C C4    . DA  I 6  55  ? 91.406  97.706  146.821 1.00 29.33  ? 52  DA  I C4    1 
ATOM   7006  P P     . DC  I 6  56  ? 86.151  101.581 145.434 1.00 71.16  ? 53  DC  I P     1 
ATOM   7007  O OP1   . DC  I 6  56  ? 84.672  101.627 145.348 1.00 70.36  ? 53  DC  I OP1   1 
ATOM   7008  O OP2   . DC  I 6  56  ? 86.974  102.675 144.858 1.00 63.78  ? 53  DC  I OP2   1 
ATOM   7009  O "O5'" . DC  I 6  56  ? 86.580  101.529 146.968 1.00 59.03  ? 53  DC  I "O5'" 1 
ATOM   7010  C "C5'" . DC  I 6  56  ? 86.155  100.434 147.798 1.00 58.82  ? 53  DC  I "C5'" 1 
ATOM   7011  C "C4'" . DC  I 6  56  ? 86.960  100.374 149.069 1.00 57.76  ? 53  DC  I "C4'" 1 
ATOM   7012  O "O4'" . DC  I 6  56  ? 88.325  100.011 148.791 1.00 48.32  ? 53  DC  I "O4'" 1 
ATOM   7013  C "C3'" . DC  I 6  56  ? 87.032  101.678 149.846 1.00 58.72  ? 53  DC  I "C3'" 1 
ATOM   7014  O "O3'" . DC  I 6  56  ? 86.139  101.580 150.972 1.00 63.98  ? 53  DC  I "O3'" 1 
ATOM   7015  C "C2'" . DC  I 6  56  ? 88.495  101.758 150.279 1.00 53.60  ? 53  DC  I "C2'" 1 
ATOM   7016  C "C1'" . DC  I 6  56  ? 89.089  100.429 149.884 1.00 42.28  ? 53  DC  I "C1'" 1 
ATOM   7017  N N1    . DC  I 6  56  ? 90.486  100.522 149.471 1.00 34.95  ? 53  DC  I N1    1 
ATOM   7018  C C2    . DC  I 6  56  ? 91.481  99.924  150.236 1.00 34.64  ? 53  DC  I C2    1 
ATOM   7019  O O2    . DC  I 6  56  ? 91.186  99.315  151.263 1.00 38.47  ? 53  DC  I O2    1 
ATOM   7020  N N3    . DC  I 6  56  ? 92.756  100.011 149.851 1.00 30.69  ? 53  DC  I N3    1 
ATOM   7021  C C4    . DC  I 6  56  ? 93.063  100.669 148.743 1.00 30.94  ? 53  DC  I C4    1 
ATOM   7022  N N4    . DC  I 6  56  ? 94.344  100.736 148.391 1.00 25.67  ? 53  DC  I N4    1 
ATOM   7023  C C5    . DC  I 6  56  ? 92.072  101.287 147.944 1.00 32.62  ? 53  DC  I C5    1 
ATOM   7024  C C6    . DC  I 6  56  ? 90.810  101.189 148.343 1.00 36.54  ? 53  DC  I C6    1 
ATOM   7025  P P     . DC  I 6  57  ? 85.745  102.830 151.913 1.00 80.00  ? 54  DC  I P     1 
ATOM   7026  O OP1   . DC  I 6  57  ? 84.473  102.513 152.605 1.00 74.07  ? 54  DC  I OP1   1 
ATOM   7027  O OP2   . DC  I 6  57  ? 85.891  104.092 151.144 1.00 72.05  ? 54  DC  I OP2   1 
ATOM   7028  O "O5'" . DC  I 6  57  ? 86.923  102.894 152.994 1.00 67.01  ? 54  DC  I "O5'" 1 
ATOM   7029  C "C5'" . DC  I 6  57  ? 87.135  101.808 153.919 1.00 66.59  ? 54  DC  I "C5'" 1 
ATOM   7030  C "C4'" . DC  I 6  57  ? 88.398  102.007 154.734 1.00 64.11  ? 54  DC  I "C4'" 1 
ATOM   7031  O "O4'" . DC  I 6  57  ? 89.558  101.733 153.922 1.00 51.89  ? 54  DC  I "O4'" 1 
ATOM   7032  C "C3'" . DC  I 6  57  ? 88.601  103.417 155.295 1.00 66.10  ? 54  DC  I "C3'" 1 
ATOM   7033  O "O3'" . DC  I 6  57  ? 88.446  103.402 156.730 1.00 69.87  ? 54  DC  I "O3'" 1 
ATOM   7034  C "C2'" . DC  I 6  57  ? 90.030  103.764 154.903 1.00 56.74  ? 54  DC  I "C2'" 1 
ATOM   7035  C "C1'" . DC  I 6  57  ? 90.632  102.467 154.444 1.00 45.85  ? 54  DC  I "C1'" 1 
ATOM   7036  N N1    . DC  I 6  57  ? 91.615  102.678 153.395 1.00 39.41  ? 54  DC  I N1    1 
ATOM   7037  C C2    . DC  I 6  57  ? 92.955  102.354 153.604 1.00 39.02  ? 54  DC  I C2    1 
ATOM   7038  O O2    . DC  I 6  57  ? 93.329  101.880 154.681 1.00 40.79  ? 54  DC  I O2    1 
ATOM   7039  N N3    . DC  I 6  57  ? 93.838  102.557 152.622 1.00 36.01  ? 54  DC  I N3    1 
ATOM   7040  C C4    . DC  I 6  57  ? 93.421  103.064 151.467 1.00 36.58  ? 54  DC  I C4    1 
ATOM   7041  N N4    . DC  I 6  57  ? 94.320  103.257 150.511 1.00 31.21  ? 54  DC  I N4    1 
ATOM   7042  C C5    . DC  I 6  57  ? 92.070  103.403 151.233 1.00 38.24  ? 54  DC  I C5    1 
ATOM   7043  C C6    . DC  I 6  57  ? 91.210  103.195 152.214 1.00 39.11  ? 54  DC  I C6    1 
ATOM   7044  P P     . DG  I 6  58  ? 88.357  104.746 157.629 1.00 76.39  ? 55  DG  I P     1 
ATOM   7045  O OP1   . DG  I 6  58  ? 87.658  104.413 158.893 1.00 76.38  ? 55  DG  I OP1   1 
ATOM   7046  O OP2   . DG  I 6  58  ? 87.867  105.862 156.781 1.00 72.65  ? 55  DG  I OP2   1 
ATOM   7047  O "O5'" . DG  I 6  58  ? 89.880  105.050 157.972 1.00 62.86  ? 55  DG  I "O5'" 1 
ATOM   7048  C "C5'" . DG  I 6  58  ? 90.679  104.070 158.658 1.00 63.42  ? 55  DG  I "C5'" 1 
ATOM   7049  C "C4'" . DG  I 6  58  ? 92.020  104.652 159.033 1.00 68.74  ? 55  DG  I "C4'" 1 
ATOM   7050  O "O4'" . DG  I 6  58  ? 92.925  104.554 157.905 1.00 60.39  ? 55  DG  I "O4'" 1 
ATOM   7051  C "C3'" . DG  I 6  58  ? 92.015  106.120 159.443 1.00 70.69  ? 55  DG  I "C3'" 1 
ATOM   7052  O "O3'" . DG  I 6  58  ? 92.976  106.287 160.500 1.00 69.40  ? 55  DG  I "O3'" 1 
ATOM   7053  C "C2'" . DG  I 6  58  ? 92.434  106.816 158.161 1.00 61.26  ? 55  DG  I "C2'" 1 
ATOM   7054  C "C1'" . DG  I 6  58  ? 93.433  105.836 157.582 1.00 52.81  ? 55  DG  I "C1'" 1 
ATOM   7055  N N9    . DG  I 6  58  ? 93.598  105.899 156.136 1.00 43.62  ? 55  DG  I N9    1 
ATOM   7056  C C8    . DG  I 6  58  ? 92.638  106.133 155.188 1.00 43.00  ? 55  DG  I C8    1 
ATOM   7057  N N7    . DG  I 6  58  ? 93.098  106.126 153.978 1.00 39.48  ? 55  DG  I N7    1 
ATOM   7058  C C5    . DG  I 6  58  ? 94.440  105.871 154.136 1.00 36.23  ? 55  DG  I C5    1 
ATOM   7059  C C6    . DG  I 6  58  ? 95.448  105.747 153.171 1.00 35.81  ? 55  DG  I C6    1 
ATOM   7060  O O6    . DG  I 6  58  ? 95.335  105.844 151.950 1.00 36.97  ? 55  DG  I O6    1 
ATOM   7061  N N1    . DG  I 6  58  ? 96.677  105.489 153.741 1.00 33.12  ? 55  DG  I N1    1 
ATOM   7062  C C2    . DG  I 6  58  ? 96.904  105.364 155.076 1.00 37.19  ? 55  DG  I C2    1 
ATOM   7063  N N2    . DG  I 6  58  ? 98.169  105.111 155.438 1.00 34.90  ? 55  DG  I N2    1 
ATOM   7064  N N3    . DG  I 6  58  ? 95.963  105.476 155.996 1.00 39.53  ? 55  DG  I N3    1 
ATOM   7065  C C4    . DG  I 6  58  ? 94.765  105.729 155.454 1.00 38.75  ? 55  DG  I C4    1 
ATOM   7066  P P     . DC  I 6  59  ? 93.114  107.617 161.406 1.00 81.03  ? 56  DC  I P     1 
ATOM   7067  O OP1   . DC  I 6  59  ? 93.057  107.229 162.836 1.00 73.52  ? 56  DC  I OP1   1 
ATOM   7068  O OP2   . DC  I 6  59  ? 92.234  108.689 160.875 1.00 71.81  ? 56  DC  I OP2   1 
ATOM   7069  O "O5'" . DC  I 6  59  ? 94.583  108.117 161.062 1.00 66.85  ? 56  DC  I "O5'" 1 
ATOM   7070  C "C5'" . DC  I 6  59  ? 95.698  107.253 161.339 1.00 66.58  ? 56  DC  I "C5'" 1 
ATOM   7071  C "C4'" . DC  I 6  59  ? 96.970  107.821 160.771 1.00 63.51  ? 56  DC  I "C4'" 1 
ATOM   7072  O "O4'" . DC  I 6  59  ? 96.964  107.648 159.337 1.00 57.35  ? 56  DC  I "O4'" 1 
ATOM   7073  C "C3'" . DC  I 6  59  ? 97.183  109.306 161.049 1.00 61.61  ? 56  DC  I "C3'" 1 
ATOM   7074  O "O3'" . DC  I 6  59  ? 98.432  109.461 161.747 1.00 60.46  ? 56  DC  I "O3'" 1 
ATOM   7075  C "C2'" . DC  I 6  59  ? 97.188  109.944 159.664 1.00 56.61  ? 56  DC  I "C2'" 1 
ATOM   7076  C "C1'" . DC  I 6  59  ? 97.450  108.806 158.703 1.00 53.54  ? 56  DC  I "C1'" 1 
ATOM   7077  N N1    . DC  I 6  59  ? 96.765  108.922 157.406 1.00 44.23  ? 56  DC  I N1    1 
ATOM   7078  C C2    . DC  I 6  59  ? 97.494  108.809 156.221 1.00 42.36  ? 56  DC  I C2    1 
ATOM   7079  O O2    . DC  I 6  59  ? 98.711  108.612 156.253 1.00 43.55  ? 56  DC  I O2    1 
ATOM   7080  N N3    . DC  I 6  59  ? 96.874  108.913 155.039 1.00 40.04  ? 56  DC  I N3    1 
ATOM   7081  C C4    . DC  I 6  59  ? 95.568  109.122 155.002 1.00 41.64  ? 56  DC  I C4    1 
ATOM   7082  N N4    . DC  I 6  59  ? 94.994  109.223 153.801 1.00 37.72  ? 56  DC  I N4    1 
ATOM   7083  C C5    . DC  I 6  59  ? 94.799  109.245 156.186 1.00 45.49  ? 56  DC  I C5    1 
ATOM   7084  C C6    . DC  I 6  59  ? 95.429  109.139 157.353 1.00 45.16  ? 56  DC  I C6    1 
ATOM   7085  P P     . DT  I 6  60  ? 99.007  110.874 162.282 1.00 70.62  ? 57  DT  I P     1 
ATOM   7086  O OP1   . DT  I 6  60  ? 99.816  110.624 163.498 1.00 69.46  ? 57  DT  I OP1   1 
ATOM   7087  O OP2   . DT  I 6  60  ? 97.906  111.868 162.311 1.00 65.56  ? 57  DT  I OP2   1 
ATOM   7088  O "O5'" . DT  I 6  60  ? 100.001 111.275 161.106 1.00 60.40  ? 57  DT  I "O5'" 1 
ATOM   7089  C "C5'" . DT  I 6  60  ? 101.031 110.340 160.734 1.00 62.45  ? 57  DT  I "C5'" 1 
ATOM   7090  C "C4'" . DT  I 6  60  ? 101.876 110.833 159.583 1.00 59.48  ? 57  DT  I "C4'" 1 
ATOM   7091  O "O4'" . DT  I 6  60  ? 101.111 110.793 158.363 1.00 52.12  ? 57  DT  I "O4'" 1 
ATOM   7092  C "C3'" . DT  I 6  60  ? 102.447 112.235 159.695 1.00 53.64  ? 57  DT  I "C3'" 1 
ATOM   7093  O "O3'" . DT  I 6  60  ? 103.824 112.137 159.308 1.00 53.14  ? 57  DT  I "O3'" 1 
ATOM   7094  C "C2'" . DT  I 6  60  ? 101.606 113.041 158.711 1.00 48.66  ? 57  DT  I "C2'" 1 
ATOM   7095  C "C1'" . DT  I 6  60  ? 101.237 112.010 157.672 1.00 41.85  ? 57  DT  I "C1'" 1 
ATOM   7096  N N1    . DT  I 6  60  ? 99.966  112.190 156.963 1.00 38.15  ? 57  DT  I N1    1 
ATOM   7097  C C2    . DT  I 6  60  ? 99.972  112.042 155.605 1.00 38.55  ? 57  DT  I C2    1 
ATOM   7098  O O2    . DT  I 6  60  ? 100.978 111.775 154.981 1.00 42.40  ? 57  DT  I O2    1 
ATOM   7099  N N3    . DT  I 6  60  ? 98.764  112.216 155.003 1.00 38.30  ? 57  DT  I N3    1 
ATOM   7100  C C4    . DT  I 6  60  ? 97.578  112.517 155.616 1.00 38.75  ? 57  DT  I C4    1 
ATOM   7101  O O4    . DT  I 6  60  ? 96.550  112.646 154.963 1.00 36.93  ? 57  DT  I O4    1 
ATOM   7102  C C5    . DT  I 6  60  ? 97.646  112.658 157.027 1.00 39.34  ? 57  DT  I C5    1 
ATOM   7103  C C7    . DT  I 6  60  ? 96.395  112.993 157.743 1.00 40.96  ? 57  DT  I C7    1 
ATOM   7104  C C6    . DT  I 6  60  ? 98.816  112.491 157.629 1.00 39.34  ? 57  DT  I C6    1 
ATOM   7105  P P     . DT  I 6  61  ? 104.901 113.304 159.552 1.00 58.56  ? 58  DT  I P     1 
ATOM   7106  O OP1   . DT  I 6  61  ? 106.250 112.693 159.604 1.00 61.09  ? 58  DT  I OP1   1 
ATOM   7107  O OP2   . DT  I 6  61  ? 104.426 114.171 160.660 1.00 57.31  ? 58  DT  I OP2   1 
ATOM   7108  O "O5'" . DT  I 6  61  ? 104.788 114.125 158.203 1.00 53.55  ? 58  DT  I "O5'" 1 
ATOM   7109  C "C5'" . DT  I 6  61  ? 104.982 113.461 156.942 1.00 52.70  ? 58  DT  I "C5'" 1 
ATOM   7110  C "C4'" . DT  I 6  61  ? 104.666 114.403 155.817 1.00 48.41  ? 58  DT  I "C4'" 1 
ATOM   7111  O "O4'" . DT  I 6  61  ? 103.243 114.403 155.549 1.00 43.66  ? 58  DT  I "O4'" 1 
ATOM   7112  C "C3'" . DT  I 6  61  ? 105.057 115.835 156.123 1.00 45.36  ? 58  DT  I "C3'" 1 
ATOM   7113  O "O3'" . DT  I 6  61  ? 105.722 116.395 154.998 1.00 49.19  ? 58  DT  I "O3'" 1 
ATOM   7114  C "C2'" . DT  I 6  61  ? 103.719 116.494 156.351 1.00 42.13  ? 58  DT  I "C2'" 1 
ATOM   7115  C "C1'" . DT  I 6  61  ? 102.837 115.728 155.386 1.00 35.68  ? 58  DT  I "C1'" 1 
ATOM   7116  N N1    . DT  I 6  61  ? 101.374 115.817 155.561 1.00 34.03  ? 58  DT  I N1    1 
ATOM   7117  C C2    . DT  I 6  61  ? 100.595 115.576 154.460 1.00 35.06  ? 58  DT  I C2    1 
ATOM   7118  O O2    . DT  I 6  61  ? 101.070 115.298 153.380 1.00 38.37  ? 58  DT  I O2    1 
ATOM   7119  N N3    . DT  I 6  61  ? 99.244  115.668 154.663 1.00 33.05  ? 58  DT  I N3    1 
ATOM   7120  C C4    . DT  I 6  61  ? 98.614  115.969 155.835 1.00 32.85  ? 58  DT  I C4    1 
ATOM   7121  O O4    . DT  I 6  61  ? 97.389  116.028 155.915 1.00 32.92  ? 58  DT  I O4    1 
ATOM   7122  C C5    . DT  I 6  61  ? 99.482  116.205 156.935 1.00 33.90  ? 58  DT  I C5    1 
ATOM   7123  C C7    . DT  I 6  61  ? 98.868  116.534 158.243 1.00 36.42  ? 58  DT  I C7    1 
ATOM   7124  C C6    . DT  I 6  61  ? 100.788 116.121 156.757 1.00 35.12  ? 58  DT  I C6    1 
ATOM   7125  P P     . DA  I 6  62  ? 107.320 116.544 154.888 1.00 65.00  ? 59  DA  I P     1 
ATOM   7126  O OP1   . DA  I 6  62  ? 108.005 115.254 155.138 1.00 60.86  ? 59  DA  I OP1   1 
ATOM   7127  O OP2   . DA  I 6  62  ? 107.724 117.756 155.645 1.00 69.67  ? 59  DA  I OP2   1 
ATOM   7128  O "O5'" . DA  I 6  62  ? 107.465 116.835 153.340 1.00 56.95  ? 59  DA  I "O5'" 1 
ATOM   7129  C "C5'" . DA  I 6  62  ? 107.253 115.733 152.442 1.00 56.72  ? 59  DA  I "C5'" 1 
ATOM   7130  C "C4'" . DA  I 6  62  ? 106.452 116.134 151.232 1.00 51.28  ? 59  DA  I "C4'" 1 
ATOM   7131  O "O4'" . DA  I 6  62  ? 105.078 116.412 151.581 1.00 44.01  ? 59  DA  I "O4'" 1 
ATOM   7132  C "C3'" . DA  I 6  62  ? 106.964 117.357 150.512 1.00 47.95  ? 59  DA  I "C3'" 1 
ATOM   7133  O "O3'" . DA  I 6  62  ? 106.812 117.094 149.112 1.00 47.74  ? 59  DA  I "O3'" 1 
ATOM   7134  C "C2'" . DA  I 6  62  ? 106.038 118.447 151.021 1.00 43.89  ? 59  DA  I "C2'" 1 
ATOM   7135  C "C1'" . DA  I 6  62  ? 104.726 117.712 151.165 1.00 37.56  ? 59  DA  I "C1'" 1 
ATOM   7136  N N9    . DA  I 6  62  ? 103.780 118.245 152.143 1.00 36.53  ? 59  DA  I N9    1 
ATOM   7137  C C8    . DA  I 6  62  ? 104.011 118.819 153.360 1.00 40.38  ? 59  DA  I C8    1 
ATOM   7138  N N7    . DA  I 6  62  ? 102.914 119.190 153.981 1.00 35.79  ? 59  DA  I N7    1 
ATOM   7139  C C5    . DA  I 6  62  ? 101.909 118.837 153.115 1.00 31.99  ? 59  DA  I C5    1 
ATOM   7140  C C6    . DA  I 6  62  ? 100.520 118.959 153.180 1.00 30.81  ? 59  DA  I C6    1 
ATOM   7141  N N6    . DA  I 6  62  ? 99.860  119.495 154.195 1.00 33.15  ? 59  DA  I N6    1 
ATOM   7142  N N1    . DA  I 6  62  ? 99.802  118.510 152.151 1.00 31.08  ? 59  DA  I N1    1 
ATOM   7143  C C2    . DA  I 6  62  ? 100.456 117.972 151.127 1.00 34.51  ? 59  DA  I C2    1 
ATOM   7144  N N3    . DA  I 6  62  ? 101.749 117.802 150.954 1.00 34.88  ? 59  DA  I N3    1 
ATOM   7145  C C4    . DA  I 6  62  ? 102.430 118.260 151.989 1.00 33.63  ? 59  DA  I C4    1 
ATOM   7146  P P     . DA  I 6  63  ? 107.595 117.881 147.952 1.00 53.95  ? 60  DA  I P     1 
ATOM   7147  O OP1   . DA  I 6  63  ? 108.229 116.883 147.055 1.00 49.48  ? 60  DA  I OP1   1 
ATOM   7148  O OP2   . DA  I 6  63  ? 108.405 118.973 148.550 1.00 63.66  ? 60  DA  I OP2   1 
ATOM   7149  O "O5'" . DA  I 6  63  ? 106.390 118.543 147.176 1.00 43.90  ? 60  DA  I "O5'" 1 
ATOM   7150  C "C5'" . DA  I 6  63  ? 105.533 117.682 146.426 1.00 39.03  ? 60  DA  I "C5'" 1 
ATOM   7151  C "C4'" . DA  I 6  63  ? 104.182 118.300 146.255 1.00 32.14  ? 60  DA  I "C4'" 1 
ATOM   7152  O "O4'" . DA  I 6  63  ? 103.666 118.749 147.521 1.00 32.67  ? 60  DA  I "O4'" 1 
ATOM   7153  C "C3'" . DA  I 6  63  ? 104.174 119.495 145.338 1.00 27.45  ? 60  DA  I "C3'" 1 
ATOM   7154  O "O3'" . DA  I 6  63  ? 103.180 119.270 144.343 1.00 23.94  ? 60  DA  I "O3'" 1 
ATOM   7155  C "C2'" . DA  I 6  63  ? 103.826 120.636 146.265 1.00 32.35  ? 60  DA  I "C2'" 1 
ATOM   7156  C "C1'" . DA  I 6  63  ? 103.018 119.971 147.327 1.00 27.68  ? 60  DA  I "C1'" 1 
ATOM   7157  N N9    . DA  I 6  63  ? 102.946 120.672 148.595 1.00 30.39  ? 60  DA  I N9    1 
ATOM   7158  C C8    . DA  I 6  63  ? 103.937 121.212 149.338 1.00 34.19  ? 60  DA  I C8    1 
ATOM   7159  N N7    . DA  I 6  63  ? 103.530 121.778 150.442 1.00 34.24  ? 60  DA  I N7    1 
ATOM   7160  C C5    . DA  I 6  63  ? 102.178 121.601 150.440 1.00 31.10  ? 60  DA  I C5    1 
ATOM   7161  C C6    . DA  I 6  63  ? 101.150 121.954 151.300 1.00 33.97  ? 60  DA  I C6    1 
ATOM   7162  N N6    . DA  I 6  63  ? 101.342 122.619 152.446 1.00 37.64  ? 60  DA  I N6    1 
ATOM   7163  N N1    . DA  I 6  63  ? 99.907  121.619 150.989 1.00 34.84  ? 60  DA  I N1    1 
ATOM   7164  C C2    . DA  I 6  63  ? 99.717  120.960 149.855 1.00 38.98  ? 60  DA  I C2    1 
ATOM   7165  N N3    . DA  I 6  63  ? 100.587 120.563 148.950 1.00 34.26  ? 60  DA  I N3    1 
ATOM   7166  C C4    . DA  I 6  63  ? 101.811 120.920 149.305 1.00 29.80  ? 60  DA  I C4    1 
ATOM   7167  P P     . DA  I 6  64  ? 103.059 120.138 143.011 1.00 10.82  ? 61  DA  I P     1 
ATOM   7168  O OP1   . DA  I 6  64  ? 102.905 119.239 141.844 1.00 22.98  ? 61  DA  I OP1   1 
ATOM   7169  O OP2   . DA  I 6  64  ? 104.171 121.113 142.941 1.00 27.49  ? 61  DA  I OP2   1 
ATOM   7170  O "O5'" . DA  I 6  64  ? 101.695 120.897 143.275 1.00 28.42  ? 61  DA  I "O5'" 1 
ATOM   7171  C "C5'" . DA  I 6  64  ? 100.502 120.110 143.396 1.00 30.72  ? 61  DA  I "C5'" 1 
ATOM   7172  C "C4'" . DA  I 6  64  ? 99.325  120.908 143.890 1.00 28.86  ? 61  DA  I "C4'" 1 
ATOM   7173  O "O4'" . DA  I 6  64  ? 99.560  121.368 145.234 1.00 31.78  ? 61  DA  I "O4'" 1 
ATOM   7174  C "C3'" . DA  I 6  64  ? 98.967  122.132 143.079 1.00 23.73  ? 61  DA  I "C3'" 1 
ATOM   7175  O "O3'" . DA  I 6  64  ? 97.545  122.211 142.981 1.00 27.33  ? 61  DA  I "O3'" 1 
ATOM   7176  C "C2'" . DA  I 6  64  ? 99.523  123.241 143.929 1.00 30.06  ? 61  DA  I "C2'" 1 
ATOM   7177  C "C1'" . DA  I 6  64  ? 99.238  122.729 145.312 1.00 27.52  ? 61  DA  I "C1'" 1 
ATOM   7178  N N9    . DA  I 6  64  ? 100.052 123.334 146.348 1.00 30.60  ? 61  DA  I N9    1 
ATOM   7179  C C8    . DA  I 6  64  ? 101.390 123.542 146.334 1.00 33.56  ? 61  DA  I C8    1 
ATOM   7180  N N7    . DA  I 6  64  ? 101.849 124.109 147.414 1.00 37.54  ? 61  DA  I N7    1 
ATOM   7181  C C5    . DA  I 6  64  ? 100.731 124.286 148.191 1.00 34.39  ? 61  DA  I C5    1 
ATOM   7182  C C6    . DA  I 6  64  ? 100.549 124.835 149.451 1.00 33.45  ? 61  DA  I C6    1 
ATOM   7183  N N6    . DA  I 6  64  ? 101.527 125.333 150.192 1.00 35.79  ? 61  DA  I N6    1 
ATOM   7184  N N1    . DA  I 6  64  ? 99.309  124.862 149.942 1.00 36.50  ? 61  DA  I N1    1 
ATOM   7185  C C2    . DA  I 6  64  ? 98.331  124.360 149.194 1.00 32.58  ? 61  DA  I C2    1 
ATOM   7186  N N3    . DA  I 6  64  ? 98.385  123.821 147.998 1.00 31.22  ? 61  DA  I N3    1 
ATOM   7187  C C4    . DA  I 6  64  ? 99.623  123.813 147.546 1.00 31.50  ? 61  DA  I C4    1 
ATOM   7188  P P     . DC  I 6  65  ? 96.802  123.173 141.938 1.00 31.78  ? 62  DC  I P     1 
ATOM   7189  O OP1   . DC  I 6  65  ? 95.689  122.436 141.310 1.00 37.66  ? 62  DC  I OP1   1 
ATOM   7190  O OP2   . DC  I 6  65  ? 97.819  123.839 141.092 1.00 28.73  ? 62  DC  I OP2   1 
ATOM   7191  O "O5'" . DC  I 6  65  ? 96.203  124.342 142.813 1.00 35.39  ? 62  DC  I "O5'" 1 
ATOM   7192  C "C5'" . DC  I 6  65  ? 95.284  124.027 143.861 1.00 37.46  ? 62  DC  I "C5'" 1 
ATOM   7193  C "C4'" . DC  I 6  65  ? 94.969  125.251 144.669 1.00 35.13  ? 62  DC  I "C4'" 1 
ATOM   7194  O "O4'" . DC  I 6  65  ? 96.024  125.480 145.613 1.00 33.55  ? 62  DC  I "O4'" 1 
ATOM   7195  C "C3'" . DC  I 6  65  ? 94.821  126.520 143.858 1.00 36.93  ? 62  DC  I "C3'" 1 
ATOM   7196  O "O3'" . DC  I 6  65  ? 93.456  126.944 143.964 1.00 45.92  ? 62  DC  I "O3'" 1 
ATOM   7197  C "C2'" . DC  I 6  65  ? 95.784  127.497 144.507 1.00 36.47  ? 62  DC  I "C2'" 1 
ATOM   7198  C "C1'" . DC  I 6  65  ? 96.187  126.855 145.802 1.00 31.87  ? 62  DC  I "C1'" 1 
ATOM   7199  N N1    . DC  I 6  65  ? 97.576  127.072 146.193 1.00 28.16  ? 62  DC  I N1    1 
ATOM   7200  C C2    . DC  I 6  65  ? 97.866  127.628 147.427 1.00 29.83  ? 62  DC  I C2    1 
ATOM   7201  O O2    . DC  I 6  65  ? 96.953  127.941 148.188 1.00 32.99  ? 62  DC  I O2    1 
ATOM   7202  N N3    . DC  I 6  65  ? 99.131  127.825 147.788 1.00 31.25  ? 62  DC  I N3    1 
ATOM   7203  C C4    . DC  I 6  65  ? 100.103 127.485 146.966 1.00 30.90  ? 62  DC  I C4    1 
ATOM   7204  N N4    . DC  I 6  65  ? 101.350 127.701 147.368 1.00 33.13  ? 62  DC  I N4    1 
ATOM   7205  C C5    . DC  I 6  65  ? 99.842  126.919 145.703 1.00 29.96  ? 62  DC  I C5    1 
ATOM   7206  C C6    . DC  I 6  65  ? 98.576  126.731 145.363 1.00 28.49  ? 62  DC  I C6    1 
ATOM   7207  P P     . DG  I 6  66  ? 92.838  128.168 143.124 1.00 52.66  ? 63  DG  I P     1 
ATOM   7208  O OP1   . DG  I 6  66  ? 91.379  127.949 142.998 1.00 57.39  ? 63  DG  I OP1   1 
ATOM   7209  O OP2   . DG  I 6  66  ? 93.666  128.390 141.915 1.00 54.28  ? 63  DG  I OP2   1 
ATOM   7210  O "O5'" . DG  I 6  66  ? 93.072  129.397 144.109 1.00 49.21  ? 63  DG  I "O5'" 1 
ATOM   7211  C "C5'" . DG  I 6  66  ? 92.579  129.326 145.460 1.00 49.19  ? 63  DG  I "C5'" 1 
ATOM   7212  C "C4'" . DG  I 6  66  ? 92.899  130.579 146.233 1.00 49.26  ? 63  DG  I "C4'" 1 
ATOM   7213  O "O4'" . DG  I 6  66  ? 94.254  130.510 146.720 1.00 41.09  ? 63  DG  I "O4'" 1 
ATOM   7214  C "C3'" . DG  I 6  66  ? 92.766  131.884 145.470 1.00 51.81  ? 63  DG  I "C3'" 1 
ATOM   7215  O "O3'" . DG  I 6  66  ? 92.019  132.796 146.294 1.00 55.92  ? 63  DG  I "O3'" 1 
ATOM   7216  C "C2'" . DG  I 6  66  ? 94.205  132.318 145.265 1.00 48.39  ? 63  DG  I "C2'" 1 
ATOM   7217  C "C1'" . DG  I 6  66  ? 94.923  131.717 146.446 1.00 40.28  ? 63  DG  I "C1'" 1 
ATOM   7218  N N9    . DG  I 6  66  ? 96.308  131.376 146.197 1.00 34.24  ? 63  DG  I N9    1 
ATOM   7219  C C8    . DG  I 6  66  ? 96.808  130.730 145.109 1.00 36.80  ? 63  DG  I C8    1 
ATOM   7220  N N7    . DG  I 6  66  ? 98.087  130.556 145.154 1.00 33.96  ? 63  DG  I N7    1 
ATOM   7221  C C5    . DG  I 6  66  ? 98.452  131.122 146.343 1.00 29.97  ? 63  DG  I C5    1 
ATOM   7222  C C6    . DG  I 6  66  ? 99.720  131.223 146.914 1.00 31.13  ? 63  DG  I C6    1 
ATOM   7223  O O6    . DG  I 6  66  ? 100.784 130.813 146.450 1.00 35.64  ? 63  DG  I O6    1 
ATOM   7224  N N1    . DG  I 6  66  ? 99.676  131.866 148.126 1.00 30.77  ? 63  DG  I N1    1 
ATOM   7225  C C2    . DG  I 6  66  ? 98.543  132.344 148.704 1.00 33.76  ? 63  DG  I C2    1 
ATOM   7226  N N2    . DG  I 6  66  ? 98.694  132.939 149.887 1.00 34.39  ? 63  DG  I N2    1 
ATOM   7227  N N3    . DG  I 6  66  ? 97.340  132.252 148.175 1.00 34.11  ? 63  DG  I N3    1 
ATOM   7228  C C4    . DG  I 6  66  ? 97.375  131.632 146.999 1.00 31.44  ? 63  DG  I C4    1 
ATOM   7229  P P     . DC  I 6  67  ? 91.467  134.225 145.789 1.00 66.42  ? 64  DC  I P     1 
ATOM   7230  O OP1   . DC  I 6  67  ? 90.194  134.516 146.489 1.00 66.35  ? 64  DC  I OP1   1 
ATOM   7231  O OP2   . DC  I 6  67  ? 91.556  134.306 144.309 1.00 62.18  ? 64  DC  I OP2   1 
ATOM   7232  O "O5'" . DC  I 6  67  ? 92.579  135.236 146.313 1.00 56.60  ? 64  DC  I "O5'" 1 
ATOM   7233  C "C5'" . DC  I 6  67  ? 92.878  135.271 147.719 1.00 55.71  ? 64  DC  I "C5'" 1 
ATOM   7234  C "C4'" . DC  I 6  67  ? 94.042  136.180 148.019 1.00 53.61  ? 64  DC  I "C4'" 1 
ATOM   7235  O "O4'" . DC  I 6  67  ? 95.282  135.503 147.727 1.00 45.34  ? 64  DC  I "O4'" 1 
ATOM   7236  C "C3'" . DC  I 6  67  ? 94.066  137.496 147.247 1.00 54.35  ? 64  DC  I "C3'" 1 
ATOM   7237  O "O3'" . DC  I 6  67  ? 94.283  138.556 148.191 1.00 56.86  ? 64  DC  I "O3'" 1 
ATOM   7238  C "C2'" . DC  I 6  67  ? 95.236  137.310 146.302 1.00 48.00  ? 64  DC  I "C2'" 1 
ATOM   7239  C "C1'" . DC  I 6  67  ? 96.151  136.415 147.109 1.00 42.05  ? 64  DC  I "C1'" 1 
ATOM   7240  N N1    . DC  I 6  67  ? 97.160  135.654 146.361 1.00 38.80  ? 64  DC  I N1    1 
ATOM   7241  C C2    . DC  I 6  67  ? 98.459  135.559 146.865 1.00 37.57  ? 64  DC  I C2    1 
ATOM   7242  O O2    . DC  I 6  67  ? 98.759  136.107 147.926 1.00 38.80  ? 64  DC  I O2    1 
ATOM   7243  N N3    . DC  I 6  67  ? 99.390  134.869 146.198 1.00 34.29  ? 64  DC  I N3    1 
ATOM   7244  C C4    . DC  I 6  67  ? 99.070  134.276 145.059 1.00 34.90  ? 64  DC  I C4    1 
ATOM   7245  N N4    . DC  I 6  67  ? 100.009 133.595 144.409 1.00 34.69  ? 64  DC  I N4    1 
ATOM   7246  C C5    . DC  I 6  67  ? 97.768  134.350 144.519 1.00 36.28  ? 64  DC  I C5    1 
ATOM   7247  C C6    . DC  I 6  67  ? 96.855  135.037 145.191 1.00 39.16  ? 64  DC  I C6    1 
ATOM   7248  P P     . DA  I 6  68  ? 94.162  140.130 147.854 1.00 71.91  ? 65  DA  I P     1 
ATOM   7249  O OP1   . DA  I 6  68  ? 93.300  140.755 148.884 1.00 65.03  ? 65  DA  I OP1   1 
ATOM   7250  O OP2   . DA  I 6  68  ? 93.855  140.307 146.412 1.00 58.83  ? 65  DA  I OP2   1 
ATOM   7251  O "O5'" . DA  I 6  68  ? 95.653  140.622 148.101 1.00 53.41  ? 65  DA  I "O5'" 1 
ATOM   7252  C "C5'" . DA  I 6  68  ? 96.281  140.294 149.350 1.00 54.78  ? 65  DA  I "C5'" 1 
ATOM   7253  C "C4'" . DA  I 6  68  ? 97.626  140.952 149.493 1.00 54.08  ? 65  DA  I "C4'" 1 
ATOM   7254  O "O4'" . DA  I 6  68  ? 98.623  140.121 148.867 1.00 46.00  ? 65  DA  I "O4'" 1 
ATOM   7255  C "C3'" . DA  I 6  68  ? 97.770  142.335 148.876 1.00 53.63  ? 65  DA  I "C3'" 1 
ATOM   7256  O "O3'" . DA  I 6  68  ? 98.698  143.085 149.679 1.00 53.53  ? 65  DA  I "O3'" 1 
ATOM   7257  C "C2'" . DA  I 6  68  ? 98.323  142.012 147.503 1.00 49.70  ? 65  DA  I "C2'" 1 
ATOM   7258  C "C1'" . DA  I 6  68  ? 99.202  140.810 147.783 1.00 43.32  ? 65  DA  I "C1'" 1 
ATOM   7259  N N9    . DA  I 6  68  ? 99.322  139.887 146.674 1.00 37.91  ? 65  DA  I N9    1 
ATOM   7260  C C8    . DA  I 6  68  ? 98.382  139.503 145.765 1.00 41.48  ? 65  DA  I C8    1 
ATOM   7261  N N7    . DA  I 6  68  ? 98.823  138.649 144.887 1.00 37.87  ? 65  DA  I N7    1 
ATOM   7262  C C5    . DA  I 6  68  ? 100.133 138.467 145.253 1.00 32.64  ? 65  DA  I C5    1 
ATOM   7263  C C6    . DA  I 6  68  ? 101.136 137.689 144.715 1.00 35.55  ? 65  DA  I C6    1 
ATOM   7264  N N6    . DA  I 6  68  ? 100.951 136.921 143.664 1.00 37.80  ? 65  DA  I N6    1 
ATOM   7265  N N1    . DA  I 6  68  ? 102.347 137.715 145.297 1.00 38.46  ? 65  DA  I N1    1 
ATOM   7266  C C2    . DA  I 6  68  ? 102.496 138.501 146.356 1.00 40.87  ? 65  DA  I C2    1 
ATOM   7267  N N3    . DA  I 6  68  ? 101.616 139.283 146.948 1.00 37.15  ? 65  DA  I N3    1 
ATOM   7268  C C4    . DA  I 6  68  ? 100.446 139.220 146.338 1.00 33.66  ? 65  DA  I C4    1 
ATOM   7269  P P     . DC  I 6  69  ? 98.999  144.656 149.474 1.00 61.87  ? 66  DC  I P     1 
ATOM   7270  O OP1   . DC  I 6  69  ? 99.280  145.261 150.796 1.00 59.49  ? 66  DC  I OP1   1 
ATOM   7271  O OP2   . DC  I 6  69  ? 97.978  145.247 148.572 1.00 57.59  ? 66  DC  I OP2   1 
ATOM   7272  O "O5'" . DC  I 6  69  ? 100.336 144.662 148.608 1.00 53.24  ? 66  DC  I "O5'" 1 
ATOM   7273  C "C5'" . DC  I 6  69  ? 101.524 144.039 149.123 1.00 51.25  ? 66  DC  I "C5'" 1 
ATOM   7274  C "C4'" . DC  I 6  69  ? 102.646 144.066 148.112 1.00 50.12  ? 66  DC  I "C4'" 1 
ATOM   7275  O "O4'" . DC  I 6  69  ? 102.471 143.003 147.161 1.00 44.53  ? 66  DC  I "O4'" 1 
ATOM   7276  C "C3'" . DC  I 6  69  ? 102.781 145.361 147.315 1.00 52.46  ? 66  DC  I "C3'" 1 
ATOM   7277  O "O3'" . DC  I 6  69  ? 104.025 145.977 147.706 1.00 57.12  ? 66  DC  I "O3'" 1 
ATOM   7278  C "C2'" . DC  I 6  69  ? 102.769 144.910 145.857 1.00 47.18  ? 66  DC  I "C2'" 1 
ATOM   7279  C "C1'" . DC  I 6  69  ? 102.958 143.413 145.909 1.00 40.77  ? 66  DC  I "C1'" 1 
ATOM   7280  N N1    . DC  I 6  69  ? 102.257 142.630 144.879 1.00 37.57  ? 66  DC  I N1    1 
ATOM   7281  C C2    . DC  I 6  69  ? 102.950 141.619 144.223 1.00 35.58  ? 66  DC  I C2    1 
ATOM   7282  O O2    . DC  I 6  69  ? 104.127 141.399 144.511 1.00 35.95  ? 66  DC  I O2    1 
ATOM   7283  N N3    . DC  I 6  69  ? 102.342 140.888 143.283 1.00 34.59  ? 66  DC  I N3    1 
ATOM   7284  C C4    . DC  I 6  69  ? 101.077 141.130 142.979 1.00 34.81  ? 66  DC  I C4    1 
ATOM   7285  N N4    . DC  I 6  69  ? 100.513 140.376 142.035 1.00 35.32  ? 66  DC  I N4    1 
ATOM   7286  C C5    . DC  I 6  69  ? 100.340 142.150 143.621 1.00 35.00  ? 66  DC  I C5    1 
ATOM   7287  C C6    . DC  I 6  69  ? 100.959 142.868 144.555 1.00 38.71  ? 66  DC  I C6    1 
ATOM   7288  P P     . DG  I 6  70  ? 104.577 147.387 147.144 1.00 71.17  ? 67  DG  I P     1 
ATOM   7289  O OP1   . DG  I 6  70  ? 105.450 147.989 148.180 1.00 65.53  ? 67  DG  I OP1   1 
ATOM   7290  O OP2   . DG  I 6  70  ? 103.441 148.158 146.576 1.00 60.63  ? 67  DG  I OP2   1 
ATOM   7291  O "O5'" . DG  I 6  70  ? 105.507 146.920 145.941 1.00 54.96  ? 67  DG  I "O5'" 1 
ATOM   7292  C "C5'" . DG  I 6  70  ? 106.463 145.863 146.157 1.00 55.26  ? 67  DG  I "C5'" 1 
ATOM   7293  C "C4'" . DG  I 6  70  ? 107.288 145.608 144.924 1.00 53.05  ? 67  DG  I "C4'" 1 
ATOM   7294  O "O4'" . DG  I 6  70  ? 106.567 144.767 143.996 1.00 46.58  ? 67  DG  I "O4'" 1 
ATOM   7295  C "C3'" . DG  I 6  70  ? 107.705 146.832 144.139 1.00 53.97  ? 67  DG  I "C3'" 1 
ATOM   7296  O "O3'" . DG  I 6  70  ? 109.034 146.546 143.705 1.00 51.37  ? 67  DG  I "O3'" 1 
ATOM   7297  C "C2'" . DG  I 6  70  ? 106.688 146.878 143.006 1.00 47.30  ? 67  DG  I "C2'" 1 
ATOM   7298  C "C1'" . DG  I 6  70  ? 106.436 145.409 142.738 1.00 42.40  ? 67  DG  I "C1'" 1 
ATOM   7299  N N9    . DG  I 6  70  ? 105.119 145.022 142.246 1.00 36.31  ? 67  DG  I N9    1 
ATOM   7300  C C8    . DG  I 6  70  ? 103.900 145.553 142.557 1.00 39.50  ? 67  DG  I C8    1 
ATOM   7301  N N7    . DG  I 6  70  ? 102.915 144.970 141.944 1.00 34.89  ? 67  DG  I N7    1 
ATOM   7302  C C5    . DG  I 6  70  ? 103.522 144.002 141.185 1.00 31.65  ? 67  DG  I C5    1 
ATOM   7303  C C6    . DG  I 6  70  ? 102.957 143.060 140.314 1.00 32.96  ? 67  DG  I C6    1 
ATOM   7304  O O6    . DG  I 6  70  ? 101.766 142.895 140.039 1.00 36.26  ? 67  DG  I O6    1 
ATOM   7305  N N1    . DG  I 6  70  ? 103.916 142.260 139.738 1.00 31.42  ? 67  DG  I N1    1 
ATOM   7306  C C2    . DG  I 6  70  ? 105.251 142.362 139.980 1.00 32.92  ? 67  DG  I C2    1 
ATOM   7307  N N2    . DG  I 6  70  ? 106.038 141.500 139.331 1.00 36.99  ? 67  DG  I N2    1 
ATOM   7308  N N3    . DG  I 6  70  ? 105.789 143.242 140.795 1.00 33.79  ? 67  DG  I N3    1 
ATOM   7309  C C4    . DG  I 6  70  ? 104.871 144.020 141.360 1.00 32.23  ? 67  DG  I C4    1 
ATOM   7310  P P     . DT  I 6  71  ? 110.065 147.614 143.101 1.00 53.48  ? 68  DT  I P     1 
ATOM   7311  O OP1   . DT  I 6  71  ? 111.303 147.581 143.912 1.00 59.88  ? 68  DT  I OP1   1 
ATOM   7312  O OP2   . DT  I 6  71  ? 109.360 148.898 142.859 1.00 52.95  ? 68  DT  I OP2   1 
ATOM   7313  O "O5'" . DT  I 6  71  ? 110.375 146.948 141.698 1.00 49.10  ? 68  DT  I "O5'" 1 
ATOM   7314  C "C5'" . DT  I 6  71  ? 110.741 145.556 141.618 1.00 47.77  ? 68  DT  I "C5'" 1 
ATOM   7315  C "C4'" . DT  I 6  71  ? 110.728 145.100 140.187 1.00 43.12  ? 68  DT  I "C4'" 1 
ATOM   7316  O "O4'" . DT  I 6  71  ? 109.366 144.854 139.767 1.00 38.15  ? 68  DT  I "O4'" 1 
ATOM   7317  C "C3'" . DT  I 6  71  ? 111.288 146.118 139.216 1.00 42.82  ? 68  DT  I "C3'" 1 
ATOM   7318  O "O3'" . DT  I 6  71  ? 111.926 145.465 138.126 1.00 43.52  ? 68  DT  I "O3'" 1 
ATOM   7319  C "C2'" . DT  I 6  71  ? 110.035 146.805 138.728 1.00 39.47  ? 68  DT  I "C2'" 1 
ATOM   7320  C "C1'" . DT  I 6  71  ? 109.087 145.630 138.630 1.00 31.91  ? 68  DT  I "C1'" 1 
ATOM   7321  N N1    . DT  I 6  71  ? 107.639 145.900 138.603 1.00 30.04  ? 68  DT  I N1    1 
ATOM   7322  C C2    . DT  I 6  71  ? 106.852 144.978 137.976 1.00 30.92  ? 68  DT  I C2    1 
ATOM   7323  O O2    . DT  I 6  71  ? 107.314 143.987 137.467 1.00 36.90  ? 68  DT  I O2    1 
ATOM   7324  N N3    . DT  I 6  71  ? 105.518 145.246 137.962 1.00 30.62  ? 68  DT  I N3    1 
ATOM   7325  C C4    . DT  I 6  71  ? 104.899 146.329 138.507 1.00 33.92  ? 68  DT  I C4    1 
ATOM   7326  O O4    . DT  I 6  71  ? 103.681 146.481 138.444 1.00 33.62  ? 68  DT  I O4    1 
ATOM   7327  C C5    . DT  I 6  71  ? 105.773 147.250 139.145 1.00 32.76  ? 68  DT  I C5    1 
ATOM   7328  C C7    . DT  I 6  71  ? 105.166 148.452 139.768 1.00 46.89  ? 68  DT  I C7    1 
ATOM   7329  C C6    . DT  I 6  71  ? 107.074 147.004 139.166 1.00 31.93  ? 68  DT  I C6    1 
ATOM   7330  P P     . DA  I 6  72  ? 113.499 145.152 138.063 1.00 49.20  ? 69  DA  I P     1 
ATOM   7331  O OP1   . DA  I 6  72  ? 113.941 144.480 139.305 1.00 56.53  ? 69  DA  I OP1   1 
ATOM   7332  O OP2   . DA  I 6  72  ? 114.190 146.370 137.587 1.00 60.26  ? 69  DA  I OP2   1 
ATOM   7333  O "O5'" . DA  I 6  72  ? 113.519 144.066 136.910 1.00 48.82  ? 69  DA  I "O5'" 1 
ATOM   7334  C "C5'" . DA  I 6  72  ? 112.842 142.823 137.157 1.00 56.62  ? 69  DA  I "C5'" 1 
ATOM   7335  C "C4'" . DA  I 6  72  ? 112.378 142.157 135.889 1.00 51.05  ? 69  DA  I "C4'" 1 
ATOM   7336  O "O4'" . DA  I 6  72  ? 111.065 142.610 135.509 1.00 37.48  ? 69  DA  I "O4'" 1 
ATOM   7337  C "C3'" . DA  I 6  72  ? 113.245 142.344 134.669 1.00 42.58  ? 69  DA  I "C3'" 1 
ATOM   7338  O "O3'" . DA  I 6  72  ? 113.114 141.138 133.916 1.00 41.17  ? 69  DA  I "O3'" 1 
ATOM   7339  C "C2'" . DA  I 6  72  ? 112.611 143.547 134.000 1.00 39.10  ? 69  DA  I "C2'" 1 
ATOM   7340  C "C1'" . DA  I 6  72  ? 111.141 143.398 134.341 1.00 33.82  ? 69  DA  I "C1'" 1 
ATOM   7341  N N9    . DA  I 6  72  ? 110.390 144.622 134.585 1.00 32.08  ? 69  DA  I N9    1 
ATOM   7342  C C8    . DA  I 6  72  ? 110.812 145.854 134.987 1.00 36.57  ? 69  DA  I C8    1 
ATOM   7343  N N7    . DA  I 6  72  ? 109.848 146.727 135.104 1.00 32.42  ? 69  DA  I N7    1 
ATOM   7344  C C5    . DA  I 6  72  ? 108.732 146.024 134.760 1.00 28.07  ? 69  DA  I C5    1 
ATOM   7345  C C6    . DA  I 6  72  ? 107.399 146.378 134.689 1.00 28.79  ? 69  DA  I C6    1 
ATOM   7346  N N6    . DA  I 6  72  ? 106.972 147.589 134.973 1.00 31.25  ? 69  DA  I N6    1 
ATOM   7347  N N1    . DA  I 6  72  ? 106.508 145.458 134.312 1.00 28.84  ? 69  DA  I N1    1 
ATOM   7348  C C2    . DA  I 6  72  ? 106.974 144.249 134.033 1.00 32.22  ? 69  DA  I C2    1 
ATOM   7349  N N3    . DA  I 6  72  ? 108.207 143.790 134.067 1.00 32.00  ? 69  DA  I N3    1 
ATOM   7350  C C4    . DA  I 6  72  ? 109.048 144.737 134.442 1.00 28.92  ? 69  DA  I C4    1 
ATOM   7351  P P     . DC  I 6  73  ? 113.974 140.768 132.616 1.00 42.53  ? 70  DC  I P     1 
ATOM   7352  O OP1   . DC  I 6  73  ? 114.443 139.364 132.745 1.00 49.75  ? 70  DC  I OP1   1 
ATOM   7353  O OP2   . DC  I 6  73  ? 114.936 141.860 132.325 1.00 53.54  ? 70  DC  I OP2   1 
ATOM   7354  O "O5'" . DC  I 6  73  ? 112.905 140.867 131.454 1.00 33.66  ? 70  DC  I "O5'" 1 
ATOM   7355  C "C5'" . DC  I 6  73  ? 111.727 140.068 131.564 1.00 27.97  ? 70  DC  I "C5'" 1 
ATOM   7356  C "C4'" . DC  I 6  73  ? 110.586 140.650 130.789 1.00 25.80  ? 70  DC  I "C4'" 1 
ATOM   7357  O "O4'" . DC  I 6  73  ? 110.223 141.948 131.258 1.00 29.26  ? 70  DC  I "O4'" 1 
ATOM   7358  C "C3'" . DC  I 6  73  ? 110.857 140.783 129.320 1.00 23.58  ? 70  DC  I "C3'" 1 
ATOM   7359  O "O3'" . DC  I 6  73  ? 109.983 139.861 128.673 1.00 21.40  ? 70  DC  I "O3'" 1 
ATOM   7360  C "C2'" . DC  I 6  73  ? 110.521 142.232 129.040 1.00 31.27  ? 70  DC  I "C2'" 1 
ATOM   7361  C "C1'" . DC  I 6  73  ? 109.656 142.640 130.195 1.00 22.72  ? 70  DC  I "C1'" 1 
ATOM   7362  N N1    . DC  I 6  73  ? 109.687 144.052 130.562 1.00 28.07  ? 70  DC  I N1    1 
ATOM   7363  C C2    . DC  I 6  73  ? 108.504 144.773 130.709 1.00 31.88  ? 70  DC  I C2    1 
ATOM   7364  O O2    . DC  I 6  73  ? 107.412 144.234 130.530 1.00 33.85  ? 70  DC  I O2    1 
ATOM   7365  N N3    . DC  I 6  73  ? 108.550 146.064 131.048 1.00 32.94  ? 70  DC  I N3    1 
ATOM   7366  C C4    . DC  I 6  73  ? 109.723 146.642 131.241 1.00 34.85  ? 70  DC  I C4    1 
ATOM   7367  N N4    . DC  I 6  73  ? 109.741 147.929 131.576 1.00 40.18  ? 70  DC  I N4    1 
ATOM   7368  C C5    . DC  I 6  73  ? 110.936 145.942 131.098 1.00 34.55  ? 70  DC  I C5    1 
ATOM   7369  C C6    . DC  I 6  73  ? 110.873 144.665 130.763 1.00 31.05  ? 70  DC  I C6    1 
ATOM   7370  P P     . DG  I 6  74  ? 109.978 139.609 127.103 1.00 10.23  ? 71  DG  I P     1 
ATOM   7371  O OP1   . DG  I 6  74  ? 109.802 138.135 126.917 1.00 14.96  ? 71  DG  I OP1   1 
ATOM   7372  O OP2   . DG  I 6  74  ? 111.158 140.255 126.510 1.00 22.31  ? 71  DG  I OP2   1 
ATOM   7373  O "O5'" . DG  I 6  74  ? 108.681 140.372 126.613 1.00 21.74  ? 71  DG  I "O5'" 1 
ATOM   7374  C "C5'" . DG  I 6  74  ? 107.403 139.754 126.749 1.00 21.75  ? 71  DG  I "C5'" 1 
ATOM   7375  C "C4'" . DG  I 6  74  ? 106.290 140.654 126.278 1.00 25.60  ? 71  DG  I "C4'" 1 
ATOM   7376  O "O4'" . DG  I 6  74  ? 106.403 141.968 126.871 1.00 31.97  ? 71  DG  I "O4'" 1 
ATOM   7377  C "C3'" . DG  I 6  74  ? 106.191 140.868 124.783 1.00 24.98  ? 71  DG  I "C3'" 1 
ATOM   7378  O "O3'" . DG  I 6  74  ? 104.797 140.805 124.432 1.00 28.40  ? 71  DG  I "O3'" 1 
ATOM   7379  C "C2'" . DG  I 6  74  ? 106.805 142.246 124.603 1.00 30.31  ? 71  DG  I "C2'" 1 
ATOM   7380  C "C1'" . DG  I 6  74  ? 106.429 142.970 125.872 1.00 28.17  ? 71  DG  I "C1'" 1 
ATOM   7381  N N9    . DG  I 6  74  ? 107.369 143.984 126.337 1.00 25.91  ? 71  DG  I N9    1 
ATOM   7382  C C8    . DG  I 6  74  ? 108.713 143.852 126.429 1.00 27.42  ? 71  DG  I C8    1 
ATOM   7383  N N7    . DG  I 6  74  ? 109.317 144.909 126.880 1.00 30.94  ? 71  DG  I N7    1 
ATOM   7384  C C5    . DG  I 6  74  ? 108.306 145.799 127.101 1.00 29.11  ? 71  DG  I C5    1 
ATOM   7385  C C6    . DG  I 6  74  ? 108.368 147.110 127.587 1.00 30.89  ? 71  DG  I C6    1 
ATOM   7386  O O6    . DG  I 6  74  ? 109.362 147.751 127.932 1.00 35.55  ? 71  DG  I O6    1 
ATOM   7387  N N1    . DG  I 6  74  ? 107.123 147.676 127.663 1.00 29.83  ? 71  DG  I N1    1 
ATOM   7388  C C2    . DG  I 6  74  ? 105.972 147.051 127.311 1.00 30.95  ? 71  DG  I C2    1 
ATOM   7389  N N2    . DG  I 6  74  ? 104.851 147.764 127.455 1.00 35.88  ? 71  DG  I N2    1 
ATOM   7390  N N3    . DG  I 6  74  ? 105.899 145.819 126.854 1.00 32.12  ? 71  DG  I N3    1 
ATOM   7391  C C4    . DG  I 6  74  ? 107.099 145.252 126.773 1.00 27.71  ? 71  DG  I C4    1 
ATOM   7392  P P     . DC  I 6  75  ? 104.250 140.788 122.916 1.00 34.42  ? 72  DC  I P     1 
ATOM   7393  O OP1   . DC  I 6  75  ? 102.926 140.137 122.870 1.00 35.86  ? 72  DC  I OP1   1 
ATOM   7394  O OP2   . DC  I 6  75  ? 105.340 140.372 122.003 1.00 35.05  ? 72  DC  I OP2   1 
ATOM   7395  O "O5'" . DC  I 6  75  ? 104.037 142.317 122.604 1.00 40.57  ? 72  DC  I "O5'" 1 
ATOM   7396  C "C5'" . DC  I 6  75  ? 102.977 142.994 123.280 1.00 45.89  ? 72  DC  I "C5'" 1 
ATOM   7397  C "C4'" . DC  I 6  75  ? 102.960 144.451 122.922 1.00 42.23  ? 72  DC  I "C4'" 1 
ATOM   7398  O "O4'" . DC  I 6  75  ? 104.030 145.141 123.587 1.00 34.94  ? 72  DC  I "O4'" 1 
ATOM   7399  C "C3'" . DC  I 6  75  ? 103.083 144.741 121.442 1.00 41.34  ? 72  DC  I "C3'" 1 
ATOM   7400  O "O3'" . DC  I 6  75  ? 101.810 145.266 121.030 1.00 48.09  ? 72  DC  I "O3'" 1 
ATOM   7401  C "C2'" . DC  I 6  75  ? 104.208 145.759 121.356 1.00 37.63  ? 72  DC  I "C2'" 1 
ATOM   7402  C "C1'" . DC  I 6  75  ? 104.479 146.185 122.774 1.00 31.16  ? 72  DC  I "C1'" 1 
ATOM   7403  N N1    . DC  I 6  75  ? 105.879 146.436 123.113 1.00 27.77  ? 72  DC  I N1    1 
ATOM   7404  C C2    . DC  I 6  75  ? 106.221 147.624 123.742 1.00 31.80  ? 72  DC  I C2    1 
ATOM   7405  O O2    . DC  I 6  75  ? 105.345 148.451 124.005 1.00 33.25  ? 72  DC  I O2    1 
ATOM   7406  N N3    . DC  I 6  75  ? 107.496 147.876 124.065 1.00 32.36  ? 72  DC  I N3    1 
ATOM   7407  C C4    . DC  I 6  75  ? 108.429 146.981 123.779 1.00 28.91  ? 72  DC  I C4    1 
ATOM   7408  N N4    . DC  I 6  75  ? 109.688 147.265 124.113 1.00 29.62  ? 72  DC  I N4    1 
ATOM   7409  C C5    . DC  I 6  75  ? 108.113 145.763 123.138 1.00 27.75  ? 72  DC  I C5    1 
ATOM   7410  C C6    . DC  I 6  75  ? 106.840 145.535 122.828 1.00 27.42  ? 72  DC  I C6    1 
ATOM   7411  P P     . DG  I 6  76  ? 101.430 145.669 119.520 1.00 54.22  ? 73  DG  I P     1 
ATOM   7412  O OP1   . DG  I 6  76  ? 99.967  145.504 119.357 1.00 57.83  ? 73  DG  I OP1   1 
ATOM   7413  O OP2   . DG  I 6  76  ? 102.368 144.991 118.595 1.00 54.64  ? 73  DG  I OP2   1 
ATOM   7414  O "O5'" . DG  I 6  76  ? 101.757 147.229 119.500 1.00 50.86  ? 73  DG  I "O5'" 1 
ATOM   7415  C "C5'" . DG  I 6  76  ? 101.153 148.098 120.481 1.00 50.55  ? 73  DG  I "C5'" 1 
ATOM   7416  C "C4'" . DG  I 6  76  ? 101.647 149.518 120.354 1.00 50.28  ? 73  DG  I "C4'" 1 
ATOM   7417  O "O4'" . DG  I 6  76  ? 102.964 149.633 120.942 1.00 41.65  ? 73  DG  I "O4'" 1 
ATOM   7418  C "C3'" . DG  I 6  76  ? 101.753 150.062 118.938 1.00 53.11  ? 73  DG  I "C3'" 1 
ATOM   7419  O "O3'" . DG  I 6  76  ? 101.220 151.398 118.938 1.00 59.95  ? 73  DG  I "O3'" 1 
ATOM   7420  C "C2'" . DG  I 6  76  ? 103.244 150.029 118.677 1.00 47.45  ? 73  DG  I "C2'" 1 
ATOM   7421  C "C1'" . DG  I 6  76  ? 103.827 150.290 120.044 1.00 40.94  ? 73  DG  I "C1'" 1 
ATOM   7422  N N9    . DG  I 6  76  ? 105.167 149.758 120.229 1.00 32.29  ? 73  DG  I N9    1 
ATOM   7423  C C8    . DG  I 6  76  ? 105.623 148.535 119.849 1.00 33.08  ? 73  DG  I C8    1 
ATOM   7424  N N7    . DG  I 6  76  ? 106.864 148.331 120.142 1.00 29.02  ? 73  DG  I N7    1 
ATOM   7425  C C5    . DG  I 6  76  ? 107.253 149.491 120.754 1.00 25.69  ? 73  DG  I C5    1 
ATOM   7426  C C6    . DG  I 6  76  ? 108.500 149.836 121.281 1.00 26.28  ? 73  DG  I C6    1 
ATOM   7427  O O6    . DG  I 6  76  ? 109.525 149.152 121.306 1.00 27.57  ? 73  DG  I O6    1 
ATOM   7428  N N1    . DG  I 6  76  ? 108.486 151.100 121.811 1.00 27.00  ? 73  DG  I N1    1 
ATOM   7429  C C2    . DG  I 6  76  ? 107.401 151.919 121.825 1.00 28.84  ? 73  DG  I C2    1 
ATOM   7430  N N2    . DG  I 6  76  ? 107.578 153.115 122.386 1.00 29.75  ? 73  DG  I N2    1 
ATOM   7431  N N3    . DG  I 6  76  ? 106.222 151.603 121.333 1.00 28.89  ? 73  DG  I N3    1 
ATOM   7432  C C4    . DG  I 6  76  ? 106.224 150.381 120.815 1.00 27.49  ? 73  DG  I C4    1 
ATOM   7433  P P     . DC  I 6  77  ? 100.933 152.258 117.600 1.00 76.94  ? 74  DC  I P     1 
ATOM   7434  O OP1   . DC  I 6  77  ? 99.708  153.069 117.809 1.00 69.62  ? 74  DC  I OP1   1 
ATOM   7435  O OP2   . DC  I 6  77  ? 101.075 151.393 116.402 1.00 67.53  ? 74  DC  I OP2   1 
ATOM   7436  O "O5'" . DC  I 6  77  ? 102.188 153.231 117.534 1.00 60.63  ? 74  DC  I "O5'" 1 
ATOM   7437  C "C5'" . DC  I 6  77  ? 102.404 154.156 118.607 1.00 59.63  ? 74  DC  I "C5'" 1 
ATOM   7438  C "C4'" . DC  I 6  77  ? 103.705 154.893 118.437 1.00 56.95  ? 74  DC  I "C4'" 1 
ATOM   7439  O "O4'" . DC  I 6  77  ? 104.793 154.055 118.863 1.00 45.42  ? 74  DC  I "O4'" 1 
ATOM   7440  C "C3'" . DC  I 6  77  ? 104.021 155.337 117.014 1.00 61.85  ? 74  DC  I "C3'" 1 
ATOM   7441  O "O3'" . DC  I 6  77  ? 103.934 156.774 116.959 1.00 65.62  ? 74  DC  I "O3'" 1 
ATOM   7442  C "C2'" . DC  I 6  77  ? 105.437 154.831 116.773 1.00 53.29  ? 74  DC  I "C2'" 1 
ATOM   7443  C "C1'" . DC  I 6  77  ? 105.933 154.402 118.127 1.00 41.57  ? 74  DC  I "C1'" 1 
ATOM   7444  N N1    . DC  I 6  77  ? 106.810 153.245 118.046 1.00 34.68  ? 74  DC  I N1    1 
ATOM   7445  C C2    . DC  I 6  77  ? 108.117 153.333 118.506 1.00 32.47  ? 74  DC  I C2    1 
ATOM   7446  O O2    . DC  I 6  77  ? 108.538 154.386 118.984 1.00 32.23  ? 74  DC  I O2    1 
ATOM   7447  N N3    . DC  I 6  77  ? 108.917 152.268 118.430 1.00 28.51  ? 74  DC  I N3    1 
ATOM   7448  C C4    . DC  I 6  77  ? 108.454 151.142 117.916 1.00 29.38  ? 74  DC  I C4    1 
ATOM   7449  N N4    . DC  I 6  77  ? 109.284 150.107 117.854 1.00 26.23  ? 74  DC  I N4    1 
ATOM   7450  C C5    . DC  I 6  77  ? 107.129 151.022 117.440 1.00 29.94  ? 74  DC  I C5    1 
ATOM   7451  C C6    . DC  I 6  77  ? 106.349 152.089 117.523 1.00 34.33  ? 74  DC  I C6    1 
ATOM   7452  P P     . DT  I 6  78  ? 104.106 157.638 115.604 1.00 81.99  ? 75  DT  I P     1 
ATOM   7453  O OP1   . DT  I 6  78  ? 103.387 158.921 115.785 1.00 77.12  ? 75  DT  I OP1   1 
ATOM   7454  O OP2   . DT  I 6  78  ? 103.801 156.776 114.432 1.00 72.85  ? 75  DT  I OP2   1 
ATOM   7455  O "O5'" . DT  I 6  78  ? 105.671 157.939 115.593 1.00 58.76  ? 75  DT  I "O5'" 1 
ATOM   7456  C "C5'" . DT  I 6  78  ? 106.275 158.595 116.720 1.00 57.42  ? 75  DT  I "C5'" 1 
ATOM   7457  C "C4'" . DT  I 6  78  ? 107.769 158.689 116.560 1.00 53.70  ? 75  DT  I "C4'" 1 
ATOM   7458  O "O4'" . DT  I 6  78  ? 108.351 157.387 116.755 1.00 46.91  ? 75  DT  I "O4'" 1 
ATOM   7459  C "C3'" . DT  I 6  78  ? 108.265 159.196 115.212 1.00 55.18  ? 75  DT  I "C3'" 1 
ATOM   7460  O "O3'" . DT  I 6  78  ? 109.025 160.399 115.431 1.00 57.74  ? 75  DT  I "O3'" 1 
ATOM   7461  C "C2'" . DT  I 6  78  ? 109.135 158.059 114.692 1.00 51.12  ? 75  DT  I "C2'" 1 
ATOM   7462  C "C1'" . DT  I 6  78  ? 109.470 157.260 115.922 1.00 40.33  ? 75  DT  I "C1'" 1 
ATOM   7463  N N1    . DT  I 6  78  ? 109.683 155.836 115.664 1.00 34.20  ? 75  DT  I N1    1 
ATOM   7464  C C2    . DT  I 6  78  ? 110.872 155.263 116.027 1.00 30.93  ? 75  DT  I C2    1 
ATOM   7465  O O2    . DT  I 6  78  ? 111.771 155.887 116.560 1.00 32.04  ? 75  DT  I O2    1 
ATOM   7466  N N3    . DT  I 6  78  ? 110.969 153.932 115.743 1.00 28.93  ? 75  DT  I N3    1 
ATOM   7467  C C4    . DT  I 6  78  ? 110.011 153.153 115.147 1.00 27.71  ? 75  DT  I C4    1 
ATOM   7468  O O4    . DT  I 6  78  ? 110.209 151.965 114.942 1.00 27.20  ? 75  DT  I O4    1 
ATOM   7469  C C5    . DT  I 6  78  ? 108.806 153.823 114.800 1.00 28.87  ? 75  DT  I C5    1 
ATOM   7470  C C7    . DT  I 6  78  ? 107.728 153.049 114.148 1.00 26.92  ? 75  DT  I C7    1 
ATOM   7471  C C6    . DT  I 6  78  ? 108.700 155.107 115.069 1.00 33.19  ? 75  DT  I C6    1 
ATOM   7472  P P     . DG  I 6  79  ? 109.499 161.381 114.239 1.00 71.99  ? 76  DG  I P     1 
ATOM   7473  O OP1   . DG  I 6  79  ? 109.769 162.717 114.820 1.00 66.15  ? 76  DG  I OP1   1 
ATOM   7474  O OP2   . DG  I 6  79  ? 108.561 161.243 113.097 1.00 63.12  ? 76  DG  I OP2   1 
ATOM   7475  O "O5'" . DG  I 6  79  ? 110.887 160.745 113.805 1.00 54.50  ? 76  DG  I "O5'" 1 
ATOM   7476  C "C5'" . DG  I 6  79  ? 111.941 160.615 114.770 1.00 54.31  ? 76  DG  I "C5'" 1 
ATOM   7477  C "C4'" . DG  I 6  79  ? 113.136 159.942 114.152 1.00 54.78  ? 76  DG  I "C4'" 1 
ATOM   7478  O "O4'" . DG  I 6  79  ? 112.929 158.513 114.126 1.00 47.08  ? 76  DG  I "O4'" 1 
ATOM   7479  C "C3'" . DG  I 6  79  ? 113.458 160.369 112.727 1.00 56.27  ? 76  DG  I "C3'" 1 
ATOM   7480  O "O3'" . DG  I 6  79  ? 114.812 160.830 112.738 1.00 57.91  ? 76  DG  I "O3'" 1 
ATOM   7481  C "C2'" . DG  I 6  79  ? 113.251 159.105 111.904 1.00 49.92  ? 76  DG  I "C2'" 1 
ATOM   7482  C "C1'" . DG  I 6  79  ? 113.397 157.988 112.909 1.00 41.22  ? 76  DG  I "C1'" 1 
ATOM   7483  N N9    . DG  I 6  79  ? 112.614 156.797 112.608 1.00 35.36  ? 76  DG  I N9    1 
ATOM   7484  C C8    . DG  I 6  79  ? 111.303 156.716 112.228 1.00 35.87  ? 76  DG  I C8    1 
ATOM   7485  N N7    . DG  I 6  79  ? 110.900 155.497 112.038 1.00 30.65  ? 76  DG  I N7    1 
ATOM   7486  C C5    . DG  I 6  79  ? 112.014 154.733 112.311 1.00 28.05  ? 76  DG  I C5    1 
ATOM   7487  C C6    . DG  I 6  79  ? 112.192 153.340 112.276 1.00 28.29  ? 76  DG  I C6    1 
ATOM   7488  O O6    . DG  I 6  79  ? 111.364 152.468 111.986 1.00 31.19  ? 76  DG  I O6    1 
ATOM   7489  N N1    . DG  I 6  79  ? 113.483 152.988 112.624 1.00 26.81  ? 76  DG  I N1    1 
ATOM   7490  C C2    . DG  I 6  79  ? 114.465 153.868 112.961 1.00 27.83  ? 76  DG  I C2    1 
ATOM   7491  N N2    . DG  I 6  79  ? 115.660 153.356 113.271 1.00 29.06  ? 76  DG  I N2    1 
ATOM   7492  N N3    . DG  I 6  79  ? 114.305 155.168 112.995 1.00 30.24  ? 76  DG  I N3    1 
ATOM   7493  C C4    . DG  I 6  79  ? 113.069 155.522 112.662 1.00 30.47  ? 76  DG  I C4    1 
ATOM   7494  P P     . DT  I 6  80  ? 115.562 161.496 111.480 1.00 70.46  ? 77  DT  I P     1 
ATOM   7495  O OP1   . DT  I 6  80  ? 116.335 162.663 111.967 1.00 68.50  ? 77  DT  I OP1   1 
ATOM   7496  O OP2   . DT  I 6  80  ? 114.610 161.648 110.350 1.00 63.05  ? 77  DT  I OP2   1 
ATOM   7497  O "O5'" . DT  I 6  80  ? 116.584 160.340 111.106 1.00 58.27  ? 77  DT  I "O5'" 1 
ATOM   7498  C "C5'" . DT  I 6  80  ? 117.419 159.793 112.143 1.00 57.31  ? 77  DT  I "C5'" 1 
ATOM   7499  C "C4'" . DT  I 6  80  ? 118.284 158.682 111.614 1.00 56.29  ? 77  DT  I "C4'" 1 
ATOM   7500  O "O4'" . DT  I 6  80  ? 117.496 157.480 111.545 1.00 46.49  ? 77  DT  I "O4'" 1 
ATOM   7501  C "C3'" . DT  I 6  80  ? 118.893 158.911 110.237 1.00 53.90  ? 77  DT  I "C3'" 1 
ATOM   7502  O "O3'" . DT  I 6  80  ? 120.319 158.792 110.383 1.00 57.32  ? 77  DT  I "O3'" 1 
ATOM   7503  C "C2'" . DT  I 6  80  ? 118.286 157.811 109.373 1.00 46.01  ? 77  DT  I "C2'" 1 
ATOM   7504  C "C1'" . DT  I 6  80  ? 117.774 156.790 110.359 1.00 38.38  ? 77  DT  I "C1'" 1 
ATOM   7505  N N1    . DT  I 6  80  ? 116.536 156.113 109.970 1.00 33.15  ? 77  DT  I N1    1 
ATOM   7506  C C2    . DT  I 6  80  ? 116.511 154.751 110.015 1.00 30.96  ? 77  DT  I C2    1 
ATOM   7507  O O2    . DT  I 6  80  ? 117.466 154.086 110.362 1.00 32.45  ? 77  DT  I O2    1 
ATOM   7508  N N3    . DT  I 6  80  ? 115.331 154.187 109.643 1.00 28.70  ? 77  DT  I N3    1 
ATOM   7509  C C4    . DT  I 6  80  ? 114.204 154.843 109.239 1.00 28.76  ? 77  DT  I C4    1 
ATOM   7510  O O4    . DT  I 6  80  ? 113.193 154.228 108.930 1.00 30.28  ? 77  DT  I O4    1 
ATOM   7511  C C5    . DT  I 6  80  ? 114.301 156.258 109.216 1.00 29.46  ? 77  DT  I C5    1 
ATOM   7512  C C7    . DT  I 6  80  ? 113.105 157.012 108.783 1.00 28.75  ? 77  DT  I C7    1 
ATOM   7513  C C6    . DT  I 6  80  ? 115.442 156.824 109.576 1.00 34.25  ? 77  DT  I C6    1 
ATOM   7514  P P     . DC  I 6  81  ? 121.381 159.066 109.201 1.00 70.38  ? 78  DC  I P     1 
ATOM   7515  O OP1   . DC  I 6  81  ? 122.660 159.514 109.804 1.00 67.53  ? 78  DC  I OP1   1 
ATOM   7516  O OP2   . DC  I 6  81  ? 120.731 159.849 108.118 1.00 61.53  ? 78  DC  I OP2   1 
ATOM   7517  O "O5'" . DC  I 6  81  ? 121.598 157.618 108.575 1.00 53.28  ? 78  DC  I "O5'" 1 
ATOM   7518  C "C5'" . DC  I 6  81  ? 121.912 156.509 109.442 1.00 51.63  ? 78  DC  I "C5'" 1 
ATOM   7519  C "C4'" . DC  I 6  81  ? 121.916 155.204 108.688 1.00 45.51  ? 78  DC  I "C4'" 1 
ATOM   7520  O "O4'" . DC  I 6  81  ? 120.567 154.796 108.364 1.00 40.52  ? 78  DC  I "O4'" 1 
ATOM   7521  C "C3'" . DC  I 6  81  ? 122.682 155.230 107.383 1.00 43.42  ? 78  DC  I "C3'" 1 
ATOM   7522  O "O3'" . DC  I 6  81  ? 123.445 154.026 107.338 1.00 45.21  ? 78  DC  I "O3'" 1 
ATOM   7523  C "C2'" . DC  I 6  81  ? 121.585 155.276 106.336 1.00 39.84  ? 78  DC  I "C2'" 1 
ATOM   7524  C "C1'" . DC  I 6  81  ? 120.461 154.489 106.992 1.00 35.43  ? 78  DC  I "C1'" 1 
ATOM   7525  N N1    . DC  I 6  81  ? 119.063 154.785 106.609 1.00 29.96  ? 78  DC  I N1    1 
ATOM   7526  C C2    . DC  I 6  81  ? 118.130 153.747 106.572 1.00 29.01  ? 78  DC  I C2    1 
ATOM   7527  O O2    . DC  I 6  81  ? 118.460 152.597 106.846 1.00 30.79  ? 78  DC  I O2    1 
ATOM   7528  N N3    . DC  I 6  81  ? 116.859 153.984 106.231 1.00 26.91  ? 78  DC  I N3    1 
ATOM   7529  C C4    . DC  I 6  81  ? 116.487 155.212 105.936 1.00 27.91  ? 78  DC  I C4    1 
ATOM   7530  N N4    . DC  I 6  81  ? 115.221 155.436 105.600 1.00 27.23  ? 78  DC  I N4    1 
ATOM   7531  C C5    . DC  I 6  81  ? 117.397 156.285 105.959 1.00 25.71  ? 78  DC  I C5    1 
ATOM   7532  C C6    . DC  I 6  81  ? 118.654 156.037 106.299 1.00 31.40  ? 78  DC  I C6    1 
ATOM   7533  P P     . DC  I 6  82  ? 124.661 153.767 106.325 1.00 55.91  ? 79  DC  I P     1 
ATOM   7534  O OP1   . DC  I 6  82  ? 125.916 153.648 107.105 1.00 54.86  ? 79  DC  I OP1   1 
ATOM   7535  O OP2   . DC  I 6  82  ? 124.557 154.700 105.174 1.00 50.32  ? 79  DC  I OP2   1 
ATOM   7536  O "O5'" . DC  I 6  82  ? 124.280 152.345 105.726 1.00 46.30  ? 79  DC  I "O5'" 1 
ATOM   7537  C "C5'" . DC  I 6  82  ? 124.316 151.209 106.604 1.00 46.76  ? 79  DC  I "C5'" 1 
ATOM   7538  C "C4'" . DC  I 6  82  ? 123.252 150.193 106.269 1.00 42.87  ? 79  DC  I "C4'" 1 
ATOM   7539  O "O4'" . DC  I 6  82  ? 122.017 150.829 105.876 1.00 39.09  ? 79  DC  I "O4'" 1 
ATOM   7540  C "C3'" . DC  I 6  82  ? 123.616 149.242 105.153 1.00 41.31  ? 79  DC  I "C3'" 1 
ATOM   7541  O "O3'" . DC  I 6  82  ? 123.344 147.912 105.629 1.00 41.22  ? 79  DC  I "O3'" 1 
ATOM   7542  C "C2'" . DC  I 6  82  ? 122.703 149.676 104.008 1.00 42.01  ? 79  DC  I "C2'" 1 
ATOM   7543  C "C1'" . DC  I 6  82  ? 121.491 150.219 104.720 1.00 35.09  ? 79  DC  I "C1'" 1 
ATOM   7544  N N1    . DC  I 6  82  ? 120.692 151.276 104.075 1.00 32.56  ? 79  DC  I N1    1 
ATOM   7545  C C2    . DC  I 6  82  ? 119.357 151.054 103.721 1.00 33.49  ? 79  DC  I C2    1 
ATOM   7546  O O2    . DC  I 6  82  ? 118.821 149.965 103.935 1.00 36.99  ? 79  DC  I O2    1 
ATOM   7547  N N3    . DC  I 6  82  ? 118.640 152.024 103.141 1.00 32.36  ? 79  DC  I N3    1 
ATOM   7548  C C4    . DC  I 6  82  ? 119.201 153.194 102.907 1.00 31.39  ? 79  DC  I C4    1 
ATOM   7549  N N4    . DC  I 6  82  ? 118.456 154.130 102.331 1.00 30.29  ? 79  DC  I N4    1 
ATOM   7550  C C5    . DC  I 6  82  ? 120.547 153.457 103.245 1.00 32.99  ? 79  DC  I C5    1 
ATOM   7551  C C6    . DC  I 6  82  ? 121.248 152.481 103.824 1.00 35.11  ? 79  DC  I C6    1 
ATOM   7552  P P     . DC  I 6  83  ? 124.020 146.587 105.010 1.00 45.69  ? 80  DC  I P     1 
ATOM   7553  O OP1   . DC  I 6  83  ? 124.060 145.538 106.052 1.00 47.04  ? 80  DC  I OP1   1 
ATOM   7554  O OP2   . DC  I 6  83  ? 125.246 146.961 104.265 1.00 49.92  ? 80  DC  I OP2   1 
ATOM   7555  O "O5'" . DC  I 6  83  ? 123.005 146.145 103.881 1.00 37.47  ? 80  DC  I "O5'" 1 
ATOM   7556  C "C5'" . DC  I 6  83  ? 121.625 145.916 104.200 1.00 37.27  ? 80  DC  I "C5'" 1 
ATOM   7557  C "C4'" . DC  I 6  83  ? 120.835 145.763 102.938 1.00 31.97  ? 80  DC  I "C4'" 1 
ATOM   7558  O "O4'" . DC  I 6  83  ? 120.395 147.058 102.458 1.00 34.12  ? 80  DC  I "O4'" 1 
ATOM   7559  C "C3'" . DC  I 6  83  ? 121.665 145.164 101.822 1.00 32.65  ? 80  DC  I "C3'" 1 
ATOM   7560  O "O3'" . DC  I 6  83  ? 120.874 144.342 100.976 1.00 34.65  ? 80  DC  I "O3'" 1 
ATOM   7561  C "C2'" . DC  I 6  83  ? 122.055 146.398 101.060 1.00 36.86  ? 80  DC  I "C2'" 1 
ATOM   7562  C "C1'" . DC  I 6  83  ? 120.747 147.154 101.107 1.00 31.92  ? 80  DC  I "C1'" 1 
ATOM   7563  N N1    . DC  I 6  83  ? 120.752 148.570 100.704 1.00 32.99  ? 80  DC  I N1    1 
ATOM   7564  C C2    . DC  I 6  83  ? 119.546 149.155 100.330 1.00 33.72  ? 80  DC  I C2    1 
ATOM   7565  O O2    . DC  I 6  83  ? 118.510 148.498 100.337 1.00 36.77  ? 80  DC  I O2    1 
ATOM   7566  N N3    . DC  I 6  83  ? 119.500 150.441 99.957  1.00 35.02  ? 80  DC  I N3    1 
ATOM   7567  C C4    . DC  I 6  83  ? 120.617 151.150 99.947  1.00 38.30  ? 80  DC  I C4    1 
ATOM   7568  N N4    . DC  I 6  83  ? 120.561 152.426 99.575  1.00 40.96  ? 80  DC  I N4    1 
ATOM   7569  C C5    . DC  I 6  83  ? 121.859 150.594 100.319 1.00 37.22  ? 80  DC  I C5    1 
ATOM   7570  C C6    . DC  I 6  83  ? 121.885 149.322 100.684 1.00 34.54  ? 80  DC  I C6    1 
ATOM   7571  P P     . DC  I 6  84  ? 120.663 142.776 101.188 1.00 29.00  ? 81  DC  I P     1 
ATOM   7572  O OP1   . DC  I 6  84  ? 120.301 142.450 102.583 1.00 26.79  ? 81  DC  I OP1   1 
ATOM   7573  O OP2   . DC  I 6  84  ? 121.752 142.024 100.527 1.00 31.33  ? 81  DC  I OP2   1 
ATOM   7574  O "O5'" . DC  I 6  84  ? 119.394 142.503 100.288 1.00 24.48  ? 81  DC  I "O5'" 1 
ATOM   7575  C "C5'" . DC  I 6  84  ? 118.113 142.788 100.850 1.00 25.29  ? 81  DC  I "C5'" 1 
ATOM   7576  C "C4'" . DC  I 6  84  ? 117.109 143.169 99.806  1.00 23.13  ? 81  DC  I "C4'" 1 
ATOM   7577  O "O4'" . DC  I 6  84  ? 117.326 144.534 99.405  1.00 30.15  ? 81  DC  I "O4'" 1 
ATOM   7578  C "C3'" . DC  I 6  84  ? 117.122 142.333 98.548  1.00 23.83  ? 81  DC  I "C3'" 1 
ATOM   7579  O "O3'" . DC  I 6  84  ? 115.781 142.149 98.118  1.00 23.04  ? 81  DC  I "O3'" 1 
ATOM   7580  C "C2'" . DC  I 6  84  ? 117.889 143.203 97.592  1.00 34.70  ? 81  DC  I "C2'" 1 
ATOM   7581  C "C1'" . DC  I 6  84  ? 117.488 144.602 98.015  1.00 29.70  ? 81  DC  I "C1'" 1 
ATOM   7582  N N1    . DC  I 6  84  ? 118.449 145.684 97.736  1.00 29.81  ? 81  DC  I N1    1 
ATOM   7583  C C2    . DC  I 6  84  ? 117.981 146.917 97.296  1.00 33.37  ? 81  DC  I C2    1 
ATOM   7584  O O2    . DC  I 6  84  ? 116.775 147.108 97.139  1.00 36.53  ? 81  DC  I O2    1 
ATOM   7585  N N3    . DC  I 6  84  ? 118.842 147.907 97.043  1.00 37.74  ? 81  DC  I N3    1 
ATOM   7586  C C4    . DC  I 6  84  ? 120.136 147.708 97.209  1.00 36.30  ? 81  DC  I C4    1 
ATOM   7587  N N4    . DC  I 6  84  ? 120.969 148.708 96.948  1.00 40.44  ? 81  DC  I N4    1 
ATOM   7588  C C5    . DC  I 6  84  ? 120.646 146.482 97.651  1.00 31.15  ? 81  DC  I C5    1 
ATOM   7589  C C6    . DC  I 6  84  ? 119.784 145.509 97.899  1.00 31.36  ? 81  DC  I C6    1 
ATOM   7590  P P     . DC  I 6  85  ? 115.311 141.105 97.006  1.00 12.00  ? 82  DC  I P     1 
ATOM   7591  O OP1   . DC  I 6  85  ? 114.346 140.156 97.609  1.00 25.37  ? 82  DC  I OP1   1 
ATOM   7592  O OP2   . DC  I 6  85  ? 116.444 140.570 96.220  1.00 28.82  ? 82  DC  I OP2   1 
ATOM   7593  O "O5'" . DC  I 6  85  ? 114.529 142.003 95.975  1.00 29.70  ? 82  DC  I "O5'" 1 
ATOM   7594  C "C5'" . DC  I 6  85  ? 113.416 142.773 96.440  1.00 33.81  ? 82  DC  I "C5'" 1 
ATOM   7595  C "C4'" . DC  I 6  85  ? 113.112 143.915 95.511  1.00 37.06  ? 82  DC  I "C4'" 1 
ATOM   7596  O "O4'" . DC  I 6  85  ? 114.198 144.847 95.462  1.00 35.45  ? 82  DC  I "O4'" 1 
ATOM   7597  C "C3'" . DC  I 6  85  ? 112.851 143.490 94.094  1.00 32.08  ? 82  DC  I "C3'" 1 
ATOM   7598  O "O3'" . DC  I 6  85  ? 111.561 143.964 93.760  1.00 34.98  ? 82  DC  I "O3'" 1 
ATOM   7599  C "C2'" . DC  I 6  85  ? 113.905 144.188 93.270  1.00 33.29  ? 82  DC  I "C2'" 1 
ATOM   7600  C "C1'" . DC  I 6  85  ? 114.371 145.305 94.144  1.00 29.04  ? 82  DC  I "C1'" 1 
ATOM   7601  N N1    . DC  I 6  85  ? 115.786 145.613 94.045  1.00 30.16  ? 82  DC  I N1    1 
ATOM   7602  C C2    . DC  I 6  85  ? 116.214 146.878 93.667  1.00 35.11  ? 82  DC  I C2    1 
ATOM   7603  O O2    . DC  I 6  85  ? 115.394 147.767 93.404  1.00 36.51  ? 82  DC  I O2    1 
ATOM   7604  N N3    . DC  I 6  85  ? 117.522 147.132 93.591  1.00 34.13  ? 82  DC  I N3    1 
ATOM   7605  C C4    . DC  I 6  85  ? 118.390 146.174 93.875  1.00 32.07  ? 82  DC  I C4    1 
ATOM   7606  N N4    . DC  I 6  85  ? 119.681 146.456 93.789  1.00 34.60  ? 82  DC  I N4    1 
ATOM   7607  C C5    . DC  I 6  85  ? 117.981 144.888 94.256  1.00 31.31  ? 82  DC  I C5    1 
ATOM   7608  C C6    . DC  I 6  85  ? 116.683 144.654 94.327  1.00 29.11  ? 82  DC  I C6    1 
ATOM   7609  P P     . DG  I 6  86  ? 110.717 143.348 92.565  1.00 42.62  ? 83  DG  I P     1 
ATOM   7610  O OP1   . DG  I 6  86  ? 109.307 143.695 92.912  1.00 44.41  ? 83  DG  I OP1   1 
ATOM   7611  O OP2   . DG  I 6  86  ? 111.121 141.941 92.348  1.00 38.24  ? 83  DG  I OP2   1 
ATOM   7612  O "O5'" . DG  I 6  86  ? 111.132 144.218 91.308  1.00 39.61  ? 83  DG  I "O5'" 1 
ATOM   7613  C "C5'" . DG  I 6  86  ? 110.743 145.602 91.283  1.00 40.77  ? 83  DG  I "C5'" 1 
ATOM   7614  C "C4'" . DG  I 6  86  ? 111.329 146.322 90.099  1.00 42.47  ? 83  DG  I "C4'" 1 
ATOM   7615  O "O4'" . DG  I 6  86  ? 112.714 146.663 90.363  1.00 38.24  ? 83  DG  I "O4'" 1 
ATOM   7616  C "C3'" . DG  I 6  86  ? 111.306 145.550 88.789  1.00 44.03  ? 83  DG  I "C3'" 1 
ATOM   7617  O "O3'" . DG  I 6  86  ? 110.801 146.427 87.771  1.00 48.74  ? 83  DG  I "O3'" 1 
ATOM   7618  C "C2'" . DG  I 6  86  ? 112.755 145.174 88.591  1.00 42.47  ? 83  DG  I "C2'" 1 
ATOM   7619  C "C1'" . DG  I 6  86  ? 113.493 146.318 89.243  1.00 38.17  ? 83  DG  I "C1'" 1 
ATOM   7620  N N9    . DG  I 6  86  ? 114.834 145.974 89.676  1.00 33.60  ? 83  DG  I N9    1 
ATOM   7621  C C8    . DG  I 6  86  ? 115.245 144.794 90.221  1.00 35.48  ? 83  DG  I C8    1 
ATOM   7622  N N7    . DG  I 6  86  ? 116.497 144.762 90.510  1.00 34.22  ? 83  DG  I N7    1 
ATOM   7623  C C5    . DG  I 6  86  ? 116.948 145.995 90.134  1.00 32.44  ? 83  DG  I C5    1 
ATOM   7624  C C6    . DG  I 6  86  ? 118.241 146.511 90.218  1.00 32.75  ? 83  DG  I C6    1 
ATOM   7625  O O6    . DG  I 6  86  ? 119.237 145.945 90.660  1.00 33.72  ? 83  DG  I O6    1 
ATOM   7626  N N1    . DG  I 6  86  ? 118.308 147.796 89.738  1.00 30.72  ? 83  DG  I N1    1 
ATOM   7627  C C2    . DG  I 6  86  ? 117.248 148.489 89.236  1.00 36.32  ? 83  DG  I C2    1 
ATOM   7628  N N2    . DG  I 6  86  ? 117.516 149.733 88.813  1.00 35.20  ? 83  DG  I N2    1 
ATOM   7629  N N3    . DG  I 6  86  ? 116.015 148.009 89.152  1.00 35.15  ? 83  DG  I N3    1 
ATOM   7630  C C4    . DG  I 6  86  ? 115.945 146.759 89.617  1.00 32.52  ? 83  DG  I C4    1 
ATOM   7631  P P     . DC  I 6  87  ? 110.497 145.989 86.248  1.00 61.58  ? 84  DC  I P     1 
ATOM   7632  O OP1   . DC  I 6  87  ? 109.147 146.476 85.886  1.00 57.84  ? 84  DC  I OP1   1 
ATOM   7633  O OP2   . DC  I 6  87  ? 110.886 144.572 86.032  1.00 54.18  ? 84  DC  I OP2   1 
ATOM   7634  O "O5'" . DC  I 6  87  ? 111.583 146.804 85.427  1.00 52.91  ? 84  DC  I "O5'" 1 
ATOM   7635  C "C5'" . DC  I 6  87  ? 111.794 148.197 85.700  1.00 50.75  ? 84  DC  I "C5'" 1 
ATOM   7636  C "C4'" . DC  I 6  87  ? 112.957 148.703 84.902  1.00 51.45  ? 84  DC  I "C4'" 1 
ATOM   7637  O "O4'" . DC  I 6  87  ? 114.168 148.460 85.645  1.00 44.95  ? 84  DC  I "O4'" 1 
ATOM   7638  C "C3'" . DC  I 6  87  ? 113.106 148.037 83.544  1.00 57.70  ? 84  DC  I "C3'" 1 
ATOM   7639  O "O3'" . DC  I 6  87  ? 112.916 149.031 82.517  1.00 61.25  ? 84  DC  I "O3'" 1 
ATOM   7640  C "C2'" . DC  I 6  87  ? 114.517 147.474 83.558  1.00 54.42  ? 84  DC  I "C2'" 1 
ATOM   7641  C "C1'" . DC  I 6  87  ? 115.190 148.045 84.777  1.00 45.78  ? 84  DC  I "C1'" 1 
ATOM   7642  N N1    . DC  I 6  87  ? 116.012 147.066 85.483  1.00 41.35  ? 84  DC  I N1    1 
ATOM   7643  C C2    . DC  I 6  87  ? 117.360 147.320 85.715  1.00 38.69  ? 84  DC  I C2    1 
ATOM   7644  O O2    . DC  I 6  87  ? 117.869 148.373 85.325  1.00 41.22  ? 84  DC  I O2    1 
ATOM   7645  N N3    . DC  I 6  87  ? 118.105 146.418 86.364  1.00 34.24  ? 84  DC  I N3    1 
ATOM   7646  C C4    . DC  I 6  87  ? 117.545 145.292 86.778  1.00 34.47  ? 84  DC  I C4    1 
ATOM   7647  N N4    . DC  I 6  87  ? 118.308 144.419 87.416  1.00 33.55  ? 84  DC  I N4    1 
ATOM   7648  C C5    . DC  I 6  87  ? 116.184 145.004 86.556  1.00 38.10  ? 84  DC  I C5    1 
ATOM   7649  C C6    . DC  I 6  87  ? 115.460 145.909 85.913  1.00 42.83  ? 84  DC  I C6    1 
ATOM   7650  P P     . DG  I 6  88  ? 112.854 148.692 80.936  1.00 69.87  ? 85  DG  I P     1 
ATOM   7651  O OP1   . DG  I 6  88  ? 112.145 149.800 80.253  1.00 69.37  ? 85  DG  I OP1   1 
ATOM   7652  O OP2   . DG  I 6  88  ? 112.393 147.292 80.758  1.00 64.23  ? 85  DG  I OP2   1 
ATOM   7653  O "O5'" . DG  I 6  88  ? 114.389 148.756 80.514  1.00 59.07  ? 85  DG  I "O5'" 1 
ATOM   7654  C "C5'" . DG  I 6  88  ? 115.165 149.934 80.807  1.00 59.74  ? 85  DG  I "C5'" 1 
ATOM   7655  C "C4'" . DG  I 6  88  ? 116.614 149.745 80.432  1.00 60.57  ? 85  DG  I "C4'" 1 
ATOM   7656  O "O4'" . DG  I 6  88  ? 117.278 148.901 81.407  1.00 53.04  ? 85  DG  I "O4'" 1 
ATOM   7657  C "C3'" . DG  I 6  88  ? 116.871 149.112 79.071  1.00 61.78  ? 85  DG  I "C3'" 1 
ATOM   7658  O "O3'" . DG  I 6  88  ? 117.983 149.802 78.474  1.00 64.37  ? 85  DG  I "O3'" 1 
ATOM   7659  C "C2'" . DG  I 6  88  ? 117.211 147.683 79.440  1.00 57.81  ? 85  DG  I "C2'" 1 
ATOM   7660  C "C1'" . DG  I 6  88  ? 117.964 147.865 80.736  1.00 51.23  ? 85  DG  I "C1'" 1 
ATOM   7661  N N9    . DG  I 6  88  ? 117.989 146.689 81.597  1.00 43.86  ? 85  DG  I N9    1 
ATOM   7662  C C8    . DG  I 6  88  ? 116.953 145.853 81.902  1.00 45.07  ? 85  DG  I C8    1 
ATOM   7663  N N7    . DG  I 6  88  ? 117.283 144.889 82.698  1.00 40.42  ? 85  DG  I N7    1 
ATOM   7664  C C5    . DG  I 6  88  ? 118.615 145.102 82.934  1.00 36.66  ? 85  DG  I C5    1 
ATOM   7665  C C6    . DG  I 6  88  ? 119.501 144.370 83.726  1.00 36.36  ? 85  DG  I C6    1 
ATOM   7666  O O6    . DG  I 6  88  ? 119.252 143.360 84.392  1.00 36.49  ? 85  DG  I O6    1 
ATOM   7667  N N1    . DG  I 6  88  ? 120.770 144.912 83.702  1.00 33.65  ? 85  DG  I N1    1 
ATOM   7668  C C2    . DG  I 6  88  ? 121.124 146.022 82.998  1.00 36.10  ? 85  DG  I C2    1 
ATOM   7669  N N2    . DG  I 6  88  ? 122.400 146.404 83.094  1.00 35.33  ? 85  DG  I N2    1 
ATOM   7670  N N3    . DG  I 6  88  ? 120.294 146.717 82.251  1.00 38.36  ? 85  DG  I N3    1 
ATOM   7671  C C4    . DG  I 6  88  ? 119.067 146.201 82.267  1.00 38.45  ? 85  DG  I C4    1 
ATOM   7672  P P     . DT  I 6  89  ? 118.452 149.613 76.942  1.00 78.68  ? 86  DT  I P     1 
ATOM   7673  O OP1   . DT  I 6  89  ? 118.737 150.956 76.383  1.00 70.68  ? 86  DT  I OP1   1 
ATOM   7674  O OP2   . DT  I 6  89  ? 117.506 148.703 76.247  1.00 68.81  ? 86  DT  I OP2   1 
ATOM   7675  O "O5'" . DT  I 6  89  ? 119.832 148.839 77.120  1.00 63.19  ? 86  DT  I "O5'" 1 
ATOM   7676  C "C5'" . DT  I 6  89  ? 120.927 149.521 77.753  1.00 61.68  ? 86  DT  I "C5'" 1 
ATOM   7677  C "C4'" . DT  I 6  89  ? 122.120 148.618 77.946  1.00 59.49  ? 86  DT  I "C4'" 1 
ATOM   7678  O "O4'" . DT  I 6  89  ? 121.803 147.596 78.915  1.00 52.03  ? 86  DT  I "O4'" 1 
ATOM   7679  C "C3'" . DT  I 6  89  ? 122.638 147.901 76.703  1.00 59.85  ? 86  DT  I "C3'" 1 
ATOM   7680  O "O3'" . DT  I 6  89  ? 124.058 148.121 76.625  1.00 61.11  ? 86  DT  I "O3'" 1 
ATOM   7681  C "C2'" . DT  I 6  89  ? 122.294 146.445 76.973  1.00 55.18  ? 86  DT  I "C2'" 1 
ATOM   7682  C "C1'" . DT  I 6  89  ? 122.334 146.370 78.481  1.00 48.05  ? 86  DT  I "C1'" 1 
ATOM   7683  N N1    . DT  I 6  89  ? 121.542 145.287 79.088  1.00 41.89  ? 86  DT  I N1    1 
ATOM   7684  C C2    . DT  I 6  89  ? 122.147 144.477 80.008  1.00 40.66  ? 86  DT  I C2    1 
ATOM   7685  O O2    . DT  I 6  89  ? 123.303 144.609 80.349  1.00 43.93  ? 86  DT  I O2    1 
ATOM   7686  N N3    . DT  I 6  89  ? 121.350 143.502 80.523  1.00 37.83  ? 86  DT  I N3    1 
ATOM   7687  C C4    . DT  I 6  89  ? 120.045 143.260 80.219  1.00 37.14  ? 86  DT  I C4    1 
ATOM   7688  O O4    . DT  I 6  89  ? 119.433 142.343 80.765  1.00 39.27  ? 86  DT  I O4    1 
ATOM   7689  C C5    . DT  I 6  89  ? 119.477 144.140 79.257  1.00 39.20  ? 86  DT  I C5    1 
ATOM   7690  C C7    . DT  I 6  89  ? 118.062 143.929 78.871  1.00 38.83  ? 86  DT  I C7    1 
ATOM   7691  C C6    . DT  I 6  89  ? 120.235 145.095 78.744  1.00 42.78  ? 86  DT  I C6    1 
ATOM   7692  P P     . DT  I 6  90  ? 124.977 147.694 75.365  1.00 70.78  ? 87  DT  I P     1 
ATOM   7693  O OP1   . DT  I 6  90  ? 125.996 148.750 75.161  1.00 68.89  ? 87  DT  I OP1   1 
ATOM   7694  O OP2   . DT  I 6  90  ? 124.096 147.287 74.241  1.00 67.40  ? 87  DT  I OP2   1 
ATOM   7695  O "O5'" . DT  I 6  90  ? 125.709 146.386 75.915  1.00 61.79  ? 87  DT  I "O5'" 1 
ATOM   7696  C "C5'" . DT  I 6  90  ? 126.603 146.524 77.033  1.00 61.81  ? 87  DT  I "C5'" 1 
ATOM   7697  C "C4'" . DT  I 6  90  ? 127.088 145.201 77.582  1.00 57.04  ? 87  DT  I "C4'" 1 
ATOM   7698  O "O4'" . DT  I 6  90  ? 125.991 144.427 78.113  1.00 51.97  ? 87  DT  I "O4'" 1 
ATOM   7699  C "C3'" . DT  I 6  90  ? 127.831 144.286 76.626  1.00 54.97  ? 87  DT  I "C3'" 1 
ATOM   7700  O "O3'" . DT  I 6  90  ? 128.985 143.799 77.330  1.00 59.56  ? 87  DT  I "O3'" 1 
ATOM   7701  C "C2'" . DT  I 6  90  ? 126.820 143.186 76.362  1.00 53.26  ? 87  DT  I "C2'" 1 
ATOM   7702  C "C1'" . DT  I 6  90  ? 126.121 143.092 77.695  1.00 47.73  ? 87  DT  I "C1'" 1 
ATOM   7703  N N1    . DT  I 6  90  ? 124.772 142.489 77.706  1.00 43.70  ? 87  DT  I N1    1 
ATOM   7704  C C2    . DT  I 6  90  ? 124.520 141.484 78.597  1.00 42.31  ? 87  DT  I C2    1 
ATOM   7705  O O2    . DT  I 6  90  ? 125.364 141.081 79.368  1.00 47.32  ? 87  DT  I O2    1 
ATOM   7706  N N3    . DT  I 6  90  ? 123.255 140.972 78.556  1.00 38.26  ? 87  DT  I N3    1 
ATOM   7707  C C4    . DT  I 6  90  ? 122.241 141.359 77.728  1.00 36.07  ? 87  DT  I C4    1 
ATOM   7708  O O4    . DT  I 6  90  ? 121.135 140.825 77.790  1.00 36.96  ? 87  DT  I O4    1 
ATOM   7709  C C5    . DT  I 6  90  ? 122.574 142.406 76.831  1.00 38.66  ? 87  DT  I C5    1 
ATOM   7710  C C7    . DT  I 6  90  ? 121.523 142.867 75.907  1.00 37.89  ? 87  DT  I C7    1 
ATOM   7711  C C6    . DT  I 6  90  ? 123.797 142.916 76.856  1.00 42.43  ? 87  DT  I C6    1 
ATOM   7712  P P     . DT  I 6  91  ? 130.224 143.046 76.625  1.00 67.17  ? 88  DT  I P     1 
ATOM   7713  O OP1   . DT  I 6  91  ? 131.475 143.520 77.263  1.00 67.06  ? 88  DT  I OP1   1 
ATOM   7714  O OP2   . DT  I 6  91  ? 130.053 143.132 75.153  1.00 68.60  ? 88  DT  I OP2   1 
ATOM   7715  O "O5'" . DT  I 6  91  ? 129.988 141.531 77.051  1.00 61.27  ? 88  DT  I "O5'" 1 
ATOM   7716  C "C5'" . DT  I 6  91  ? 130.031 141.167 78.442  1.00 59.60  ? 88  DT  I "C5'" 1 
ATOM   7717  C "C4'" . DT  I 6  91  ? 129.642 139.725 78.645  1.00 53.80  ? 88  DT  I "C4'" 1 
ATOM   7718  O "O4'" . DT  I 6  91  ? 128.217 139.561 78.442  1.00 47.70  ? 88  DT  I "O4'" 1 
ATOM   7719  C "C3'" . DT  I 6  91  ? 130.304 138.741 77.698  1.00 53.05  ? 88  DT  I "C3'" 1 
ATOM   7720  O "O3'" . DT  I 6  91  ? 130.582 137.525 78.382  1.00 54.24  ? 88  DT  I "O3'" 1 
ATOM   7721  C "C2'" . DT  I 6  91  ? 129.199 138.482 76.704  1.00 50.59  ? 88  DT  I "C2'" 1 
ATOM   7722  C "C1'" . DT  I 6  91  ? 128.024 138.426 77.649  1.00 42.48  ? 88  DT  I "C1'" 1 
ATOM   7723  N N1    . DT  I 6  91  ? 126.676 138.490 77.076  1.00 37.21  ? 88  DT  I N1    1 
ATOM   7724  C C2    . DT  I 6  91  ? 125.718 137.676 77.607  1.00 37.49  ? 88  DT  I C2    1 
ATOM   7725  O O2    . DT  I 6  91  ? 125.949 136.920 78.520  1.00 42.15  ? 88  DT  I O2    1 
ATOM   7726  N N3    . DT  I 6  91  ? 124.482 137.777 77.037  1.00 37.54  ? 88  DT  I N3    1 
ATOM   7727  C C4    . DT  I 6  91  ? 124.125 138.600 76.004  1.00 36.81  ? 88  DT  I C4    1 
ATOM   7728  O O4    . DT  I 6  91  ? 122.979 138.618 75.562  1.00 36.96  ? 88  DT  I O4    1 
ATOM   7729  C C5    . DT  I 6  91  ? 125.176 139.420 75.503  1.00 40.59  ? 88  DT  I C5    1 
ATOM   7730  C C7    . DT  I 6  91  ? 124.868 140.343 74.385  1.00 44.78  ? 88  DT  I C7    1 
ATOM   7731  C C6    . DT  I 6  91  ? 126.379 139.329 76.051  1.00 41.42  ? 88  DT  I C6    1 
ATOM   7732  P P     . DT  I 6  92  ? 132.018 137.124 78.978  1.00 58.24  ? 89  DT  I P     1 
ATOM   7733  O OP1   . DT  I 6  92  ? 132.359 138.047 80.084  1.00 60.88  ? 89  DT  I OP1   1 
ATOM   7734  O OP2   . DT  I 6  92  ? 132.950 136.970 77.836  1.00 64.22  ? 89  DT  I OP2   1 
ATOM   7735  O "O5'" . DT  I 6  92  ? 131.706 135.684 79.583  1.00 58.16  ? 89  DT  I "O5'" 1 
ATOM   7736  C "C5'" . DT  I 6  92  ? 130.583 135.485 80.466  1.00 56.10  ? 89  DT  I "C5'" 1 
ATOM   7737  C "C4'" . DT  I 6  92  ? 129.720 134.319 80.021  1.00 49.93  ? 89  DT  I "C4'" 1 
ATOM   7738  O "O4'" . DT  I 6  92  ? 128.572 134.769 79.275  1.00 46.65  ? 89  DT  I "O4'" 1 
ATOM   7739  C "C3'" . DT  I 6  92  ? 130.379 133.328 79.076  1.00 51.41  ? 89  DT  I "C3'" 1 
ATOM   7740  O "O3'" . DT  I 6  92  ? 131.264 132.344 79.713  1.00 60.17  ? 89  DT  I "O3'" 1 
ATOM   7741  C "C2'" . DT  I 6  92  ? 129.192 132.728 78.335  1.00 46.49  ? 89  DT  I "C2'" 1 
ATOM   7742  C "C1'" . DT  I 6  92  ? 128.027 133.649 78.622  1.00 39.99  ? 89  DT  I "C1'" 1 
ATOM   7743  N N1    . DT  I 6  92  ? 127.282 134.073 77.421  1.00 37.19  ? 89  DT  I N1    1 
ATOM   7744  C C2    . DT  I 6  92  ? 125.951 133.749 77.331  1.00 37.50  ? 89  DT  I C2    1 
ATOM   7745  O O2    . DT  I 6  92  ? 125.367 133.134 78.197  1.00 39.14  ? 89  DT  I O2    1 
ATOM   7746  N N3    . DT  I 6  92  ? 125.320 134.171 76.194  1.00 34.78  ? 89  DT  I N3    1 
ATOM   7747  C C4    . DT  I 6  92  ? 125.881 134.866 75.164  1.00 35.36  ? 89  DT  I C4    1 
ATOM   7748  O O4    . DT  I 6  92  ? 125.208 135.192 74.192  1.00 36.09  ? 89  DT  I O4    1 
ATOM   7749  C C5    . DT  I 6  92  ? 127.266 135.171 75.319  1.00 35.15  ? 89  DT  I C5    1 
ATOM   7750  C C7    . DT  I 6  92  ? 127.923 135.927 74.228  1.00 35.10  ? 89  DT  I C7    1 
ATOM   7751  C C6    . DT  I 6  92  ? 127.896 134.768 76.420  1.00 38.31  ? 89  DT  I C6    1 
ATOM   7752  P P     . DA  I 6  93  ? 130.993 131.304 80.947  1.00 56.01  ? 90  DA  I P     1 
ATOM   7753  O OP1   . DA  I 6  93  ? 130.568 132.065 82.136  1.00 59.24  ? 90  DA  I OP1   1 
ATOM   7754  O OP2   . DA  I 6  93  ? 132.167 130.408 81.056  1.00 71.42  ? 90  DA  I OP2   1 
ATOM   7755  O "O5'" . DA  I 6  93  ? 129.786 130.400 80.479  1.00 51.49  ? 90  DA  I "O5'" 1 
ATOM   7756  C "C5'" . DA  I 6  93  ? 128.739 130.129 81.404  1.00 49.38  ? 90  DA  I "C5'" 1 
ATOM   7757  C "C4'" . DA  I 6  93  ? 127.618 129.364 80.759  1.00 44.06  ? 90  DA  I "C4'" 1 
ATOM   7758  O "O4'" . DA  I 6  93  ? 127.258 129.958 79.499  1.00 43.77  ? 90  DA  I "O4'" 1 
ATOM   7759  C "C3'" . DA  I 6  93  ? 127.901 127.907 80.466  1.00 43.40  ? 90  DA  I "C3'" 1 
ATOM   7760  O "O3'" . DA  I 6  93  ? 126.717 127.195 80.814  1.00 41.75  ? 90  DA  I "O3'" 1 
ATOM   7761  C "C2'" . DA  I 6  93  ? 128.138 127.901 78.971  1.00 41.15  ? 90  DA  I "C2'" 1 
ATOM   7762  C "C1'" . DA  I 6  93  ? 127.180 128.967 78.511  1.00 37.46  ? 90  DA  I "C1'" 1 
ATOM   7763  N N9    . DA  I 6  93  ? 127.475 129.583 77.221  1.00 36.46  ? 90  DA  I N9    1 
ATOM   7764  C C8    . DA  I 6  93  ? 128.679 129.809 76.609  1.00 37.71  ? 90  DA  I C8    1 
ATOM   7765  N N7    . DA  I 6  93  ? 128.563 130.391 75.443  1.00 35.29  ? 90  DA  I N7    1 
ATOM   7766  C C5    . DA  I 6  93  ? 127.206 130.556 75.284  1.00 34.47  ? 90  DA  I C5    1 
ATOM   7767  C C6    . DA  I 6  93  ? 126.428 131.107 74.268  1.00 35.39  ? 90  DA  I C6    1 
ATOM   7768  N N6    . DA  I 6  93  ? 126.915 131.627 73.150  1.00 37.11  ? 90  DA  I N6    1 
ATOM   7769  N N1    . DA  I 6  93  ? 125.099 131.113 74.424  1.00 37.12  ? 90  DA  I N1    1 
ATOM   7770  C C2    . DA  I 6  93  ? 124.602 130.596 75.530  1.00 36.16  ? 90  DA  I C2    1 
ATOM   7771  N N3    . DA  I 6  93  ? 125.228 130.056 76.548  1.00 35.67  ? 90  DA  I N3    1 
ATOM   7772  C C4    . DA  I 6  93  ? 126.538 130.065 76.364  1.00 34.94  ? 90  DA  I C4    1 
ATOM   7773  P P     . DA  I 6  94  ? 126.653 125.647 81.219  1.00 37.16  ? 91  DA  I P     1 
ATOM   7774  O OP1   . DA  I 6  94  ? 126.839 125.487 82.684  1.00 37.41  ? 91  DA  I OP1   1 
ATOM   7775  O OP2   . DA  I 6  94  ? 127.538 124.867 80.330  1.00 53.84  ? 91  DA  I OP2   1 
ATOM   7776  O "O5'" . DA  I 6  94  ? 125.152 125.305 80.838  1.00 31.99  ? 91  DA  I "O5'" 1 
ATOM   7777  C "C5'" . DA  I 6  94  ? 124.087 126.023 81.467  1.00 33.72  ? 91  DA  I "C5'" 1 
ATOM   7778  C "C4'" . DA  I 6  94  ? 122.874 126.062 80.593  1.00 32.48  ? 91  DA  I "C4'" 1 
ATOM   7779  O "O4'" . DA  I 6  94  ? 123.167 126.788 79.393  1.00 39.39  ? 91  DA  I "O4'" 1 
ATOM   7780  C "C3'" . DA  I 6  94  ? 122.355 124.711 80.179  1.00 25.48  ? 91  DA  I "C3'" 1 
ATOM   7781  O "O3'" . DA  I 6  94  ? 120.930 124.700 80.324  1.00 30.95  ? 91  DA  I "O3'" 1 
ATOM   7782  C "C2'" . DA  I 6  94  ? 122.781 124.609 78.735  1.00 34.30  ? 91  DA  I "C2'" 1 
ATOM   7783  C "C1'" . DA  I 6  94  ? 122.821 126.026 78.267  1.00 34.42  ? 91  DA  I "C1'" 1 
ATOM   7784  N N9    . DA  I 6  94  ? 123.816 126.263 77.235  1.00 33.11  ? 91  DA  I N9    1 
ATOM   7785  C C8    . DA  I 6  94  ? 125.139 125.945 77.250  1.00 34.25  ? 91  DA  I C8    1 
ATOM   7786  N N7    . DA  I 6  94  ? 125.775 126.290 76.162  1.00 34.41  ? 91  DA  I N7    1 
ATOM   7787  C C5    . DA  I 6  94  ? 124.805 126.873 75.390  1.00 32.12  ? 91  DA  I C5    1 
ATOM   7788  C C6    . DA  I 6  94  ? 124.845 127.442 74.129  1.00 35.70  ? 91  DA  I C6    1 
ATOM   7789  N N6    . DA  I 6  94  ? 125.933 127.521 73.388  1.00 38.15  ? 91  DA  I N6    1 
ATOM   7790  N N1    . DA  I 6  94  ? 123.708 127.937 73.627  1.00 39.32  ? 91  DA  I N1    1 
ATOM   7791  C C2    . DA  I 6  94  ? 122.608 127.856 74.368  1.00 38.72  ? 91  DA  I C2    1 
ATOM   7792  N N3    . DA  I 6  94  ? 122.450 127.343 75.574  1.00 34.55  ? 91  DA  I N3    1 
ATOM   7793  C C4    . DA  I 6  94  ? 123.599 126.863 76.034  1.00 32.60  ? 91  DA  I C4    1 
ATOM   7794  P P     . DC  I 6  95  ? 120.098 123.332 80.307  1.00 32.30  ? 92  DC  I P     1 
ATOM   7795  O OP1   . DC  I 6  95  ? 118.815 123.520 81.015  1.00 32.66  ? 92  DC  I OP1   1 
ATOM   7796  O OP2   . DC  I 6  95  ? 121.019 122.250 80.749  1.00 32.08  ? 92  DC  I OP2   1 
ATOM   7797  O "O5'" . DC  I 6  95  ? 119.822 123.088 78.779  1.00 39.91  ? 92  DC  I "O5'" 1 
ATOM   7798  C "C5'" . DC  I 6  95  ? 118.914 123.971 78.113  1.00 48.00  ? 92  DC  I "C5'" 1 
ATOM   7799  C "C4'" . DC  I 6  95  ? 118.952 123.775 76.622  1.00 47.81  ? 92  DC  I "C4'" 1 
ATOM   7800  O "O4'" . DC  I 6  95  ? 120.230 124.154 76.102  1.00 40.95  ? 92  DC  I "O4'" 1 
ATOM   7801  C "C3'" . DC  I 6  95  ? 118.718 122.348 76.166  1.00 52.50  ? 92  DC  I "C3'" 1 
ATOM   7802  O "O3'" . DC  I 6  95  ? 117.407 122.299 75.590  1.00 58.90  ? 92  DC  I "O3'" 1 
ATOM   7803  C "C2'" . DC  I 6  95  ? 119.821 122.092 75.145  1.00 50.78  ? 92  DC  I "C2'" 1 
ATOM   7804  C "C1'" . DC  I 6  95  ? 120.431 123.447 74.915  1.00 40.70  ? 92  DC  I "C1'" 1 
ATOM   7805  N N1    . DC  I 6  95  ? 121.865 123.478 74.682  1.00 35.47  ? 92  DC  I N1    1 
ATOM   7806  C C2    . DC  I 6  95  ? 122.347 124.059 73.522  1.00 37.93  ? 92  DC  I C2    1 
ATOM   7807  O O2    . DC  I 6  95  ? 121.562 124.537 72.701  1.00 40.20  ? 92  DC  I O2    1 
ATOM   7808  N N3    . DC  I 6  95  ? 123.664 124.093 73.303  1.00 40.69  ? 92  DC  I N3    1 
ATOM   7809  C C4    . DC  I 6  95  ? 124.499 123.573 74.194  1.00 39.27  ? 92  DC  I C4    1 
ATOM   7810  N N4    . DC  I 6  95  ? 125.809 123.633 73.930  1.00 35.99  ? 92  DC  I N4    1 
ATOM   7811  C C5    . DC  I 6  95  ? 124.031 122.973 75.387  1.00 32.75  ? 92  DC  I C5    1 
ATOM   7812  C C6    . DC  I 6  95  ? 122.718 122.950 75.586  1.00 33.74  ? 92  DC  I C6    1 
ATOM   7813  P P     . DC  I 6  96  ? 116.666 120.932 75.191  1.00 64.77  ? 93  DC  I P     1 
ATOM   7814  O OP1   . DC  I 6  96  ? 115.203 121.152 75.273  1.00 73.35  ? 93  DC  I OP1   1 
ATOM   7815  O OP2   . DC  I 6  96  ? 117.297 119.795 75.903  1.00 70.95  ? 93  DC  I OP2   1 
ATOM   7816  O "O5'" . DC  I 6  96  ? 117.092 120.732 73.676  1.00 62.18  ? 93  DC  I "O5'" 1 
ATOM   7817  C "C5'" . DC  I 6  96  ? 116.705 121.721 72.714  1.00 64.81  ? 93  DC  I "C5'" 1 
ATOM   7818  C "C4'" . DC  I 6  96  ? 117.410 121.499 71.409  1.00 63.66  ? 93  DC  I "C4'" 1 
ATOM   7819  O "O4'" . DC  I 6  96  ? 118.758 121.978 71.496  1.00 56.05  ? 93  DC  I "O4'" 1 
ATOM   7820  C "C3'" . DC  I 6  96  ? 117.577 120.056 70.996  1.00 67.11  ? 93  DC  I "C3'" 1 
ATOM   7821  O "O3'" . DC  I 6  96  ? 116.370 119.558 70.377  1.00 74.24  ? 93  DC  I "O3'" 1 
ATOM   7822  C "C2'" . DC  I 6  96  ? 118.706 120.203 70.000  1.00 61.79  ? 93  DC  I "C2'" 1 
ATOM   7823  C "C1'" . DC  I 6  96  ? 119.488 121.408 70.441  1.00 51.74  ? 93  DC  I "C1'" 1 
ATOM   7824  N N1    . DC  I 6  96  ? 120.831 121.145 70.949  1.00 48.85  ? 93  DC  I N1    1 
ATOM   7825  C C2    . DC  I 6  96  ? 121.938 121.571 70.222  1.00 51.25  ? 93  DC  I C2    1 
ATOM   7826  O O2    . DC  I 6  96  ? 121.777 122.162 69.147  1.00 57.78  ? 93  DC  I O2    1 
ATOM   7827  N N3    . DC  I 6  96  ? 123.168 121.338 70.685  1.00 49.14  ? 93  DC  I N3    1 
ATOM   7828  C C4    . DC  I 6  96  ? 123.315 120.706 71.837  1.00 46.08  ? 93  DC  I C4    1 
ATOM   7829  N N4    . DC  I 6  96  ? 124.552 120.493 72.262  1.00 44.86  ? 93  DC  I N4    1 
ATOM   7830  C C5    . DC  I 6  96  ? 122.214 120.258 72.597  1.00 48.36  ? 93  DC  I C5    1 
ATOM   7831  C C6    . DC  I 6  96  ? 120.999 120.500 72.121  1.00 49.23  ? 93  DC  I C6    1 
ATOM   7832  P P     . DG  I 6  97  ? 116.191 118.031 69.852  1.00 90.11  ? 94  DG  I P     1 
ATOM   7833  O OP1   . DG  I 6  97  ? 114.893 117.938 69.140  1.00 81.70  ? 94  DG  I OP1   1 
ATOM   7834  O OP2   . DG  I 6  97  ? 116.477 117.101 70.975  1.00 79.78  ? 94  DG  I OP2   1 
ATOM   7835  O "O5'" . DG  I 6  97  ? 117.363 117.847 68.780  1.00 74.72  ? 94  DG  I "O5'" 1 
ATOM   7836  C "C5'" . DG  I 6  97  ? 117.104 118.069 67.385  1.00 78.94  ? 94  DG  I "C5'" 1 
ATOM   7837  C "C4'" . DG  I 6  97  ? 118.374 118.198 66.571  1.00 76.20  ? 94  DG  I "C4'" 1 
ATOM   7838  O "O4'" . DG  I 6  97  ? 119.422 118.806 67.345  1.00 66.07  ? 94  DG  I "O4'" 1 
ATOM   7839  C "C3'" . DG  I 6  97  ? 118.983 116.906 66.052  1.00 84.93  ? 94  DG  I "C3'" 1 
ATOM   7840  O "O3'" . DG  I 6  97  ? 118.392 116.592 64.776  1.00 90.37  ? 94  DG  I "O3'" 1 
ATOM   7841  C "C2'" . DG  I 6  97  ? 120.452 117.273 65.897  1.00 75.04  ? 94  DG  I "C2'" 1 
ATOM   7842  C "C1'" . DG  I 6  97  ? 120.673 118.437 66.826  1.00 64.27  ? 94  DG  I "C1'" 1 
ATOM   7843  N N9    . DG  I 6  97  ? 121.536 118.153 67.946  1.00 59.32  ? 94  DG  I N9    1 
ATOM   7844  C C8    . DG  I 6  97  ? 121.173 117.665 69.169  1.00 58.65  ? 94  DG  I C8    1 
ATOM   7845  N N7    . DG  I 6  97  ? 122.179 117.520 69.981  1.00 58.52  ? 94  DG  I N7    1 
ATOM   7846  C C5    . DG  I 6  97  ? 123.256 117.945 69.232  1.00 57.05  ? 94  DG  I C5    1 
ATOM   7847  C C6    . DG  I 6  97  ? 124.604 118.013 69.592  1.00 57.58  ? 94  DG  I C6    1 
ATOM   7848  O O6    . DG  I 6  97  ? 125.106 117.705 70.664  1.00 56.96  ? 94  DG  I O6    1 
ATOM   7849  N N1    . DG  I 6  97  ? 125.376 118.491 68.563  1.00 58.07  ? 94  DG  I N1    1 
ATOM   7850  C C2    . DG  I 6  97  ? 124.900 118.859 67.344  1.00 57.67  ? 94  DG  I C2    1 
ATOM   7851  N N2    . DG  I 6  97  ? 125.802 119.308 66.470  1.00 61.95  ? 94  DG  I N2    1 
ATOM   7852  N N3    . DG  I 6  97  ? 123.630 118.795 66.996  1.00 59.38  ? 94  DG  I N3    1 
ATOM   7853  C C4    . DG  I 6  97  ? 122.878 118.330 67.991  1.00 59.23  ? 94  DG  I C4    1 
ATOM   7854  P P     . DC  I 6  98  ? 118.569 115.160 64.044  1.00 85.11  ? 95  DC  I P     1 
ATOM   7855  O OP1   . DC  I 6  98  ? 118.113 115.282 62.636  1.00 94.33  ? 95  DC  I OP1   1 
ATOM   7856  O OP2   . DC  I 6  98  ? 118.010 114.106 64.930  1.00 94.18  ? 95  DC  I OP2   1 
ATOM   7857  O "O5'" . DC  I 6  98  ? 120.141 114.899 64.052  1.00 87.02  ? 95  DC  I "O5'" 1 
ATOM   7858  C "C5'" . DC  I 6  98  ? 120.961 115.370 62.971  1.00 85.96  ? 95  DC  I "C5'" 1 
ATOM   7859  C "C4'" . DC  I 6  98  ? 122.405 115.007 63.215  1.00 84.41  ? 95  DC  I "C4'" 1 
ATOM   7860  O "O4'" . DC  I 6  98  ? 122.844 115.441 64.521  1.00 75.97  ? 95  DC  I "O4'" 1 
ATOM   7861  C "C3'" . DC  I 6  98  ? 122.674 113.508 63.168  1.00 87.72  ? 95  DC  I "C3'" 1 
ATOM   7862  O "O3'" . DC  I 6  98  ? 123.322 113.205 61.918  1.00 86.94  ? 95  DC  I "O3'" 1 
ATOM   7863  C "C2'" . DC  I 6  98  ? 123.573 113.248 64.377  1.00 78.09  ? 95  DC  I "C2'" 1 
ATOM   7864  C "C1'" . DC  I 6  98  ? 123.919 114.617 64.909  1.00 74.32  ? 95  DC  I "C1'" 1 
ATOM   7865  N N1    . DC  I 6  98  ? 124.038 114.637 66.371  1.00 69.01  ? 95  DC  I N1    1 
ATOM   7866  C C2    . DC  I 6  98  ? 125.287 114.827 66.975  1.00 65.80  ? 95  DC  I C2    1 
ATOM   7867  O O2    . DC  I 6  98  ? 126.297 114.978 66.280  1.00 64.56  ? 95  DC  I O2    1 
ATOM   7868  N N3    . DC  I 6  98  ? 125.380 114.844 68.311  1.00 63.97  ? 95  DC  I N3    1 
ATOM   7869  C C4    . DC  I 6  98  ? 124.287 114.680 69.050  1.00 62.88  ? 95  DC  I C4    1 
ATOM   7870  N N4    . DC  I 6  98  ? 124.424 114.702 70.373  1.00 62.82  ? 95  DC  I N4    1 
ATOM   7871  C C5    . DC  I 6  98  ? 123.008 114.485 68.467  1.00 67.91  ? 95  DC  I C5    1 
ATOM   7872  C C6    . DC  I 6  98  ? 122.930 114.470 67.138  1.00 67.14  ? 95  DC  I C6    1 
ATOM   7873  P P     . DC  I 6  99  ? 123.564 111.699 61.390  1.00 97.95  ? 96  DC  I P     1 
ATOM   7874  O OP1   . DC  I 6  99  ? 123.735 111.729 59.915  1.00 94.77  ? 96  DC  I OP1   1 
ATOM   7875  O OP2   . DC  I 6  99  ? 122.568 110.792 62.020  1.00 90.02  ? 96  DC  I OP2   1 
ATOM   7876  O "O5'" . DC  I 6  99  ? 124.944 111.298 62.069  1.00 91.04  ? 96  DC  I "O5'" 1 
ATOM   7877  C "C5'" . DC  I 6  99  ? 126.125 112.100 61.883  1.00 87.37  ? 96  DC  I "C5'" 1 
ATOM   7878  C "C4'" . DC  I 6  99  ? 127.206 111.611 62.809  1.00 82.26  ? 96  DC  I "C4'" 1 
ATOM   7879  O "O4'" . DC  I 6  99  ? 127.024 112.137 64.138  1.00 76.51  ? 96  DC  I "O4'" 1 
ATOM   7880  C "C3'" . DC  I 6  99  ? 127.226 110.099 62.974  1.00 85.96  ? 96  DC  I "C3'" 1 
ATOM   7881  O "O3'" . DC  I 6  99  ? 128.186 109.565 62.049  1.00 88.50  ? 96  DC  I "O3'" 1 
ATOM   7882  C "C2'" . DC  I 6  99  ? 127.610 109.900 64.437  1.00 79.41  ? 96  DC  I "C2'" 1 
ATOM   7883  C "C1'" . DC  I 6  99  ? 127.702 111.282 65.032  1.00 75.34  ? 96  DC  I "C1'" 1 
ATOM   7884  N N1    . DC  I 6  99  ? 127.078 111.339 66.357  1.00 70.23  ? 96  DC  I N1    1 
ATOM   7885  C C2    . DC  I 6  99  ? 127.868 111.542 67.491  1.00 68.31  ? 96  DC  I C2    1 
ATOM   7886  O O2    . DC  I 6  99  ? 129.093 111.676 67.376  1.00 65.47  ? 96  DC  I O2    1 
ATOM   7887  N N3    . DC  I 6  99  ? 127.290 111.592 68.701  1.00 63.22  ? 96  DC  I N3    1 
ATOM   7888  C C4    . DC  I 6  99  ? 125.974 111.448 68.805  1.00 63.87  ? 96  DC  I C4    1 
ATOM   7889  N N4    . DC  I 6  99  ? 125.430 111.501 70.021  1.00 64.39  ? 96  DC  I N4    1 
ATOM   7890  C C5    . DC  I 6  99  ? 125.149 111.240 67.672  1.00 64.97  ? 96  DC  I C5    1 
ATOM   7891  C C6    . DC  I 6  99  ? 125.737 111.194 66.482  1.00 68.47  ? 96  DC  I C6    1 
ATOM   7892  P P     . DA  I 6  100 ? 128.504 107.991 61.893  1.00 105.75 ? 97  DA  I P     1 
ATOM   7893  O OP1   . DA  I 6  100 ? 129.107 107.769 60.555  1.00 95.19  ? 97  DA  I OP1   1 
ATOM   7894  O OP2   . DA  I 6  100 ? 127.314 107.201 62.311  1.00 90.68  ? 97  DA  I OP2   1 
ATOM   7895  O "O5'" . DA  I 6  100 ? 129.639 107.767 62.990  1.00 88.78  ? 97  DA  I "O5'" 1 
ATOM   7896  C "C5'" . DA  I 6  100 ? 130.787 108.640 63.064  1.00 84.90  ? 97  DA  I "C5'" 1 
ATOM   7897  C "C4'" . DA  I 6  100 ? 131.614 108.298 64.274  1.00 88.96  ? 97  DA  I "C4'" 1 
ATOM   7898  O "O4'" . DA  I 6  100 ? 130.936 108.717 65.484  1.00 80.41  ? 97  DA  I "O4'" 1 
ATOM   7899  C "C3'" . DA  I 6  100 ? 131.913 106.811 64.429  1.00 97.80  ? 97  DA  I "C3'" 1 
ATOM   7900  O "O3'" . DA  I 6  100 ? 133.311 106.689 64.739  1.00 95.77  ? 97  DA  I "O3'" 1 
ATOM   7901  C "C2'" . DA  I 6  100 ? 130.997 106.392 65.574  1.00 88.75  ? 97  DA  I "C2'" 1 
ATOM   7902  C "C1'" . DA  I 6  100 ? 130.923 107.652 66.413  1.00 79.78  ? 97  DA  I "C1'" 1 
ATOM   7903  N N9    . DA  I 6  100 ? 129.733 107.785 67.255  1.00 72.63  ? 97  DA  I N9    1 
ATOM   7904  C C8    . DA  I 6  100 ? 128.413 107.640 66.918  1.00 71.02  ? 97  DA  I C8    1 
ATOM   7905  N N7    . DA  I 6  100 ? 127.587 107.829 67.914  1.00 64.43  ? 97  DA  I N7    1 
ATOM   7906  C C5    . DA  I 6  100 ? 128.422 108.120 68.975  1.00 65.81  ? 97  DA  I C5    1 
ATOM   7907  C C6    . DA  I 6  100 ? 128.166 108.415 70.309  1.00 63.37  ? 97  DA  I C6    1 
ATOM   7908  N N6    . DA  I 6  100 ? 126.936 108.471 70.807  1.00 59.59  ? 97  DA  I N6    1 
ATOM   7909  N N1    . DA  I 6  100 ? 129.219 108.656 71.116  1.00 62.38  ? 97  DA  I N1    1 
ATOM   7910  C C2    . DA  I 6  100 ? 130.437 108.594 70.585  1.00 62.67  ? 97  DA  I C2    1 
ATOM   7911  N N3    . DA  I 6  100 ? 130.802 108.325 69.345  1.00 65.84  ? 97  DA  I N3    1 
ATOM   7912  C C4    . DA  I 6  100 ? 129.736 108.095 68.583  1.00 67.74  ? 97  DA  I C4    1 
ATOM   7913  P P     . DA  I 6  101 ? 134.108 105.287 64.787  1.00 88.43  ? 98  DA  I P     1 
ATOM   7914  O OP1   . DA  I 6  101 ? 135.500 105.529 64.331  1.00 101.12 ? 98  DA  I OP1   1 
ATOM   7915  O OP2   . DA  I 6  101 ? 133.283 104.227 64.152  1.00 100.59 ? 98  DA  I OP2   1 
ATOM   7916  O "O5'" . DA  I 6  101 ? 134.142 105.010 66.348  1.00 94.03  ? 98  DA  I "O5'" 1 
ATOM   7917  C "C5'" . DA  I 6  101 ? 134.635 106.037 67.221  1.00 89.03  ? 98  DA  I "C5'" 1 
ATOM   7918  C "C4'" . DA  I 6  101 ? 134.822 105.497 68.606  1.00 90.58  ? 98  DA  I "C4'" 1 
ATOM   7919  O "O4'" . DA  I 6  101 ? 133.596 105.617 69.360  1.00 78.04  ? 98  DA  I "O4'" 1 
ATOM   7920  C "C3'" . DA  I 6  101 ? 135.224 104.035 68.670  1.00 88.31  ? 98  DA  I "C3'" 1 
ATOM   7921  O "O3'" . DA  I 6  101 ? 136.151 103.923 69.752  1.00 88.85  ? 98  DA  I "O3'" 1 
ATOM   7922  C "C2'" . DA  I 6  101 ? 133.901 103.333 68.937  1.00 79.51  ? 98  DA  I "C2'" 1 
ATOM   7923  C "C1'" . DA  I 6  101 ? 133.175 104.342 69.805  1.00 72.49  ? 98  DA  I "C1'" 1 
ATOM   7924  N N9    . DA  I 6  101 ? 131.724 104.346 69.740  1.00 67.60  ? 98  DA  I N9    1 
ATOM   7925  C C8    . DA  I 6  101 ? 130.893 104.004 68.709  1.00 68.15  ? 98  DA  I C8    1 
ATOM   7926  N N7    . DA  I 6  101 ? 129.628 104.132 68.994  1.00 66.94  ? 98  DA  I N7    1 
ATOM   7927  C C5    . DA  I 6  101 ? 129.624 104.582 70.287  1.00 65.46  ? 98  DA  I C5    1 
ATOM   7928  C C6    . DA  I 6  101 ? 128.586 104.903 71.150  1.00 62.60  ? 98  DA  I C6    1 
ATOM   7929  N N6    . DA  I 6  101 ? 127.292 104.821 70.835  1.00 59.58  ? 98  DA  I N6    1 
ATOM   7930  N N1    . DA  I 6  101 ? 128.923 105.322 72.375  1.00 61.20  ? 98  DA  I N1    1 
ATOM   7931  C C2    . DA  I 6  101 ? 130.208 105.406 72.693  1.00 61.25  ? 98  DA  I C2    1 
ATOM   7932  N N3    . DA  I 6  101 ? 131.266 105.129 71.961  1.00 64.66  ? 98  DA  I N3    1 
ATOM   7933  C C4    . DA  I 6  101 ? 130.901 104.717 70.757  1.00 65.07  ? 98  DA  I C4    1 
ATOM   7934  P P     . DG  I 6  102 ? 137.004 102.601 70.059  1.00 99.62  ? 99  DG  I P     1 
ATOM   7935  O OP1   . DG  I 6  102 ? 138.361 103.028 70.477  1.00 93.42  ? 99  DG  I OP1   1 
ATOM   7936  O OP2   . DG  I 6  102 ? 136.840 101.631 68.943  1.00 92.86  ? 99  DG  I OP2   1 
ATOM   7937  O "O5'" . DG  I 6  102 ? 136.234 102.029 71.330  1.00 91.23  ? 99  DG  I "O5'" 1 
ATOM   7938  C "C5'" . DG  I 6  102 ? 136.021 102.844 72.500  1.00 90.19  ? 99  DG  I "C5'" 1 
ATOM   7939  C "C4'" . DG  I 6  102 ? 135.129 102.115 73.466  1.00 77.53  ? 99  DG  I "C4'" 1 
ATOM   7940  O "O4'" . DG  I 6  102 ? 133.746 102.303 73.076  1.00 71.21  ? 99  DG  I "O4'" 1 
ATOM   7941  C "C3'" . DG  I 6  102 ? 135.384 100.606 73.483  1.00 77.55  ? 99  DG  I "C3'" 1 
ATOM   7942  O "O3'" . DG  I 6  102 ? 135.386 100.037 74.798  1.00 78.16  ? 99  DG  I "O3'" 1 
ATOM   7943  C "C2'" . DG  I 6  102 ? 134.199 100.088 72.717  1.00 72.77  ? 99  DG  I "C2'" 1 
ATOM   7944  C "C1'" . DG  I 6  102 ? 133.120 101.054 73.143  1.00 64.48  ? 99  DG  I "C1'" 1 
ATOM   7945  N N9    . DG  I 6  102 ? 131.926 101.041 72.313  1.00 64.28  ? 99  DG  I N9    1 
ATOM   7946  C C8    . DG  I 6  102 ? 131.816 100.703 70.993  1.00 67.95  ? 99  DG  I C8    1 
ATOM   7947  N N7    . DG  I 6  102 ? 130.603 100.792 70.542  1.00 69.12  ? 99  DG  I N7    1 
ATOM   7948  C C5    . DG  I 6  102 ? 129.869 101.214 71.628  1.00 65.38  ? 99  DG  I C5    1 
ATOM   7949  C C6    . DG  I 6  102 ? 128.492 101.488 71.744  1.00 64.40  ? 99  DG  I C6    1 
ATOM   7950  O O6    . DG  I 6  102 ? 127.621 101.404 70.870  1.00 65.43  ? 99  DG  I O6    1 
ATOM   7951  N N1    . DG  I 6  102 ? 128.158 101.891 73.022  1.00 60.96  ? 99  DG  I N1    1 
ATOM   7952  C C2    . DG  I 6  102 ? 129.042 102.015 74.048  1.00 59.41  ? 99  DG  I C2    1 
ATOM   7953  N N2    . DG  I 6  102 ? 128.537 102.423 75.218  1.00 57.44  ? 99  DG  I N2    1 
ATOM   7954  N N3    . DG  I 6  102 ? 130.332 101.763 73.948  1.00 63.02  ? 99  DG  I N3    1 
ATOM   7955  C C4    . DG  I 6  102 ? 130.669 101.372 72.720  1.00 64.36  ? 99  DG  I C4    1 
ATOM   7956  P P     . DG  I 6  103 ? 136.626 100.128 75.819  1.00 63.45  ? 100 DG  I P     1 
ATOM   7957  O OP1   . DG  I 6  103 ? 137.403 101.349 75.521  1.00 83.56  ? 100 DG  I OP1   1 
ATOM   7958  O OP2   . DG  I 6  103 ? 137.283 98.800  75.849  1.00 82.12  ? 100 DG  I OP2   1 
ATOM   7959  O "O5'" . DG  I 6  103 ? 135.859 100.352 77.193  1.00 78.44  ? 100 DG  I "O5'" 1 
ATOM   7960  C "C5'" . DG  I 6  103 ? 134.924 101.443 77.315  1.00 76.99  ? 100 DG  I "C5'" 1 
ATOM   7961  C "C4'" . DG  I 6  103 ? 133.990 101.234 78.469  1.00 68.45  ? 100 DG  I "C4'" 1 
ATOM   7962  O "O4'" . DG  I 6  103 ? 132.664 100.936 77.980  1.00 66.02  ? 100 DG  I "O4'" 1 
ATOM   7963  C "C3'" . DG  I 6  103 ? 134.322 100.101 79.409  1.00 68.21  ? 100 DG  I "C3'" 1 
ATOM   7964  O "O3'" . DG  I 6  103 ? 133.723 100.447 80.666  1.00 66.59  ? 100 DG  I "O3'" 1 
ATOM   7965  C "C2'" . DG  I 6  103 ? 133.653 98.929  78.715  1.00 64.84  ? 100 DG  I "C2'" 1 
ATOM   7966  C "C1'" . DG  I 6  103 ? 132.391 99.550  78.122  1.00 61.68  ? 100 DG  I "C1'" 1 
ATOM   7967  N N9    . DG  I 6  103 ? 131.940 99.037  76.820  1.00 61.19  ? 100 DG  I N9    1 
ATOM   7968  C C8    . DG  I 6  103 ? 132.689 98.482  75.817  1.00 64.94  ? 100 DG  I C8    1 
ATOM   7969  N N7    . DG  I 6  103 ? 131.989 98.124  74.783  1.00 61.04  ? 100 DG  I N7    1 
ATOM   7970  C C5    . DG  I 6  103 ? 130.708 98.457  75.113  1.00 54.90  ? 100 DG  I C5    1 
ATOM   7971  C C6    . DG  I 6  103 ? 129.531 98.298  74.370  1.00 58.21  ? 100 DG  I C6    1 
ATOM   7972  O O6    . DG  I 6  103 ? 129.402 97.821  73.242  1.00 59.15  ? 100 DG  I O6    1 
ATOM   7973  N N1    . DG  I 6  103 ? 128.432 98.762  75.056  1.00 58.08  ? 100 DG  I N1    1 
ATOM   7974  C C2    . DG  I 6  103 ? 128.471 99.308  76.302  1.00 56.71  ? 100 DG  I C2    1 
ATOM   7975  N N2    . DG  I 6  103 ? 127.291 99.702  76.807  1.00 57.90  ? 100 DG  I N2    1 
ATOM   7976  N N3    . DG  I 6  103 ? 129.574 99.462  77.008  1.00 54.11  ? 100 DG  I N3    1 
ATOM   7977  C C4    . DG  I 6  103 ? 130.650 99.016  76.356  1.00 52.70  ? 100 DG  I C4    1 
ATOM   7978  P P     . DG  I 6  104 ? 133.864 99.625  82.044  1.00 66.15  ? 101 DG  I P     1 
ATOM   7979  O OP1   . DG  I 6  104 ? 134.267 100.586 83.096  1.00 65.24  ? 101 DG  I OP1   1 
ATOM   7980  O OP2   . DG  I 6  104 ? 134.686 98.412  81.812  1.00 67.70  ? 101 DG  I OP2   1 
ATOM   7981  O "O5'" . DG  I 6  104 ? 132.365 99.161  82.300  1.00 52.67  ? 101 DG  I "O5'" 1 
ATOM   7982  C "C5'" . DG  I 6  104 ? 131.297 100.113 82.188  1.00 49.62  ? 101 DG  I "C5'" 1 
ATOM   7983  C "C4'" . DG  I 6  104 ? 129.955 99.443  82.089  1.00 38.89  ? 101 DG  I "C4'" 1 
ATOM   7984  O "O4'" . DG  I 6  104 ? 129.755 98.848  80.787  1.00 47.12  ? 101 DG  I "O4'" 1 
ATOM   7985  C "C3'" . DG  I 6  104 ? 129.687 98.348  83.082  1.00 29.50  ? 101 DG  I "C3'" 1 
ATOM   7986  O "O3'" . DG  I 6  104 ? 128.307 98.447  83.404  1.00 23.55  ? 101 DG  I "O3'" 1 
ATOM   7987  C "C2'" . DG  I 6  104 ? 129.989 97.107  82.276  1.00 40.19  ? 101 DG  I "C2'" 1 
ATOM   7988  C "C1'" . DG  I 6  104 ? 129.421 97.480  80.926  1.00 41.10  ? 101 DG  I "C1'" 1 
ATOM   7989  N N9    . DG  I 6  104 ? 129.973 96.771  79.771  1.00 46.51  ? 101 DG  I N9    1 
ATOM   7990  C C8    . DG  I 6  104 ? 131.260 96.347  79.606  1.00 50.37  ? 101 DG  I C8    1 
ATOM   7991  N N7    . DG  I 6  104 ? 131.469 95.745  78.477  1.00 51.90  ? 101 DG  I N7    1 
ATOM   7992  C C5    . DG  I 6  104 ? 130.249 95.772  77.854  1.00 49.84  ? 101 DG  I C5    1 
ATOM   7993  C C6    . DG  I 6  104 ? 129.890 95.262  76.600  1.00 53.87  ? 101 DG  I C6    1 
ATOM   7994  O O6    . DG  I 6  104 ? 130.620 94.678  75.789  1.00 59.85  ? 101 DG  I O6    1 
ATOM   7995  N N1    . DG  I 6  104 ? 128.559 95.485  76.325  1.00 54.89  ? 101 DG  I N1    1 
ATOM   7996  C C2    . DG  I 6  104 ? 127.692 96.120  77.159  1.00 51.58  ? 101 DG  I C2    1 
ATOM   7997  N N2    . DG  I 6  104 ? 126.432 96.244  76.720  1.00 55.31  ? 101 DG  I N2    1 
ATOM   7998  N N3    . DG  I 6  104 ? 128.023 96.602  78.341  1.00 47.76  ? 101 DG  I N3    1 
ATOM   7999  C C4    . DG  I 6  104 ? 129.313 96.394  78.626  1.00 46.04  ? 101 DG  I C4    1 
ATOM   8000  P P     . DG  I 6  105 ? 127.681 97.724  84.669  1.00 24.94  ? 102 DG  I P     1 
ATOM   8001  O OP1   . DG  I 6  105 ? 127.339 98.742  85.685  1.00 32.43  ? 102 DG  I OP1   1 
ATOM   8002  O OP2   . DG  I 6  105 ? 128.581 96.624  85.046  1.00 34.18  ? 102 DG  I OP2   1 
ATOM   8003  O "O5'" . DG  I 6  105 ? 126.354 97.122  84.095  1.00 29.08  ? 102 DG  I "O5'" 1 
ATOM   8004  C "C5'" . DG  I 6  105 ? 125.392 97.994  83.511  1.00 31.50  ? 102 DG  I "C5'" 1 
ATOM   8005  C "C4'" . DG  I 6  105 ? 124.320 97.172  82.858  1.00 48.09  ? 102 DG  I "C4'" 1 
ATOM   8006  O "O4'" . DG  I 6  105 ? 124.843 96.537  81.666  1.00 46.89  ? 102 DG  I "O4'" 1 
ATOM   8007  C "C3'" . DG  I 6  105 ? 123.760 96.063  83.725  1.00 51.31  ? 102 DG  I "C3'" 1 
ATOM   8008  O "O3'" . DG  I 6  105 ? 122.344 96.034  83.520  1.00 58.85  ? 102 DG  I "O3'" 1 
ATOM   8009  C "C2'" . DG  I 6  105 ? 124.475 94.820  83.216  1.00 51.67  ? 102 DG  I "C2'" 1 
ATOM   8010  C "C1'" . DG  I 6  105 ? 124.742 95.129  81.762  1.00 48.79  ? 102 DG  I "C1'" 1 
ATOM   8011  N N9    . DG  I 6  105 ? 125.968 94.551  81.227  1.00 44.55  ? 102 DG  I N9    1 
ATOM   8012  C C8    . DG  I 6  105 ? 127.203 94.486  81.809  1.00 44.29  ? 102 DG  I C8    1 
ATOM   8013  N N7    . DG  I 6  105 ? 128.099 93.902  81.062  1.00 47.85  ? 102 DG  I N7    1 
ATOM   8014  C C5    . DG  I 6  105 ? 127.411 93.566  79.925  1.00 50.07  ? 102 DG  I C5    1 
ATOM   8015  C C6    . DG  I 6  105 ? 127.857 92.913  78.762  1.00 52.85  ? 102 DG  I C6    1 
ATOM   8016  O O6    . DG  I 6  105 ? 128.992 92.494  78.509  1.00 53.01  ? 102 DG  I O6    1 
ATOM   8017  N N1    . DG  I 6  105 ? 126.831 92.768  77.848  1.00 56.10  ? 102 DG  I N1    1 
ATOM   8018  C C2    . DG  I 6  105 ? 125.547 93.199  78.035  1.00 55.64  ? 102 DG  I C2    1 
ATOM   8019  N N2    . DG  I 6  105 ? 124.683 92.973  77.037  1.00 60.71  ? 102 DG  I N2    1 
ATOM   8020  N N3    . DG  I 6  105 ? 125.125 93.810  79.119  1.00 53.18  ? 102 DG  I N3    1 
ATOM   8021  C C4    . DG  I 6  105 ? 126.103 93.958  80.013  1.00 50.03  ? 102 DG  I C4    1 
ATOM   8022  P P     . DA  I 6  106 ? 121.348 95.123  84.389  1.00 72.57  ? 103 DA  I P     1 
ATOM   8023  O OP1   . DA  I 6  106 ? 120.067 95.852  84.535  1.00 77.21  ? 103 DA  I OP1   1 
ATOM   8024  O OP2   . DA  I 6  106 ? 122.063 94.627  85.592  1.00 72.85  ? 103 DA  I OP2   1 
ATOM   8025  O "O5'" . DA  I 6  106 ? 121.113 93.887  83.418  1.00 67.27  ? 103 DA  I "O5'" 1 
ATOM   8026  C "C5'" . DA  I 6  106 ? 120.507 94.125  82.138  1.00 65.28  ? 103 DA  I "C5'" 1 
ATOM   8027  C "C4'" . DA  I 6  106 ? 120.479 92.877  81.297  1.00 65.04  ? 103 DA  I "C4'" 1 
ATOM   8028  O "O4'" . DA  I 6  106 ? 121.806 92.598  80.799  1.00 60.14  ? 103 DA  I "O4'" 1 
ATOM   8029  C "C3'" . DA  I 6  106 ? 119.991 91.612  81.995  1.00 66.67  ? 103 DA  I "C3'" 1 
ATOM   8030  O "O3'" . DA  I 6  106 ? 118.931 91.042  81.200  1.00 71.15  ? 103 DA  I "O3'" 1 
ATOM   8031  C "C2'" . DA  I 6  106 ? 121.241 90.744  82.034  1.00 63.39  ? 103 DA  I "C2'" 1 
ATOM   8032  C "C1'" . DA  I 6  106 ? 122.035 91.215  80.840  1.00 58.51  ? 103 DA  I "C1'" 1 
ATOM   8033  N N9    . DA  I 6  106 ? 123.467 90.977  80.966  1.00 57.50  ? 103 DA  I N9    1 
ATOM   8034  C C8    . DA  I 6  106 ? 124.258 91.248  82.040  1.00 56.64  ? 103 DA  I C8    1 
ATOM   8035  N N7    . DA  I 6  106 ? 125.510 90.923  81.863  1.00 57.04  ? 103 DA  I N7    1 
ATOM   8036  C C5    . DA  I 6  106 ? 125.546 90.405  80.592  1.00 56.84  ? 103 DA  I C5    1 
ATOM   8037  C C6    . DA  I 6  106 ? 126.579 89.886  79.824  1.00 60.38  ? 103 DA  I C6    1 
ATOM   8038  N N6    . DA  I 6  106 ? 127.831 89.802  80.254  1.00 59.08  ? 103 DA  I N6    1 
ATOM   8039  N N1    . DA  I 6  106 ? 126.291 89.449  78.593  1.00 62.71  ? 103 DA  I N1    1 
ATOM   8040  C C2    . DA  I 6  106 ? 125.035 89.537  78.173  1.00 61.25  ? 103 DA  I C2    1 
ATOM   8041  N N3    . DA  I 6  106 ? 123.978 90.010  78.812  1.00 59.07  ? 103 DA  I N3    1 
ATOM   8042  C C4    . DA  I 6  106 ? 124.302 90.431  80.028  1.00 58.02  ? 103 DA  I C4    1 
ATOM   8043  P P     . DT  I 6  107 ? 118.066 89.738  81.612  1.00 81.53  ? 104 DT  I P     1 
ATOM   8044  O OP1   . DT  I 6  107 ? 116.723 89.870  81.001  1.00 75.35  ? 104 DT  I OP1   1 
ATOM   8045  O OP2   . DT  I 6  107 ? 118.202 89.498  83.069  1.00 72.80  ? 104 DT  I OP2   1 
ATOM   8046  O "O5'" . DT  I 6  107 ? 118.841 88.584  80.840  1.00 66.31  ? 104 DT  I "O5'" 1 
ATOM   8047  C "C5'" . DT  I 6  107 ? 118.975 88.685  79.416  1.00 69.63  ? 104 DT  I "C5'" 1 
ATOM   8048  C "C4'" . DT  I 6  107 ? 119.684 87.490  78.844  1.00 71.83  ? 104 DT  I "C4'" 1 
ATOM   8049  O "O4'" . DT  I 6  107 ? 121.103 87.660  79.008  1.00 67.70  ? 104 DT  I "O4'" 1 
ATOM   8050  C "C3'" . DT  I 6  107 ? 119.320 86.142  79.453  1.00 77.32  ? 104 DT  I "C3'" 1 
ATOM   8051  O "O3'" . DT  I 6  107 ? 118.743 85.335  78.407  1.00 82.95  ? 104 DT  I "O3'" 1 
ATOM   8052  C "C2'" . DT  I 6  107 ? 120.653 85.589  79.947  1.00 72.49  ? 104 DT  I "C2'" 1 
ATOM   8053  C "C1'" . DT  I 6  107 ? 121.691 86.402  79.209  1.00 68.88  ? 104 DT  I "C1'" 1 
ATOM   8054  N N1    . DT  I 6  107 ? 122.943 86.613  79.948  1.00 65.54  ? 104 DT  I N1    1 
ATOM   8055  C C2    . DT  I 6  107 ? 124.134 86.229  79.382  1.00 66.99  ? 104 DT  I C2    1 
ATOM   8056  O O2    . DT  I 6  107 ? 124.211 85.717  78.283  1.00 67.15  ? 104 DT  I O2    1 
ATOM   8057  N N3    . DT  I 6  107 ? 125.237 86.468  80.153  1.00 65.29  ? 104 DT  I N3    1 
ATOM   8058  C C4    . DT  I 6  107 ? 125.261 87.035  81.398  1.00 65.29  ? 104 DT  I C4    1 
ATOM   8059  O O4    . DT  I 6  107 ? 126.320 87.206  82.001  1.00 67.08  ? 104 DT  I O4    1 
ATOM   8060  C C5    . DT  I 6  107 ? 123.984 87.404  81.919  1.00 63.02  ? 104 DT  I C5    1 
ATOM   8061  C C7    . DT  I 6  107 ? 123.929 88.018  83.266  1.00 66.67  ? 104 DT  I C7    1 
ATOM   8062  C C6    . DT  I 6  107 ? 122.906 87.180  81.184  1.00 63.13  ? 104 DT  I C6    1 
ATOM   8063  P P     . DT  I 6  108 ? 118.024 83.907  78.654  1.00 97.28  ? 105 DT  I P     1 
ATOM   8064  O OP1   . DT  I 6  108 ? 117.053 83.678  77.559  1.00 86.92  ? 105 DT  I OP1   1 
ATOM   8065  O OP2   . DT  I 6  108 ? 117.577 83.826  80.068  1.00 84.38  ? 105 DT  I OP2   1 
ATOM   8066  O "O5'" . DT  I 6  108 ? 119.237 82.889  78.469  1.00 85.18  ? 105 DT  I "O5'" 1 
ATOM   8067  C "C5'" . DT  I 6  108 ? 120.006 82.896  77.253  1.00 82.57  ? 105 DT  I "C5'" 1 
ATOM   8068  C "C4'" . DT  I 6  108 ? 121.180 81.951  77.346  1.00 82.07  ? 105 DT  I "C4'" 1 
ATOM   8069  O "O4'" . DT  I 6  108 ? 122.263 82.588  78.053  1.00 76.34  ? 105 DT  I "O4'" 1 
ATOM   8070  C "C3'" . DT  I 6  108 ? 120.915 80.622  78.051  1.00 86.01  ? 105 DT  I "C3'" 1 
ATOM   8071  O "O3'" . DT  I 6  108 ? 121.036 79.575  77.067  1.00 87.94  ? 105 DT  I "O3'" 1 
ATOM   8072  C "C2'" . DT  I 6  108 ? 121.998 80.538  79.127  1.00 80.83  ? 105 DT  I "C2'" 1 
ATOM   8073  C "C1'" . DT  I 6  108 ? 122.995 81.607  78.742  1.00 76.82  ? 105 DT  I "C1'" 1 
ATOM   8074  N N1    . DT  I 6  108 ? 123.659 82.250  79.883  1.00 73.59  ? 105 DT  I N1    1 
ATOM   8075  C C2    . DT  I 6  108 ? 125.032 82.246  79.942  1.00 74.04  ? 105 DT  I C2    1 
ATOM   8076  O O2    . DT  I 6  108 ? 125.725 81.727  79.082  1.00 73.42  ? 105 DT  I O2    1 
ATOM   8077  N N3    . DT  I 6  108 ? 125.555 82.870  81.038  1.00 70.29  ? 105 DT  I N3    1 
ATOM   8078  C C4    . DT  I 6  108 ? 124.850 83.478  82.051  1.00 70.35  ? 105 DT  I C4    1 
ATOM   8079  O O4    . DT  I 6  108 ? 125.424 84.010  82.994  1.00 71.14  ? 105 DT  I O4    1 
ATOM   8080  C C5    . DT  I 6  108 ? 123.426 83.437  81.918  1.00 69.28  ? 105 DT  I C5    1 
ATOM   8081  C C7    . DT  I 6  108 ? 122.594 84.065  82.974  1.00 73.08  ? 105 DT  I C7    1 
ATOM   8082  C C6    . DT  I 6  108 ? 122.908 82.836  80.860  1.00 71.15  ? 105 DT  I C6    1 
ATOM   8083  P P     . DA  I 6  109 ? 120.680 78.022  77.347  1.00 96.17  ? 106 DA  I P     1 
ATOM   8084  O OP1   . DA  I 6  109 ? 120.316 77.389  76.055  1.00 92.04  ? 106 DA  I OP1   1 
ATOM   8085  O OP2   . DA  I 6  109 ? 119.748 77.939  78.503  1.00 87.31  ? 106 DA  I OP2   1 
ATOM   8086  O "O5'" . DA  I 6  109 ? 122.086 77.426  77.810  1.00 88.19  ? 106 DA  I "O5'" 1 
ATOM   8087  C "C5'" . DA  I 6  109 ? 123.287 77.664  77.045  1.00 88.63  ? 106 DA  I "C5'" 1 
ATOM   8088  C "C4'" . DA  I 6  109 ? 124.480 77.035  77.720  1.00 86.24  ? 106 DA  I "C4'" 1 
ATOM   8089  O "O4'" . DA  I 6  109 ? 124.997 77.914  78.749  1.00 83.11  ? 106 DA  I "O4'" 1 
ATOM   8090  C "C3'" . DA  I 6  109 ? 124.197 75.713  78.417  1.00 88.26  ? 106 DA  I "C3'" 1 
ATOM   8091  O "O3'" . DA  I 6  109 ? 125.372 74.900  78.291  1.00 93.15  ? 106 DA  I "O3'" 1 
ATOM   8092  C "C2'" . DA  I 6  109 ? 123.978 76.153  79.854  1.00 85.56  ? 106 DA  I "C2'" 1 
ATOM   8093  C "C1'" . DA  I 6  109 ? 125.056 77.210  79.978  1.00 83.86  ? 106 DA  I "C1'" 1 
ATOM   8094  N N9    . DA  I 6  109 ? 124.890 78.181  81.061  1.00 83.14  ? 106 DA  I N9    1 
ATOM   8095  C C8    . DA  I 6  109 ? 123.738 78.713  81.574  1.00 78.91  ? 106 DA  I C8    1 
ATOM   8096  N N7    . DA  I 6  109 ? 123.935 79.563  82.547  1.00 75.69  ? 106 DA  I N7    1 
ATOM   8097  C C5    . DA  I 6  109 ? 125.307 79.595  82.684  1.00 75.37  ? 106 DA  I C5    1 
ATOM   8098  C C6    . DA  I 6  109 ? 126.147 80.301  83.543  1.00 74.34  ? 106 DA  I C6    1 
ATOM   8099  N N6    . DA  I 6  109 ? 125.697 81.143  84.458  1.00 75.62  ? 106 DA  I N6    1 
ATOM   8100  N N1    . DA  I 6  109 ? 127.475 80.112  83.430  1.00 72.91  ? 106 DA  I N1    1 
ATOM   8101  C C2    . DA  I 6  109 ? 127.908 79.259  82.503  1.00 75.06  ? 106 DA  I C2    1 
ATOM   8102  N N3    . DA  I 6  109 ? 127.214 78.537  81.638  1.00 78.81  ? 106 DA  I N3    1 
ATOM   8103  C C4    . DA  I 6  109 ? 125.905 78.751  81.780  1.00 79.44  ? 106 DA  I C4    1 
ATOM   8104  P P     . DC  I 6  110 ? 125.333 73.292  78.253  1.00 104.40 ? 107 DC  I P     1 
ATOM   8105  O OP1   . DC  I 6  110 ? 125.531 72.843  76.854  1.00 103.40 ? 107 DC  I OP1   1 
ATOM   8106  O OP2   . DC  I 6  110 ? 124.178 72.812  79.057  1.00 95.19  ? 107 DC  I OP2   1 
ATOM   8107  O "O5'" . DC  I 6  110 ? 126.591 72.876  79.127  1.00 96.23  ? 107 DC  I "O5'" 1 
ATOM   8108  C "C5'" . DC  I 6  110 ? 126.583 73.200  80.521  1.00 91.37  ? 107 DC  I "C5'" 1 
ATOM   8109  C "C4'" . DC  I 6  110 ? 127.973 73.414  81.051  1.00 93.00  ? 107 DC  I "C4'" 1 
ATOM   8110  O "O4'" . DC  I 6  110 ? 128.013 74.713  81.691  1.00 87.80  ? 107 DC  I "O4'" 1 
ATOM   8111  C "C3'" . DC  I 6  110 ? 128.384 72.394  82.105  1.00 94.82  ? 107 DC  I "C3'" 1 
ATOM   8112  O "O3'" . DC  I 6  110 ? 129.779 72.064  81.971  1.00 101.61 ? 107 DC  I "O3'" 1 
ATOM   8113  C "C2'" . DC  I 6  110 ? 128.088 73.109  83.412  1.00 91.76  ? 107 DC  I "C2'" 1 
ATOM   8114  C "C1'" . DC  I 6  110 ? 128.210 74.584  83.087  1.00 89.09  ? 107 DC  I "C1'" 1 
ATOM   8115  N N1    . DC  I 6  110 ? 127.221 75.445  83.778  1.00 83.03  ? 107 DC  I N1    1 
ATOM   8116  C C2    . DC  I 6  110 ? 127.655 76.404  84.697  1.00 79.20  ? 107 DC  I C2    1 
ATOM   8117  O O2    . DC  I 6  110 ? 128.856 76.535  84.931  1.00 78.12  ? 107 DC  I O2    1 
ATOM   8118  N N3    . DC  I 6  110 ? 126.761 77.186  85.325  1.00 75.34  ? 107 DC  I N3    1 
ATOM   8119  C C4    . DC  I 6  110 ? 125.466 77.049  85.074  1.00 75.99  ? 107 DC  I C4    1 
ATOM   8120  N N4    . DC  I 6  110 ? 124.621 77.851  85.727  1.00 73.96  ? 107 DC  I N4    1 
ATOM   8121  C C5    . DC  I 6  110 ? 124.987 76.089  84.150  1.00 77.51  ? 107 DC  I C5    1 
ATOM   8122  C C6    . DC  I 6  110 ? 125.886 75.320  83.534  1.00 81.85  ? 107 DC  I C6    1 
ATOM   8123  P P     . DT  I 6  111 ? 130.421 70.736  82.641  1.00 97.40  ? 108 DT  I P     1 
ATOM   8124  O OP1   . DT  I 6  111 ? 131.657 70.385  81.902  1.00 104.33 ? 108 DT  I OP1   1 
ATOM   8125  O OP2   . DT  I 6  111 ? 129.346 69.724  82.808  1.00 104.59 ? 108 DT  I OP2   1 
ATOM   8126  O "O5'" . DT  I 6  111 ? 130.832 71.240  84.091  1.00 98.88  ? 108 DT  I "O5'" 1 
ATOM   8127  C "C5'" . DT  I 6  111 ? 131.843 72.248  84.227  1.00 97.57  ? 108 DT  I "C5'" 1 
ATOM   8128  C "C4'" . DT  I 6  111 ? 131.967 72.690  85.661  1.00 92.86  ? 108 DT  I "C4'" 1 
ATOM   8129  O "O4'" . DT  I 6  111 ? 130.889 73.583  85.984  1.00 85.90  ? 108 DT  I "O4'" 1 
ATOM   8130  C "C3'" . DT  I 6  111 ? 131.935 71.581  86.702  1.00 93.21  ? 108 DT  I "C3'" 1 
ATOM   8131  O "O3'" . DT  I 6  111 ? 133.284 71.428  87.182  1.00 90.77  ? 108 DT  I "O3'" 1 
ATOM   8132  C "C2'" . DT  I 6  111 ? 130.969 72.095  87.773  1.00 85.47  ? 108 DT  I "C2'" 1 
ATOM   8133  C "C1'" . DT  I 6  111 ? 130.627 73.503  87.360  1.00 82.99  ? 108 DT  I "C1'" 1 
ATOM   8134  N N1    . DT  I 6  111 ? 129.222 73.895  87.541  1.00 81.19  ? 108 DT  I N1    1 
ATOM   8135  C C2    . DT  I 6  111 ? 128.945 74.979  88.331  1.00 79.56  ? 108 DT  I C2    1 
ATOM   8136  O O2    . DT  I 6  111 ? 129.826 75.619  88.885  1.00 76.88  ? 108 DT  I O2    1 
ATOM   8137  N N3    . DT  I 6  111 ? 127.612 75.278  88.442  1.00 75.65  ? 108 DT  I N3    1 
ATOM   8138  C C4    . DT  I 6  111 ? 126.565 74.606  87.851  1.00 71.13  ? 108 DT  I C4    1 
ATOM   8139  O O4    . DT  I 6  111 ? 125.399 74.955  88.012  1.00 68.07  ? 108 DT  I O4    1 
ATOM   8140  C C5    . DT  I 6  111 ? 126.939 73.490  87.048  1.00 73.22  ? 108 DT  I C5    1 
ATOM   8141  C C7    . DT  I 6  111 ? 125.858 72.718  86.391  1.00 78.28  ? 108 DT  I C7    1 
ATOM   8142  C C6    . DT  I 6  111 ? 128.226 73.191  86.932  1.00 80.18  ? 108 DT  I C6    1 
ATOM   8143  P P     . DC  I 6  112 ? 133.748 70.343  88.282  1.00 88.55  ? 109 DC  I P     1 
ATOM   8144  O OP1   . DC  I 6  112 ? 135.184 70.033  88.073  1.00 96.51  ? 109 DC  I OP1   1 
ATOM   8145  O OP2   . DC  I 6  112 ? 132.735 69.257  88.377  1.00 96.23  ? 109 DC  I OP2   1 
ATOM   8146  O "O5'" . DC  I 6  112 ? 133.602 71.137  89.655  1.00 93.52  ? 109 DC  I "O5'" 1 
ATOM   8147  C "C5'" . DC  I 6  112 ? 134.176 72.453  89.782  1.00 95.59  ? 109 DC  I "C5'" 1 
ATOM   8148  C "C4'" . DC  I 6  112 ? 133.881 73.046  91.136  1.00 95.61  ? 109 DC  I "C4'" 1 
ATOM   8149  O "O4'" . DC  I 6  112 ? 132.497 73.468  91.208  1.00 85.99  ? 109 DC  I "O4'" 1 
ATOM   8150  C "C3'" . DC  I 6  112 ? 134.121 72.113  92.312  1.00 94.20  ? 109 DC  I "C3'" 1 
ATOM   8151  O "O3'" . DC  I 6  112 ? 134.818 72.887  93.304  1.00 95.49  ? 109 DC  I "O3'" 1 
ATOM   8152  C "C2'" . DC  I 6  112 ? 132.709 71.668  92.683  1.00 87.60  ? 109 DC  I "C2'" 1 
ATOM   8153  C "C1'" . DC  I 6  112 ? 131.842 72.862  92.305  1.00 83.83  ? 109 DC  I "C1'" 1 
ATOM   8154  N N1    . DC  I 6  112 ? 130.453 72.620  91.854  1.00 79.05  ? 109 DC  I N1    1 
ATOM   8155  C C2    . DC  I 6  112 ? 129.450 73.511  92.243  1.00 76.21  ? 109 DC  I C2    1 
ATOM   8156  O O2    . DC  I 6  112 ? 129.729 74.473  92.957  1.00 76.54  ? 109 DC  I O2    1 
ATOM   8157  N N3    . DC  I 6  112 ? 128.181 73.326  91.851  1.00 76.41  ? 109 DC  I N3    1 
ATOM   8158  C C4    . DC  I 6  112 ? 127.879 72.292  91.084  1.00 74.63  ? 109 DC  I C4    1 
ATOM   8159  N N4    . DC  I 6  112 ? 126.616 72.131  90.708  1.00 74.71  ? 109 DC  I N4    1 
ATOM   8160  C C5    . DC  I 6  112 ? 128.861 71.367  90.668  1.00 79.02  ? 109 DC  I C5    1 
ATOM   8161  C C6    . DC  I 6  112 ? 130.119 71.563  91.067  1.00 79.57  ? 109 DC  I C6    1 
ATOM   8162  P P     . DC  I 6  113 ? 135.227 72.414  94.792  1.00 94.59  ? 110 DC  I P     1 
ATOM   8163  O OP1   . DC  I 6  113 ? 136.638 72.792  95.046  1.00 95.85  ? 110 DC  I OP1   1 
ATOM   8164  O OP2   . DC  I 6  113 ? 134.748 71.028  95.038  1.00 92.23  ? 110 DC  I OP2   1 
ATOM   8165  O "O5'" . DC  I 6  113 ? 134.289 73.336  95.692  1.00 94.23  ? 110 DC  I "O5'" 1 
ATOM   8166  C "C5'" . DC  I 6  113 ? 134.046 74.700  95.282  1.00 91.78  ? 110 DC  I "C5'" 1 
ATOM   8167  C "C4'" . DC  I 6  113 ? 133.226 75.453  96.291  1.00 84.13  ? 110 DC  I "C4'" 1 
ATOM   8168  O "O4'" . DC  I 6  113 ? 131.823 75.212  96.060  1.00 74.41  ? 110 DC  I "O4'" 1 
ATOM   8169  C "C3'" . DC  I 6  113 ? 133.485 75.104  97.743  1.00 84.08  ? 110 DC  I "C3'" 1 
ATOM   8170  O "O3'" . DC  I 6  113 ? 133.305 76.323  98.496  1.00 84.04  ? 110 DC  I "O3'" 1 
ATOM   8171  C "C2'" . DC  I 6  113 ? 132.438 74.028  97.996  1.00 79.82  ? 110 DC  I "C2'" 1 
ATOM   8172  C "C1'" . DC  I 6  113 ? 131.267 74.435  97.103  1.00 69.22  ? 110 DC  I "C1'" 1 
ATOM   8173  N N1    . DC  I 6  113 ? 130.478 73.371  96.443  1.00 69.93  ? 110 DC  I N1    1 
ATOM   8174  C C2    . DC  I 6  113 ? 129.090 73.509  96.326  1.00 71.33  ? 110 DC  I C2    1 
ATOM   8175  O O2    . DC  I 6  113 ? 128.522 74.501  96.769  1.00 71.58  ? 110 DC  I O2    1 
ATOM   8176  N N3    . DC  I 6  113 ? 128.352 72.562  95.730  1.00 73.35  ? 110 DC  I N3    1 
ATOM   8177  C C4    . DC  I 6  113 ? 128.951 71.488  95.249  1.00 74.65  ? 110 DC  I C4    1 
ATOM   8178  N N4    . DC  I 6  113 ? 128.220 70.553  94.660  1.00 79.72  ? 110 DC  I N4    1 
ATOM   8179  C C5    . DC  I 6  113 ? 130.343 71.308  95.345  1.00 77.10  ? 110 DC  I C5    1 
ATOM   8180  C C6    . DC  I 6  113 ? 131.062 72.255  95.939  1.00 77.35  ? 110 DC  I C6    1 
ATOM   8181  P P     . DC  I 6  114 ? 133.381 76.496  100.102 1.00 84.48  ? 111 DC  I P     1 
ATOM   8182  O OP1   . DC  I 6  114 ? 134.098 77.755  100.398 1.00 79.51  ? 111 DC  I OP1   1 
ATOM   8183  O OP2   . DC  I 6  114 ? 133.788 75.214  100.733 1.00 76.80  ? 111 DC  I OP2   1 
ATOM   8184  O "O5'" . DC  I 6  114 ? 131.848 76.681  100.501 1.00 72.61  ? 111 DC  I "O5'" 1 
ATOM   8185  C "C5'" . DC  I 6  114 ? 131.032 77.585  99.728  1.00 71.22  ? 111 DC  I "C5'" 1 
ATOM   8186  C "C4'" . DC  I 6  114 ? 129.653 77.732  100.309 1.00 61.08  ? 111 DC  I "C4'" 1 
ATOM   8187  O "O4'" . DC  I 6  114 ? 128.791 76.682  99.817  1.00 61.35  ? 111 DC  I "O4'" 1 
ATOM   8188  C "C3'" . DC  I 6  114 ? 129.602 77.656  101.819 1.00 60.98  ? 111 DC  I "C3'" 1 
ATOM   8189  O "O3'" . DC  I 6  114 ? 128.608 78.576  102.296 1.00 55.39  ? 111 DC  I "O3'" 1 
ATOM   8190  C "C2'" . DC  I 6  114 ? 129.253 76.198  102.065 1.00 62.25  ? 111 DC  I "C2'" 1 
ATOM   8191  C "C1'" . DC  I 6  114 ? 128.403 75.815  100.867 1.00 59.79  ? 111 DC  I "C1'" 1 
ATOM   8192  N N1    . DC  I 6  114 ? 128.530 74.434  100.357 1.00 63.04  ? 111 DC  I N1    1 
ATOM   8193  C C2    . DC  I 6  114 ? 127.396 73.772  99.884  1.00 64.83  ? 111 DC  I C2    1 
ATOM   8194  O O2    . DC  I 6  114 ? 126.306 74.303  99.887  1.00 66.84  ? 111 DC  I O2    1 
ATOM   8195  N N3    . DC  I 6  114 ? 127.449 72.529  99.408  1.00 68.77  ? 111 DC  I N3    1 
ATOM   8196  C C4    . DC  I 6  114 ? 128.644 71.918  99.392  1.00 70.22  ? 111 DC  I C4    1 
ATOM   8197  N N4    . DC  I 6  114 ? 128.769 70.673  98.930  1.00 75.97  ? 111 DC  I N4    1 
ATOM   8198  C C5    . DC  I 6  114 ? 129.813 72.549  99.861  1.00 67.27  ? 111 DC  I C5    1 
ATOM   8199  C C6    . DC  I 6  114 ? 129.718 73.786  100.327 1.00 67.13  ? 111 DC  I C6    1 
ATOM   8200  P P     . DT  I 6  115 ? 128.302 78.771  103.855 1.00 42.23  ? 112 DT  I P     1 
ATOM   8201  O OP1   . DT  I 6  115 ? 128.179 80.215  104.196 1.00 47.13  ? 112 DT  I OP1   1 
ATOM   8202  O OP2   . DT  I 6  115 ? 129.244 77.935  104.631 1.00 49.58  ? 112 DT  I OP2   1 
ATOM   8203  O "O5'" . DT  I 6  115 ? 126.867 78.118  103.998 1.00 43.77  ? 112 DT  I "O5'" 1 
ATOM   8204  C "C5'" . DT  I 6  115 ? 125.792 78.582  103.169 1.00 41.46  ? 112 DT  I "C5'" 1 
ATOM   8205  C "C4'" . DT  I 6  115 ? 124.532 77.787  103.397 1.00 40.06  ? 112 DT  I "C4'" 1 
ATOM   8206  O "O4'" . DT  I 6  115 ? 124.685 76.473  102.811 1.00 47.53  ? 112 DT  I "O4'" 1 
ATOM   8207  C "C3'" . DT  I 6  115 ? 124.115 77.572  104.843 1.00 39.63  ? 112 DT  I "C3'" 1 
ATOM   8208  O "O3'" . DT  I 6  115 ? 122.686 77.582  104.915 1.00 40.15  ? 112 DT  I "O3'" 1 
ATOM   8209  C "C2'" . DT  I 6  115 ? 124.697 76.209  105.125 1.00 47.13  ? 112 DT  I "C2'" 1 
ATOM   8210  C "C1'" . DT  I 6  115 ? 124.489 75.490  103.800 1.00 48.41  ? 112 DT  I "C1'" 1 
ATOM   8211  N N1    . DT  I 6  115 ? 125.373 74.334  103.516 1.00 50.24  ? 112 DT  I N1    1 
ATOM   8212  C C2    . DT  I 6  115 ? 124.852 73.259  102.832 1.00 56.24  ? 112 DT  I C2    1 
ATOM   8213  O O2    . DT  I 6  115 ? 123.704 73.200  102.441 1.00 62.65  ? 112 DT  I O2    1 
ATOM   8214  N N3    . DT  I 6  115 ? 125.728 72.236  102.608 1.00 63.50  ? 112 DT  I N3    1 
ATOM   8215  C C4    . DT  I 6  115 ? 127.039 72.182  102.991 1.00 63.61  ? 112 DT  I C4    1 
ATOM   8216  O O4    . DT  I 6  115 ? 127.752 71.216  102.742 1.00 71.30  ? 112 DT  I O4    1 
ATOM   8217  C C5    . DT  I 6  115 ? 127.512 73.315  103.688 1.00 55.95  ? 112 DT  I C5    1 
ATOM   8218  C C7    . DT  I 6  115 ? 128.929 73.305  104.128 1.00 56.42  ? 112 DT  I C7    1 
ATOM   8219  C C6    . DT  I 6  115 ? 126.683 74.317  103.915 1.00 52.41  ? 112 DT  I C6    1 
ATOM   8220  P P     . DA  I 6  116 ? 121.855 77.527  106.293 1.00 38.68  ? 113 DA  I P     1 
ATOM   8221  O OP1   . DA  I 6  116 ? 120.999 78.741  106.322 1.00 39.51  ? 113 DA  I OP1   1 
ATOM   8222  O OP2   . DA  I 6  116 ? 122.755 77.231  107.431 1.00 43.08  ? 113 DA  I OP2   1 
ATOM   8223  O "O5'" . DA  I 6  116 ? 120.922 76.273  106.062 1.00 48.15  ? 113 DA  I "O5'" 1 
ATOM   8224  C "C5'" . DA  I 6  116 ? 119.879 76.351  105.085 1.00 48.38  ? 113 DA  I "C5'" 1 
ATOM   8225  C "C4'" . DA  I 6  116 ? 119.234 75.006  104.872 1.00 57.47  ? 113 DA  I "C4'" 1 
ATOM   8226  O "O4'" . DA  I 6  116 ? 120.228 74.036  104.486 1.00 57.07  ? 113 DA  I "O4'" 1 
ATOM   8227  C "C3'" . DA  I 6  116 ? 118.525 74.435  106.086 1.00 63.33  ? 113 DA  I "C3'" 1 
ATOM   8228  O "O3'" . DA  I 6  116 ? 117.300 73.814  105.664 1.00 67.82  ? 113 DA  I "O3'" 1 
ATOM   8229  C "C2'" . DA  I 6  116 ? 119.527 73.433  106.625 1.00 66.80  ? 113 DA  I "C2'" 1 
ATOM   8230  C "C1'" . DA  I 6  116 ? 120.238 72.955  105.389 1.00 62.56  ? 113 DA  I "C1'" 1 
ATOM   8231  N N9    . DA  I 6  116 ? 121.625 72.590  105.606 1.00 59.89  ? 113 DA  I N9    1 
ATOM   8232  C C8    . DA  I 6  116 ? 122.605 73.304  106.213 1.00 61.15  ? 113 DA  I C8    1 
ATOM   8233  N N7    . DA  I 6  116 ? 123.764 72.698  106.249 1.00 64.36  ? 113 DA  I N7    1 
ATOM   8234  C C5    . DA  I 6  116 ? 123.521 71.515  105.618 1.00 64.52  ? 113 DA  I C5    1 
ATOM   8235  C C6    . DA  I 6  116 ? 124.334 70.438  105.333 1.00 75.48  ? 113 DA  I C6    1 
ATOM   8236  N N6    . DA  I 6  116 ? 125.610 70.405  105.672 1.00 76.27  ? 113 DA  I N6    1 
ATOM   8237  N N1    . DA  I 6  116 ? 123.792 69.395  104.688 1.00 80.76  ? 113 DA  I N1    1 
ATOM   8238  C C2    . DA  I 6  116 ? 122.500 69.471  104.367 1.00 84.46  ? 113 DA  I C2    1 
ATOM   8239  N N3    . DA  I 6  116 ? 121.637 70.440  104.586 1.00 77.66  ? 113 DA  I N3    1 
ATOM   8240  C C4    . DA  I 6  116 ? 122.216 71.439  105.222 1.00 66.82  ? 113 DA  I C4    1 
ATOM   8241  P P     . DG  I 6  117 ? 116.133 73.405  106.697 1.00 71.80  ? 114 DG  I P     1 
ATOM   8242  O OP1   . DG  I 6  117 ? 114.858 73.333  105.952 1.00 78.14  ? 114 DG  I OP1   1 
ATOM   8243  O OP2   . DG  I 6  117 ? 116.236 74.264  107.898 1.00 76.05  ? 114 DG  I OP2   1 
ATOM   8244  O "O5'" . DG  I 6  117 ? 116.554 71.930  107.116 1.00 82.47  ? 114 DG  I "O5'" 1 
ATOM   8245  C "C5'" . DG  I 6  117 ? 116.587 70.891  106.124 1.00 86.65  ? 114 DG  I "C5'" 1 
ATOM   8246  C "C4'" . DG  I 6  117 ? 117.071 69.590  106.711 1.00 89.77  ? 114 DG  I "C4'" 1 
ATOM   8247  O "O4'" . DG  I 6  117 ? 118.513 69.563  106.665 1.00 86.13  ? 114 DG  I "O4'" 1 
ATOM   8248  C "C3'" . DG  I 6  117 ? 116.666 69.320  108.161 1.00 101.37 ? 114 DG  I "C3'" 1 
ATOM   8249  O "O3'" . DG  I 6  117 ? 115.864 68.122  108.191 1.00 112.78 ? 114 DG  I "O3'" 1 
ATOM   8250  C "C2'" . DG  I 6  117 ? 117.992 69.159  108.887 1.00 101.60 ? 114 DG  I "C2'" 1 
ATOM   8251  C "C1'" . DG  I 6  117 ? 118.981 68.863  107.789 1.00 92.17  ? 114 DG  I "C1'" 1 
ATOM   8252  N N9    . DG  I 6  117 ? 120.319 69.321  108.107 1.00 89.64  ? 114 DG  I N9    1 
ATOM   8253  C C8    . DG  I 6  117 ? 120.690 70.542  108.590 1.00 85.00  ? 114 DG  I C8    1 
ATOM   8254  N N7    . DG  I 6  117 ? 121.966 70.655  108.781 1.00 86.47  ? 114 DG  I N7    1 
ATOM   8255  C C5    . DG  I 6  117 ? 122.465 69.434  108.401 1.00 91.51  ? 114 DG  I C5    1 
ATOM   8256  C C6    . DG  I 6  117 ? 123.790 68.971  108.393 1.00 95.64  ? 114 DG  I C6    1 
ATOM   8257  O O6    . DG  I 6  117 ? 124.805 69.588  108.730 1.00 97.66  ? 114 DG  I O6    1 
ATOM   8258  N N1    . DG  I 6  117 ? 123.864 67.669  107.934 1.00 98.12  ? 114 DG  I N1    1 
ATOM   8259  C C2    . DG  I 6  117 ? 122.789 66.922  107.540 1.00 103.08 ? 114 DG  I C2    1 
ATOM   8260  N N2    . DG  I 6  117 ? 123.041 65.678  107.122 1.00 105.34 ? 114 DG  I N2    1 
ATOM   8261  N N3    . DG  I 6  117 ? 121.544 67.351  107.546 1.00 97.29  ? 114 DG  I N3    1 
ATOM   8262  C C4    . DG  I 6  117 ? 121.463 68.604  107.986 1.00 93.40  ? 114 DG  I C4    1 
ATOM   8263  P P     . DT  I 6  118 ? 115.154 67.521  109.518 1.00 130.01 ? 115 DT  I P     1 
ATOM   8264  O OP1   . DT  I 6  118 ? 113.890 66.861  109.109 1.00 123.10 ? 115 DT  I OP1   1 
ATOM   8265  O OP2   . DT  I 6  118 ? 115.139 68.554  110.586 1.00 119.62 ? 115 DT  I OP2   1 
ATOM   8266  O "O5'" . DT  I 6  118 ? 116.190 66.393  109.957 1.00 123.07 ? 115 DT  I "O5'" 1 
ATOM   8267  C "C5'" . DT  I 6  118 ? 116.642 65.421  108.996 1.00 121.14 ? 115 DT  I "C5'" 1 
ATOM   8268  C "C4'" . DT  I 6  118 ? 117.656 64.500  109.610 1.00 122.99 ? 115 DT  I "C4'" 1 
ATOM   8269  O "O4'" . DT  I 6  118 ? 118.949 65.138  109.559 1.00 115.24 ? 115 DT  I "O4'" 1 
ATOM   8270  C "C3'" . DT  I 6  118 ? 117.393 64.128  111.066 1.00 129.65 ? 115 DT  I "C3'" 1 
ATOM   8271  O "O3'" . DT  I 6  118 ? 117.182 62.705  111.142 1.00 136.73 ? 115 DT  I "O3'" 1 
ATOM   8272  C "C2'" . DT  I 6  118 ? 118.660 64.558  111.799 1.00 132.23 ? 115 DT  I "C2'" 1 
ATOM   8273  C "C1'" . DT  I 6  118 ? 119.684 64.777  110.703 1.00 126.10 ? 115 DT  I "C1'" 1 
ATOM   8274  N N1    . DT  I 6  118 ? 120.643 65.855  110.997 1.00 121.75 ? 115 DT  I N1    1 
ATOM   8275  C C2    . DT  I 6  118 ? 122.001 65.594  110.962 1.00 122.22 ? 115 DT  I C2    1 
ATOM   8276  O O2    . DT  I 6  118 ? 122.472 64.504  110.694 1.00 123.83 ? 115 DT  I O2    1 
ATOM   8277  N N3    . DT  I 6  118 ? 122.791 66.671  111.254 1.00 118.09 ? 115 DT  I N3    1 
ATOM   8278  C C4    . DT  I 6  118 ? 122.371 67.937  111.567 1.00 117.46 ? 115 DT  I C4    1 
ATOM   8279  O O4    . DT  I 6  118 ? 123.177 68.830  111.810 1.00 117.57 ? 115 DT  I O4    1 
ATOM   8280  C C5    . DT  I 6  118 ? 120.954 68.129  111.585 1.00 113.27 ? 115 DT  I C5    1 
ATOM   8281  C C7    . DT  I 6  118 ? 120.434 69.476  111.923 1.00 113.04 ? 115 DT  I C7    1 
ATOM   8282  C C6    . DT  I 6  118 ? 120.171 67.101  111.305 1.00 116.11 ? 115 DT  I C6    1 
ATOM   8283  P P     . DC  I 6  119 ? 116.631 61.951  112.464 1.00 149.17 ? 116 DC  I P     1 
ATOM   8284  O OP1   . DC  I 6  119 ? 116.009 60.667  112.054 1.00 147.60 ? 116 DC  I OP1   1 
ATOM   8285  O OP2   . DC  I 6  119 ? 115.886 62.915  113.315 1.00 143.75 ? 116 DC  I OP2   1 
ATOM   8286  O "O5'" . DC  I 6  119 ? 117.950 61.638  113.304 1.00 148.84 ? 116 DC  I "O5'" 1 
ATOM   8287  C "C5'" . DC  I 6  119 ? 118.983 60.798  112.756 1.00 151.62 ? 116 DC  I "C5'" 1 
ATOM   8288  C "C4'" . DC  I 6  119 ? 120.254 60.903  113.569 1.00 147.78 ? 116 DC  I "C4'" 1 
ATOM   8289  O "O4'" . DC  I 6  119 ? 120.851 62.208  113.385 1.00 146.14 ? 116 DC  I "O4'" 1 
ATOM   8290  C "C3'" . DC  I 6  119 ? 120.080 60.718  115.082 1.00 154.11 ? 116 DC  I "C3'" 1 
ATOM   8291  O "O3'" . DC  I 6  119 ? 120.726 59.492  115.488 1.00 167.90 ? 116 DC  I "O3'" 1 
ATOM   8292  C "C2'" . DC  I 6  119 ? 120.761 61.946  115.682 1.00 158.09 ? 116 DC  I "C2'" 1 
ATOM   8293  C "C1'" . DC  I 6  119 ? 121.573 62.526  114.550 1.00 152.15 ? 116 DC  I "C1'" 1 
ATOM   8294  N N1    . DC  I 6  119 ? 121.754 63.988  114.647 1.00 149.48 ? 116 DC  I N1    1 
ATOM   8295  C C2    . DC  I 6  119 ? 123.047 64.515  114.709 1.00 145.02 ? 116 DC  I C2    1 
ATOM   8296  O O2    . DC  I 6  119 ? 124.020 63.757  114.679 1.00 146.48 ? 116 DC  I O2    1 
ATOM   8297  N N3    . DC  I 6  119 ? 123.224 65.839  114.801 1.00 139.34 ? 116 DC  I N3    1 
ATOM   8298  C C4    . DC  I 6  119 ? 122.166 66.645  114.831 1.00 139.81 ? 116 DC  I C4    1 
ATOM   8299  N N4    . DC  I 6  119 ? 122.385 67.956  114.924 1.00 137.96 ? 116 DC  I N4    1 
ATOM   8300  C C5    . DC  I 6  119 ? 120.839 66.146  114.770 1.00 140.05 ? 116 DC  I C5    1 
ATOM   8301  C C6    . DC  I 6  119 ? 120.680 64.826  114.680 1.00 142.46 ? 116 DC  I C6    1 
ATOM   8302  P P     . DT  I 6  120 ? 120.654 58.886  116.989 1.00 164.66 ? 117 DT  I P     1 
ATOM   8303  O OP1   . DT  I 6  120 ? 120.812 57.414  116.903 1.00 169.91 ? 117 DT  I OP1   1 
ATOM   8304  O OP2   . DT  I 6  120 ? 119.474 59.464  117.685 1.00 162.14 ? 117 DT  I OP2   1 
ATOM   8305  O "O5'" . DT  I 6  120 ? 121.967 59.495  117.672 1.00 172.25 ? 117 DT  I "O5'" 1 
ATOM   8306  C "C5'" . DT  I 6  120 ? 123.272 59.162  117.158 1.00 171.87 ? 117 DT  I "C5'" 1 
ATOM   8307  C "C4'" . DT  I 6  120 ? 124.372 59.969  117.820 1.00 169.54 ? 117 DT  I "C4'" 1 
ATOM   8308  O "O4'" . DT  I 6  120 ? 124.261 61.352  117.416 1.00 164.80 ? 117 DT  I "O4'" 1 
ATOM   8309  C "C3'" . DT  I 6  120 ? 124.413 59.960  119.351 1.00 173.21 ? 117 DT  I "C3'" 1 
ATOM   8310  O "O3'" . DT  I 6  120 ? 125.612 59.278  119.781 1.00 183.13 ? 117 DT  I "O3'" 1 
ATOM   8311  C "C2'" . DT  I 6  120 ? 124.446 61.438  119.740 1.00 176.16 ? 117 DT  I "C2'" 1 
ATOM   8312  C "C1'" . DT  I 6  120 ? 124.741 62.174  118.456 1.00 167.07 ? 117 DT  I "C1'" 1 
ATOM   8313  N N1    . DT  I 6  120 ? 124.055 63.473  118.396 1.00 164.25 ? 117 DT  I N1    1 
ATOM   8314  C C2    . DT  I 6  120 ? 124.799 64.629  118.353 1.00 159.73 ? 117 DT  I C2    1 
ATOM   8315  O O2    . DT  I 6  120 ? 126.022 64.632  118.361 1.00 158.97 ? 117 DT  I O2    1 
ATOM   8316  N N3    . DT  I 6  120 ? 124.052 65.778  118.298 1.00 154.82 ? 117 DT  I N3    1 
ATOM   8317  C C4    . DT  I 6  120 ? 122.678 65.878  118.287 1.00 155.59 ? 117 DT  I C4    1 
ATOM   8318  O O4    . DT  I 6  120 ? 122.112 66.974  118.233 1.00 155.16 ? 117 DT  I O4    1 
ATOM   8319  C C5    . DT  I 6  120 ? 121.979 64.629  118.334 1.00 155.90 ? 117 DT  I C5    1 
ATOM   8320  C C7    . DT  I 6  120 ? 120.495 64.653  118.334 1.00 153.90 ? 117 DT  I C7    1 
ATOM   8321  C C6    . DT  I 6  120 ? 122.688 63.508  118.387 1.00 161.04 ? 117 DT  I C6    1 
ATOM   8322  P P     . DC  I 6  121 ? 125.903 58.868  121.321 1.00 172.72 ? 118 DC  I P     1 
ATOM   8323  O OP1   . DC  I 6  121 ? 126.907 57.775  121.345 1.00 183.78 ? 118 DC  I OP1   1 
ATOM   8324  O OP2   . DC  I 6  121 ? 124.609 58.728  122.039 1.00 184.38 ? 118 DC  I OP2   1 
ATOM   8325  O "O5'" . DC  I 6  121 ? 126.557 60.179  121.959 1.00 187.05 ? 118 DC  I "O5'" 1 
ATOM   8326  C "C5'" . DC  I 6  121 ? 127.819 60.668  121.469 1.00 185.94 ? 118 DC  I "C5'" 1 
ATOM   8327  C "C4'" . DC  I 6  121 ? 128.181 62.004  122.083 1.00 186.40 ? 118 DC  I "C4'" 1 
ATOM   8328  O "O4'" . DC  I 6  121 ? 127.279 63.026  121.612 1.00 179.92 ? 118 DC  I "O4'" 1 
ATOM   8329  C "C3'" . DC  I 6  121 ? 128.163 62.071  123.615 1.00 187.45 ? 118 DC  I "C3'" 1 
ATOM   8330  O "O3'" . DC  I 6  121 ? 129.498 62.403  124.049 1.00 194.95 ? 118 DC  I "O3'" 1 
ATOM   8331  C "C2'" . DC  I 6  121 ? 127.149 63.173  123.938 1.00 187.14 ? 118 DC  I "C2'" 1 
ATOM   8332  C "C1'" . DC  I 6  121 ? 127.045 63.953  122.648 1.00 181.79 ? 118 DC  I "C1'" 1 
ATOM   8333  N N1    . DC  I 6  121 ? 125.733 64.576  122.397 1.00 177.57 ? 118 DC  I N1    1 
ATOM   8334  C C2    . DC  I 6  121 ? 125.659 65.960  122.235 1.00 173.47 ? 118 DC  I C2    1 
ATOM   8335  O O2    . DC  I 6  121 ? 126.697 66.635  122.303 1.00 173.63 ? 118 DC  I O2    1 
ATOM   8336  N N3    . DC  I 6  121 ? 124.466 66.537  122.003 1.00 167.93 ? 118 DC  I N3    1 
ATOM   8337  C C4    . DC  I 6  121 ? 123.365 65.791  121.932 1.00 167.46 ? 118 DC  I C4    1 
ATOM   8338  N N4    . DC  I 6  121 ? 122.207 66.413  121.703 1.00 165.86 ? 118 DC  I N4    1 
ATOM   8339  C C5    . DC  I 6  121 ? 123.408 64.382  122.094 1.00 168.74 ? 118 DC  I C5    1 
ATOM   8340  C C6    . DC  I 6  121 ? 124.599 63.823  122.323 1.00 173.71 ? 118 DC  I C6    1 
ATOM   8341  P P     . DC  I 6  122 ? 129.986 62.370  125.589 1.00 174.81 ? 119 DC  I P     1 
ATOM   8342  O OP1   . DC  I 6  122 ? 131.445 62.100  125.623 1.00 194.21 ? 119 DC  I OP1   1 
ATOM   8343  O OP2   . DC  I 6  122 ? 129.041 61.547  126.388 1.00 200.96 ? 119 DC  I OP2   1 
ATOM   8344  O "O5'" . DC  I 6  122 ? 129.731 63.861  126.084 1.00 197.37 ? 119 DC  I "O5'" 1 
ATOM   8345  C "C5'" . DC  I 6  122 ? 130.342 64.955  125.376 1.00 196.49 ? 119 DC  I "C5'" 1 
ATOM   8346  C "C4'" . DC  I 6  122 ? 129.934 66.274  125.977 1.00 199.42 ? 119 DC  I "C4'" 1 
ATOM   8347  O "O4'" . DC  I 6  122 ? 128.584 66.600  125.573 1.00 190.89 ? 119 DC  I "O4'" 1 
ATOM   8348  C "C3'" . DC  I 6  122 ? 129.940 66.290  127.505 1.00 204.44 ? 119 DC  I "C3'" 1 
ATOM   8349  O "O3'" . DC  I 6  122 ? 130.474 67.527  127.993 1.00 208.56 ? 119 DC  I "O3'" 1 
ATOM   8350  C "C2'" . DC  I 6  122 ? 128.467 66.188  127.844 1.00 201.30 ? 119 DC  I "C2'" 1 
ATOM   8351  C "C1'" . DC  I 6  122 ? 127.845 66.984  126.710 1.00 197.47 ? 119 DC  I "C1'" 1 
ATOM   8352  N N1    . DC  I 6  122 ? 126.423 66.757  126.377 1.00 193.11 ? 119 DC  I N1    1 
ATOM   8353  C C2    . DC  I 6  122 ? 125.679 67.842  125.904 1.00 189.38 ? 119 DC  I C2    1 
ATOM   8354  O O2    . DC  I 6  122 ? 126.215 68.948  125.776 1.00 191.60 ? 119 DC  I O2    1 
ATOM   8355  N N3    . DC  I 6  122 ? 124.384 67.686  125.586 1.00 185.66 ? 119 DC  I N3    1 
ATOM   8356  C C4    . DC  I 6  122 ? 123.812 66.494  125.725 1.00 184.92 ? 119 DC  I C4    1 
ATOM   8357  N N4    . DC  I 6  122 ? 122.526 66.366  125.403 1.00 183.32 ? 119 DC  I N4    1 
ATOM   8358  C C5    . DC  I 6  122 ? 124.530 65.372  126.200 1.00 182.69 ? 119 DC  I C5    1 
ATOM   8359  C C6    . DC  I 6  122 ? 125.814 65.540  126.512 1.00 186.44 ? 119 DC  I C6    1 
ATOM   8360  P P     . DA  I 6  123 ? 132.037 67.753  128.329 1.00 198.60 ? 120 DA  I P     1 
ATOM   8361  O OP1   . DA  I 6  123 ? 132.869 67.497  127.121 1.00 207.16 ? 120 DA  I OP1   1 
ATOM   8362  O OP2   . DA  I 6  123 ? 132.347 67.053  129.602 1.00 216.08 ? 120 DA  I OP2   1 
ATOM   8363  O "O5'" . DA  I 6  123 ? 132.067 69.321  128.589 1.00 216.40 ? 120 DA  I "O5'" 1 
ATOM   8364  C "C5'" . DA  I 6  123 ? 132.070 70.224  127.467 1.00 216.45 ? 120 DA  I "C5'" 1 
ATOM   8365  C "C4'" . DA  I 6  123 ? 131.337 71.514  127.766 1.00 219.82 ? 120 DA  I "C4'" 1 
ATOM   8366  O "O4'" . DA  I 6  123 ? 129.920 71.260  127.884 1.00 216.97 ? 120 DA  I "O4'" 1 
ATOM   8367  C "C3'" . DA  I 6  123 ? 131.725 72.232  129.055 1.00 220.43 ? 120 DA  I "C3'" 1 
ATOM   8368  O "O3'" . DA  I 6  123 ? 131.445 73.639  128.935 1.00 221.54 ? 120 DA  I "O3'" 1 
ATOM   8369  C "C2'" . DA  I 6  123 ? 130.754 71.622  130.043 1.00 221.47 ? 120 DA  I "C2'" 1 
ATOM   8370  C "C1'" . DA  I 6  123 ? 129.487 71.554  129.200 1.00 219.58 ? 120 DA  I "C1'" 1 
ATOM   8371  N N9    . DA  I 6  123 ? 128.508 70.530  129.548 1.00 220.12 ? 120 DA  I N9    1 
ATOM   8372  C C8    . DA  I 6  123 ? 128.656 69.395  130.302 1.00 220.16 ? 120 DA  I C8    1 
ATOM   8373  N N7    . DA  I 6  123 ? 127.559 68.685  130.414 1.00 217.78 ? 120 DA  I N7    1 
ATOM   8374  C C5    . DA  I 6  123 ? 126.634 69.398  129.687 1.00 218.19 ? 120 DA  I C5    1 
ATOM   8375  C C6    . DA  I 6  123 ? 125.285 69.172  129.419 1.00 214.84 ? 120 DA  I C6    1 
ATOM   8376  N N6    . DA  I 6  123 ? 124.612 68.118  129.873 1.00 216.52 ? 120 DA  I N6    1 
ATOM   8377  N N1    . DA  I 6  123 ? 124.639 70.072  128.663 1.00 210.92 ? 120 DA  I N1    1 
ATOM   8378  C C2    . DA  I 6  123 ? 125.321 71.123  128.212 1.00 213.38 ? 120 DA  I C2    1 
ATOM   8379  N N3    . DA  I 6  123 ? 126.591 71.446  128.392 1.00 220.13 ? 120 DA  I N3    1 
ATOM   8380  C C4    . DA  I 6  123 ? 127.202 70.532  129.150 1.00 221.64 ? 120 DA  I C4    1 
ATOM   8381  P P     . DG  I 6  124 ? 132.553 74.774  128.636 1.00 220.07 ? 121 DG  I P     1 
ATOM   8382  O OP1   . DG  I 6  124 ? 133.252 74.455  127.364 1.00 213.39 ? 121 DG  I OP1   1 
ATOM   8383  O OP2   . DG  I 6  124 ? 133.342 74.971  129.879 1.00 219.14 ? 121 DG  I OP2   1 
ATOM   8384  O "O5'" . DG  I 6  124 ? 131.629 76.060  128.410 1.00 219.29 ? 121 DG  I "O5'" 1 
ATOM   8385  C "C5'" . DG  I 6  124 ? 130.945 76.230  127.150 1.00 213.07 ? 121 DG  I "C5'" 1 
ATOM   8386  C "C4'" . DG  I 6  124 ? 129.639 77.001  127.273 1.00 208.46 ? 121 DG  I "C4'" 1 
ATOM   8387  O "O4'" . DG  I 6  124 ? 128.603 76.172  127.862 1.00 218.75 ? 121 DG  I "O4'" 1 
ATOM   8388  C "C3'" . DG  I 6  124 ? 129.649 78.286  128.095 1.00 209.91 ? 121 DG  I "C3'" 1 
ATOM   8389  O "O3'" . DG  I 6  124 ? 128.711 79.213  127.489 1.00 203.22 ? 121 DG  I "O3'" 1 
ATOM   8390  C "C2'" . DG  I 6  124 ? 129.213 77.775  129.463 1.00 218.19 ? 121 DG  I "C2'" 1 
ATOM   8391  C "C1'" . DG  I 6  124 ? 128.197 76.692  129.124 1.00 221.16 ? 121 DG  I "C1'" 1 
ATOM   8392  N N9    . DG  I 6  124 ? 128.113 75.554  130.054 1.00 229.85 ? 121 DG  I N9    1 
ATOM   8393  C C8    . DG  I 6  124 ? 129.115 75.016  130.829 1.00 228.25 ? 121 DG  I C8    1 
ATOM   8394  N N7    . DG  I 6  124 ? 128.728 74.004  131.550 1.00 229.32 ? 121 DG  I N7    1 
ATOM   8395  C C5    . DG  I 6  124 ? 127.400 73.856  131.241 1.00 236.12 ? 121 DG  I C5    1 
ATOM   8396  C C6    . DG  I 6  124 ? 126.481 72.914  131.731 1.00 239.30 ? 121 DG  I C6    1 
ATOM   8397  O O6    . DG  I 6  124 ? 126.693 72.011  132.548 1.00 241.30 ? 121 DG  I O6    1 
ATOM   8398  N N1    . DG  I 6  124 ? 125.229 73.092  131.174 1.00 239.47 ? 121 DG  I N1    1 
ATOM   8399  C C2    . DG  I 6  124 ? 124.905 74.061  130.262 1.00 238.02 ? 121 DG  I C2    1 
ATOM   8400  N N2    . DG  I 6  124 ? 123.628 74.059  129.847 1.00 237.87 ? 121 DG  I N2    1 
ATOM   8401  N N3    . DG  I 6  124 ? 125.765 74.955  129.792 1.00 238.73 ? 121 DG  I N3    1 
ATOM   8402  C C4    . DG  I 6  124 ? 126.993 74.796  130.326 1.00 236.32 ? 121 DG  I C4    1 
ATOM   8403  P P     . DG  I 6  125 ? 128.430 80.718  128.023 1.00 176.73 ? 122 DG  I P     1 
ATOM   8404  O OP1   . DG  I 6  125 ? 128.305 81.658  126.868 1.00 168.00 ? 122 DG  I OP1   1 
ATOM   8405  O OP2   . DG  I 6  125 ? 129.403 81.025  129.104 1.00 194.52 ? 122 DG  I OP2   1 
ATOM   8406  O "O5'" . DG  I 6  125 ? 126.993 80.583  128.689 1.00 192.42 ? 122 DG  I "O5'" 1 
ATOM   8407  C "C5'" . DG  I 6  125 ? 125.895 80.146  127.869 1.00 194.59 ? 122 DG  I "C5'" 1 
ATOM   8408  C "C4'" . DG  I 6  125 ? 124.622 79.966  128.663 1.00 200.27 ? 122 DG  I "C4'" 1 
ATOM   8409  O "O4'" . DG  I 6  125 ? 124.700 78.790  129.506 1.00 220.38 ? 122 DG  I "O4'" 1 
ATOM   8410  C "C3'" . DG  I 6  125 ? 124.213 81.097  129.594 1.00 199.45 ? 122 DG  I "C3'" 1 
ATOM   8411  O "O3'" . DG  I 6  125 ? 122.783 81.119  129.564 1.00 203.19 ? 122 DG  I "O3'" 1 
ATOM   8412  C "C2'" . DG  I 6  125 ? 124.731 80.613  130.935 1.00 216.77 ? 122 DG  I "C2'" 1 
ATOM   8413  C "C1'" . DG  I 6  125 ? 124.384 79.138  130.846 1.00 229.20 ? 122 DG  I "C1'" 1 
ATOM   8414  N N9    . DG  I 6  125 ? 125.142 78.221  131.695 1.00 241.32 ? 122 DG  I N9    1 
ATOM   8415  C C8    . DG  I 6  125 ? 126.485 78.240  131.951 1.00 238.41 ? 122 DG  I C8    1 
ATOM   8416  N N7    . DG  I 6  125 ? 126.877 77.287  132.748 1.00 245.59 ? 122 DG  I N7    1 
ATOM   8417  C C5    . DG  I 6  125 ? 125.716 76.593  133.037 1.00 248.83 ? 122 DG  I C5    1 
ATOM   8418  C C6    . DG  I 6  125 ? 125.510 75.456  133.851 1.00 257.28 ? 122 DG  I C6    1 
ATOM   8419  O O6    . DG  I 6  125 ? 126.352 74.822  134.495 1.00 263.31 ? 122 DG  I O6    1 
ATOM   8420  N N1    . DG  I 6  125 ? 124.175 75.073  133.870 1.00 264.55 ? 122 DG  I N1    1 
ATOM   8421  C C2    . DG  I 6  125 ? 123.166 75.706  133.192 1.00 261.76 ? 122 DG  I C2    1 
ATOM   8422  N N2    . DG  I 6  125 ? 121.928 75.197  133.326 1.00 267.29 ? 122 DG  I N2    1 
ATOM   8423  N N3    . DG  I 6  125 ? 123.354 76.769  132.429 1.00 255.74 ? 122 DG  I N3    1 
ATOM   8424  C C4    . DG  I 6  125 ? 124.640 77.155  132.396 1.00 247.93 ? 122 DG  I C4    1 
ATOM   8425  P P     . DC  I 6  126 ? 121.865 82.334  130.066 1.00 210.53 ? 123 DC  I P     1 
ATOM   8426  O OP1   . DC  I 6  126 ? 120.922 82.644  128.980 1.00 166.19 ? 123 DC  I OP1   1 
ATOM   8427  O OP2   . DC  I 6  126 ? 122.689 83.396  130.659 1.00 198.50 ? 123 DC  I OP2   1 
ATOM   8428  O "O5'" . DC  I 6  126 ? 121.070 81.716  131.292 1.00 230.85 ? 123 DC  I "O5'" 1 
ATOM   8429  C "C5'" . DC  I 6  126 ? 119.821 81.046  131.052 1.00 232.17 ? 123 DC  I "C5'" 1 
ATOM   8430  C "C4'" . DC  I 6  126 ? 119.229 80.563  132.349 1.00 253.65 ? 123 DC  I "C4'" 1 
ATOM   8431  O "O4'" . DC  I 6  126 ? 120.145 79.614  132.954 1.00 260.62 ? 123 DC  I "O4'" 1 
ATOM   8432  C "C3'" . DC  I 6  126 ? 118.989 81.682  133.368 1.00 261.66 ? 123 DC  I "C3'" 1 
ATOM   8433  O "O3'" . DC  I 6  126 ? 117.630 81.625  133.859 1.00 268.05 ? 123 DC  I "O3'" 1 
ATOM   8434  C "C2'" . DC  I 6  126 ? 120.022 81.398  134.448 1.00 271.45 ? 123 DC  I "C2'" 1 
ATOM   8435  C "C1'" . DC  I 6  126 ? 120.298 79.906  134.324 1.00 276.24 ? 123 DC  I "C1'" 1 
ATOM   8436  N N1    . DC  I 6  126 ? 121.657 79.499  134.730 1.00 276.77 ? 123 DC  I N1    1 
ATOM   8437  C C2    . DC  I 6  126 ? 121.841 78.416  135.604 1.00 288.83 ? 123 DC  I C2    1 
ATOM   8438  O O2    . DC  I 6  126 ? 120.875 77.787  136.049 1.00 296.14 ? 123 DC  I O2    1 
ATOM   8439  N N3    . DC  I 6  126 ? 123.084 78.051  135.970 1.00 287.54 ? 123 DC  I N3    1 
ATOM   8440  C C4    . DC  I 6  126 ? 124.132 78.722  135.494 1.00 278.37 ? 123 DC  I C4    1 
ATOM   8441  N N4    . DC  I 6  126 ? 125.357 78.348  135.868 1.00 283.50 ? 123 DC  I N4    1 
ATOM   8442  C C5    . DC  I 6  126 ? 123.979 79.819  134.611 1.00 265.52 ? 123 DC  I C5    1 
ATOM   8443  C C6    . DC  I 6  126 ? 122.745 80.168  134.257 1.00 262.62 ? 123 DC  I C6    1 
ATOM   8444  P P     . DA  I 6  127 ? 116.949 82.752  134.811 1.00 293.31 ? 124 DA  I P     1 
ATOM   8445  O OP1   . DA  I 6  127 ? 115.763 83.300  134.112 1.00 264.31 ? 124 DA  I OP1   1 
ATOM   8446  O OP2   . DA  I 6  127 ? 118.001 83.687  135.290 1.00 283.82 ? 124 DA  I OP2   1 
ATOM   8447  O "O5'" . DA  I 6  127 ? 116.459 81.882  136.053 1.00 290.76 ? 124 DA  I "O5'" 1 
ATOM   8448  C "C5'" . DA  I 6  127 ? 115.482 80.842  135.862 1.00 282.31 ? 124 DA  I "C5'" 1 
ATOM   8449  C "C4'" . DA  I 6  127 ? 115.361 79.956  137.084 1.00 303.44 ? 124 DA  I "C4'" 1 
ATOM   8450  O "O4'" . DA  I 6  127 ? 116.631 79.314  137.366 1.00 314.30 ? 124 DA  I "O4'" 1 
ATOM   8451  C "C3'" . DA  I 6  127 ? 114.936 80.654  138.376 1.00 320.71 ? 124 DA  I "C3'" 1 
ATOM   8452  O "O3'" . DA  I 6  127 ? 114.050 79.781  139.111 1.00 333.57 ? 124 DA  I "O3'" 1 
ATOM   8453  C "C2'" . DA  I 6  127 ? 116.264 80.867  139.088 1.00 328.42 ? 124 DA  I "C2'" 1 
ATOM   8454  C "C1'" . DA  I 6  127 ? 117.093 79.665  138.663 1.00 323.77 ? 124 DA  I "C1'" 1 
ATOM   8455  N N9    . DA  I 6  127 ? 118.531 79.940  138.584 1.00 323.69 ? 124 DA  I N9    1 
ATOM   8456  C C8    . DA  I 6  127 ? 119.130 81.011  137.986 1.00 317.18 ? 124 DA  I C8    1 
ATOM   8457  N N7    . DA  I 6  127 ? 120.435 81.009  138.064 1.00 319.69 ? 124 DA  I N7    1 
ATOM   8458  C C5    . DA  I 6  127 ? 120.719 79.860  138.759 1.00 325.26 ? 124 DA  I C5    1 
ATOM   8459  C C6    . DA  I 6  127 ? 121.936 79.308  139.159 1.00 328.04 ? 124 DA  I C6    1 
ATOM   8460  N N6    . DA  I 6  127 ? 123.097 79.888  138.883 1.00 327.72 ? 124 DA  I N6    1 
ATOM   8461  N N1    . DA  I 6  127 ? 121.914 78.143  139.847 1.00 333.08 ? 124 DA  I N1    1 
ATOM   8462  C C2    . DA  I 6  127 ? 120.716 77.602  140.095 1.00 332.34 ? 124 DA  I C2    1 
ATOM   8463  N N3    . DA  I 6  127 ? 119.501 78.033  139.768 1.00 334.32 ? 124 DA  I N3    1 
ATOM   8464  C C4    . DA  I 6  127 ? 119.566 79.185  139.090 1.00 328.61 ? 124 DA  I C4    1 
ATOM   8465  P P     . DC  I 6  128 ? 113.223 80.245  140.425 1.00 329.24 ? 125 DC  I P     1 
ATOM   8466  O OP1   . DC  I 6  128 ? 112.030 79.372  140.574 1.00 341.42 ? 125 DC  I OP1   1 
ATOM   8467  O OP2   . DC  I 6  128 ? 113.079 81.725  140.398 1.00 337.89 ? 125 DC  I OP2   1 
ATOM   8468  O "O5'" . DC  I 6  128 ? 114.232 79.961  141.636 1.00 349.26 ? 125 DC  I "O5'" 1 
ATOM   8469  C "C5'" . DC  I 6  128 ? 114.689 78.621  141.914 1.00 350.74 ? 125 DC  I "C5'" 1 
ATOM   8470  C "C4'" . DC  I 6  128 ? 115.876 78.607  142.860 1.00 356.35 ? 125 DC  I "C4'" 1 
ATOM   8471  O "O4'" . DC  I 6  128 ? 117.065 79.061  142.173 1.00 352.94 ? 125 DC  I "O4'" 1 
ATOM   8472  C "C3'" . DC  I 6  128 ? 115.762 79.494  144.107 1.00 368.73 ? 125 DC  I "C3'" 1 
ATOM   8473  O "O3'" . DC  I 6  128 ? 115.424 78.689  145.263 1.00 376.80 ? 125 DC  I "O3'" 1 
ATOM   8474  C "C2'" . DC  I 6  128 ? 117.160 80.097  144.248 1.00 375.72 ? 125 DC  I "C2'" 1 
ATOM   8475  C "C1'" . DC  I 6  128 ? 117.993 79.479  143.149 1.00 364.81 ? 125 DC  I "C1'" 1 
ATOM   8476  N N1    . DC  I 6  128 ? 118.967 80.404  142.537 1.00 357.81 ? 125 DC  I N1    1 
ATOM   8477  C C2    . DC  I 6  128 ? 120.345 80.153  142.648 1.00 365.91 ? 125 DC  I C2    1 
ATOM   8478  O O2    . DC  I 6  128 ? 120.747 79.155  143.259 1.00 365.27 ? 125 DC  I O2    1 
ATOM   8479  N N3    . DC  I 6  128 ? 121.228 81.000  142.086 1.00 359.18 ? 125 DC  I N3    1 
ATOM   8480  C C4    . DC  I 6  128 ? 120.789 82.073  141.429 1.00 359.17 ? 125 DC  I C4    1 
ATOM   8481  N N4    . DC  I 6  128 ? 121.697 82.887  140.887 1.00 359.83 ? 125 DC  I N4    1 
ATOM   8482  C C5    . DC  I 6  128 ? 119.403 82.355  141.301 1.00 355.01 ? 125 DC  I C5    1 
ATOM   8483  C C6    . DC  I 6  128 ? 118.539 81.506  141.863 1.00 355.42 ? 125 DC  I C6    1 
ATOM   8484  P P     . DG  I 6  129 ? 115.075 79.309  146.725 1.00 384.77 ? 126 DG  I P     1 
ATOM   8485  O OP1   . DG  I 6  129 ? 114.341 78.277  147.501 1.00 386.66 ? 126 DG  I OP1   1 
ATOM   8486  O OP2   . DG  I 6  129 ? 114.477 80.658  146.540 1.00 379.02 ? 126 DG  I OP2   1 
ATOM   8487  O "O5'" . DG  I 6  129 ? 116.516 79.511  147.397 1.00 389.73 ? 126 DG  I "O5'" 1 
ATOM   8488  C "C5'" . DG  I 6  129 ? 117.203 78.406  148.020 1.00 392.78 ? 126 DG  I "C5'" 1 
ATOM   8489  C "C4'" . DG  I 6  129 ? 118.677 78.700  148.259 1.00 393.73 ? 126 DG  I "C4'" 1 
ATOM   8490  O "O4'" . DG  I 6  129 ? 119.256 79.333  147.099 1.00 391.02 ? 126 DG  I "O4'" 1 
ATOM   8491  C "C3'" . DG  I 6  129 ? 119.022 79.614  149.440 1.00 402.75 ? 126 DG  I "C3'" 1 
ATOM   8492  O "O3'" . DG  I 6  129 ? 119.542 78.797  150.513 1.00 412.60 ? 126 DG  I "O3'" 1 
ATOM   8493  C "C2'" . DG  I 6  129 ? 120.092 80.568  148.895 1.00 405.77 ? 126 DG  I "C2'" 1 
ATOM   8494  C "C1'" . DG  I 6  129 ? 120.382 80.092  147.492 1.00 397.22 ? 126 DG  I "C1'" 1 
ATOM   8495  N N9    . DG  I 6  129 ? 120.543 81.175  146.528 1.00 393.31 ? 126 DG  I N9    1 
ATOM   8496  C C8    . DG  I 6  129 ? 119.536 81.867  145.914 1.00 388.04 ? 126 DG  I C8    1 
ATOM   8497  N N7    . DG  I 6  129 ? 119.957 82.783  145.094 1.00 386.98 ? 126 DG  I N7    1 
ATOM   8498  C C5    . DG  I 6  129 ? 121.333 82.692  145.170 1.00 387.70 ? 126 DG  I C5    1 
ATOM   8499  C C6    . DG  I 6  129 ? 122.321 83.437  144.498 1.00 388.65 ? 126 DG  I C6    1 
ATOM   8500  O O6    . DG  I 6  129 ? 122.150 84.348  143.680 1.00 387.71 ? 126 DG  I O6    1 
ATOM   8501  N N1    . DG  I 6  129 ? 123.597 83.033  144.855 1.00 385.30 ? 126 DG  I N1    1 
ATOM   8502  C C2    . DG  I 6  129 ? 123.886 82.034  145.749 1.00 396.03 ? 126 DG  I C2    1 
ATOM   8503  N N2    . DG  I 6  129 ? 125.188 81.785  145.965 1.00 392.26 ? 126 DG  I N2    1 
ATOM   8504  N N3    . DG  I 6  129 ? 122.965 81.325  146.385 1.00 394.32 ? 126 DG  I N3    1 
ATOM   8505  C C4    . DG  I 6  129 ? 121.717 81.706  146.048 1.00 393.02 ? 126 DG  I C4    1 
ATOM   8506  P P     . DT  I 6  130 ? 119.874 79.357  151.997 1.00 409.58 ? 127 DT  I P     1 
ATOM   8507  O OP1   . DT  I 6  130 ? 119.562 78.288  152.975 1.00 419.44 ? 127 DT  I OP1   1 
ATOM   8508  O OP2   . DT  I 6  130 ? 119.252 80.701  152.151 1.00 414.86 ? 127 DT  I OP2   1 
ATOM   8509  O "O5'" . DT  I 6  130 ? 121.457 79.541  151.946 1.00 421.35 ? 127 DT  I "O5'" 1 
ATOM   8510  C "C5'" . DT  I 6  130 ? 122.086 80.768  152.361 1.00 433.24 ? 127 DT  I "C5'" 1 
ATOM   8511  C "C4'" . DT  I 6  130 ? 123.469 80.884  151.753 1.00 427.91 ? 127 DT  I "C4'" 1 
ATOM   8512  O "O4'" . DT  I 6  130 ? 123.337 81.380  150.396 1.00 413.89 ? 127 DT  I "O4'" 1 
ATOM   8513  C "C3'" . DT  I 6  130 ? 124.428 81.840  152.475 1.00 433.99 ? 127 DT  I "C3'" 1 
ATOM   8514  O "O3'" . DT  I 6  130 ? 125.732 81.238  152.649 1.00 438.66 ? 127 DT  I "O3'" 1 
ATOM   8515  C "C2'" . DT  I 6  130 ? 124.510 83.033  151.537 1.00 432.72 ? 127 DT  I "C2'" 1 
ATOM   8516  C "C1'" . DT  I 6  130 ? 124.215 82.465  150.177 1.00 422.57 ? 127 DT  I "C1'" 1 
ATOM   8517  N N1    . DT  I 6  130 ? 123.564 83.444  149.286 1.00 415.30 ? 127 DT  I N1    1 
ATOM   8518  C C2    . DT  I 6  130 ? 124.361 84.223  148.469 1.00 416.43 ? 127 DT  I C2    1 
ATOM   8519  O O2    . DT  I 6  130 ? 125.577 84.131  148.457 1.00 418.51 ? 127 DT  I O2    1 
ATOM   8520  N N3    . DT  I 6  130 ? 123.675 85.104  147.675 1.00 409.93 ? 127 DT  I N3    1 
ATOM   8521  C C4    . DT  I 6  130 ? 122.306 85.274  147.622 1.00 408.02 ? 127 DT  I C4    1 
ATOM   8522  O O4    . DT  I 6  130 ? 121.804 86.098  146.862 1.00 408.06 ? 127 DT  I O4    1 
ATOM   8523  C C5    . DT  I 6  130 ? 121.542 84.433  148.500 1.00 407.93 ? 127 DT  I C5    1 
ATOM   8524  C C7    . DT  I 6  130 ? 120.057 84.571  148.494 1.00 401.70 ? 127 DT  I C7    1 
ATOM   8525  C C6    . DT  I 6  130 ? 122.197 83.571  149.277 1.00 412.60 ? 127 DT  I C6    1 
ATOM   8526  P P     . DG  I 6  131 ? 126.783 81.736  153.785 1.00 439.74 ? 128 DG  I P     1 
ATOM   8527  O OP1   . DG  I 6  131 ? 127.903 80.764  153.844 1.00 455.77 ? 128 DG  I OP1   1 
ATOM   8528  O OP2   . DG  I 6  131 ? 126.014 82.046  155.019 1.00 452.95 ? 128 DG  I OP2   1 
ATOM   8529  O "O5'" . DG  I 6  131 ? 127.355 83.117  153.211 1.00 443.16 ? 128 DG  I "O5'" 1 
ATOM   8530  C "C5'" . DG  I 6  131 ? 128.340 83.110  152.156 1.00 445.13 ? 128 DG  I "C5'" 1 
ATOM   8531  C "C4'" . DG  I 6  131 ? 128.951 84.480  151.920 1.00 438.08 ? 128 DG  I "C4'" 1 
ATOM   8532  O "O4'" . DG  I 6  131 ? 128.114 85.250  151.017 1.00 436.23 ? 128 DG  I "O4'" 1 
ATOM   8533  C "C3'" . DG  I 6  131 ? 129.191 85.373  153.140 1.00 438.19 ? 128 DG  I "C3'" 1 
ATOM   8534  O "O3'" . DG  I 6  131 ? 130.469 86.017  152.948 1.00 439.76 ? 128 DG  I "O3'" 1 
ATOM   8535  C "C2'" . DG  I 6  131 ? 128.023 86.352  153.083 1.00 436.97 ? 128 DG  I "C2'" 1 
ATOM   8536  C "C1'" . DG  I 6  131 ? 127.792 86.511  151.591 1.00 435.71 ? 128 DG  I "C1'" 1 
ATOM   8537  N N9    . DG  I 6  131 ? 126.419 86.824  151.188 1.00 433.61 ? 128 DG  I N9    1 
ATOM   8538  C C8    . DG  I 6  131 ? 125.261 86.290  151.688 1.00 431.05 ? 128 DG  I C8    1 
ATOM   8539  N N7    . DG  I 6  131 ? 124.182 86.760  151.130 1.00 426.06 ? 128 DG  I N7    1 
ATOM   8540  C C5    . DG  I 6  131 ? 124.654 87.667  150.201 1.00 425.37 ? 128 DG  I C5    1 
ATOM   8541  C C6    . DG  I 6  131 ? 123.947 88.489  149.293 1.00 420.45 ? 128 DG  I C6    1 
ATOM   8542  O O6    . DG  I 6  131 ? 122.721 88.568  149.137 1.00 419.95 ? 128 DG  I O6    1 
ATOM   8543  N N1    . DG  I 6  131 ? 124.808 89.261  148.527 1.00 415.86 ? 128 DG  I N1    1 
ATOM   8544  C C2    . DG  I 6  131 ? 126.175 89.242  148.628 1.00 420.56 ? 128 DG  I C2    1 
ATOM   8545  N N2    . DG  I 6  131 ? 126.848 90.060  147.805 1.00 413.94 ? 128 DG  I N2    1 
ATOM   8546  N N3    . DG  I 6  131 ? 126.845 88.475  149.473 1.00 426.28 ? 128 DG  I N3    1 
ATOM   8547  C C4    . DG  I 6  131 ? 126.029 87.719  150.223 1.00 427.72 ? 128 DG  I C4    1 
ATOM   8548  P P     . DT  I 6  132 ? 131.220 86.958  154.033 1.00 433.83 ? 129 DT  I P     1 
ATOM   8549  O OP1   . DT  I 6  132 ? 132.640 86.532  154.114 1.00 441.03 ? 129 DT  I OP1   1 
ATOM   8550  O OP2   . DT  I 6  132 ? 130.397 87.044  155.269 1.00 443.21 ? 129 DT  I OP2   1 
ATOM   8551  O "O5'" . DT  I 6  132 ? 131.168 88.379  153.311 1.00 435.34 ? 129 DT  I "O5'" 1 
ATOM   8552  C "C5'" . DT  I 6  132 ? 131.744 88.515  151.998 1.00 437.04 ? 129 DT  I "C5'" 1 
ATOM   8553  C "C4'" . DT  I 6  132 ? 131.587 89.917  151.461 1.00 424.29 ? 129 DT  I "C4'" 1 
ATOM   8554  O "O4'" . DT  I 6  132 ? 130.224 90.096  151.005 1.00 424.28 ? 129 DT  I "O4'" 1 
ATOM   8555  C "C3'" . DT  I 6  132 ? 131.894 91.063  152.430 1.00 421.59 ? 129 DT  I "C3'" 1 
ATOM   8556  O "O3'" . DT  I 6  132 ? 132.818 91.953  151.759 1.00 418.80 ? 129 DT  I "O3'" 1 
ATOM   8557  C "C2'" . DT  I 6  132 ? 130.517 91.679  152.694 1.00 418.50 ? 129 DT  I "C2'" 1 
ATOM   8558  C "C1'" . DT  I 6  132 ? 129.732 91.347  151.435 1.00 419.00 ? 129 DT  I "C1'" 1 
ATOM   8559  N N1    . DT  I 6  132 ? 128.266 91.204  151.597 1.00 424.35 ? 129 DT  I N1    1 
ATOM   8560  C C2    . DT  I 6  132 ? 127.430 91.896  150.736 1.00 420.93 ? 129 DT  I C2    1 
ATOM   8561  O O2    . DT  I 6  132 ? 127.842 92.619  149.847 1.00 416.38 ? 129 DT  I O2    1 
ATOM   8562  N N3    . DT  I 6  132 ? 126.089 91.703  150.957 1.00 420.63 ? 129 DT  I N3    1 
ATOM   8563  C C4    . DT  I 6  132 ? 125.517 90.910  151.930 1.00 424.45 ? 129 DT  I C4    1 
ATOM   8564  O O4    . DT  I 6  132 ? 124.296 90.807  152.037 1.00 425.64 ? 129 DT  I O4    1 
ATOM   8565  C C5    . DT  I 6  132 ? 126.441 90.224  152.785 1.00 426.62 ? 129 DT  I C5    1 
ATOM   8566  C C7    . DT  I 6  132 ? 125.881 89.357  153.857 1.00 432.84 ? 129 DT  I C7    1 
ATOM   8567  C C6    . DT  I 6  132 ? 127.748 90.398  152.585 1.00 427.63 ? 129 DT  I C6    1 
ATOM   8568  P P     . DC  I 6  133 ? 133.418 93.335  152.361 1.00 404.25 ? 130 DC  I P     1 
ATOM   8569  O OP1   . DC  I 6  133 ? 134.830 93.479  151.924 1.00 408.76 ? 130 DC  I OP1   1 
ATOM   8570  O OP2   . DC  I 6  133 ? 133.053 93.454  153.800 1.00 413.56 ? 130 DC  I OP2   1 
ATOM   8571  O "O5'" . DC  I 6  133 ? 132.539 94.453  151.629 1.00 403.23 ? 130 DC  I "O5'" 1 
ATOM   8572  C "C5'" . DC  I 6  133 ? 132.411 94.440  150.188 1.00 398.51 ? 130 DC  I "C5'" 1 
ATOM   8573  C "C4'" . DC  I 6  133 ? 131.450 95.501  149.691 1.00 391.17 ? 130 DC  I "C4'" 1 
ATOM   8574  O "O4'" . DC  I 6  133 ? 130.084 95.142  150.030 1.00 396.14 ? 130 DC  I "O4'" 1 
ATOM   8575  C "C3'" . DC  I 6  133 ? 131.666 96.899  150.277 1.00 384.57 ? 130 DC  I "C3'" 1 
ATOM   8576  O "O3'" . DC  I 6  133 ? 131.356 97.913  149.296 1.00 369.88 ? 130 DC  I "O3'" 1 
ATOM   8577  C "C2'" . DC  I 6  133 ? 130.634 96.914  151.395 1.00 395.24 ? 130 DC  I "C2'" 1 
ATOM   8578  C "C1'" . DC  I 6  133 ? 129.468 96.228  150.697 1.00 399.48 ? 130 DC  I "C1'" 1 
ATOM   8579  N N1    . DC  I 6  133 ? 128.386 95.666  151.539 1.00 409.53 ? 130 DC  I N1    1 
ATOM   8580  C C2    . DC  I 6  133 ? 127.044 95.885  151.183 1.00 416.32 ? 130 DC  I C2    1 
ATOM   8581  O O2    . DC  I 6  133 ? 126.762 96.543  150.174 1.00 413.02 ? 130 DC  I O2    1 
ATOM   8582  N N3    . DC  I 6  133 ? 126.058 95.372  151.945 1.00 418.33 ? 130 DC  I N3    1 
ATOM   8583  C C4    . DC  I 6  133 ? 126.360 94.661  153.033 1.00 423.67 ? 130 DC  I C4    1 
ATOM   8584  N N4    . DC  I 6  133 ? 125.364 94.168  153.770 1.00 426.79 ? 130 DC  I N4    1 
ATOM   8585  C C5    . DC  I 6  133 ? 127.703 94.424  153.422 1.00 415.20 ? 130 DC  I C5    1 
ATOM   8586  C C6    . DC  I 6  133 ? 128.671 94.935  152.657 1.00 410.83 ? 130 DC  I C6    1 
ATOM   8587  P P     . DA  I 6  134 ? 132.432 98.542  148.257 1.00 356.12 ? 131 DA  I P     1 
ATOM   8588  O OP1   . DA  I 6  134 ? 132.802 97.506  147.258 1.00 380.22 ? 131 DA  I OP1   1 
ATOM   8589  O OP2   . DA  I 6  134 ? 133.499 99.217  149.043 1.00 366.91 ? 131 DA  I OP2   1 
ATOM   8590  O "O5'" . DA  I 6  134 ? 131.565 99.670  147.517 1.00 340.89 ? 131 DA  I "O5'" 1 
ATOM   8591  C "C5'" . DA  I 6  134 ? 130.625 99.308  146.480 1.00 327.28 ? 131 DA  I "C5'" 1 
ATOM   8592  C "C4'" . DA  I 6  134 ? 129.648 100.425 146.138 1.00 297.04 ? 131 DA  I "C4'" 1 
ATOM   8593  O "O4'" . DA  I 6  134 ? 128.617 100.499 147.143 1.00 313.89 ? 131 DA  I "O4'" 1 
ATOM   8594  C "C3'" . DA  I 6  134 ? 130.194 101.851 146.035 1.00 278.22 ? 131 DA  I "C3'" 1 
ATOM   8595  O "O3'" . DA  I 6  134 ? 129.360 102.589 145.103 1.00 251.04 ? 131 DA  I "O3'" 1 
ATOM   8596  C "C2'" . DA  I 6  134 ? 130.086 102.326 147.486 1.00 323.96 ? 131 DA  I "C2'" 1 
ATOM   8597  C "C1'" . DA  I 6  134 ? 128.849 101.607 148.007 1.00 350.67 ? 131 DA  I "C1'" 1 
ATOM   8598  N N9    . DA  I 6  134 ? 128.914 101.054 149.363 1.00 379.23 ? 131 DA  I N9    1 
ATOM   8599  C C8    . DA  I 6  134 ? 129.975 100.925 150.237 1.00 387.64 ? 131 DA  I C8    1 
ATOM   8600  N N7    . DA  I 6  134 ? 129.648 100.373 151.376 1.00 400.85 ? 131 DA  I N7    1 
ATOM   8601  C C5    . DA  I 6  134 ? 128.296 100.127 151.255 1.00 406.33 ? 131 DA  I C5    1 
ATOM   8602  C C6    . DA  I 6  134 ? 127.383 99.550  152.134 1.00 407.73 ? 131 DA  I C6    1 
ATOM   8603  N N6    . DA  I 6  134 ? 127.689 99.111  153.342 1.00 416.97 ? 131 DA  I N6    1 
ATOM   8604  N N1    . DA  I 6  134 ? 126.102 99.441  151.722 1.00 422.30 ? 131 DA  I N1    1 
ATOM   8605  C C2    . DA  I 6  134 ? 125.802 99.887  150.497 1.00 415.91 ? 131 DA  I C2    1 
ATOM   8606  N N3    . DA  I 6  134 ? 126.578 100.442 149.588 1.00 404.52 ? 131 DA  I N3    1 
ATOM   8607  C C4    . DA  I 6  134 ? 127.839 100.535 150.030 1.00 391.56 ? 131 DA  I C4    1 
ATOM   8608  P P     . DG  I 6  135 ? 129.511 104.177 144.809 1.00 209.54 ? 132 DG  I P     1 
ATOM   8609  O OP1   . DG  I 6  135 ? 129.373 104.446 143.342 1.00 147.45 ? 132 DG  I OP1   1 
ATOM   8610  O OP2   . DG  I 6  135 ? 130.739 104.663 145.487 1.00 204.45 ? 132 DG  I OP2   1 
ATOM   8611  O "O5'" . DG  I 6  135 ? 128.257 104.820 145.542 1.00 303.16 ? 132 DG  I "O5'" 1 
ATOM   8612  C "C5'" . DG  I 6  135 ? 126.921 104.461 145.149 1.00 303.64 ? 132 DG  I "C5'" 1 
ATOM   8613  C "C4'" . DG  I 6  135 ? 125.939 104.829 146.236 1.00 333.43 ? 132 DG  I "C4'" 1 
ATOM   8614  O "O4'" . DG  I 6  135 ? 126.285 104.146 147.470 1.00 355.11 ? 132 DG  I "O4'" 1 
ATOM   8615  C "C3'" . DG  I 6  135 ? 125.855 106.318 146.578 1.00 355.49 ? 132 DG  I "C3'" 1 
ATOM   8616  O "O3'" . DG  I 6  135 ? 124.470 106.695 146.499 1.00 362.54 ? 132 DG  I "O3'" 1 
ATOM   8617  C "C2'" . DG  I 6  135 ? 126.405 106.385 147.999 1.00 383.65 ? 132 DG  I "C2'" 1 
ATOM   8618  C "C1'" . DG  I 6  135 ? 126.056 105.014 148.566 1.00 393.34 ? 132 DG  I "C1'" 1 
ATOM   8619  N N9    . DG  I 6  135 ? 126.895 104.575 149.697 1.00 411.98 ? 132 DG  I N9    1 
ATOM   8620  C C8    . DG  I 6  135 ? 128.252 104.756 149.829 1.00 405.13 ? 132 DG  I C8    1 
ATOM   8621  N N7    . DG  I 6  135 ? 128.739 104.268 150.931 1.00 419.13 ? 132 DG  I N7    1 
ATOM   8622  C C5    . DG  I 6  135 ? 127.650 103.727 151.581 1.00 429.23 ? 132 DG  I C5    1 
ATOM   8623  C C6    . DG  I 6  135 ? 127.590 103.063 152.831 1.00 428.17 ? 132 DG  I C6    1 
ATOM   8624  O O6    . DG  I 6  135 ? 128.522 102.825 153.612 1.00 433.44 ? 132 DG  I O6    1 
ATOM   8625  N N1    . DG  I 6  135 ? 126.297 102.666 153.137 1.00 424.59 ? 132 DG  I N1    1 
ATOM   8626  C C2    . DG  I 6  135 ? 125.201 102.879 152.342 1.00 434.79 ? 132 DG  I C2    1 
ATOM   8627  N N2    . DG  I 6  135 ? 124.027 102.413 152.813 1.00 450.70 ? 132 DG  I N2    1 
ATOM   8628  N N3    . DG  I 6  135 ? 125.247 103.503 151.164 1.00 437.95 ? 132 DG  I N3    1 
ATOM   8629  C C4    . DG  I 6  135 ? 126.497 103.903 150.844 1.00 394.90 ? 132 DG  I C4    1 
ATOM   8630  P P     . DA  I 6  136 ? 123.912 108.211 146.437 1.00 386.12 ? 133 DA  I P     1 
ATOM   8631  O OP1   . DA  I 6  136 ? 123.376 108.437 145.069 1.00 350.71 ? 133 DA  I OP1   1 
ATOM   8632  O OP2   . DA  I 6  136 ? 124.974 109.128 146.934 1.00 375.01 ? 133 DA  I OP2   1 
ATOM   8633  O "O5'" . DA  I 6  136 ? 122.711 108.145 147.499 1.00 424.95 ? 133 DA  I "O5'" 1 
ATOM   8634  C "C5'" . DA  I 6  136 ? 121.615 107.214 147.304 1.00 438.01 ? 133 DA  I "C5'" 1 
ATOM   8635  C "C4'" . DA  I 6  136 ? 120.840 106.914 148.582 1.00 471.45 ? 133 DA  I "C4'" 1 
ATOM   8636  O "O4'" . DA  I 6  136 ? 121.676 106.210 149.540 1.00 467.09 ? 133 DA  I "O4'" 1 
ATOM   8637  C "C3'" . DA  I 6  136 ? 120.259 108.127 149.316 1.00 504.53 ? 133 DA  I "C3'" 1 
ATOM   8638  O "O3'" . DA  I 6  136 ? 118.890 107.856 149.703 1.00 516.96 ? 133 DA  I "O3'" 1 
ATOM   8639  C "C2'" . DA  I 6  136 ? 121.171 108.272 150.529 1.00 488.54 ? 133 DA  I "C2'" 1 
ATOM   8640  C "C1'" . DA  I 6  136 ? 121.644 106.857 150.806 1.00 483.58 ? 133 DA  I "C1'" 1 
ATOM   8641  N N9    . DA  I 6  136 ? 122.993 106.823 151.384 1.00 462.81 ? 133 DA  I N9    1 
ATOM   8642  C C8    . DA  I 6  136 ? 124.134 107.319 150.816 1.00 441.67 ? 133 DA  I C8    1 
ATOM   8643  N N7    . DA  I 6  136 ? 125.211 107.156 151.544 1.00 453.11 ? 133 DA  I N7    1 
ATOM   8644  C C5    . DA  I 6  136 ? 124.753 106.510 152.669 1.00 459.28 ? 133 DA  I C5    1 
ATOM   8645  C C6    . DA  I 6  136 ? 125.426 106.064 153.813 1.00 462.83 ? 133 DA  I C6    1 
ATOM   8646  N N6    . DA  I 6  136 ? 126.733 106.234 153.964 1.00 471.03 ? 133 DA  I N6    1 
ATOM   8647  N N1    . DA  I 6  136 ? 124.711 105.448 154.782 1.00 462.13 ? 133 DA  I N1    1 
ATOM   8648  C C2    . DA  I 6  136 ? 123.392 105.305 154.571 1.00 474.30 ? 133 DA  I C2    1 
ATOM   8649  N N3    . DA  I 6  136 ? 122.646 105.685 153.529 1.00 478.08 ? 133 DA  I N3    1 
ATOM   8650  C C4    . DA  I 6  136 ? 123.392 106.292 152.595 1.00 466.51 ? 133 DA  I C4    1 
ATOM   8651  P P     . DT  I 6  137 ? 117.857 109.007 150.202 1.00 537.15 ? 134 DT  I P     1 
ATOM   8652  O OP1   . DT  I 6  137 ? 116.474 108.494 150.034 1.00 503.34 ? 134 DT  I OP1   1 
ATOM   8653  O OP2   . DT  I 6  137 ? 118.247 110.294 149.567 1.00 562.25 ? 134 DT  I OP2   1 
ATOM   8654  O "O5'" . DT  I 6  137 ? 118.168 109.120 151.768 1.00 502.37 ? 134 DT  I "O5'" 1 
ATOM   8655  C "C5'" . DT  I 6  137 ? 117.808 108.047 152.664 1.00 518.75 ? 134 DT  I "C5'" 1 
ATOM   8656  C "C4'" . DT  I 6  137 ? 118.291 108.296 154.084 1.00 486.07 ? 134 DT  I "C4'" 1 
ATOM   8657  O "O4'" . DT  I 6  137 ? 119.720 108.072 154.156 1.00 463.97 ? 134 DT  I "O4'" 1 
ATOM   8658  C "C3'" . DT  I 6  137 ? 118.036 109.695 154.670 1.00 537.13 ? 134 DT  I "C3'" 1 
ATOM   8659  O "O3'" . DT  I 6  137 ? 117.126 109.600 155.796 1.00 534.24 ? 134 DT  I "O3'" 1 
ATOM   8660  C "C2'" . DT  I 6  137 ? 119.418 110.156 155.125 1.00 529.04 ? 134 DT  I "C2'" 1 
ATOM   8661  C "C1'" . DT  I 6  137 ? 120.250 108.889 155.176 1.00 600.00 ? 134 DT  I "C1'" 1 
ATOM   8662  N N1    . DT  I 6  137 ? 121.695 109.080 154.921 1.00 487.77 ? 134 DT  I N1    1 
ATOM   8663  C C2    . DT  I 6  137 ? 122.621 108.614 155.839 1.00 474.68 ? 134 DT  I C2    1 
ATOM   8664  O O2    . DT  I 6  137 ? 122.303 108.043 156.870 1.00 600.00 ? 134 DT  I O2    1 
ATOM   8665  N N3    . DT  I 6  137 ? 123.931 108.843 155.501 1.00 465.71 ? 134 DT  I N3    1 
ATOM   8666  C C4    . DT  I 6  137 ? 124.393 109.477 154.366 1.00 483.38 ? 134 DT  I C4    1 
ATOM   8667  O O4    . DT  I 6  137 ? 125.601 109.625 154.166 1.00 508.78 ? 134 DT  I O4    1 
ATOM   8668  C C5    . DT  I 6  137 ? 123.374 109.934 153.461 1.00 475.59 ? 134 DT  I C5    1 
ATOM   8669  C C7    . DT  I 6  137 ? 123.782 110.640 152.217 1.00 421.72 ? 134 DT  I C7    1 
ATOM   8670  C C6    . DT  I 6  137 ? 122.102 109.717 153.776 1.00 510.86 ? 134 DT  I C6    1 
ATOM   8671  P P     . DA  I 6  138 ? 116.349 110.874 156.447 1.00 563.96 ? 135 DA  I P     1 
ATOM   8672  O OP1   . DA  I 6  138 ? 115.268 110.356 157.324 1.00 553.29 ? 135 DA  I OP1   1 
ATOM   8673  O OP2   . DA  I 6  138 ? 116.006 111.832 155.361 1.00 584.56 ? 135 DA  I OP2   1 
ATOM   8674  O "O5'" . DA  I 6  138 ? 117.457 111.562 157.376 1.00 600.00 ? 135 DA  I "O5'" 1 
ATOM   8675  C "C5'" . DA  I 6  138 ? 117.503 111.324 158.798 1.00 585.89 ? 135 DA  I "C5'" 1 
ATOM   8676  C "C4'" . DA  I 6  138 ? 118.882 111.591 159.374 1.00 600.00 ? 135 DA  I "C4'" 1 
ATOM   8677  O "O4'" . DA  I 6  138 ? 119.892 111.248 158.416 1.00 567.50 ? 135 DA  I "O4'" 1 
ATOM   8678  C "C3'" . DA  I 6  138 ? 119.233 113.025 159.774 1.00 600.00 ? 135 DA  I "C3'" 1 
ATOM   8679  O "O3'" . DA  I 6  138 ? 118.810 113.265 161.135 1.00 600.00 ? 135 DA  I "O3'" 1 
ATOM   8680  C "C2'" . DA  I 6  138 ? 120.761 113.034 159.660 1.00 600.00 ? 135 DA  I "C2'" 1 
ATOM   8681  C "C1'" . DA  I 6  138 ? 121.108 111.781 158.866 1.00 569.18 ? 135 DA  I "C1'" 1 
ATOM   8682  N N9    . DA  I 6  138 ? 122.001 112.014 157.733 1.00 546.91 ? 135 DA  I N9    1 
ATOM   8683  C C8    . DA  I 6  138 ? 121.728 112.368 156.430 1.00 545.55 ? 135 DA  I C8    1 
ATOM   8684  N N7    . DA  I 6  138 ? 122.786 112.487 155.681 1.00 538.81 ? 135 DA  I N7    1 
ATOM   8685  C C5    . DA  I 6  138 ? 123.839 112.191 156.541 1.00 600.00 ? 135 DA  I C5    1 
ATOM   8686  C C6    . DA  I 6  138 ? 125.228 112.146 156.348 1.00 541.93 ? 135 DA  I C6    1 
ATOM   8687  N N6    . DA  I 6  138 ? 125.873 112.397 155.197 1.00 548.67 ? 135 DA  I N6    1 
ATOM   8688  N N1    . DA  I 6  138 ? 125.976 111.814 157.426 1.00 600.00 ? 135 DA  I N1    1 
ATOM   8689  C C2    . DA  I 6  138 ? 125.376 111.558 158.584 1.00 600.00 ? 135 DA  I C2    1 
ATOM   8690  N N3    . DA  I 6  138 ? 124.087 111.573 158.879 1.00 600.00 ? 135 DA  I N3    1 
ATOM   8691  C C4    . DA  I 6  138 ? 123.367 111.900 157.805 1.00 559.37 ? 135 DA  I C4    1 
ATOM   8692  P P     . DT  I 6  139 ? 118.799 114.733 161.821 1.00 600.00 ? 136 DT  I P     1 
ATOM   8693  O OP1   . DT  I 6  139 ? 118.180 114.606 163.165 1.00 600.00 ? 136 DT  I OP1   1 
ATOM   8694  O OP2   . DT  I 6  139 ? 118.232 115.699 160.842 1.00 600.00 ? 136 DT  I OP2   1 
ATOM   8695  O "O5'" . DT  I 6  139 ? 120.354 115.065 162.016 1.00 600.00 ? 136 DT  I "O5'" 1 
ATOM   8696  C "C5'" . DT  I 6  139 ? 121.039 114.658 163.218 1.00 600.00 ? 136 DT  I "C5'" 1 
ATOM   8697  C "C4'" . DT  I 6  139 ? 122.540 114.883 163.127 1.00 600.00 ? 136 DT  I "C4'" 1 
ATOM   8698  O "O4'" . DT  I 6  139 ? 123.026 114.531 161.809 1.00 600.00 ? 136 DT  I "O4'" 1 
ATOM   8699  C "C3'" . DT  I 6  139 ? 123.034 116.321 163.366 1.00 600.00 ? 136 DT  I "C3'" 1 
ATOM   8700  O "O3'" . DT  I 6  139 ? 123.633 116.455 164.678 1.00 600.00 ? 136 DT  I "O3'" 1 
ATOM   8701  C "C2'" . DT  I 6  139 ? 124.083 116.536 162.271 1.00 600.00 ? 136 DT  I "C2'" 1 
ATOM   8702  C "C1'" . DT  I 6  139 ? 124.265 115.178 161.635 1.00 600.00 ? 136 DT  I "C1'" 1 
ATOM   8703  N N1    . DT  I 6  139 ? 124.601 115.305 160.206 1.00 600.00 ? 136 DT  I N1    1 
ATOM   8704  C C2    . DT  I 6  139 ? 125.917 115.140 159.825 1.00 600.00 ? 136 DT  I C2    1 
ATOM   8705  O O2    . DT  I 6  139 ? 126.799 114.889 160.631 1.00 600.00 ? 136 DT  I O2    1 
ATOM   8706  N N3    . DT  I 6  139 ? 126.144 115.276 158.479 1.00 600.00 ? 136 DT  I N3    1 
ATOM   8707  C C4    . DT  I 6  139 ? 125.198 115.556 157.503 1.00 600.00 ? 136 DT  I C4    1 
ATOM   8708  O O4    . DT  I 6  139 ? 125.518 115.654 156.319 1.00 600.00 ? 136 DT  I O4    1 
ATOM   8709  C C5    . DT  I 6  139 ? 123.848 115.717 157.984 1.00 600.00 ? 136 DT  I C5    1 
ATOM   8710  C C7    . DT  I 6  139 ? 122.766 116.024 157.006 1.00 600.00 ? 136 DT  I C7    1 
ATOM   8711  C C6    . DT  I 6  139 ? 123.623 115.585 159.291 1.00 600.00 ? 136 DT  I C6    1 
ATOM   8712  P P     . DA  I 6  140 ? 123.936 117.900 165.368 1.00 600.00 ? 137 DA  I P     1 
ATOM   8713  O OP1   . DA  I 6  140 ? 124.328 117.666 166.781 1.00 600.00 ? 137 DA  I OP1   1 
ATOM   8714  O OP2   . DA  I 6  140 ? 122.794 118.805 165.064 1.00 600.00 ? 137 DA  I OP2   1 
ATOM   8715  O "O5'" . DA  I 6  140 ? 125.222 118.454 164.586 1.00 600.00 ? 137 DA  I "O5'" 1 
ATOM   8716  C "C5'" . DA  I 6  140 ? 126.542 117.967 164.912 1.00 600.00 ? 137 DA  I "C5'" 1 
ATOM   8717  C "C4'" . DA  I 6  140 ? 127.621 118.547 164.011 1.00 600.00 ? 137 DA  I "C4'" 1 
ATOM   8718  O "O4'" . DA  I 6  140 ? 127.373 118.190 162.626 1.00 600.00 ? 137 DA  I "O4'" 1 
ATOM   8719  C "C3'" . DA  I 6  140 ? 127.811 120.073 164.050 1.00 600.00 ? 137 DA  I "C3'" 1 
ATOM   8720  O "O3'" . DA  I 6  140 ? 129.206 120.356 164.321 1.00 600.00 ? 137 DA  I "O3'" 1 
ATOM   8721  C "C2'" . DA  I 6  140 ? 127.399 120.513 162.645 1.00 600.00 ? 137 DA  I "C2'" 1 
ATOM   8722  C "C1'" . DA  I 6  140 ? 127.708 119.295 161.797 1.00 600.00 ? 137 DA  I "C1'" 1 
ATOM   8723  N N9    . DA  I 6  140 ? 126.953 119.219 160.536 1.00 600.00 ? 137 DA  I N9    1 
ATOM   8724  C C8    . DA  I 6  140 ? 125.601 119.328 160.333 1.00 600.00 ? 137 DA  I C8    1 
ATOM   8725  N N7    . DA  I 6  140 ? 125.231 119.214 159.076 1.00 600.00 ? 137 DA  I N7    1 
ATOM   8726  C C5    . DA  I 6  140 ? 126.416 119.020 158.401 1.00 600.00 ? 137 DA  I C5    1 
ATOM   8727  C C6    . DA  I 6  140 ? 126.742 118.829 157.037 1.00 600.00 ? 137 DA  I C6    1 
ATOM   8728  N N6    . DA  I 6  140 ? 125.841 118.800 156.049 1.00 600.00 ? 137 DA  I N6    1 
ATOM   8729  N N1    . DA  I 6  140 ? 128.038 118.663 156.708 1.00 600.00 ? 137 DA  I N1    1 
ATOM   8730  C C2    . DA  I 6  140 ? 128.957 118.684 157.677 1.00 600.00 ? 137 DA  I C2    1 
ATOM   8731  N N3    . DA  I 6  140 ? 128.785 118.855 158.981 1.00 600.00 ? 137 DA  I N3    1 
ATOM   8732  C C4    . DA  I 6  140 ? 127.489 119.019 159.286 1.00 600.00 ? 137 DA  I C4    1 
ATOM   8733  P P     . DT  I 6  141 ? 129.809 121.826 164.658 1.00 600.00 ? 138 DT  I P     1 
ATOM   8734  O OP1   . DT  I 6  141 ? 130.850 121.678 165.709 1.00 600.00 ? 138 DT  I OP1   1 
ATOM   8735  O OP2   . DT  I 6  141 ? 128.687 122.778 164.866 1.00 600.00 ? 138 DT  I OP2   1 
ATOM   8736  O "O5'" . DT  I 6  141 ? 130.534 122.204 163.286 1.00 600.00 ? 138 DT  I "O5'" 1 
ATOM   8737  C "C5'" . DT  I 6  141 ? 131.758 121.536 162.924 1.00 600.00 ? 138 DT  I "C5'" 1 
ATOM   8738  C "C4'" . DT  I 6  141 ? 132.255 121.960 161.556 1.00 600.00 ? 138 DT  I "C4'" 1 
ATOM   8739  O "O4'" . DT  I 6  141 ? 131.291 121.587 160.544 1.00 600.00 ? 138 DT  I "O4'" 1 
ATOM   8740  C "C3'" . DT  I 6  141 ? 132.531 123.457 161.360 1.00 600.00 ? 138 DT  I "C3'" 1 
ATOM   8741  O "O3'" . DT  I 6  141 ? 133.954 123.647 161.165 1.00 600.00 ? 138 DT  I "O3'" 1 
ATOM   8742  C "C2'" . DT  I 6  141 ? 131.734 123.819 160.101 1.00 600.00 ? 138 DT  I "C2'" 1 
ATOM   8743  C "C1'" . DT  I 6  141 ? 131.417 122.483 159.462 1.00 600.00 ? 138 DT  I "C1'" 1 
ATOM   8744  N N1    . DT  I 6  141 ? 130.152 122.457 158.697 1.00 600.00 ? 138 DT  I N1    1 
ATOM   8745  C C2    . DT  I 6  141 ? 130.187 122.254 157.326 1.00 600.00 ? 138 DT  I C2    1 
ATOM   8746  O O2    . DT  I 6  141 ? 131.227 122.094 156.704 1.00 600.00 ? 138 DT  I O2    1 
ATOM   8747  N N3    . DT  I 6  141 ? 128.953 122.247 156.717 1.00 600.00 ? 138 DT  I N3    1 
ATOM   8748  C C4    . DT  I 6  141 ? 127.726 122.422 157.334 1.00 600.00 ? 138 DT  I C4    1 
ATOM   8749  O O4    . DT  I 6  141 ? 126.679 122.397 156.684 1.00 600.00 ? 138 DT  I O4    1 
ATOM   8750  C C5    . DT  I 6  141 ? 127.772 122.630 158.759 1.00 600.00 ? 138 DT  I C5    1 
ATOM   8751  C C7    . DT  I 6  141 ? 126.490 122.828 159.495 1.00 600.00 ? 138 DT  I C7    1 
ATOM   8752  C C6    . DT  I 6  141 ? 128.962 122.636 159.360 1.00 600.00 ? 138 DT  I C6    1 
ATOM   8753  P P     . DA  I 6  142 ? 134.689 125.095 161.209 1.00 600.00 ? 139 DA  I P     1 
ATOM   8754  O OP1   . DA  I 6  142 ? 136.133 124.868 161.477 1.00 600.00 ? 139 DA  I OP1   1 
ATOM   8755  O OP2   . DA  I 6  142 ? 133.911 125.998 162.098 1.00 600.00 ? 139 DA  I OP2   1 
ATOM   8756  O "O5'" . DA  I 6  142 ? 134.538 125.627 159.708 1.00 600.00 ? 139 DA  I "O5'" 1 
ATOM   8757  C "C5'" . DA  I 6  142 ? 135.316 125.042 158.644 1.00 600.00 ? 139 DA  I "C5'" 1 
ATOM   8758  C "C4'" . DA  I 6  142 ? 134.777 125.410 157.273 1.00 600.00 ? 139 DA  I "C4'" 1 
ATOM   8759  O "O4'" . DA  I 6  142 ? 133.401 125.000 157.152 1.00 600.00 ? 139 DA  I "O4'" 1 
ATOM   8760  C "C3'" . DA  I 6  142 ? 134.792 126.899 156.902 1.00 600.00 ? 139 DA  I "C3'" 1 
ATOM   8761  O "O3'" . DA  I 6  142 ? 135.936 127.144 156.043 1.00 600.00 ? 139 DA  I "O3'" 1 
ATOM   8762  C "C2'" . DA  I 6  142 ? 133.448 127.110 156.180 1.00 600.00 ? 139 DA  I "C2'" 1 
ATOM   8763  C "C1'" . DA  I 6  142 ? 132.817 125.734 156.099 1.00 600.00 ? 139 DA  I "C1'" 1 
ATOM   8764  N N9    . DA  I 6  142 ? 131.356 125.730 156.253 1.00 600.00 ? 139 DA  I N9    1 
ATOM   8765  C C8    . DA  I 6  142 ? 130.611 125.941 157.392 1.00 600.00 ? 139 DA  I C8    1 
ATOM   8766  N N7    . DA  I 6  142 ? 129.315 125.868 157.199 1.00 600.00 ? 139 DA  I N7    1 
ATOM   8767  C C5    . DA  I 6  142 ? 129.197 125.586 155.839 1.00 600.00 ? 139 DA  I C5    1 
ATOM   8768  C C6    . DA  I 6  142 ? 128.071 125.400 155.014 1.00 600.00 ? 139 DA  I C6    1 
ATOM   8769  N N6    . DA  I 6  142 ? 126.810 125.450 155.431 1.00 600.00 ? 139 DA  I N6    1 
ATOM   8770  N N1    . DA  I 6  142 ? 128.292 125.142 153.704 1.00 600.00 ? 139 DA  I N1    1 
ATOM   8771  C C2    . DA  I 6  142 ? 129.560 125.090 153.276 1.00 600.00 ? 139 DA  I C2    1 
ATOM   8772  N N3    . DA  I 6  142 ? 130.688 125.253 153.961 1.00 600.00 ? 139 DA  I N3    1 
ATOM   8773  C C4    . DA  I 6  142 ? 130.440 125.507 155.249 1.00 600.00 ? 139 DA  I C4    1 
ATOM   8774  P P     . DC  I 6  143 ? 136.330 128.584 155.405 1.00 600.00 ? 140 DC  I P     1 
ATOM   8775  O OP1   . DC  I 6  143 ? 137.795 128.612 155.161 1.00 600.00 ? 140 DC  I OP1   1 
ATOM   8776  O OP2   . DC  I 6  143 ? 135.674 129.664 156.194 1.00 600.00 ? 140 DC  I OP2   1 
ATOM   8777  O "O5'" . DC  I 6  143 ? 135.573 128.594 153.989 1.00 600.00 ? 140 DC  I "O5'" 1 
ATOM   8778  C "C5'" . DC  I 6  143 ? 135.782 127.517 153.042 1.00 600.00 ? 140 DC  I "C5'" 1 
ATOM   8779  C "C4'" . DC  I 6  143 ? 134.831 127.579 151.858 1.00 600.00 ? 140 DC  I "C4'" 1 
ATOM   8780  O "O4'" . DC  I 6  143 ? 133.453 127.400 152.292 1.00 600.00 ? 140 DC  I "O4'" 1 
ATOM   8781  C "C3'" . DC  I 6  143 ? 134.848 128.877 151.043 1.00 600.00 ? 140 DC  I "C3'" 1 
ATOM   8782  O "O3'" . DC  I 6  143 ? 134.738 128.545 149.641 1.00 596.15 ? 140 DC  I "O3'" 1 
ATOM   8783  C "C2'" . DC  I 6  143 ? 133.605 129.587 151.559 1.00 600.00 ? 140 DC  I "C2'" 1 
ATOM   8784  C "C1'" . DC  I 6  143 ? 132.644 128.417 151.723 1.00 593.75 ? 140 DC  I "C1'" 1 
ATOM   8785  N N1    . DC  I 6  143 ? 131.469 128.632 152.609 1.00 600.00 ? 140 DC  I N1    1 
ATOM   8786  C C2    . DC  I 6  143 ? 130.169 128.329 152.151 1.00 600.00 ? 140 DC  I C2    1 
ATOM   8787  O O2    . DC  I 6  143 ? 129.991 127.881 151.013 1.00 600.00 ? 140 DC  I O2    1 
ATOM   8788  N N3    . DC  I 6  143 ? 129.103 128.526 152.960 1.00 600.00 ? 140 DC  I N3    1 
ATOM   8789  C C4    . DC  I 6  143 ? 129.283 129.009 154.191 1.00 586.72 ? 140 DC  I C4    1 
ATOM   8790  N N4    . DC  I 6  143 ? 128.205 129.193 154.968 1.00 513.90 ? 140 DC  I N4    1 
ATOM   8791  C C5    . DC  I 6  143 ? 130.579 129.326 154.684 1.00 600.00 ? 140 DC  I C5    1 
ATOM   8792  C C6    . DC  I 6  143 ? 131.626 129.127 153.873 1.00 600.00 ? 140 DC  I C6    1 
ATOM   8793  P P     . DA  I 6  144 ? 135.079 129.561 148.423 1.00 600.00 ? 141 DA  I P     1 
ATOM   8794  O OP1   . DA  I 6  144 ? 136.096 128.917 147.556 1.00 566.52 ? 141 DA  I OP1   1 
ATOM   8795  O OP2   . DA  I 6  144 ? 135.324 130.914 148.990 1.00 600.00 ? 141 DA  I OP2   1 
ATOM   8796  O "O5'" . DA  I 6  144 ? 133.700 129.621 147.614 1.00 588.83 ? 141 DA  I "O5'" 1 
ATOM   8797  C "C5'" . DA  I 6  144 ? 133.039 128.404 147.202 1.00 594.10 ? 141 DA  I "C5'" 1 
ATOM   8798  C "C4'" . DA  I 6  144 ? 131.836 128.667 146.315 1.00 600.00 ? 141 DA  I "C4'" 1 
ATOM   8799  O "O4'" . DA  I 6  144 ? 130.648 128.760 147.139 1.00 600.00 ? 141 DA  I "O4'" 1 
ATOM   8800  C "C3'" . DA  I 6  144 ? 131.865 129.942 145.466 1.00 600.00 ? 141 DA  I "C3'" 1 
ATOM   8801  O "O3'" . DA  I 6  144 ? 131.160 129.709 144.221 1.00 600.00 ? 141 DA  I "O3'" 1 
ATOM   8802  C "C2'" . DA  I 6  144 ? 131.141 130.935 146.364 1.00 600.00 ? 141 DA  I "C2'" 1 
ATOM   8803  C "C1'" . DA  I 6  144 ? 130.104 130.078 147.079 1.00 568.79 ? 141 DA  I "C1'" 1 
ATOM   8804  N N9    . DA  I 6  144 ? 129.806 130.535 148.444 1.00 600.00 ? 141 DA  I N9    1 
ATOM   8805  C C8    . DA  I 6  144 ? 130.701 130.886 149.426 1.00 600.00 ? 141 DA  I C8    1 
ATOM   8806  N N7    . DA  I 6  144 ? 130.135 131.253 150.548 1.00 600.00 ? 141 DA  I N7    1 
ATOM   8807  C C5    . DA  I 6  144 ? 128.782 131.140 150.288 1.00 600.00 ? 141 DA  I C5    1 
ATOM   8808  C C6    . DA  I 6  144 ? 127.661 131.389 151.100 1.00 600.00 ? 141 DA  I C6    1 
ATOM   8809  N N6    . DA  I 6  144 ? 127.744 131.818 152.359 1.00 600.00 ? 141 DA  I N6    1 
ATOM   8810  N N1    . DA  I 6  144 ? 126.439 131.185 150.566 1.00 600.00 ? 141 DA  I N1    1 
ATOM   8811  C C2    . DA  I 6  144 ? 126.373 130.755 149.296 1.00 569.50 ? 141 DA  I C2    1 
ATOM   8812  N N3    . DA  I 6  144 ? 127.359 130.486 148.443 1.00 594.39 ? 141 DA  I N3    1 
ATOM   8813  C C4    . DA  I 6  144 ? 128.555 130.698 149.001 1.00 588.66 ? 141 DA  I C4    1 
ATOM   8814  P P     . DT  I 6  145 ? 131.080 130.771 142.992 1.00 600.00 ? 142 DT  I P     1 
ATOM   8815  O OP1   . DT  I 6  145 ? 130.927 130.009 141.727 1.00 522.47 ? 142 DT  I OP1   1 
ATOM   8816  O OP2   . DT  I 6  145 ? 132.184 131.759 143.129 1.00 490.27 ? 142 DT  I OP2   1 
ATOM   8817  O "O5'" . DT  I 6  145 ? 129.703 131.531 143.285 1.00 539.97 ? 142 DT  I "O5'" 1 
ATOM   8818  C "C5'" . DT  I 6  145 ? 128.465 130.792 143.260 1.00 512.13 ? 142 DT  I "C5'" 1 
ATOM   8819  C "C4'" . DT  I 6  145 ? 127.263 131.643 143.626 1.00 514.57 ? 142 DT  I "C4'" 1 
ATOM   8820  O "O4'" . DT  I 6  145 ? 127.230 131.878 145.059 1.00 467.31 ? 142 DT  I "O4'" 1 
ATOM   8821  C "C3'" . DT  I 6  145 ? 127.143 133.016 142.957 1.00 493.76 ? 142 DT  I "C3'" 1 
ATOM   8822  O "O3'" . DT  I 6  145 ? 125.799 133.130 142.437 1.00 473.77 ? 142 DT  I "O3'" 1 
ATOM   8823  C "C2'" . DT  I 6  145 ? 127.404 133.982 144.111 1.00 495.38 ? 142 DT  I "C2'" 1 
ATOM   8824  C "C1'" . DT  I 6  145 ? 126.850 133.220 145.307 1.00 508.82 ? 142 DT  I "C1'" 1 
ATOM   8825  N N1    . DT  I 6  145 ? 127.349 133.621 146.656 1.00 515.49 ? 142 DT  I N1    1 
ATOM   8826  C C2    . DT  I 6  145 ? 126.431 133.833 147.679 1.00 513.56 ? 142 DT  I C2    1 
ATOM   8827  O O2    . DT  I 6  145 ? 125.227 133.699 147.535 1.00 535.74 ? 142 DT  I O2    1 
ATOM   8828  N N3    . DT  I 6  145 ? 126.980 134.199 148.889 1.00 503.04 ? 142 DT  I N3    1 
ATOM   8829  C C4    . DT  I 6  145 ? 128.315 134.377 149.176 1.00 600.00 ? 142 DT  I C4    1 
ATOM   8830  O O4    . DT  I 6  145 ? 128.686 134.707 150.307 1.00 569.87 ? 142 DT  I O4    1 
ATOM   8831  C C5    . DT  I 6  145 ? 129.211 134.144 148.075 1.00 600.00 ? 142 DT  I C5    1 
ATOM   8832  C C7    . DT  I 6  145 ? 130.671 134.318 148.313 1.00 600.00 ? 142 DT  I C7    1 
ATOM   8833  C C6    . DT  I 6  145 ? 128.697 133.786 146.893 1.00 503.04 ? 142 DT  I C6    1 
ATOM   8834  P P     . DC  I 6  146 ? 125.281 134.314 141.461 1.00 428.30 ? 143 DC  I P     1 
ATOM   8835  O OP1   . DC  I 6  146 ? 124.408 133.714 140.417 1.00 390.38 ? 143 DC  I OP1   1 
ATOM   8836  O OP2   . DC  I 6  146 ? 126.428 135.186 141.085 1.00 412.65 ? 143 DC  I OP2   1 
ATOM   8837  O "O5'" . DC  I 6  146 ? 124.388 135.222 142.431 1.00 451.55 ? 143 DC  I "O5'" 1 
ATOM   8838  C "C5'" . DC  I 6  146 ? 123.153 134.699 142.967 1.00 439.40 ? 143 DC  I "C5'" 1 
ATOM   8839  C "C4'" . DC  I 6  146 ? 122.515 135.628 143.984 1.00 415.10 ? 143 DC  I "C4'" 1 
ATOM   8840  O "O4'" . DC  I 6  146 ? 123.339 135.735 145.174 1.00 437.95 ? 143 DC  I "O4'" 1 
ATOM   8841  C "C3'" . DC  I 6  146 ? 122.265 137.062 143.507 1.00 403.88 ? 143 DC  I "C3'" 1 
ATOM   8842  O "O3'" . DC  I 6  146 ? 120.923 137.438 143.875 1.00 374.84 ? 143 DC  I "O3'" 1 
ATOM   8843  C "C2'" . DC  I 6  146 ? 123.304 137.870 144.274 1.00 438.44 ? 143 DC  I "C2'" 1 
ATOM   8844  C "C1'" . DC  I 6  146 ? 123.423 137.091 145.574 1.00 450.16 ? 143 DC  I "C1'" 1 
ATOM   8845  N N1    . DC  I 6  146 ? 124.692 137.261 146.318 1.00 479.37 ? 143 DC  I N1    1 
ATOM   8846  C C2    . DC  I 6  146 ? 124.675 137.616 147.681 1.00 488.44 ? 143 DC  I C2    1 
ATOM   8847  O O2    . DC  I 6  146 ? 123.596 137.789 148.268 1.00 486.03 ? 143 DC  I O2    1 
ATOM   8848  N N3    . DC  I 6  146 ? 125.843 137.765 148.341 1.00 518.38 ? 143 DC  I N3    1 
ATOM   8849  C C4    . DC  I 6  146 ? 127.003 137.580 147.701 1.00 499.46 ? 143 DC  I C4    1 
ATOM   8850  N N4    . DC  I 6  146 ? 128.138 137.738 148.387 1.00 498.01 ? 143 DC  I N4    1 
ATOM   8851  C C5    . DC  I 6  146 ? 127.051 137.221 146.327 1.00 460.43 ? 143 DC  I C5    1 
ATOM   8852  C C6    . DC  I 6  146 ? 125.889 137.076 145.684 1.00 475.08 ? 143 DC  I C6    1 
ATOM   8853  O "O5'" . DG  J 7  5   ? 126.976 140.862 158.976 1.00 600.00 ? 5   DG  J "O5'" 1 
ATOM   8854  C "C5'" . DG  J 7  5   ? 125.841 141.704 158.676 1.00 600.00 ? 5   DG  J "C5'" 1 
ATOM   8855  C "C4'" . DG  J 7  5   ? 124.717 140.956 157.976 1.00 600.00 ? 5   DG  J "C4'" 1 
ATOM   8856  O "O4'" . DG  J 7  5   ? 125.068 140.738 156.582 1.00 600.00 ? 5   DG  J "O4'" 1 
ATOM   8857  C "C3'" . DG  J 7  5   ? 124.317 139.585 158.538 1.00 586.14 ? 5   DG  J "C3'" 1 
ATOM   8858  O "O3'" . DG  J 7  5   ? 122.872 139.503 158.535 1.00 574.55 ? 5   DG  J "O3'" 1 
ATOM   8859  C "C2'" . DG  J 7  5   ? 124.956 138.621 157.546 1.00 578.27 ? 5   DG  J "C2'" 1 
ATOM   8860  C "C1'" . DG  J 7  5   ? 124.844 139.379 156.229 1.00 573.54 ? 5   DG  J "C1'" 1 
ATOM   8861  N N9    . DG  J 7  5   ? 125.833 139.021 155.201 1.00 600.00 ? 5   DG  J N9    1 
ATOM   8862  C C8    . DG  J 7  5   ? 127.172 138.778 155.393 1.00 600.00 ? 5   DG  J C8    1 
ATOM   8863  N N7    . DG  J 7  5   ? 127.814 138.484 154.301 1.00 600.00 ? 5   DG  J N7    1 
ATOM   8864  C C5    . DG  J 7  5   ? 126.847 138.531 153.319 1.00 600.00 ? 5   DG  J C5    1 
ATOM   8865  C C6    . DG  J 7  5   ? 126.973 138.296 151.933 1.00 558.28 ? 5   DG  J C6    1 
ATOM   8866  O O6    . DG  J 7  5   ? 128.002 137.997 151.312 1.00 600.00 ? 5   DG  J O6    1 
ATOM   8867  N N1    . DG  J 7  5   ? 125.761 138.440 151.276 1.00 580.40 ? 5   DG  J N1    1 
ATOM   8868  C C2    . DG  J 7  5   ? 124.573 138.770 151.880 1.00 548.94 ? 5   DG  J C2    1 
ATOM   8869  N N2    . DG  J 7  5   ? 123.511 138.864 151.062 1.00 524.87 ? 5   DG  J N2    1 
ATOM   8870  N N3    . DG  J 7  5   ? 124.441 138.996 153.188 1.00 549.53 ? 5   DG  J N3    1 
ATOM   8871  C C4    . DG  J 7  5   ? 125.615 138.858 153.846 1.00 589.54 ? 5   DG  J C4    1 
ATOM   8872  P P     . DA  J 7  6   ? 122.004 138.316 159.223 1.00 552.02 ? 6   DA  J P     1 
ATOM   8873  O OP1   . DA  J 7  6   ? 120.911 138.939 160.014 1.00 559.44 ? 6   DA  J OP1   1 
ATOM   8874  O OP2   . DA  J 7  6   ? 122.932 137.351 159.875 1.00 572.64 ? 6   DA  J OP2   1 
ATOM   8875  O "O5'" . DA  J 7  6   ? 121.354 137.588 157.955 1.00 560.51 ? 6   DA  J "O5'" 1 
ATOM   8876  C "C5'" . DA  J 7  6   ? 120.489 138.324 157.061 1.00 562.47 ? 6   DA  J "C5'" 1 
ATOM   8877  C "C4'" . DA  J 7  6   ? 120.066 137.501 155.859 1.00 541.93 ? 6   DA  J "C4'" 1 
ATOM   8878  O "O4'" . DA  J 7  6   ? 121.180 137.348 154.943 1.00 523.17 ? 6   DA  J "O4'" 1 
ATOM   8879  C "C3'" . DA  J 7  6   ? 119.542 136.092 156.153 1.00 531.49 ? 6   DA  J "C3'" 1 
ATOM   8880  O "O3'" . DA  J 7  6   ? 118.357 135.880 155.354 1.00 512.82 ? 6   DA  J "O3'" 1 
ATOM   8881  C "C2'" . DA  J 7  6   ? 120.710 135.202 155.731 1.00 523.74 ? 6   DA  J "C2'" 1 
ATOM   8882  C "C1'" . DA  J 7  6   ? 121.355 135.980 154.596 1.00 529.92 ? 6   DA  J "C1'" 1 
ATOM   8883  N N9    . DA  J 7  6   ? 122.798 135.750 154.426 1.00 538.18 ? 6   DA  J N9    1 
ATOM   8884  C C8    . DA  J 7  6   ? 123.761 135.725 155.402 1.00 548.63 ? 6   DA  J C8    1 
ATOM   8885  N N7    . DA  J 7  6   ? 124.973 135.497 154.954 1.00 529.83 ? 6   DA  J N7    1 
ATOM   8886  C C5    . DA  J 7  6   ? 124.801 135.362 153.588 1.00 549.32 ? 6   DA  J C5    1 
ATOM   8887  C C6    . DA  J 7  6   ? 125.706 135.108 152.543 1.00 541.66 ? 6   DA  J C6    1 
ATOM   8888  N N6    . DA  J 7  6   ? 127.016 134.939 152.727 1.00 562.88 ? 6   DA  J N6    1 
ATOM   8889  N N1    . DA  J 7  6   ? 125.220 135.030 151.284 1.00 552.55 ? 6   DA  J N1    1 
ATOM   8890  C C2    . DA  J 7  6   ? 123.906 135.200 151.104 1.00 600.00 ? 6   DA  J C2    1 
ATOM   8891  N N3    . DA  J 7  6   ? 122.961 135.444 152.007 1.00 528.28 ? 6   DA  J N3    1 
ATOM   8892  C C4    . DA  J 7  6   ? 123.471 135.515 153.245 1.00 534.55 ? 6   DA  J C4    1 
ATOM   8893  P P     . DT  J 7  7   ? 117.389 134.583 155.453 1.00 481.98 ? 7   DT  J P     1 
ATOM   8894  O OP1   . DT  J 7  7   ? 115.994 135.037 155.218 1.00 461.77 ? 7   DT  J OP1   1 
ATOM   8895  O OP2   . DT  J 7  7   ? 117.724 133.819 156.685 1.00 462.69 ? 7   DT  J OP2   1 
ATOM   8896  O "O5'" . DT  J 7  7   ? 117.860 133.724 154.189 1.00 497.67 ? 7   DT  J "O5'" 1 
ATOM   8897  C "C5'" . DT  J 7  7   ? 117.802 134.306 152.869 1.00 480.43 ? 7   DT  J "C5'" 1 
ATOM   8898  C "C4'" . DT  J 7  7   ? 118.386 133.397 151.807 1.00 456.97 ? 7   DT  J "C4'" 1 
ATOM   8899  O "O4'" . DT  J 7  7   ? 119.836 133.374 151.901 1.00 501.15 ? 7   DT  J "O4'" 1 
ATOM   8900  C "C3'" . DT  J 7  7   ? 117.946 131.930 151.822 1.00 470.01 ? 7   DT  J "C3'" 1 
ATOM   8901  O "O3'" . DT  J 7  7   ? 117.741 131.511 150.452 1.00 446.33 ? 7   DT  J "O3'" 1 
ATOM   8902  C "C2'" . DT  J 7  7   ? 119.160 131.251 152.454 1.00 491.25 ? 7   DT  J "C2'" 1 
ATOM   8903  C "C1'" . DT  J 7  7   ? 120.284 132.034 151.795 1.00 499.95 ? 7   DT  J "C1'" 1 
ATOM   8904  N N1    . DT  J 7  7   ? 121.644 131.963 152.390 1.00 510.71 ? 7   DT  J N1    1 
ATOM   8905  C C2    . DT  J 7  7   ? 122.732 131.772 151.548 1.00 519.74 ? 7   DT  J C2    1 
ATOM   8906  O O2    . DT  J 7  7   ? 122.645 131.655 150.335 1.00 529.44 ? 7   DT  J O2    1 
ATOM   8907  N N3    . DT  J 7  7   ? 123.948 131.722 152.181 1.00 537.42 ? 7   DT  J N3    1 
ATOM   8908  C C4    . DT  J 7  7   ? 124.190 131.837 153.532 1.00 532.88 ? 7   DT  J C4    1 
ATOM   8909  O O4    . DT  J 7  7   ? 125.343 131.776 153.965 1.00 600.00 ? 7   DT  J O4    1 
ATOM   8910  C C5    . DT  J 7  7   ? 123.021 132.032 154.348 1.00 530.35 ? 7   DT  J C5    1 
ATOM   8911  C C7    . DT  J 7  7   ? 123.196 132.165 155.822 1.00 516.54 ? 7   DT  J C7    1 
ATOM   8912  C C6    . DT  J 7  7   ? 121.828 132.084 153.749 1.00 530.05 ? 7   DT  J C6    1 
ATOM   8913  P P     . DG  J 7  8   ? 116.896 130.171 150.071 1.00 431.39 ? 8   DG  J P     1 
ATOM   8914  O OP1   . DG  J 7  8   ? 115.655 130.593 149.377 1.00 410.90 ? 8   DG  J OP1   1 
ATOM   8915  O OP2   . DG  J 7  8   ? 116.813 129.299 151.271 1.00 441.79 ? 8   DG  J OP2   1 
ATOM   8916  O "O5'" . DG  J 7  8   ? 117.856 129.447 149.020 1.00 426.37 ? 8   DG  J "O5'" 1 
ATOM   8917  C "C5'" . DG  J 7  8   ? 119.051 128.807 149.502 1.00 455.30 ? 8   DG  J "C5'" 1 
ATOM   8918  C "C4'" . DG  J 7  8   ? 119.928 128.256 148.402 1.00 433.37 ? 8   DG  J "C4'" 1 
ATOM   8919  O "O4'" . DG  J 7  8   ? 121.299 128.618 148.716 1.00 467.10 ? 8   DG  J "O4'" 1 
ATOM   8920  C "C3'" . DG  J 7  8   ? 119.943 126.733 148.257 1.00 469.51 ? 8   DG  J "C3'" 1 
ATOM   8921  O "O3'" . DG  J 7  8   ? 120.330 126.361 146.912 1.00 451.34 ? 8   DG  J "O3'" 1 
ATOM   8922  C "C2'" . DG  J 7  8   ? 120.994 126.342 149.288 1.00 486.03 ? 8   DG  J "C2'" 1 
ATOM   8923  C "C1'" . DG  J 7  8   ? 121.989 127.497 149.260 1.00 505.28 ? 8   DG  J "C1'" 1 
ATOM   8924  N N9    . DG  J 7  8   ? 122.535 127.825 150.590 1.00 536.42 ? 8   DG  J N9    1 
ATOM   8925  C C8    . DG  J 7  8   ? 121.839 128.124 151.742 1.00 526.42 ? 8   DG  J C8    1 
ATOM   8926  N N7    . DG  J 7  8   ? 122.610 128.368 152.767 1.00 539.77 ? 8   DG  J N7    1 
ATOM   8927  C C5    . DG  J 7  8   ? 123.896 128.224 152.273 1.00 559.55 ? 8   DG  J C5    1 
ATOM   8928  C C6    . DG  J 7  8   ? 125.154 128.367 152.922 1.00 549.17 ? 8   DG  J C6    1 
ATOM   8929  O O6    . DG  J 7  8   ? 125.379 128.659 154.106 1.00 600.00 ? 8   DG  J O6    1 
ATOM   8930  N N1    . DG  J 7  8   ? 126.213 128.131 152.050 1.00 593.19 ? 8   DG  J N1    1 
ATOM   8931  C C2    . DG  J 7  8   ? 126.079 127.801 150.725 1.00 600.00 ? 8   DG  J C2    1 
ATOM   8932  N N2    . DG  J 7  8   ? 127.211 127.605 150.023 1.00 563.66 ? 8   DG  J N2    1 
ATOM   8933  N N3    . DG  J 7  8   ? 124.912 127.667 150.114 1.00 557.20 ? 8   DG  J N3    1 
ATOM   8934  C C4    . DG  J 7  8   ? 123.868 127.888 150.937 1.00 535.82 ? 8   DG  J C4    1 
ATOM   8935  P P     . DT  J 7  9   ? 120.259 124.841 146.339 1.00 405.50 ? 9   DT  J P     1 
ATOM   8936  O OP1   . DT  J 7  9   ? 119.947 124.892 144.888 1.00 433.16 ? 9   DT  J OP1   1 
ATOM   8937  O OP2   . DT  J 7  9   ? 119.408 124.026 147.248 1.00 450.81 ? 9   DT  J OP2   1 
ATOM   8938  O "O5'" . DT  J 7  9   ? 121.767 124.336 146.504 1.00 477.98 ? 9   DT  J "O5'" 1 
ATOM   8939  C "C5'" . DT  J 7  9   ? 122.819 125.003 145.778 1.00 496.55 ? 9   DT  J "C5'" 1 
ATOM   8940  C "C4'" . DT  J 7  9   ? 124.189 124.430 146.085 1.00 471.37 ? 9   DT  J "C4'" 1 
ATOM   8941  O "O4'" . DT  J 7  9   ? 124.622 124.895 147.388 1.00 516.57 ? 9   DT  J "O4'" 1 
ATOM   8942  C "C3'" . DT  J 7  9   ? 124.318 122.903 146.085 1.00 473.09 ? 9   DT  J "C3'" 1 
ATOM   8943  O "O3'" . DT  J 7  9   ? 125.285 122.531 145.067 1.00 520.27 ? 9   DT  J "O3'" 1 
ATOM   8944  C "C2'" . DT  J 7  9   ? 124.799 122.576 147.505 1.00 504.61 ? 9   DT  J "C2'" 1 
ATOM   8945  C "C1'" . DT  J 7  9   ? 125.355 123.883 148.049 1.00 570.92 ? 9   DT  J "C1'" 1 
ATOM   8946  N N1    . DT  J 7  9   ? 125.203 124.108 149.515 1.00 537.42 ? 9   DT  J N1    1 
ATOM   8947  C C2    . DT  J 7  9   ? 126.326 124.354 150.299 1.00 536.99 ? 9   DT  J C2    1 
ATOM   8948  O O2    . DT  J 7  9   ? 127.461 124.398 149.848 1.00 563.04 ? 9   DT  J O2    1 
ATOM   8949  N N3    . DT  J 7  9   ? 126.066 124.548 151.644 1.00 562.39 ? 9   DT  J N3    1 
ATOM   8950  C C4    . DT  J 7  9   ? 124.834 124.519 152.265 1.00 560.32 ? 9   DT  J C4    1 
ATOM   8951  O O4    . DT  J 7  9   ? 124.725 124.709 153.482 1.00 575.29 ? 9   DT  J O4    1 
ATOM   8952  C C5    . DT  J 7  9   ? 123.719 124.256 151.393 1.00 506.16 ? 9   DT  J C5    1 
ATOM   8953  C C7    . DT  J 7  9   ? 122.355 124.217 151.995 1.00 535.94 ? 9   DT  J C7    1 
ATOM   8954  C C6    . DT  J 7  9   ? 123.953 124.068 150.088 1.00 526.56 ? 9   DT  J C6    1 
ATOM   8955  P P     . DA  J 7  10  ? 125.664 121.009 144.638 1.00 500.01 ? 10  DA  J P     1 
ATOM   8956  O OP1   . DA  J 7  10  ? 125.934 120.999 143.163 1.00 388.38 ? 10  DA  J OP1   1 
ATOM   8957  O OP2   . DA  J 7  10  ? 124.627 120.091 145.177 1.00 423.82 ? 10  DA  J OP2   1 
ATOM   8958  O "O5'" . DA  J 7  10  ? 127.034 120.739 145.441 1.00 523.84 ? 10  DA  J "O5'" 1 
ATOM   8959  C "C5'" . DA  J 7  10  ? 128.196 121.586 145.249 1.00 536.54 ? 10  DA  J "C5'" 1 
ATOM   8960  C "C4'" . DA  J 7  10  ? 129.281 121.393 146.304 1.00 528.40 ? 10  DA  J "C4'" 1 
ATOM   8961  O "O4'" . DA  J 7  10  ? 128.819 121.852 147.605 1.00 529.49 ? 10  DA  J "O4'" 1 
ATOM   8962  C "C3'" . DA  J 7  10  ? 129.808 119.965 146.528 1.00 517.84 ? 10  DA  J "C3'" 1 
ATOM   8963  O "O3'" . DA  J 7  10  ? 131.255 120.002 146.618 1.00 480.63 ? 10  DA  J "O3'" 1 
ATOM   8964  C "C2'" . DA  J 7  10  ? 129.182 119.596 147.868 1.00 542.27 ? 10  DA  J "C2'" 1 
ATOM   8965  C "C1'" . DA  J 7  10  ? 129.230 120.923 148.595 1.00 545.60 ? 10  DA  J "C1'" 1 
ATOM   8966  N N9    . DA  J 7  10  ? 128.335 121.013 149.759 1.00 600.00 ? 10  DA  J N9    1 
ATOM   8967  C C8    . DA  J 7  10  ? 126.982 120.805 149.801 1.00 514.43 ? 10  DA  J C8    1 
ATOM   8968  N N7    . DA  J 7  10  ? 126.448 120.956 150.988 1.00 600.00 ? 10  DA  J N7    1 
ATOM   8969  C C5    . DA  J 7  10  ? 127.525 121.288 151.791 1.00 568.34 ? 10  DA  J C5    1 
ATOM   8970  C C6    . DA  J 7  10  ? 127.620 121.579 153.159 1.00 600.00 ? 10  DA  J C6    1 
ATOM   8971  N N6    . DA  J 7  10  ? 126.563 121.569 153.965 1.00 600.00 ? 10  DA  J N6    1 
ATOM   8972  N N1    . DA  J 7  10  ? 128.842 121.873 153.665 1.00 600.00 ? 10  DA  J N1    1 
ATOM   8973  C C2    . DA  J 7  10  ? 129.880 121.871 152.816 1.00 600.00 ? 10  DA  J C2    1 
ATOM   8974  N N3    . DA  J 7  10  ? 129.907 121.618 151.515 1.00 570.51 ? 10  DA  J N3    1 
ATOM   8975  C C4    . DA  J 7  10  ? 128.689 121.328 151.051 1.00 576.51 ? 10  DA  J C4    1 
ATOM   8976  P P     . DT  J 7  11  ? 132.203 118.682 146.636 1.00 527.70 ? 11  DT  J P     1 
ATOM   8977  O OP1   . DT  J 7  11  ? 133.461 118.990 145.905 1.00 468.22 ? 11  DT  J OP1   1 
ATOM   8978  O OP2   . DT  J 7  11  ? 131.398 117.515 146.189 1.00 478.31 ? 11  DT  J OP2   1 
ATOM   8979  O "O5'" . DT  J 7  11  ? 132.561 118.480 148.189 1.00 540.71 ? 11  DT  J "O5'" 1 
ATOM   8980  C "C5'" . DT  J 7  11  ? 133.540 119.334 148.829 1.00 549.99 ? 11  DT  J "C5'" 1 
ATOM   8981  C "C4'" . DT  J 7  11  ? 133.715 119.060 150.318 1.00 600.00 ? 11  DT  J "C4'" 1 
ATOM   8982  O "O4'" . DT  J 7  11  ? 132.481 119.333 151.038 1.00 562.44 ? 11  DT  J "O4'" 1 
ATOM   8983  C "C3'" . DT  J 7  11  ? 134.136 117.643 150.733 1.00 600.00 ? 11  DT  J "C3'" 1 
ATOM   8984  O "O3'" . DT  J 7  11  ? 135.120 117.732 151.791 1.00 543.71 ? 11  DT  J "O3'" 1 
ATOM   8985  C "C2'" . DT  J 7  11  ? 132.828 117.072 151.254 1.00 600.00 ? 11  DT  J "C2'" 1 
ATOM   8986  C "C1'" . DT  J 7  11  ? 132.260 118.287 151.963 1.00 561.55 ? 11  DT  J "C1'" 1 
ATOM   8987  N N1    . DT  J 7  11  ? 130.821 118.225 152.321 1.00 600.00 ? 11  DT  J N1    1 
ATOM   8988  C C2    . DT  J 7  11  ? 130.448 118.558 153.614 1.00 600.00 ? 11  DT  J C2    1 
ATOM   8989  O O2    . DT  J 7  11  ? 131.247 118.900 154.470 1.00 600.00 ? 11  DT  J O2    1 
ATOM   8990  N N3    . DT  J 7  11  ? 129.098 118.475 153.863 1.00 600.00 ? 11  DT  J N3    1 
ATOM   8991  C C4    . DT  J 7  11  ? 128.103 118.105 152.982 1.00 600.00 ? 11  DT  J C4    1 
ATOM   8992  O O4    . DT  J 7  11  ? 126.912 118.071 153.337 1.00 600.00 ? 11  DT  J O4    1 
ATOM   8993  C C5    . DT  J 7  11  ? 128.557 117.771 151.657 1.00 561.92 ? 11  DT  J C5    1 
ATOM   8994  C C7    . DT  J 7  11  ? 127.532 117.357 150.655 1.00 600.00 ? 11  DT  J C7    1 
ATOM   8995  C C6    . DT  J 7  11  ? 129.869 117.845 151.393 1.00 600.00 ? 11  DT  J C6    1 
ATOM   8996  P P     . DA  J 7  12  ? 136.148 116.539 152.182 1.00 556.54 ? 12  DA  J P     1 
ATOM   8997  O OP1   . DA  J 7  12  ? 137.529 117.068 152.066 1.00 600.00 ? 12  DA  J OP1   1 
ATOM   8998  O OP2   . DA  J 7  12  ? 135.752 115.316 151.434 1.00 561.13 ? 12  DA  J OP2   1 
ATOM   8999  O "O5'" . DA  J 7  12  ? 135.838 116.276 153.732 1.00 582.62 ? 12  DA  J "O5'" 1 
ATOM   9000  C "C5'" . DA  J 7  12  ? 136.436 117.108 154.750 1.00 600.00 ? 12  DA  J "C5'" 1 
ATOM   9001  C "C4'" . DA  J 7  12  ? 136.106 116.652 156.167 1.00 600.00 ? 12  DA  J "C4'" 1 
ATOM   9002  O "O4'" . DA  J 7  12  ? 134.706 116.900 156.475 1.00 600.00 ? 12  DA  J "O4'" 1 
ATOM   9003  C "C3'" . DA  J 7  12  ? 136.353 115.175 156.505 1.00 600.00 ? 12  DA  J "C3'" 1 
ATOM   9004  O "O3'" . DA  J 7  12  ? 136.762 115.073 157.892 1.00 600.00 ? 12  DA  J "O3'" 1 
ATOM   9005  C "C2'" . DA  J 7  12  ? 134.978 114.577 156.268 1.00 600.00 ? 12  DA  J "C2'" 1 
ATOM   9006  C "C1'" . DA  J 7  12  ? 134.072 115.664 156.802 1.00 600.00 ? 12  DA  J "C1'" 1 
ATOM   9007  N N9    . DA  J 7  12  ? 132.744 115.586 156.208 1.00 600.00 ? 12  DA  J N9    1 
ATOM   9008  C C8    . DA  J 7  12  ? 132.429 115.571 154.876 1.00 600.00 ? 12  DA  J C8    1 
ATOM   9009  N N7    . DA  J 7  12  ? 131.140 115.493 154.638 1.00 600.00 ? 12  DA  J N7    1 
ATOM   9010  C C5    . DA  J 7  12  ? 130.572 115.452 155.898 1.00 600.00 ? 12  DA  J C5    1 
ATOM   9011  C C6    . DA  J 7  12  ? 129.241 115.371 156.323 1.00 600.00 ? 12  DA  J C6    1 
ATOM   9012  N N6    . DA  J 7  12  ? 128.212 115.308 155.473 1.00 600.00 ? 12  DA  J N6    1 
ATOM   9013  N N1    . DA  J 7  12  ? 129.012 115.351 157.662 1.00 600.00 ? 12  DA  J N1    1 
ATOM   9014  C C2    . DA  J 7  12  ? 130.060 115.416 158.494 1.00 600.00 ? 12  DA  J C2    1 
ATOM   9015  N N3    . DA  J 7  12  ? 131.352 115.495 158.203 1.00 600.00 ? 12  DA  J N3    1 
ATOM   9016  C C4    . DA  J 7  12  ? 131.545 115.511 156.875 1.00 600.00 ? 12  DA  J C4    1 
ATOM   9017  P P     . DT  J 7  13  ? 137.154 113.685 158.641 1.00 600.00 ? 13  DT  J P     1 
ATOM   9018  O OP1   . DT  J 7  13  ? 138.138 113.992 159.707 1.00 600.00 ? 13  DT  J OP1   1 
ATOM   9019  O OP2   . DT  J 7  13  ? 137.470 112.653 157.616 1.00 600.00 ? 13  DT  J OP2   1 
ATOM   9020  O "O5'" . DT  J 7  13  ? 135.779 113.281 159.339 1.00 600.00 ? 13  DT  J "O5'" 1 
ATOM   9021  C "C5'" . DT  J 7  13  ? 135.345 111.909 159.377 1.00 600.00 ? 13  DT  J "C5'" 1 
ATOM   9022  C "C4'" . DT  J 7  13  ? 134.137 111.746 160.277 1.00 600.00 ? 13  DT  J "C4'" 1 
ATOM   9023  O "O4'" . DT  J 7  13  ? 132.986 112.381 159.665 1.00 600.00 ? 13  DT  J "O4'" 1 
ATOM   9024  C "C3'" . DT  J 7  13  ? 133.742 110.296 160.564 1.00 600.00 ? 13  DT  J "C3'" 1 
ATOM   9025  O "O3'" . DT  J 7  13  ? 133.838 110.043 161.983 1.00 600.00 ? 13  DT  J "O3'" 1 
ATOM   9026  C "C2'" . DT  J 7  13  ? 132.300 110.172 160.075 1.00 600.00 ? 13  DT  J "C2'" 1 
ATOM   9027  C "C1'" . DT  J 7  13  ? 131.824 111.587 159.830 1.00 600.00 ? 13  DT  J "C1'" 1 
ATOM   9028  N N1    . DT  J 7  13  ? 131.002 111.708 158.608 1.00 600.00 ? 13  DT  J N1    1 
ATOM   9029  C C2    . DT  J 7  13  ? 129.620 111.697 158.715 1.00 594.43 ? 13  DT  J C2    1 
ATOM   9030  O O2    . DT  J 7  13  ? 129.030 111.591 159.785 1.00 600.00 ? 13  DT  J O2    1 
ATOM   9031  N N3    . DT  J 7  13  ? 128.962 111.820 157.512 1.00 600.00 ? 13  DT  J N3    1 
ATOM   9032  C C4    . DT  J 7  13  ? 129.527 111.948 156.256 1.00 589.41 ? 13  DT  J C4    1 
ATOM   9033  O O4    . DT  J 7  13  ? 128.819 112.053 155.245 1.00 600.00 ? 13  DT  J O4    1 
ATOM   9034  C C5    . DT  J 7  13  ? 130.969 111.951 156.231 1.00 600.00 ? 13  DT  J C5    1 
ATOM   9035  C C7    . DT  J 7  13  ? 131.683 112.082 154.926 1.00 600.00 ? 13  DT  J C7    1 
ATOM   9036  C C6    . DT  J 7  13  ? 131.620 111.833 157.386 1.00 600.00 ? 13  DT  J C6    1 
ATOM   9037  P P     . DA  J 7  14  ? 134.040 108.558 162.604 1.00 589.83 ? 14  DA  J P     1 
ATOM   9038  O OP1   . DA  J 7  14  ? 134.468 108.700 164.019 1.00 600.00 ? 14  DA  J OP1   1 
ATOM   9039  O OP2   . DA  J 7  14  ? 134.870 107.760 161.662 1.00 600.00 ? 14  DA  J OP2   1 
ATOM   9040  O "O5'" . DA  J 7  14  ? 132.561 107.956 162.589 1.00 600.00 ? 14  DA  J "O5'" 1 
ATOM   9041  C "C5'" . DA  J 7  14  ? 131.594 108.391 163.565 1.00 600.00 ? 14  DA  J "C5'" 1 
ATOM   9042  C "C4'" . DA  J 7  14  ? 130.298 107.617 163.450 1.00 600.00 ? 14  DA  J "C4'" 1 
ATOM   9043  O "O4'" . DA  J 7  14  ? 129.537 108.111 162.322 1.00 557.34 ? 14  DA  J "O4'" 1 
ATOM   9044  C "C3'" . DA  J 7  14  ? 130.438 106.101 163.271 1.00 600.00 ? 14  DA  J "C3'" 1 
ATOM   9045  O "O3'" . DA  J 7  14  ? 129.640 105.449 164.285 1.00 600.00 ? 14  DA  J "O3'" 1 
ATOM   9046  C "C2'" . DA  J 7  14  ? 129.914 105.844 161.855 1.00 600.00 ? 14  DA  J "C2'" 1 
ATOM   9047  C "C1'" . DA  J 7  14  ? 129.008 107.030 161.574 1.00 554.65 ? 14  DA  J "C1'" 1 
ATOM   9048  N N9    . DA  J 7  14  ? 128.975 107.450 160.171 1.00 544.26 ? 14  DA  J N9    1 
ATOM   9049  C C8    . DA  J 7  14  ? 130.036 107.687 159.341 1.00 563.27 ? 14  DA  J C8    1 
ATOM   9050  N N7    . DA  J 7  14  ? 129.700 108.055 158.130 1.00 544.54 ? 14  DA  J N7    1 
ATOM   9051  C C5    . DA  J 7  14  ? 128.318 108.058 158.163 1.00 600.00 ? 14  DA  J C5    1 
ATOM   9052  C C6    . DA  J 7  14  ? 127.357 108.361 157.189 1.00 540.40 ? 14  DA  J C6    1 
ATOM   9053  N N6    . DA  J 7  14  ? 127.680 108.729 155.953 1.00 554.15 ? 14  DA  J N6    1 
ATOM   9054  N N1    . DA  J 7  14  ? 126.052 108.267 157.537 1.00 521.93 ? 14  DA  J N1    1 
ATOM   9055  C C2    . DA  J 7  14  ? 125.762 107.895 158.790 1.00 532.84 ? 14  DA  J C2    1 
ATOM   9056  N N3    . DA  J 7  14  ? 126.581 107.589 159.789 1.00 528.59 ? 14  DA  J N3    1 
ATOM   9057  C C4    . DA  J 7  14  ? 127.859 107.689 159.411 1.00 533.89 ? 14  DA  J C4    1 
ATOM   9058  P P     . DT  J 7  15  ? 129.670 103.857 164.590 1.00 569.71 ? 15  DT  J P     1 
ATOM   9059  O OP1   . DT  J 7  15  ? 129.400 103.657 166.037 1.00 600.00 ? 15  DT  J OP1   1 
ATOM   9060  O OP2   . DT  J 7  15  ? 130.891 103.265 163.980 1.00 600.00 ? 15  DT  J OP2   1 
ATOM   9061  O "O5'" . DT  J 7  15  ? 128.405 103.335 163.764 1.00 534.61 ? 15  DT  J "O5'" 1 
ATOM   9062  C "C5'" . DT  J 7  15  ? 127.089 103.859 164.038 1.00 502.10 ? 15  DT  J "C5'" 1 
ATOM   9063  C "C4'" . DT  J 7  15  ? 126.087 103.417 162.994 1.00 518.82 ? 15  DT  J "C4'" 1 
ATOM   9064  O "O4'" . DT  J 7  15  ? 126.275 104.177 161.778 1.00 517.64 ? 15  DT  J "O4'" 1 
ATOM   9065  C "C3'" . DT  J 7  15  ? 126.143 101.942 162.584 1.00 502.74 ? 15  DT  J "C3'" 1 
ATOM   9066  O "O3'" . DT  J 7  15  ? 125.034 101.255 163.213 1.00 485.91 ? 15  DT  J "O3'" 1 
ATOM   9067  C "C2'" . DT  J 7  15  ? 126.029 101.984 161.054 1.00 506.12 ? 15  DT  J "C2'" 1 
ATOM   9068  C "C1'" . DT  J 7  15  ? 125.748 103.428 160.707 1.00 496.77 ? 15  DT  J "C1'" 1 
ATOM   9069  N N1    . DT  J 7  15  ? 126.388 103.872 159.453 1.00 562.52 ? 15  DT  J N1    1 
ATOM   9070  C C2    . DT  J 7  15  ? 125.595 104.304 158.405 1.00 486.21 ? 15  DT  J C2    1 
ATOM   9071  O O2    . DT  J 7  15  ? 124.376 104.338 158.463 1.00 497.87 ? 15  DT  J O2    1 
ATOM   9072  N N3    . DT  J 7  15  ? 126.290 104.694 157.286 1.00 460.57 ? 15  DT  J N3    1 
ATOM   9073  C C4    . DT  J 7  15  ? 127.663 104.691 157.123 1.00 493.21 ? 15  DT  J C4    1 
ATOM   9074  O O4    . DT  J 7  15  ? 128.176 105.068 156.073 1.00 501.78 ? 15  DT  J O4    1 
ATOM   9075  C C5    . DT  J 7  15  ? 128.417 104.227 158.257 1.00 510.22 ? 15  DT  J C5    1 
ATOM   9076  C C7    . DT  J 7  15  ? 129.901 104.192 158.160 1.00 504.85 ? 15  DT  J C7    1 
ATOM   9077  C C6    . DT  J 7  15  ? 127.755 103.846 159.347 1.00 492.06 ? 15  DT  J C6    1 
ATOM   9078  P P     . DC  J 7  16  ? 124.716 99.673  163.047 1.00 537.24 ? 16  DC  J P     1 
ATOM   9079  O OP1   . DC  J 7  16  ? 123.911 99.220  164.211 1.00 551.55 ? 16  DC  J OP1   1 
ATOM   9080  O OP2   . DC  J 7  16  ? 125.962 98.956  162.662 1.00 563.28 ? 16  DC  J OP2   1 
ATOM   9081  O "O5'" . DC  J 7  16  ? 123.797 99.610  161.734 1.00 521.24 ? 16  DC  J "O5'" 1 
ATOM   9082  C "C5'" . DC  J 7  16  ? 122.656 100.491 161.586 1.00 519.66 ? 16  DC  J "C5'" 1 
ATOM   9083  C "C4'" . DC  J 7  16  ? 122.021 100.381 160.213 1.00 504.52 ? 16  DC  J "C4'" 1 
ATOM   9084  O "O4'" . DC  J 7  16  ? 122.846 101.008 159.196 1.00 455.83 ? 16  DC  J "O4'" 1 
ATOM   9085  C "C3'" . DC  J 7  16  ? 121.738 98.961  159.737 1.00 574.17 ? 16  DC  J "C3'" 1 
ATOM   9086  O "O3'" . DC  J 7  16  ? 120.347 98.930  159.356 1.00 479.86 ? 16  DC  J "O3'" 1 
ATOM   9087  C "C2'" . DC  J 7  16  ? 122.713 98.760  158.574 1.00 485.19 ? 16  DC  J "C2'" 1 
ATOM   9088  C "C1'" . DC  J 7  16  ? 123.001 100.161 158.064 1.00 473.51 ? 16  DC  J "C1'" 1 
ATOM   9089  N N1    . DC  J 7  16  ? 124.358 100.435 157.526 1.00 460.89 ? 16  DC  J N1    1 
ATOM   9090  C C2    . DC  J 7  16  ? 124.521 101.034 156.259 1.00 456.57 ? 16  DC  J C2    1 
ATOM   9091  O O2    . DC  J 7  16  ? 123.538 101.334 155.574 1.00 447.75 ? 16  DC  J O2    1 
ATOM   9092  N N3    . DC  J 7  16  ? 125.760 101.283 155.783 1.00 446.51 ? 16  DC  J N3    1 
ATOM   9093  C C4    . DC  J 7  16  ? 126.823 100.960 156.521 1.00 449.00 ? 16  DC  J C4    1 
ATOM   9094  N N4    . DC  J 7  16  ? 128.039 101.215 156.032 1.00 461.65 ? 16  DC  J N4    1 
ATOM   9095  C C5    . DC  J 7  16  ? 126.694 100.354 157.799 1.00 459.75 ? 16  DC  J C5    1 
ATOM   9096  C C6    . DC  J 7  16  ? 125.462 100.115 158.256 1.00 480.53 ? 16  DC  J C6    1 
ATOM   9097  P P     . DT  J 7  17  ? 119.542 97.635  158.816 1.00 441.09 ? 17  DT  J P     1 
ATOM   9098  O OP1   . DT  J 7  17  ? 118.171 97.662  159.384 1.00 483.01 ? 17  DT  J OP1   1 
ATOM   9099  O OP2   . DT  J 7  17  ? 120.396 96.427  158.979 1.00 477.37 ? 17  DT  J OP2   1 
ATOM   9100  O "O5'" . DT  J 7  17  ? 119.442 97.969  157.258 1.00 441.12 ? 17  DT  J "O5'" 1 
ATOM   9101  C "C5'" . DT  J 7  17  ? 119.200 99.328  156.832 1.00 469.59 ? 17  DT  J "C5'" 1 
ATOM   9102  C "C4'" . DT  J 7  17  ? 118.765 99.386  155.391 1.00 436.86 ? 17  DT  J "C4'" 1 
ATOM   9103  O "O4'" . DT  J 7  17  ? 119.914 99.584  154.532 1.00 435.24 ? 17  DT  J "O4'" 1 
ATOM   9104  C "C3'" . DT  J 7  17  ? 118.064 98.140  154.887 1.00 442.86 ? 17  DT  J "C3'" 1 
ATOM   9105  O "O3'" . DT  J 7  17  ? 117.097 98.536  153.893 1.00 438.43 ? 17  DT  J "O3'" 1 
ATOM   9106  C "C2'" . DT  J 7  17  ? 119.211 97.333  154.294 1.00 433.90 ? 17  DT  J "C2'" 1 
ATOM   9107  C "C1'" . DT  J 7  17  ? 120.247 98.380  153.854 1.00 440.86 ? 17  DT  J "C1'" 1 
ATOM   9108  N N1    . DT  J 7  17  ? 121.704 98.126  154.093 1.00 443.04 ? 17  DT  J N1    1 
ATOM   9109  C C2    . DT  J 7  17  ? 122.603 98.708  153.210 1.00 438.16 ? 17  DT  J C2    1 
ATOM   9110  O O2    . DT  J 7  17  ? 122.255 99.402  152.263 1.00 442.73 ? 17  DT  J O2    1 
ATOM   9111  N N3    . DT  J 7  17  ? 123.933 98.454  153.468 1.00 450.96 ? 17  DT  J N3    1 
ATOM   9112  C C4    . DT  J 7  17  ? 124.452 97.696  154.489 1.00 421.42 ? 17  DT  J C4    1 
ATOM   9113  O O4    . DT  J 7  17  ? 125.667 97.538  154.622 1.00 438.08 ? 17  DT  J O4    1 
ATOM   9114  C C5    . DT  J 7  17  ? 123.481 97.120  155.367 1.00 444.60 ? 17  DT  J C5    1 
ATOM   9115  C C7    . DT  J 7  17  ? 123.986 96.283  156.495 1.00 470.52 ? 17  DT  J C7    1 
ATOM   9116  C C6    . DT  J 7  17  ? 122.179 97.351  155.140 1.00 450.19 ? 17  DT  J C6    1 
ATOM   9117  P P     . DG  J 7  18  ? 115.815 97.648  153.453 1.00 445.51 ? 18  DG  J P     1 
ATOM   9118  O OP1   . DG  J 7  18  ? 114.610 98.510  153.553 1.00 440.21 ? 18  DG  J OP1   1 
ATOM   9119  O OP2   . DG  J 7  18  ? 115.840 96.340  154.163 1.00 442.51 ? 18  DG  J OP2   1 
ATOM   9120  O "O5'" . DG  J 7  18  ? 116.113 97.377  151.905 1.00 439.24 ? 18  DG  J "O5'" 1 
ATOM   9121  C "C5'" . DG  J 7  18  ? 115.715 98.353  150.920 1.00 437.65 ? 18  DG  J "C5'" 1 
ATOM   9122  C "C4'" . DG  J 7  18  ? 116.689 98.413  149.759 1.00 426.29 ? 18  DG  J "C4'" 1 
ATOM   9123  O "O4'" . DG  J 7  18  ? 118.027 98.125  150.227 1.00 431.53 ? 18  DG  J "O4'" 1 
ATOM   9124  C "C3'" . DG  J 7  18  ? 116.412 97.471  148.582 1.00 423.93 ? 18  DG  J "C3'" 1 
ATOM   9125  O "O3'" . DG  J 7  18  ? 116.383 98.284  147.384 1.00 420.12 ? 18  DG  J "O3'" 1 
ATOM   9126  C "C2'" . DG  J 7  18  ? 117.570 96.466  148.619 1.00 425.22 ? 18  DG  J "C2'" 1 
ATOM   9127  C "C1'" . DG  J 7  18  ? 118.666 97.156  149.415 1.00 421.30 ? 18  DG  J "C1'" 1 
ATOM   9128  N N9    . DG  J 7  18  ? 119.401 96.300  150.346 1.00 430.38 ? 18  DG  J N9    1 
ATOM   9129  C C8    . DG  J 7  18  ? 118.867 95.386  151.219 1.00 433.99 ? 18  DG  J C8    1 
ATOM   9130  N N7    . DG  J 7  18  ? 119.767 94.765  151.932 1.00 436.38 ? 18  DG  J N7    1 
ATOM   9131  C C5    . DG  J 7  18  ? 120.964 95.299  151.509 1.00 430.54 ? 18  DG  J C5    1 
ATOM   9132  C C6    . DG  J 7  18  ? 122.276 95.001  151.935 1.00 432.93 ? 18  DG  J C6    1 
ATOM   9133  O O6    . DG  J 7  18  ? 122.627 94.187  152.798 1.00 434.26 ? 18  DG  J O6    1 
ATOM   9134  N N1    . DG  J 7  18  ? 123.208 95.759  151.254 1.00 419.37 ? 18  DG  J N1    1 
ATOM   9135  C C2    . DG  J 7  18  ? 122.918 96.683  150.288 1.00 425.97 ? 18  DG  J C2    1 
ATOM   9136  N N2    . DG  J 7  18  ? 123.967 97.312  149.752 1.00 426.87 ? 18  DG  J N2    1 
ATOM   9137  N N3    . DG  J 7  18  ? 121.693 96.977  149.879 1.00 426.63 ? 18  DG  J N3    1 
ATOM   9138  C C4    . DG  J 7  18  ? 120.764 96.246  150.528 1.00 426.13 ? 18  DG  J C4    1 
ATOM   9139  P P     . DA  J 7  19  ? 116.032 97.741  145.898 1.00 403.02 ? 19  DA  J P     1 
ATOM   9140  O OP1   . DA  J 7  19  ? 115.512 98.878  145.094 1.00 420.69 ? 19  DA  J OP1   1 
ATOM   9141  O OP2   . DA  J 7  19  ? 115.221 96.499  146.025 1.00 422.07 ? 19  DA  J OP2   1 
ATOM   9142  O "O5'" . DA  J 7  19  ? 117.477 97.354  145.333 1.00 398.29 ? 19  DA  J "O5'" 1 
ATOM   9143  C "C5'" . DA  J 7  19  ? 118.555 98.316  145.363 1.00 391.15 ? 19  DA  J "C5'" 1 
ATOM   9144  C "C4'" . DA  J 7  19  ? 119.890 97.644  145.156 1.00 365.96 ? 19  DA  J "C4'" 1 
ATOM   9145  O "O4'" . DA  J 7  19  ? 120.283 96.919  146.342 1.00 392.41 ? 19  DA  J "O4'" 1 
ATOM   9146  C "C3'" . DA  J 7  19  ? 119.923 96.627  144.022 1.00 340.96 ? 19  DA  J "C3'" 1 
ATOM   9147  O "O3'" . DA  J 7  19  ? 120.680 97.185  142.938 1.00 311.66 ? 19  DA  J "O3'" 1 
ATOM   9148  C "C2'" . DA  J 7  19  ? 120.599 95.397  144.638 1.00 353.28 ? 19  DA  J "C2'" 1 
ATOM   9149  C "C1'" . DA  J 7  19  ? 121.160 95.887  145.949 1.00 377.51 ? 19  DA  J "C1'" 1 
ATOM   9150  N N9    . DA  J 7  19  ? 121.197 94.846  146.975 1.00 402.78 ? 19  DA  J N9    1 
ATOM   9151  C C8    . DA  J 7  19  ? 120.147 94.131  147.484 1.00 407.88 ? 19  DA  J C8    1 
ATOM   9152  N N7    . DA  J 7  19  ? 120.493 93.265  148.396 1.00 415.12 ? 19  DA  J N7    1 
ATOM   9153  C C5    . DA  J 7  19  ? 121.864 93.415  148.496 1.00 412.02 ? 19  DA  J C5    1 
ATOM   9154  C C6    . DA  J 7  19  ? 122.813 92.773  149.296 1.00 418.10 ? 19  DA  J C6    1 
ATOM   9155  N N6    . DA  J 7  19  ? 122.480 91.828  150.160 1.00 419.68 ? 19  DA  J N6    1 
ATOM   9156  N N1    . DA  J 7  19  ? 124.112 93.135  149.174 1.00 416.83 ? 19  DA  J N1    1 
ATOM   9157  C C2    . DA  J 7  19  ? 124.398 94.098  148.282 1.00 412.19 ? 19  DA  J C2    1 
ATOM   9158  N N3    . DA  J 7  19  ? 123.583 94.775  147.472 1.00 404.82 ? 19  DA  J N3    1 
ATOM   9159  C C4    . DA  J 7  19  ? 122.314 94.384  147.629 1.00 404.06 ? 19  DA  J C4    1 
ATOM   9160  P P     . DC  J 7  20  ? 120.863 96.417  141.543 1.00 237.49 ? 20  DC  J P     1 
ATOM   9161  O OP1   . DC  J 7  20  ? 121.173 97.407  140.471 1.00 159.39 ? 20  DC  J OP1   1 
ATOM   9162  O OP2   . DC  J 7  20  ? 119.763 95.431  141.356 1.00 243.63 ? 20  DC  J OP2   1 
ATOM   9163  O "O5'" . DC  J 7  20  ? 122.169 95.517  141.761 1.00 283.39 ? 20  DC  J "O5'" 1 
ATOM   9164  C "C5'" . DC  J 7  20  ? 123.482 96.097  141.663 1.00 256.32 ? 20  DC  J "C5'" 1 
ATOM   9165  C "C4'" . DC  J 7  20  ? 124.543 95.262  142.357 1.00 292.11 ? 20  DC  J "C4'" 1 
ATOM   9166  O "O4'" . DC  J 7  20  ? 124.040 94.663  143.571 1.00 336.13 ? 20  DC  J "O4'" 1 
ATOM   9167  C "C3'" . DC  J 7  20  ? 125.154 94.131  141.534 1.00 300.69 ? 20  DC  J "C3'" 1 
ATOM   9168  O "O3'" . DC  J 7  20  ? 126.510 94.495  141.194 1.00 282.80 ? 20  DC  J "O3'" 1 
ATOM   9169  C "C2'" . DC  J 7  20  ? 125.149 92.928  142.473 1.00 337.73 ? 20  DC  J "C2'" 1 
ATOM   9170  C "C1'" . DC  J 7  20  ? 124.746 93.465  143.823 1.00 350.92 ? 20  DC  J "C1'" 1 
ATOM   9171  N N1    . DC  J 7  20  ? 123.888 92.542  144.590 1.00 373.66 ? 20  DC  J N1    1 
ATOM   9172  C C2    . DC  J 7  20  ? 124.436 91.795  145.641 1.00 391.37 ? 20  DC  J C2    1 
ATOM   9173  O O2    . DC  J 7  20  ? 125.636 91.911  145.919 1.00 390.23 ? 20  DC  J O2    1 
ATOM   9174  N N3    . DC  J 7  20  ? 123.654 90.954  146.344 1.00 398.94 ? 20  DC  J N3    1 
ATOM   9175  C C4    . DC  J 7  20  ? 122.362 90.835  146.037 1.00 402.07 ? 20  DC  J C4    1 
ATOM   9176  N N4    . DC  J 7  20  ? 121.615 89.989  146.758 1.00 408.97 ? 20  DC  J N4    1 
ATOM   9177  C C5    . DC  J 7  20  ? 121.778 91.580  144.975 1.00 393.07 ? 20  DC  J C5    1 
ATOM   9178  C C6    . DC  J 7  20  ? 122.569 92.411  144.288 1.00 376.45 ? 20  DC  J C6    1 
ATOM   9179  P P     . DA  J 7  21  ? 127.388 93.749  140.057 1.00 269.84 ? 21  DA  J P     1 
ATOM   9180  O OP1   . DA  J 7  21  ? 128.395 94.736  139.581 1.00 205.72 ? 21  DA  J OP1   1 
ATOM   9181  O OP2   . DA  J 7  21  ? 126.463 93.071  139.112 1.00 277.61 ? 21  DA  J OP2   1 
ATOM   9182  O "O5'" . DA  J 7  21  ? 128.138 92.610  140.888 1.00 310.34 ? 21  DA  J "O5'" 1 
ATOM   9183  C "C5'" . DA  J 7  21  ? 129.078 92.960  141.921 1.00 315.09 ? 21  DA  J "C5'" 1 
ATOM   9184  C "C4'" . DA  J 7  21  ? 129.656 91.735  142.605 1.00 333.96 ? 21  DA  J "C4'" 1 
ATOM   9185  O "O4'" . DA  J 7  21  ? 128.654 91.123  143.460 1.00 357.21 ? 21  DA  J "O4'" 1 
ATOM   9186  C "C3'" . DA  J 7  21  ? 130.168 90.616  141.689 1.00 333.85 ? 21  DA  J "C3'" 1 
ATOM   9187  O "O3'" . DA  J 7  21  ? 131.364 90.048  142.269 1.00 335.01 ? 21  DA  J "O3'" 1 
ATOM   9188  C "C2'" . DA  J 7  21  ? 129.009 89.630  141.712 1.00 351.57 ? 21  DA  J "C2'" 1 
ATOM   9189  C "C1'" . DA  J 7  21  ? 128.543 89.741  143.151 1.00 366.38 ? 21  DA  J "C1'" 1 
ATOM   9190  N N9    . DA  J 7  21  ? 127.157 89.331  143.367 1.00 378.49 ? 21  DA  J N9    1 
ATOM   9191  C C8    . DA  J 7  21  ? 126.056 89.685  142.635 1.00 372.01 ? 21  DA  J C8    1 
ATOM   9192  N N7    . DA  J 7  21  ? 124.937 89.162  143.061 1.00 389.23 ? 21  DA  J N7    1 
ATOM   9193  C C5    . DA  J 7  21  ? 125.330 88.410  144.150 1.00 393.10 ? 21  DA  J C5    1 
ATOM   9194  C C6    . DA  J 7  21  ? 124.597 87.618  145.033 1.00 403.14 ? 21  DA  J C6    1 
ATOM   9195  N N6    . DA  J 7  21  ? 123.283 87.465  144.922 1.00 402.80 ? 21  DA  J N6    1 
ATOM   9196  N N1    . DA  J 7  21  ? 125.266 86.990  146.023 1.00 402.82 ? 21  DA  J N1    1 
ATOM   9197  C C2    . DA  J 7  21  ? 126.590 87.172  146.096 1.00 402.70 ? 21  DA  J C2    1 
ATOM   9198  N N3    . DA  J 7  21  ? 127.390 87.900  145.324 1.00 395.54 ? 21  DA  J N3    1 
ATOM   9199  C C4    . DA  J 7  21  ? 126.690 88.502  144.355 1.00 390.86 ? 21  DA  J C4    1 
ATOM   9200  P P     . DC  J 7  22  ? 132.313 88.980  141.509 1.00 310.09 ? 22  DC  J P     1 
ATOM   9201  O OP1   . DC  J 7  22  ? 133.710 89.193  141.959 1.00 328.59 ? 22  DC  J OP1   1 
ATOM   9202  O OP2   . DC  J 7  22  ? 131.987 88.989  140.058 1.00 298.24 ? 22  DC  J OP2   1 
ATOM   9203  O "O5'" . DC  J 7  22  ? 131.798 87.560  142.043 1.00 357.17 ? 22  DC  J "O5'" 1 
ATOM   9204  C "C5'" . DC  J 7  22  ? 132.433 86.954  143.187 1.00 359.95 ? 22  DC  J "C5'" 1 
ATOM   9205  C "C4'" . DC  J 7  22  ? 131.623 85.812  143.779 1.00 364.08 ? 22  DC  J "C4'" 1 
ATOM   9206  O "O4'" . DC  J 7  22  ? 130.208 86.083  143.725 1.00 374.77 ? 22  DC  J "O4'" 1 
ATOM   9207  C "C3'" . DC  J 7  22  ? 131.793 84.445  143.108 1.00 371.52 ? 22  DC  J "C3'" 1 
ATOM   9208  O "O3'" . DC  J 7  22  ? 132.678 83.626  143.907 1.00 373.86 ? 22  DC  J "O3'" 1 
ATOM   9209  C "C2'" . DC  J 7  22  ? 130.376 83.866  143.084 1.00 378.49 ? 22  DC  J "C2'" 1 
ATOM   9210  C "C1'" . DC  J 7  22  ? 129.543 84.846  143.866 1.00 381.43 ? 22  DC  J "C1'" 1 
ATOM   9211  N N1    . DC  J 7  22  ? 128.169 84.991  143.371 1.00 385.23 ? 22  DC  J N1    1 
ATOM   9212  C C2    . DC  J 7  22  ? 127.122 84.290  143.991 1.00 388.45 ? 22  DC  J C2    1 
ATOM   9213  O O2    . DC  J 7  22  ? 127.351 83.547  144.955 1.00 389.13 ? 22  DC  J O2    1 
ATOM   9214  N N3    . DC  J 7  22  ? 125.869 84.432  143.532 1.00 389.87 ? 22  DC  J N3    1 
ATOM   9215  C C4    . DC  J 7  22  ? 125.632 85.237  142.495 1.00 389.75 ? 22  DC  J C4    1 
ATOM   9216  N N4    . DC  J 7  22  ? 124.372 85.348  142.072 1.00 388.50 ? 22  DC  J N4    1 
ATOM   9217  C C5    . DC  J 7  22  ? 126.673 85.958  141.846 1.00 388.31 ? 22  DC  J C5    1 
ATOM   9218  C C6    . DC  J 7  22  ? 127.914 85.807  142.313 1.00 385.91 ? 22  DC  J C6    1 
ATOM   9219  P P     . DG  J 7  23  ? 133.299 82.221  143.393 1.00 377.02 ? 23  DG  J P     1 
ATOM   9220  O OP1   . DG  J 7  23  ? 134.502 81.922  144.209 1.00 371.03 ? 23  DG  J OP1   1 
ATOM   9221  O OP2   . DG  J 7  23  ? 133.404 82.278  141.912 1.00 373.24 ? 23  DG  J OP2   1 
ATOM   9222  O "O5'" . DG  J 7  23  ? 132.164 81.156  143.766 1.00 373.20 ? 23  DG  J "O5'" 1 
ATOM   9223  C "C5'" . DG  J 7  23  ? 131.831 80.908  145.149 1.00 375.41 ? 23  DG  J "C5'" 1 
ATOM   9224  C "C4'" . DG  J 7  23  ? 130.791 79.815  145.310 1.00 367.17 ? 23  DG  J "C4'" 1 
ATOM   9225  O "O4'" . DG  J 7  23  ? 129.484 80.299  144.909 1.00 373.65 ? 23  DG  J "O4'" 1 
ATOM   9226  C "C3'" . DG  J 7  23  ? 131.014 78.523  144.530 1.00 368.15 ? 23  DG  J "C3'" 1 
ATOM   9227  O "O3'" . DG  J 7  23  ? 130.646 77.436  145.401 1.00 370.71 ? 23  DG  J "O3'" 1 
ATOM   9228  C "C2'" . DG  J 7  23  ? 130.048 78.661  143.360 1.00 367.91 ? 23  DG  J "C2'" 1 
ATOM   9229  C "C1'" . DG  J 7  23  ? 128.878 79.384  144.005 1.00 370.41 ? 23  DG  J "C1'" 1 
ATOM   9230  N N9    . DG  J 7  23  ? 128.043 80.191  143.116 1.00 372.38 ? 23  DG  J N9    1 
ATOM   9231  C C8    . DG  J 7  23  ? 128.480 81.125  142.214 1.00 373.84 ? 23  DG  J C8    1 
ATOM   9232  N N7    . DG  J 7  23  ? 127.520 81.702  141.552 1.00 376.06 ? 23  DG  J N7    1 
ATOM   9233  C C5    . DG  J 7  23  ? 126.372 81.113  142.044 1.00 372.77 ? 23  DG  J C5    1 
ATOM   9234  C C6    . DG  J 7  23  ? 125.021 81.346  141.697 1.00 369.73 ? 23  DG  J C6    1 
ATOM   9235  O O6    . DG  J 7  23  ? 124.580 82.146  140.860 1.00 368.69 ? 23  DG  J O6    1 
ATOM   9236  N N1    . DG  J 7  23  ? 124.162 80.542  142.428 1.00 368.24 ? 23  DG  J N1    1 
ATOM   9237  C C2    . DG  J 7  23  ? 124.553 79.635  143.375 1.00 367.61 ? 23  DG  J C2    1 
ATOM   9238  N N2    . DG  J 7  23  ? 123.564 78.953  143.974 1.00 369.20 ? 23  DG  J N2    1 
ATOM   9239  N N3    . DG  J 7  23  ? 125.818 79.407  143.711 1.00 368.33 ? 23  DG  J N3    1 
ATOM   9240  C C4    . DG  J 7  23  ? 126.671 80.179  143.010 1.00 369.86 ? 23  DG  J C4    1 
ATOM   9241  P P     . DT  J 7  24  ? 131.231 75.935  145.275 1.00 339.05 ? 24  DT  J P     1 
ATOM   9242  O OP1   . DT  J 7  24  ? 132.154 75.687  146.408 1.00 370.96 ? 24  DT  J OP1   1 
ATOM   9243  O OP2   . DT  J 7  24  ? 131.687 75.727  143.876 1.00 365.73 ? 24  DT  J OP2   1 
ATOM   9244  O "O5'" . DT  J 7  24  ? 129.920 75.061  145.477 1.00 359.41 ? 24  DT  J "O5'" 1 
ATOM   9245  C "C5'" . DT  J 7  24  ? 128.888 75.175  144.490 1.00 367.52 ? 24  DT  J "C5'" 1 
ATOM   9246  C "C4'" . DT  J 7  24  ? 127.677 74.340  144.813 1.00 351.90 ? 24  DT  J "C4'" 1 
ATOM   9247  O "O4'" . DT  J 7  24  ? 126.503 75.122  144.472 1.00 353.47 ? 24  DT  J "O4'" 1 
ATOM   9248  C "C3'" . DT  J 7  24  ? 127.566 73.037  144.024 1.00 347.16 ? 24  DT  J "C3'" 1 
ATOM   9249  O "O3'" . DT  J 7  24  ? 126.928 72.004  144.810 1.00 352.20 ? 24  DT  J "O3'" 1 
ATOM   9250  C "C2'" . DT  J 7  24  ? 126.716 73.439  142.827 1.00 347.18 ? 24  DT  J "C2'" 1 
ATOM   9251  C "C1'" . DT  J 7  24  ? 125.887 74.619  143.294 1.00 348.30 ? 24  DT  J "C1'" 1 
ATOM   9252  N N1    . DT  J 7  24  ? 125.767 75.696  142.280 1.00 346.12 ? 24  DT  J N1    1 
ATOM   9253  C C2    . DT  J 7  24  ? 124.504 76.134  141.919 1.00 342.05 ? 24  DT  J C2    1 
ATOM   9254  O O2    . DT  J 7  24  ? 123.475 75.679  142.396 1.00 343.70 ? 24  DT  J O2    1 
ATOM   9255  N N3    . DT  J 7  24  ? 124.490 77.133  140.977 1.00 343.19 ? 24  DT  J N3    1 
ATOM   9256  C C4    . DT  J 7  24  ? 125.583 77.717  140.375 1.00 344.82 ? 24  DT  J C4    1 
ATOM   9257  O O4    . DT  J 7  24  ? 125.450 78.607  139.540 1.00 341.51 ? 24  DT  J O4    1 
ATOM   9258  C C5    . DT  J 7  24  ? 126.854 77.217  140.791 1.00 350.90 ? 24  DT  J C5    1 
ATOM   9259  C C7    . DT  J 7  24  ? 128.068 77.809  140.172 1.00 348.25 ? 24  DT  J C7    1 
ATOM   9260  C C6    . DT  J 7  24  ? 126.889 76.252  141.702 1.00 349.98 ? 24  DT  J C6    1 
ATOM   9261  P P     . DG  J 7  25  ? 126.938 70.438  144.373 1.00 351.46 ? 25  DG  J P     1 
ATOM   9262  O OP1   . DG  J 7  25  ? 126.655 69.611  145.572 1.00 359.91 ? 25  DG  J OP1   1 
ATOM   9263  O OP2   . DG  J 7  25  ? 128.172 70.189  143.578 1.00 351.29 ? 25  DG  J OP2   1 
ATOM   9264  O "O5'" . DG  J 7  25  ? 125.686 70.324  143.380 1.00 347.66 ? 25  DG  J "O5'" 1 
ATOM   9265  C "C5'" . DG  J 7  25  ? 124.359 70.663  143.844 1.00 349.18 ? 25  DG  J "C5'" 1 
ATOM   9266  C "C4'" . DG  J 7  25  ? 123.330 70.660  142.728 1.00 333.98 ? 25  DG  J "C4'" 1 
ATOM   9267  O "O4'" . DG  J 7  25  ? 123.473 71.842  141.892 1.00 333.65 ? 25  DG  J "O4'" 1 
ATOM   9268  C "C3'" . DG  J 7  25  ? 123.344 69.471  141.769 1.00 336.95 ? 25  DG  J "C3'" 1 
ATOM   9269  O "O3'" . DG  J 7  25  ? 121.969 69.164  141.470 1.00 333.28 ? 25  DG  J "O3'" 1 
ATOM   9270  C "C2'" . DG  J 7  25  ? 124.096 70.033  140.570 1.00 325.47 ? 25  DG  J "C2'" 1 
ATOM   9271  C "C1'" . DG  J 7  25  ? 123.572 71.461  140.525 1.00 326.71 ? 25  DG  J "C1'" 1 
ATOM   9272  N N9    . DG  J 7  25  ? 124.427 72.449  139.852 1.00 321.52 ? 25  DG  J N9    1 
ATOM   9273  C C8    . DG  J 7  25  ? 125.800 72.501  139.835 1.00 326.71 ? 25  DG  J C8    1 
ATOM   9274  N N7    . DG  J 7  25  ? 126.277 73.500  139.155 1.00 322.53 ? 25  DG  J N7    1 
ATOM   9275  C C5    . DG  J 7  25  ? 125.155 74.154  138.691 1.00 318.49 ? 25  DG  J C5    1 
ATOM   9276  C C6    . DG  J 7  25  ? 125.058 75.312  137.896 1.00 311.78 ? 25  DG  J C6    1 
ATOM   9277  O O6    . DG  J 7  25  ? 125.983 75.992  137.442 1.00 307.68 ? 25  DG  J O6    1 
ATOM   9278  N N1    . DG  J 7  25  ? 123.734 75.652  137.644 1.00 306.65 ? 25  DG  J N1    1 
ATOM   9279  C C2    . DG  J 7  25  ? 122.643 74.959  138.102 1.00 309.59 ? 25  DG  J C2    1 
ATOM   9280  N N2    . DG  J 7  25  ? 121.432 75.438  137.758 1.00 305.97 ? 25  DG  J N2    1 
ATOM   9281  N N3    . DG  J 7  25  ? 122.728 73.870  138.853 1.00 314.14 ? 25  DG  J N3    1 
ATOM   9282  C C4    . DG  J 7  25  ? 124.006 73.527  139.108 1.00 318.58 ? 25  DG  J C4    1 
ATOM   9283  P P     . DC  J 7  26  ? 121.462 67.856  140.670 1.00 338.02 ? 26  DC  J P     1 
ATOM   9284  O OP1   . DC  J 7  26  ? 120.476 67.133  141.512 1.00 336.94 ? 26  DC  J OP1   1 
ATOM   9285  O OP2   . DC  J 7  26  ? 122.630 67.145  140.082 1.00 334.27 ? 26  DC  J OP2   1 
ATOM   9286  O "O5'" . DC  J 7  26  ? 120.704 68.495  139.418 1.00 316.56 ? 26  DC  J "O5'" 1 
ATOM   9287  C "C5'" . DC  J 7  26  ? 119.590 69.388  139.634 1.00 318.35 ? 26  DC  J "C5'" 1 
ATOM   9288  C "C4'" . DC  J 7  26  ? 119.069 69.939  138.325 1.00 302.95 ? 26  DC  J "C4'" 1 
ATOM   9289  O "O4'" . DC  J 7  26  ? 119.979 70.969  137.865 1.00 300.77 ? 26  DC  J "O4'" 1 
ATOM   9290  C "C3'" . DC  J 7  26  ? 118.952 68.903  137.202 1.00 298.21 ? 26  DC  J "C3'" 1 
ATOM   9291  O "O3'" . DC  J 7  26  ? 117.659 68.996  136.554 1.00 296.39 ? 26  DC  J "O3'" 1 
ATOM   9292  C "C2'" . DC  J 7  26  ? 120.081 69.272  136.251 1.00 286.69 ? 26  DC  J "C2'" 1 
ATOM   9293  C "C1'" . DC  J 7  26  ? 120.345 70.742  136.516 1.00 288.75 ? 26  DC  J "C1'" 1 
ATOM   9294  N N1    . DC  J 7  26  ? 121.754 71.151  136.359 1.00 287.33 ? 26  DC  J N1    1 
ATOM   9295  C C2    . DC  J 7  26  ? 122.078 72.259  135.564 1.00 282.37 ? 26  DC  J C2    1 
ATOM   9296  O O2    . DC  J 7  26  ? 121.188 72.899  134.990 1.00 280.33 ? 26  DC  J O2    1 
ATOM   9297  N N3    . DC  J 7  26  ? 123.368 72.629  135.424 1.00 281.56 ? 26  DC  J N3    1 
ATOM   9298  C C4    . DC  J 7  26  ? 124.326 71.939  136.044 1.00 287.49 ? 26  DC  J C4    1 
ATOM   9299  N N4    . DC  J 7  26  ? 125.594 72.330  135.886 1.00 286.04 ? 26  DC  J N4    1 
ATOM   9300  C C5    . DC  J 7  26  ? 124.030 70.813  136.854 1.00 294.89 ? 26  DC  J C5    1 
ATOM   9301  C C6    . DC  J 7  26  ? 122.750 70.457  136.984 1.00 300.23 ? 26  DC  J C6    1 
ATOM   9302  P P     . DC  J 7  27  ? 117.032 67.797  135.655 1.00 276.54 ? 27  DC  J P     1 
ATOM   9303  O OP1   . DC  J 7  27  ? 115.659 68.176  135.238 1.00 289.76 ? 27  DC  J OP1   1 
ATOM   9304  O OP2   . DC  J 7  27  ? 117.266 66.502  136.345 1.00 299.48 ? 27  DC  J OP2   1 
ATOM   9305  O "O5'" . DC  J 7  27  ? 117.974 67.716  134.360 1.00 273.99 ? 27  DC  J "O5'" 1 
ATOM   9306  C "C5'" . DC  J 7  27  ? 117.506 68.019  133.029 1.00 262.88 ? 27  DC  J "C5'" 1 
ATOM   9307  C "C4'" . DC  J 7  27  ? 117.545 69.512  132.777 1.00 255.03 ? 27  DC  J "C4'" 1 
ATOM   9308  O "O4'" . DC  J 7  27  ? 118.835 70.062  133.130 1.00 257.39 ? 27  DC  J "O4'" 1 
ATOM   9309  C "C3'" . DC  J 7  27  ? 117.338 69.963  131.337 1.00 237.34 ? 27  DC  J "C3'" 1 
ATOM   9310  O "O3'" . DC  J 7  27  ? 116.726 71.267  131.399 1.00 229.40 ? 27  DC  J "O3'" 1 
ATOM   9311  C "C2'" . DC  J 7  27  ? 118.769 70.052  130.810 1.00 226.20 ? 27  DC  J "C2'" 1 
ATOM   9312  C "C1'" . DC  J 7  27  ? 119.462 70.654  132.006 1.00 236.39 ? 27  DC  J "C1'" 1 
ATOM   9313  N N1    . DC  J 7  27  ? 120.895 70.417  132.236 1.00 246.29 ? 27  DC  J N1    1 
ATOM   9314  C C2    . DC  J 7  27  ? 121.852 71.345  131.803 1.00 240.90 ? 27  DC  J C2    1 
ATOM   9315  O O2    . DC  J 7  27  ? 121.512 72.378  131.213 1.00 236.86 ? 27  DC  J O2    1 
ATOM   9316  N N3    . DC  J 7  27  ? 123.153 71.104  132.035 1.00 242.13 ? 27  DC  J N3    1 
ATOM   9317  C C4    . DC  J 7  27  ? 123.520 69.990  132.671 1.00 243.94 ? 27  DC  J C4    1 
ATOM   9318  N N4    . DC  J 7  27  ? 124.821 69.788  132.881 1.00 249.67 ? 27  DC  J N4    1 
ATOM   9319  C C5    . DC  J 7  27  ? 122.575 69.033  133.117 1.00 247.29 ? 27  DC  J C5    1 
ATOM   9320  C C6    . DC  J 7  27  ? 121.290 69.285  132.882 1.00 256.34 ? 27  DC  J C6    1 
ATOM   9321  P P     . DT  J 7  28  ? 115.443 71.714  130.528 1.00 208.32 ? 28  DT  J P     1 
ATOM   9322  O OP1   . DT  J 7  28  ? 114.811 72.878  131.204 1.00 222.63 ? 28  DT  J OP1   1 
ATOM   9323  O OP2   . DT  J 7  28  ? 114.627 70.512  130.212 1.00 229.76 ? 28  DT  J OP2   1 
ATOM   9324  O "O5'" . DT  J 7  28  ? 116.130 72.232  129.194 1.00 210.70 ? 28  DT  J "O5'" 1 
ATOM   9325  C "C5'" . DT  J 7  28  ? 117.024 73.360  129.241 1.00 204.77 ? 28  DT  J "C5'" 1 
ATOM   9326  C "C4'" . DT  J 7  28  ? 117.745 73.499  127.930 1.00 193.38 ? 28  DT  J "C4'" 1 
ATOM   9327  O "O4'" . DT  J 7  28  ? 118.986 72.750  127.978 1.00 193.45 ? 28  DT  J "O4'" 1 
ATOM   9328  C "C3'" . DT  J 7  28  ? 116.969 72.970  126.730 1.00 187.02 ? 28  DT  J "C3'" 1 
ATOM   9329  O "O3'" . DT  J 7  28  ? 117.268 73.753  125.569 1.00 172.54 ? 28  DT  J "O3'" 1 
ATOM   9330  C "C2'" . DT  J 7  28  ? 117.555 71.581  126.580 1.00 188.45 ? 28  DT  J "C2'" 1 
ATOM   9331  C "C1'" . DT  J 7  28  ? 119.016 71.833  126.909 1.00 184.08 ? 28  DT  J "C1'" 1 
ATOM   9332  N N1    . DT  J 7  28  ? 119.823 70.674  127.343 1.00 194.38 ? 28  DT  J N1    1 
ATOM   9333  C C2    . DT  J 7  28  ? 121.089 70.928  127.816 1.00 198.60 ? 28  DT  J C2    1 
ATOM   9334  O O2    . DT  J 7  28  ? 121.558 72.051  127.882 1.00 198.64 ? 28  DT  J O2    1 
ATOM   9335  N N3    . DT  J 7  28  ? 121.791 69.820  128.207 1.00 199.02 ? 28  DT  J N3    1 
ATOM   9336  C C4    . DT  J 7  28  ? 121.369 68.516  128.177 1.00 199.44 ? 28  DT  J C4    1 
ATOM   9337  O O4    . DT  J 7  28  ? 122.102 67.605  128.563 1.00 204.05 ? 28  DT  J O4    1 
ATOM   9338  C C5    . DT  J 7  28  ? 120.039 68.321  127.672 1.00 196.29 ? 28  DT  J C5    1 
ATOM   9339  C C7    . DT  J 7  28  ? 119.498 66.935  127.602 1.00 202.52 ? 28  DT  J C7    1 
ATOM   9340  C C6    . DT  J 7  28  ? 119.341 69.387  127.286 1.00 191.95 ? 28  DT  J C6    1 
ATOM   9341  P P     . DG  J 7  29  ? 116.280 74.846  124.912 1.00 146.71 ? 29  DG  J P     1 
ATOM   9342  O OP1   . DG  J 7  29  ? 115.883 75.852  125.932 1.00 179.28 ? 29  DG  J OP1   1 
ATOM   9343  O OP2   . DG  J 7  29  ? 115.232 74.116  124.152 1.00 176.71 ? 29  DG  J OP2   1 
ATOM   9344  O "O5'" . DG  J 7  29  ? 117.272 75.543  123.875 1.00 154.70 ? 29  DG  J "O5'" 1 
ATOM   9345  C "C5'" . DG  J 7  29  ? 118.120 76.617  124.324 1.00 151.16 ? 29  DG  J "C5'" 1 
ATOM   9346  C "C4'" . DG  J 7  29  ? 119.583 76.360  124.028 1.00 139.52 ? 29  DG  J "C4'" 1 
ATOM   9347  O "O4'" . DG  J 7  29  ? 119.938 75.002  124.381 1.00 157.58 ? 29  DG  J "O4'" 1 
ATOM   9348  C "C3'" . DG  J 7  29  ? 120.025 76.525  122.577 1.00 131.32 ? 29  DG  J "C3'" 1 
ATOM   9349  O "O3'" . DG  J 7  29  ? 121.327 77.142  122.586 1.00 125.67 ? 29  DG  J "O3'" 1 
ATOM   9350  C "C2'" . DG  J 7  29  ? 120.099 75.082  122.103 1.00 138.93 ? 29  DG  J "C2'" 1 
ATOM   9351  C "C1'" . DG  J 7  29  ? 120.688 74.421  123.333 1.00 146.00 ? 29  DG  J "C1'" 1 
ATOM   9352  N N9    . DG  J 7  29  ? 120.499 72.979  123.474 1.00 160.08 ? 29  DG  J N9    1 
ATOM   9353  C C8    . DG  J 7  29  ? 119.356 72.273  123.217 1.00 162.94 ? 29  DG  J C8    1 
ATOM   9354  N N7    . DG  J 7  29  ? 119.474 70.995  123.437 1.00 167.45 ? 29  DG  J N7    1 
ATOM   9355  C C5    . DG  J 7  29  ? 120.773 70.852  123.865 1.00 166.90 ? 29  DG  J C5    1 
ATOM   9356  C C6    . DG  J 7  29  ? 121.453 69.686  124.247 1.00 175.62 ? 29  DG  J C6    1 
ATOM   9357  O O6    . DG  J 7  29  ? 121.002 68.534  124.274 1.00 177.74 ? 29  DG  J O6    1 
ATOM   9358  N N1    . DG  J 7  29  ? 122.757 69.962  124.616 1.00 173.15 ? 29  DG  J N1    1 
ATOM   9359  C C2    . DG  J 7  29  ? 123.331 71.207  124.617 1.00 170.88 ? 29  DG  J C2    1 
ATOM   9360  N N2    . DG  J 7  29  ? 124.612 71.264  125.010 1.00 175.34 ? 29  DG  J N2    1 
ATOM   9361  N N3    . DG  J 7  29  ? 122.696 72.308  124.259 1.00 161.57 ? 29  DG  J N3    1 
ATOM   9362  C C4    . DG  J 7  29  ? 121.426 72.058  123.897 1.00 162.93 ? 29  DG  J C4    1 
ATOM   9363  P P     . DG  J 7  30  ? 121.961 77.962  121.351 1.00 104.52 ? 30  DG  J P     1 
ATOM   9364  O OP1   . DG  J 7  30  ? 122.176 79.352  121.805 1.00 76.97  ? 30  DG  J OP1   1 
ATOM   9365  O OP2   . DG  J 7  30  ? 121.154 77.681  120.137 1.00 87.29  ? 30  DG  J OP2   1 
ATOM   9366  O "O5'" . DG  J 7  30  ? 123.380 77.283  121.177 1.00 99.15  ? 30  DG  J "O5'" 1 
ATOM   9367  C "C5'" . DG  J 7  30  ? 124.354 77.461  122.217 1.00 102.12 ? 30  DG  J "C5'" 1 
ATOM   9368  C "C4'" . DG  J 7  30  ? 125.565 76.605  121.967 1.00 96.72  ? 30  DG  J "C4'" 1 
ATOM   9369  O "O4'" . DG  J 7  30  ? 125.218 75.221  122.206 1.00 115.85 ? 30  DG  J "O4'" 1 
ATOM   9370  C "C3'" . DG  J 7  30  ? 126.105 76.681  120.548 1.00 86.78  ? 30  DG  J "C3'" 1 
ATOM   9371  O "O3'" . DG  J 7  30  ? 127.541 76.682  120.592 1.00 87.46  ? 30  DG  J "O3'" 1 
ATOM   9372  C "C2'" . DG  J 7  30  ? 125.523 75.436  119.906 1.00 104.15 ? 30  DG  J "C2'" 1 
ATOM   9373  C "C1'" . DG  J 7  30  ? 125.511 74.455  121.056 1.00 115.34 ? 30  DG  J "C1'" 1 
ATOM   9374  N N9    . DG  J 7  30  ? 124.507 73.401  120.940 1.00 131.96 ? 30  DG  J N9    1 
ATOM   9375  C C8    . DG  J 7  30  ? 123.199 73.525  120.553 1.00 133.65 ? 30  DG  J C8    1 
ATOM   9376  N N7    . DG  J 7  30  ? 122.551 72.393  120.551 1.00 144.02 ? 30  DG  J N7    1 
ATOM   9377  C C5    . DG  J 7  30  ? 123.489 71.470  120.961 1.00 146.02 ? 30  DG  J C5    1 
ATOM   9378  C C6    . DG  J 7  30  ? 123.368 70.078  121.148 1.00 152.73 ? 30  DG  J C6    1 
ATOM   9379  O O6    . DG  J 7  30  ? 122.363 69.371  120.982 1.00 157.63 ? 30  DG  J O6    1 
ATOM   9380  N N1    . DG  J 7  30  ? 124.564 69.523  121.572 1.00 156.02 ? 30  DG  J N1    1 
ATOM   9381  C C2    . DG  J 7  30  ? 125.726 70.224  121.786 1.00 149.46 ? 30  DG  J C2    1 
ATOM   9382  N N2    . DG  J 7  30  ? 126.784 69.515  122.197 1.00 155.97 ? 30  DG  J N2    1 
ATOM   9383  N N3    . DG  J 7  30  ? 125.845 71.523  121.613 1.00 141.36 ? 30  DG  J N3    1 
ATOM   9384  C C4    . DG  J 7  30  ? 124.697 72.076  121.204 1.00 139.34 ? 30  DG  J C4    1 
ATOM   9385  P P     . DA  J 7  31  ? 128.433 76.965  119.287 1.00 75.37  ? 31  DA  J P     1 
ATOM   9386  O OP1   . DA  J 7  31  ? 129.519 77.956  119.625 1.00 66.82  ? 31  DA  J OP1   1 
ATOM   9387  O OP2   . DA  J 7  31  ? 127.488 77.243  118.171 1.00 69.90  ? 31  DA  J OP2   1 
ATOM   9388  O "O5'" . DA  J 7  31  ? 129.118 75.556  119.007 1.00 86.39  ? 31  DA  J "O5'" 1 
ATOM   9389  C "C5'" . DA  J 7  31  ? 129.725 74.817  120.088 1.00 89.52  ? 31  DA  J "C5'" 1 
ATOM   9390  C "C4'" . DA  J 7  31  ? 130.243 73.469  119.641 1.00 86.71  ? 31  DA  J "C4'" 1 
ATOM   9391  O "O4'" . DA  J 7  31  ? 129.123 72.561  119.649 1.00 104.55 ? 31  DA  J "O4'" 1 
ATOM   9392  C "C3'" . DA  J 7  31  ? 130.854 73.404  118.241 1.00 88.05  ? 31  DA  J "C3'" 1 
ATOM   9393  O "O3'" . DA  J 7  31  ? 131.980 72.494  118.210 1.00 90.86  ? 31  DA  J "O3'" 1 
ATOM   9394  C "C2'" . DA  J 7  31  ? 129.669 72.905  117.428 1.00 90.74  ? 31  DA  J "C2'" 1 
ATOM   9395  C "C1'" . DA  J 7  31  ? 129.026 71.933  118.392 1.00 103.26 ? 31  DA  J "C1'" 1 
ATOM   9396  N N9    . DA  J 7  31  ? 127.618 71.632  118.122 1.00 117.07 ? 31  DA  J N9    1 
ATOM   9397  C C8    . DA  J 7  31  ? 126.637 72.428  117.589 1.00 120.51 ? 31  DA  J C8    1 
ATOM   9398  N N7    . DA  J 7  31  ? 125.477 71.844  117.482 1.00 128.50 ? 31  DA  J N7    1 
ATOM   9399  C C5    . DA  J 7  31  ? 125.704 70.579  117.972 1.00 129.25 ? 31  DA  J C5    1 
ATOM   9400  C C6    . DA  J 7  31  ? 124.884 69.464  118.138 1.00 137.99 ? 31  DA  J C6    1 
ATOM   9401  N N6    . DA  J 7  31  ? 123.601 69.475  117.786 1.00 141.94 ? 31  DA  J N6    1 
ATOM   9402  N N1    . DA  J 7  31  ? 125.408 68.350  118.659 1.00 143.30 ? 31  DA  J N1    1 
ATOM   9403  C C2    . DA  J 7  31  ? 126.699 68.364  118.996 1.00 137.51 ? 31  DA  J C2    1 
ATOM   9404  N N3    . DA  J 7  31  ? 127.553 69.358  118.886 1.00 128.97 ? 31  DA  J N3    1 
ATOM   9405  C C4    . DA  J 7  31  ? 127.003 70.440  118.366 1.00 124.63 ? 31  DA  J C4    1 
ATOM   9406  P P     . DG  J 7  32  ? 132.900 72.278  116.885 1.00 98.19  ? 32  DG  J P     1 
ATOM   9407  O OP1   . DG  J 7  32  ? 134.359 72.353  117.192 1.00 87.13  ? 32  DG  J OP1   1 
ATOM   9408  O OP2   . DG  J 7  32  ? 132.371 73.116  115.778 1.00 84.14  ? 32  DG  J OP2   1 
ATOM   9409  O "O5'" . DG  J 7  32  ? 132.567 70.778  116.508 1.00 102.85 ? 32  DG  J "O5'" 1 
ATOM   9410  C "C5'" . DG  J 7  32  ? 132.678 69.766  117.512 1.00 107.59 ? 32  DG  J "C5'" 1 
ATOM   9411  C "C4'" . DG  J 7  32  ? 132.696 68.409  116.872 1.00 110.39 ? 32  DG  J "C4'" 1 
ATOM   9412  O "O4'" . DG  J 7  32  ? 131.340 67.917  116.819 1.00 109.17 ? 32  DG  J "O4'" 1 
ATOM   9413  C "C3'" . DG  J 7  32  ? 133.253 68.355  115.451 1.00 111.25 ? 32  DG  J "C3'" 1 
ATOM   9414  O "O3'" . DG  J 7  32  ? 134.020 67.142  115.299 1.00 119.27 ? 32  DG  J "O3'" 1 
ATOM   9415  C "C2'" . DG  J 7  32  ? 131.996 68.383  114.597 1.00 114.01 ? 32  DG  J "C2'" 1 
ATOM   9416  C "C1'" . DG  J 7  32  ? 130.931 67.760  115.480 1.00 114.75 ? 32  DG  J "C1'" 1 
ATOM   9417  N N9    . DG  J 7  32  ? 129.625 68.373  115.336 1.00 115.97 ? 32  DG  J N9    1 
ATOM   9418  C C8    . DG  J 7  32  ? 129.337 69.702  115.262 1.00 113.91 ? 32  DG  J C8    1 
ATOM   9419  N N7    . DG  J 7  32  ? 128.065 69.944  115.135 1.00 120.23 ? 32  DG  J N7    1 
ATOM   9420  C C5    . DG  J 7  32  ? 127.482 68.696  115.125 1.00 123.00 ? 32  DG  J C5    1 
ATOM   9421  C C6    . DG  J 7  32  ? 126.127 68.322  115.010 1.00 129.68 ? 32  DG  J C6    1 
ATOM   9422  O O6    . DG  J 7  32  ? 125.141 69.062  114.892 1.00 130.58 ? 32  DG  J O6    1 
ATOM   9423  N N1    . DG  J 7  32  ? 125.977 66.946  115.045 1.00 132.51 ? 32  DG  J N1    1 
ATOM   9424  C C2    . DG  J 7  32  ? 127.005 66.049  115.171 1.00 132.08 ? 32  DG  J C2    1 
ATOM   9425  N N2    . DG  J 7  32  ? 126.676 64.751  115.188 1.00 137.06 ? 32  DG  J N2    1 
ATOM   9426  N N3    . DG  J 7  32  ? 128.274 66.391  115.278 1.00 126.25 ? 32  DG  J N3    1 
ATOM   9427  C C4    . DG  J 7  32  ? 128.434 67.720  115.248 1.00 121.32 ? 32  DG  J C4    1 
ATOM   9428  P P     . DA  J 7  33  ? 134.844 66.755  113.960 1.00 131.44 ? 33  DA  J P     1 
ATOM   9429  O OP1   . DA  J 7  33  ? 136.009 65.925  114.351 1.00 124.11 ? 33  DA  J OP1   1 
ATOM   9430  O OP2   . DA  J 7  33  ? 135.047 67.975  113.136 1.00 120.37 ? 33  DA  J OP2   1 
ATOM   9431  O "O5'" . DA  J 7  33  ? 133.808 65.818  113.198 1.00 123.58 ? 33  DA  J "O5'" 1 
ATOM   9432  C "C5'" . DA  J 7  33  ? 133.222 64.699  113.890 1.00 127.72 ? 33  DA  J "C5'" 1 
ATOM   9433  C "C4'" . DA  J 7  33  ? 132.299 63.931  112.985 1.00 128.83 ? 33  DA  J "C4'" 1 
ATOM   9434  O "O4'" . DA  J 7  33  ? 131.003 64.570  112.994 1.00 125.35 ? 33  DA  J "O4'" 1 
ATOM   9435  C "C3'" . DA  J 7  33  ? 132.732 63.854  111.525 1.00 135.47 ? 33  DA  J "C3'" 1 
ATOM   9436  O "O3'" . DA  J 7  33  ? 132.398 62.545  111.034 1.00 143.39 ? 33  DA  J "O3'" 1 
ATOM   9437  C "C2'" . DA  J 7  33  ? 131.879 64.941  110.889 1.00 127.76 ? 33  DA  J "C2'" 1 
ATOM   9438  C "C1'" . DA  J 7  33  ? 130.584 64.789  111.665 1.00 126.91 ? 33  DA  J "C1'" 1 
ATOM   9439  N N9    . DA  J 7  33  ? 129.707 65.957  111.667 1.00 123.96 ? 33  DA  J N9    1 
ATOM   9440  C C8    . DA  J 7  33  ? 130.039 67.286  111.693 1.00 121.08 ? 33  DA  J C8    1 
ATOM   9441  N N7    . DA  J 7  33  ? 129.004 68.082  111.688 1.00 120.43 ? 33  DA  J N7    1 
ATOM   9442  C C5    . DA  J 7  33  ? 127.924 67.224  111.656 1.00 118.66 ? 33  DA  J C5    1 
ATOM   9443  C C6    . DA  J 7  33  ? 126.550 67.450  111.638 1.00 117.84 ? 33  DA  J C6    1 
ATOM   9444  N N6    . DA  J 7  33  ? 126.014 68.662  111.647 1.00 119.81 ? 33  DA  J N6    1 
ATOM   9445  N N1    . DA  J 7  33  ? 125.734 66.383  111.606 1.00 118.99 ? 33  DA  J N1    1 
ATOM   9446  C C2    . DA  J 7  33  ? 126.285 65.173  111.598 1.00 122.21 ? 33  DA  J C2    1 
ATOM   9447  N N3    . DA  J 7  33  ? 127.566 64.841  111.614 1.00 121.40 ? 33  DA  J N3    1 
ATOM   9448  C C4    . DA  J 7  33  ? 128.340 65.922  111.643 1.00 120.54 ? 33  DA  J C4    1 
ATOM   9449  P P     . DC  J 7  34  ? 133.110 61.855  109.761 1.00 136.00 ? 34  DC  J P     1 
ATOM   9450  O OP1   . DC  J 7  34  ? 133.971 60.743  110.230 1.00 148.42 ? 34  DC  J OP1   1 
ATOM   9451  O OP2   . DC  J 7  34  ? 133.644 62.910  108.860 1.00 142.58 ? 34  DC  J OP2   1 
ATOM   9452  O "O5'" . DC  J 7  34  ? 131.878 61.272  108.948 1.00 142.52 ? 34  DC  J "O5'" 1 
ATOM   9453  C "C5'" . DC  J 7  34  ? 130.917 62.200  108.432 1.00 137.21 ? 34  DC  J "C5'" 1 
ATOM   9454  C "C4'" . DC  J 7  34  ? 129.684 61.528  107.899 1.00 129.74 ? 34  DC  J "C4'" 1 
ATOM   9455  O "O4'" . DC  J 7  34  ? 128.546 62.307  108.340 1.00 122.31 ? 34  DC  J "O4'" 1 
ATOM   9456  C "C3'" . DC  J 7  34  ? 129.617 61.487  106.377 1.00 128.50 ? 34  DC  J "C3'" 1 
ATOM   9457  O "O3'" . DC  J 7  34  ? 128.937 60.304  105.917 1.00 134.56 ? 34  DC  J "O3'" 1 
ATOM   9458  C "C2'" . DC  J 7  34  ? 128.842 62.748  106.035 1.00 123.04 ? 34  DC  J "C2'" 1 
ATOM   9459  C "C1'" . DC  J 7  34  ? 127.973 63.005  107.247 1.00 120.55 ? 34  DC  J "C1'" 1 
ATOM   9460  N N1    . DC  J 7  34  ? 127.869 64.441  107.574 1.00 115.92 ? 34  DC  J N1    1 
ATOM   9461  C C2    . DC  J 7  34  ? 126.613 65.051  107.581 1.00 112.11 ? 34  DC  J C2    1 
ATOM   9462  O O2    . DC  J 7  34  ? 125.601 64.395  107.318 1.00 109.77 ? 34  DC  J O2    1 
ATOM   9463  N N3    . DC  J 7  34  ? 126.508 66.354  107.875 1.00 107.12 ? 34  DC  J N3    1 
ATOM   9464  C C4    . DC  J 7  34  ? 127.595 67.059  108.159 1.00 109.18 ? 34  DC  J C4    1 
ATOM   9465  N N4    . DC  J 7  34  ? 127.443 68.350  108.442 1.00 107.23 ? 34  DC  J N4    1 
ATOM   9466  C C5    . DC  J 7  34  ? 128.884 66.477  108.161 1.00 113.14 ? 34  DC  J C5    1 
ATOM   9467  C C6    . DC  J 7  34  ? 128.974 65.184  107.868 1.00 116.89 ? 34  DC  J C6    1 
ATOM   9468  P P     . DT  J 7  35  ? 129.025 59.815  104.374 1.00 130.62 ? 35  DT  J P     1 
ATOM   9469  O OP1   . DT  J 7  35  ? 128.724 58.364  104.323 1.00 147.25 ? 35  DT  J OP1   1 
ATOM   9470  O OP2   . DT  J 7  35  ? 130.290 60.330  103.788 1.00 142.82 ? 35  DT  J OP2   1 
ATOM   9471  O "O5'" . DT  J 7  35  ? 127.825 60.600  103.680 1.00 128.54 ? 35  DT  J "O5'" 1 
ATOM   9472  C "C5'" . DT  J 7  35  ? 126.473 60.302  104.057 1.00 127.00 ? 35  DT  J "C5'" 1 
ATOM   9473  C "C4'" . DT  J 7  35  ? 125.496 61.253  103.411 1.00 115.60 ? 35  DT  J "C4'" 1 
ATOM   9474  O "O4'" . DT  J 7  35  ? 125.560 62.533  104.067 1.00 113.49 ? 35  DT  J "O4'" 1 
ATOM   9475  C "C3'" . DT  J 7  35  ? 125.684 61.524  101.918 1.00 117.32 ? 35  DT  J "C3'" 1 
ATOM   9476  O "O3'" . DT  J 7  35  ? 124.596 60.870  101.233 1.00 115.59 ? 35  DT  J "O3'" 1 
ATOM   9477  C "C2'" . DT  J 7  35  ? 125.629 63.052  101.801 1.00 111.03 ? 35  DT  J "C2'" 1 
ATOM   9478  C "C1'" . DT  J 7  35  ? 125.151 63.521  103.156 1.00 109.09 ? 35  DT  J "C1'" 1 
ATOM   9479  N N1    . DT  J 7  35  ? 125.717 64.802  103.603 1.00 107.12 ? 35  DT  J N1    1 
ATOM   9480  C C2    . DT  J 7  35  ? 124.860 65.829  103.921 1.00 98.38  ? 35  DT  J C2    1 
ATOM   9481  O O2    . DT  J 7  35  ? 123.647 65.723  103.847 1.00 97.71  ? 35  DT  J O2    1 
ATOM   9482  N N3    . DT  J 7  35  ? 125.476 66.978  104.328 1.00 95.11  ? 35  DT  J N3    1 
ATOM   9483  C C4    . DT  J 7  35  ? 126.830 67.189  104.442 1.00 96.32  ? 35  DT  J C4    1 
ATOM   9484  O O4    . DT  J 7  35  ? 127.278 68.269  104.819 1.00 94.49  ? 35  DT  J O4    1 
ATOM   9485  C C5    . DT  J 7  35  ? 127.657 66.077  104.092 1.00 102.58 ? 35  DT  J C5    1 
ATOM   9486  C C7    . DT  J 7  35  ? 129.131 66.237  104.190 1.00 101.18 ? 35  DT  J C7    1 
ATOM   9487  C C6    . DT  J 7  35  ? 127.072 64.955  103.696 1.00 107.71 ? 35  DT  J C6    1 
ATOM   9488  P P     . DA  J 7  36  ? 124.400 60.850  99.630  1.00 118.77 ? 36  DA  J P     1 
ATOM   9489  O OP1   . DA  J 7  36  ? 123.629 59.634  99.272  1.00 121.31 ? 36  DA  J OP1   1 
ATOM   9490  O OP2   . DA  J 7  36  ? 125.708 61.123  98.978  1.00 115.95 ? 36  DA  J OP2   1 
ATOM   9491  O "O5'" . DA  J 7  36  ? 123.459 62.113  99.389  1.00 107.59 ? 36  DA  J "O5'" 1 
ATOM   9492  C "C5'" . DA  J 7  36  ? 122.251 62.267  100.160 1.00 108.04 ? 36  DA  J "C5'" 1 
ATOM   9493  C "C4'" . DA  J 7  36  ? 121.520 63.530  99.780  1.00 110.29 ? 36  DA  J "C4'" 1 
ATOM   9494  O "O4'" . DA  J 7  36  ? 122.195 64.666  100.349 1.00 102.80 ? 36  DA  J "O4'" 1 
ATOM   9495  C "C3'" . DA  J 7  36  ? 121.381 63.796  98.286  1.00 114.15 ? 36  DA  J "C3'" 1 
ATOM   9496  O "O3'" . DA  J 7  36  ? 120.015 64.189  98.058  1.00 112.84 ? 36  DA  J "O3'" 1 
ATOM   9497  C "C2'" . DA  J 7  36  ? 122.385 64.915  98.028  1.00 101.48 ? 36  DA  J "C2'" 1 
ATOM   9498  C "C1'" . DA  J 7  36  ? 122.462 65.635  99.355  1.00 98.93  ? 36  DA  J "C1'" 1 
ATOM   9499  N N9    . DA  J 7  36  ? 123.765 66.199  99.695  1.00 95.67  ? 36  DA  J N9    1 
ATOM   9500  C C8    . DA  J 7  36  ? 125.016 65.665  99.522  1.00 95.18  ? 36  DA  J C8    1 
ATOM   9501  N N7    . DA  J 7  36  ? 125.980 66.446  99.947  1.00 89.80  ? 36  DA  J N7    1 
ATOM   9502  C C5    . DA  J 7  36  ? 125.320 67.549  100.423 1.00 86.18  ? 36  DA  J C5    1 
ATOM   9503  C C6    . DA  J 7  36  ? 125.772 68.721  100.995 1.00 81.91  ? 36  DA  J C6    1 
ATOM   9504  N N6    . DA  J 7  36  ? 127.054 68.977  101.192 1.00 84.23  ? 36  DA  J N6    1 
ATOM   9505  N N1    . DA  J 7  36  ? 124.861 69.638  101.367 1.00 79.39  ? 36  DA  J N1    1 
ATOM   9506  C C2    . DA  J 7  36  ? 123.578 69.367  101.162 1.00 80.82  ? 36  DA  J C2    1 
ATOM   9507  N N3    . DA  J 7  36  ? 123.035 68.292  100.628 1.00 85.65  ? 36  DA  J N3    1 
ATOM   9508  C C4    . DA  J 7  36  ? 123.968 67.415  100.274 1.00 89.48  ? 36  DA  J C4    1 
ATOM   9509  P P     . DG  J 7  37  ? 119.363 64.456  96.608  1.00 101.98 ? 37  DG  J P     1 
ATOM   9510  O OP1   . DG  J 7  37  ? 117.940 64.042  96.657  1.00 121.81 ? 37  DG  J OP1   1 
ATOM   9511  O OP2   . DG  J 7  37  ? 120.262 63.917  95.554  1.00 117.38 ? 37  DG  J OP2   1 
ATOM   9512  O "O5'" . DG  J 7  37  ? 119.417 66.041  96.536  1.00 106.54 ? 37  DG  J "O5'" 1 
ATOM   9513  C "C5'" . DG  J 7  37  ? 118.876 66.808  97.626  1.00 108.47 ? 37  DG  J "C5'" 1 
ATOM   9514  C "C4'" . DG  J 7  37  ? 118.945 68.275  97.315  1.00 97.78  ? 37  DG  J "C4'" 1 
ATOM   9515  O "O4'" . DG  J 7  37  ? 120.273 68.758  97.618  1.00 92.59  ? 37  DG  J "O4'" 1 
ATOM   9516  C "C3'" . DG  J 7  37  ? 118.666 68.615  95.865  1.00 96.59  ? 37  DG  J "C3'" 1 
ATOM   9517  O "O3'" . DG  J 7  37  ? 117.845 69.786  95.831  1.00 90.85  ? 37  DG  J "O3'" 1 
ATOM   9518  C "C2'" . DG  J 7  37  ? 120.050 68.856  95.292  1.00 90.63  ? 37  DG  J "C2'" 1 
ATOM   9519  C "C1'" . DG  J 7  37  ? 120.839 69.378  96.483  1.00 85.38  ? 37  DG  J "C1'" 1 
ATOM   9520  N N9    . DG  J 7  37  ? 122.266 69.059  96.516  1.00 82.60  ? 37  DG  J N9    1 
ATOM   9521  C C8    . DG  J 7  37  ? 122.913 67.992  95.952  1.00 83.74  ? 37  DG  J C8    1 
ATOM   9522  N N7    . DG  J 7  37  ? 124.196 67.988  96.163  1.00 80.00  ? 37  DG  J N7    1 
ATOM   9523  C C5    . DG  J 7  37  ? 124.414 69.117  96.909  1.00 79.40  ? 37  DG  J C5    1 
ATOM   9524  C C6    . DG  J 7  37  ? 125.612 69.633  97.432  1.00 77.75  ? 37  DG  J C6    1 
ATOM   9525  O O6    . DG  J 7  37  ? 126.761 69.203  97.354  1.00 78.93  ? 37  DG  J O6    1 
ATOM   9526  N N1    . DG  J 7  37  ? 125.392 70.792  98.127  1.00 76.50  ? 37  DG  J N1    1 
ATOM   9527  C C2    . DG  J 7  37  ? 124.195 71.386  98.300  1.00 74.97  ? 37  DG  J C2    1 
ATOM   9528  N N2    . DG  J 7  37  ? 124.262 72.505  99.021  1.00 72.13  ? 37  DG  J N2    1 
ATOM   9529  N N3    . DG  J 7  37  ? 123.058 70.925  97.824  1.00 78.18  ? 37  DG  J N3    1 
ATOM   9530  C C4    . DG  J 7  37  ? 123.241 69.789  97.137  1.00 79.54  ? 37  DG  J C4    1 
ATOM   9531  P P     . DG  J 7  38  ? 116.983 70.221  94.542  1.00 90.69  ? 38  DG  J P     1 
ATOM   9532  O OP1   . DG  J 7  38  ? 115.553 70.266  94.938  1.00 100.88 ? 38  DG  J OP1   1 
ATOM   9533  O OP2   . DG  J 7  38  ? 117.406 69.420  93.362  1.00 100.63 ? 38  DG  J OP2   1 
ATOM   9534  O "O5'" . DG  J 7  38  ? 117.496 71.706  94.317  1.00 92.90  ? 38  DG  J "O5'" 1 
ATOM   9535  C "C5'" . DG  J 7  38  ? 117.096 72.713  95.253  1.00 89.62  ? 38  DG  J "C5'" 1 
ATOM   9536  C "C4'" . DG  J 7  38  ? 118.229 73.653  95.571  1.00 79.28  ? 38  DG  J "C4'" 1 
ATOM   9537  O "O4'" . DG  J 7  38  ? 119.486 72.959  95.575  1.00 79.43  ? 38  DG  J "O4'" 1 
ATOM   9538  C "C3'" . DG  J 7  38  ? 118.391 74.824  94.623  1.00 72.55  ? 38  DG  J "C3'" 1 
ATOM   9539  O "O3'" . DG  J 7  38  ? 118.011 75.984  95.381  1.00 68.47  ? 38  DG  J "O3'" 1 
ATOM   9540  C "C2'" . DG  J 7  38  ? 119.871 74.803  94.239  1.00 65.85  ? 38  DG  J "C2'" 1 
ATOM   9541  C "C1'" . DG  J 7  38  ? 120.513 73.839  95.201  1.00 66.47  ? 38  DG  J "C1'" 1 
ATOM   9542  N N9    . DG  J 7  38  ? 121.566 72.995  94.664  1.00 70.21  ? 38  DG  J N9    1 
ATOM   9543  C C8    . DG  J 7  38  ? 121.407 71.980  93.769  1.00 75.17  ? 38  DG  J C8    1 
ATOM   9544  N N7    . DG  J 7  38  ? 122.522 71.384  93.463  1.00 73.97  ? 38  DG  J N7    1 
ATOM   9545  C C5    . DG  J 7  38  ? 123.470 72.051  94.207  1.00 71.23  ? 38  DG  J C5    1 
ATOM   9546  C C6    . DG  J 7  38  ? 124.858 71.849  94.287  1.00 72.79  ? 38  DG  J C6    1 
ATOM   9547  O O6    . DG  J 7  38  ? 125.545 71.013  93.705  1.00 76.85  ? 38  DG  J O6    1 
ATOM   9548  N N1    . DG  J 7  38  ? 125.456 72.735  95.154  1.00 72.99  ? 38  DG  J N1    1 
ATOM   9549  C C2    . DG  J 7  38  ? 124.803 73.698  95.854  1.00 71.77  ? 38  DG  J C2    1 
ATOM   9550  N N2    . DG  J 7  38  ? 125.562 74.465  96.649  1.00 69.89  ? 38  DG  J N2    1 
ATOM   9551  N N3    . DG  J 7  38  ? 123.499 73.899  95.788  1.00 67.42  ? 38  DG  J N3    1 
ATOM   9552  C C4    . DG  J 7  38  ? 122.900 73.045  94.950  1.00 68.48  ? 38  DG  J C4    1 
ATOM   9553  P P     . DG  J 7  39  ? 117.826 77.456  94.762  1.00 72.17  ? 39  DG  J P     1 
ATOM   9554  O OP1   . DG  J 7  39  ? 116.864 78.189  95.616  1.00 66.80  ? 39  DG  J OP1   1 
ATOM   9555  O OP2   . DG  J 7  39  ? 117.601 77.336  93.302  1.00 68.66  ? 39  DG  J OP2   1 
ATOM   9556  O "O5'" . DG  J 7  39  ? 119.266 78.079  95.016  1.00 59.73  ? 39  DG  J "O5'" 1 
ATOM   9557  C "C5'" . DG  J 7  39  ? 119.833 77.973  96.333  1.00 58.18  ? 39  DG  J "C5'" 1 
ATOM   9558  C "C4'" . DG  J 7  39  ? 121.140 78.688  96.424  1.00 48.76  ? 39  DG  J "C4'" 1 
ATOM   9559  O "O4'" . DG  J 7  39  ? 122.184 77.859  95.881  1.00 55.02  ? 39  DG  J "O4'" 1 
ATOM   9560  C "C3'" . DG  J 7  39  ? 121.174 80.002  95.695  1.00 45.07  ? 39  DG  J "C3'" 1 
ATOM   9561  O "O3'" . DG  J 7  39  ? 121.847 80.939  96.544  1.00 41.26  ? 39  DG  J "O3'" 1 
ATOM   9562  C "C2'" . DG  J 7  39  ? 121.952 79.679  94.435  1.00 50.13  ? 39  DG  J "C2'" 1 
ATOM   9563  C "C1'" . DG  J 7  39  ? 122.839 78.511  94.816  1.00 49.16  ? 39  DG  J "C1'" 1 
ATOM   9564  N N9    . DG  J 7  39  ? 123.032 77.491  93.797  1.00 54.85  ? 39  DG  J N9    1 
ATOM   9565  C C8    . DG  J 7  39  ? 122.108 77.046  92.900  1.00 57.27  ? 39  DG  J C8    1 
ATOM   9566  N N7    . DG  J 7  39  ? 122.556 76.124  92.111  1.00 60.41  ? 39  DG  J N7    1 
ATOM   9567  C C5    . DG  J 7  39  ? 123.848 75.949  92.507  1.00 60.98  ? 39  DG  J C5    1 
ATOM   9568  C C6    . DG  J 7  39  ? 124.803 75.068  91.996  1.00 64.60  ? 39  DG  J C6    1 
ATOM   9569  O O6    . DG  J 7  39  ? 124.670 74.266  91.078  1.00 66.73  ? 39  DG  J O6    1 
ATOM   9570  N N1    . DG  J 7  39  ? 126.003 75.176  92.655  1.00 66.84  ? 39  DG  J N1    1 
ATOM   9571  C C2    . DG  J 7  39  ? 126.247 76.032  93.683  1.00 67.07  ? 39  DG  J C2    1 
ATOM   9572  N N2    . DG  J 7  39  ? 127.487 75.984  94.195  1.00 70.37  ? 39  DG  J N2    1 
ATOM   9573  N N3    . DG  J 7  39  ? 125.348 76.869  94.178  1.00 59.03  ? 39  DG  J N3    1 
ATOM   9574  C C4    . DG  J 7  39  ? 124.170 76.775  93.540  1.00 58.68  ? 39  DG  J C4    1 
ATOM   9575  P P     . DA  J 7  40  ? 121.945 82.510  96.233  1.00 34.93  ? 40  DA  J P     1 
ATOM   9576  O OP1   . DA  J 7  40  ? 121.692 83.250  97.505  1.00 33.31  ? 40  DA  J OP1   1 
ATOM   9577  O OP2   . DA  J 7  40  ? 121.081 82.814  95.077  1.00 32.90  ? 40  DA  J OP2   1 
ATOM   9578  O "O5'" . DA  J 7  40  ? 123.461 82.685  95.793  1.00 39.16  ? 40  DA  J "O5'" 1 
ATOM   9579  C "C5'" . DA  J 7  40  ? 124.522 82.138  96.590  1.00 39.70  ? 40  DA  J "C5'" 1 
ATOM   9580  C "C4'" . DA  J 7  40  ? 125.809 82.028  95.807  1.00 44.81  ? 40  DA  J "C4'" 1 
ATOM   9581  O "O4'" . DA  J 7  40  ? 125.734 80.970  94.830  1.00 46.78  ? 40  DA  J "O4'" 1 
ATOM   9582  C "C3'" . DA  J 7  40  ? 126.233 83.268  95.047  1.00 49.00  ? 40  DA  J "C3'" 1 
ATOM   9583  O "O3'" . DA  J 7  40  ? 127.642 83.422  95.274  1.00 51.80  ? 40  DA  J "O3'" 1 
ATOM   9584  C "C2'" . DA  J 7  40  ? 125.887 82.898  93.610  1.00 49.84  ? 40  DA  J "C2'" 1 
ATOM   9585  C "C1'" . DA  J 7  40  ? 126.238 81.426  93.589  1.00 48.29  ? 40  DA  J "C1'" 1 
ATOM   9586  N N9    . DA  J 7  40  ? 125.607 80.580  92.563  1.00 51.84  ? 40  DA  J N9    1 
ATOM   9587  C C8    . DA  J 7  40  ? 124.344 80.653  92.069  1.00 51.76  ? 40  DA  J C8    1 
ATOM   9588  N N7    . DA  J 7  40  ? 124.059 79.756  91.157  1.00 53.39  ? 40  DA  J N7    1 
ATOM   9589  C C5    . DA  J 7  40  ? 125.226 79.047  91.042  1.00 57.40  ? 40  DA  J C5    1 
ATOM   9590  C C6    . DA  J 7  40  ? 125.612 77.959  90.259  1.00 60.84  ? 40  DA  J C6    1 
ATOM   9591  N N6    . DA  J 7  40  ? 124.777 77.399  89.399  1.00 61.70  ? 40  DA  J N6    1 
ATOM   9592  N N1    . DA  J 7  40  ? 126.866 77.474  90.379  1.00 64.16  ? 40  DA  J N1    1 
ATOM   9593  C C2    . DA  J 7  40  ? 127.675 78.065  91.254  1.00 62.12  ? 40  DA  J C2    1 
ATOM   9594  N N3    . DA  J 7  40  ? 127.431 79.088  92.046  1.00 57.65  ? 40  DA  J N3    1 
ATOM   9595  C C4    . DA  J 7  40  ? 126.184 79.538  91.897  1.00 58.89  ? 40  DA  J C4    1 
ATOM   9596  P P     . DG  J 7  41  ? 128.526 84.699  94.849  1.00 58.09  ? 41  DG  J P     1 
ATOM   9597  O OP1   . DG  J 7  41  ? 129.378 85.062  96.001  1.00 56.13  ? 41  DG  J OP1   1 
ATOM   9598  O OP2   . DG  J 7  41  ? 127.630 85.729  94.244  1.00 59.49  ? 41  DG  J OP2   1 
ATOM   9599  O "O5'" . DG  J 7  41  ? 129.457 84.064  93.728  1.00 57.18  ? 41  DG  J "O5'" 1 
ATOM   9600  C "C5'" . DG  J 7  41  ? 130.299 82.953  94.103  1.00 59.07  ? 41  DG  J "C5'" 1 
ATOM   9601  C "C4'" . DG  J 7  41  ? 131.062 82.397  92.928  1.00 61.15  ? 41  DG  J "C4'" 1 
ATOM   9602  O "O4'" . DG  J 7  41  ? 130.185 81.565  92.134  1.00 56.31  ? 41  DG  J "O4'" 1 
ATOM   9603  C "C3'" . DG  J 7  41  ? 131.659 83.431  91.989  1.00 60.60  ? 41  DG  J "C3'" 1 
ATOM   9604  O "O3'" . DG  J 7  41  ? 133.028 83.074  91.750  1.00 64.19  ? 41  DG  J "O3'" 1 
ATOM   9605  C "C2'" . DG  J 7  41  ? 130.798 83.315  90.746  1.00 58.04  ? 41  DG  J "C2'" 1 
ATOM   9606  C "C1'" . DG  J 7  41  ? 130.327 81.881  90.769  1.00 58.89  ? 41  DG  J "C1'" 1 
ATOM   9607  N N9    . DG  J 7  41  ? 129.035 81.674  90.124  1.00 59.16  ? 41  DG  J N9    1 
ATOM   9608  C C8    . DG  J 7  41  ? 127.883 82.365  90.353  1.00 56.63  ? 41  DG  J C8    1 
ATOM   9609  N N7    . DG  J 7  41  ? 126.879 81.960  89.630  1.00 58.03  ? 41  DG  J N7    1 
ATOM   9610  C C5    . DG  J 7  41  ? 127.403 80.932  88.876  1.00 60.84  ? 41  DG  J C5    1 
ATOM   9611  C C6    . DG  J 7  41  ? 126.791 80.107  87.905  1.00 64.16  ? 41  DG  J C6    1 
ATOM   9612  O O6    . DG  J 7  41  ? 125.617 80.128  87.515  1.00 66.14  ? 41  DG  J O6    1 
ATOM   9613  N N1    . DG  J 7  41  ? 127.685 79.192  87.381  1.00 65.14  ? 41  DG  J N1    1 
ATOM   9614  C C2    . DG  J 7  41  ? 128.995 79.091  87.748  1.00 67.87  ? 41  DG  J C2    1 
ATOM   9615  N N2    . DG  J 7  41  ? 129.721 78.147  87.140  1.00 72.52  ? 41  DG  J N2    1 
ATOM   9616  N N3    . DG  J 7  41  ? 129.572 79.856  88.651  1.00 62.70  ? 41  DG  J N3    1 
ATOM   9617  C C4    . DG  J 7  41  ? 128.728 80.746  89.169  1.00 61.38  ? 41  DG  J C4    1 
ATOM   9618  P P     . DT  J 7  42  ? 134.080 84.034  90.990  1.00 88.68  ? 42  DT  J P     1 
ATOM   9619  O OP1   . DT  J 7  42  ? 135.413 83.839  91.606  1.00 72.18  ? 42  DT  J OP1   1 
ATOM   9620  O OP2   . DT  J 7  42  ? 133.509 85.401  90.875  1.00 68.11  ? 42  DT  J OP2   1 
ATOM   9621  O "O5'" . DT  J 7  42  ? 134.101 83.392  89.534  1.00 72.52  ? 42  DT  J "O5'" 1 
ATOM   9622  C "C5'" . DT  J 7  42  ? 134.448 82.005  89.385  1.00 76.64  ? 42  DT  J "C5'" 1 
ATOM   9623  C "C4'" . DT  J 7  42  ? 134.421 81.586  87.938  1.00 72.92  ? 42  DT  J "C4'" 1 
ATOM   9624  O "O4'" . DT  J 7  42  ? 133.069 81.248  87.591  1.00 66.05  ? 42  DT  J "O4'" 1 
ATOM   9625  C "C3'" . DT  J 7  42  ? 134.895 82.626  86.930  1.00 73.11  ? 42  DT  J "C3'" 1 
ATOM   9626  O "O3'" . DT  J 7  42  ? 136.080 82.116  86.293  1.00 76.50  ? 42  DT  J "O3'" 1 
ATOM   9627  C "C2'" . DT  J 7  42  ? 133.731 82.766  85.955  1.00 68.49  ? 42  DT  J "C2'" 1 
ATOM   9628  C "C1'" . DT  J 7  42  ? 132.826 81.600  86.259  1.00 66.98  ? 42  DT  J "C1'" 1 
ATOM   9629  N N1    . DT  J 7  42  ? 131.399 81.900  86.158  1.00 64.29  ? 42  DT  J N1    1 
ATOM   9630  C C2    . DT  J 7  42  ? 130.618 81.127  85.340  1.00 68.27  ? 42  DT  J C2    1 
ATOM   9631  O O2    . DT  J 7  42  ? 131.059 80.199  84.689  1.00 67.67  ? 42  DT  J O2    1 
ATOM   9632  N N3    . DT  J 7  42  ? 129.302 81.481  85.312  1.00 67.39  ? 42  DT  J N3    1 
ATOM   9633  C C4    . DT  J 7  42  ? 128.715 82.507  86.006  1.00 67.36  ? 42  DT  J C4    1 
ATOM   9634  O O4    . DT  J 7  42  ? 127.514 82.735  85.910  1.00 68.88  ? 42  DT  J O4    1 
ATOM   9635  C C5    . DT  J 7  42  ? 129.592 83.263  86.834  1.00 61.17  ? 42  DT  J C5    1 
ATOM   9636  C C7    . DT  J 7  42  ? 129.008 84.388  87.602  1.00 66.44  ? 42  DT  J C7    1 
ATOM   9637  C C6    . DT  J 7  42  ? 130.872 82.932  86.872  1.00 62.33  ? 42  DT  J C6    1 
ATOM   9638  P P     . DA  J 7  43  ? 136.980 82.970  85.258  1.00 79.12  ? 43  DA  J P     1 
ATOM   9639  O OP1   . DA  J 7  43  ? 138.359 82.427  85.290  1.00 83.46  ? 43  DA  J OP1   1 
ATOM   9640  O OP2   . DA  J 7  43  ? 136.745 84.418  85.490  1.00 80.79  ? 43  DA  J OP2   1 
ATOM   9641  O "O5'" . DA  J 7  43  ? 136.337 82.595  83.848  1.00 81.88  ? 43  DA  J "O5'" 1 
ATOM   9642  C "C5'" . DA  J 7  43  ? 136.180 81.213  83.469  1.00 82.18  ? 43  DA  J "C5'" 1 
ATOM   9643  C "C4'" . DA  J 7  43  ? 135.500 81.090  82.128  1.00 83.57  ? 43  DA  J "C4'" 1 
ATOM   9644  O "O4'" . DA  J 7  43  ? 134.070 81.251  82.286  1.00 74.79  ? 43  DA  J "O4'" 1 
ATOM   9645  C "C3'" . DA  J 7  43  ? 135.934 82.103  81.075  1.00 87.44  ? 43  DA  J "C3'" 1 
ATOM   9646  O "O3'" . DA  J 7  43  ? 136.040 81.406  79.822  1.00 84.84  ? 43  DA  J "O3'" 1 
ATOM   9647  C "C2'" . DA  J 7  43  ? 134.790 83.106  81.093  1.00 77.70  ? 43  DA  J "C2'" 1 
ATOM   9648  C "C1'" . DA  J 7  43  ? 133.596 82.215  81.368  1.00 73.62  ? 43  DA  J "C1'" 1 
ATOM   9649  N N9    . DA  J 7  43  ? 132.444 82.882  81.969  1.00 71.46  ? 43  DA  J N9    1 
ATOM   9650  C C8    . DA  J 7  43  ? 132.420 83.838  82.945  1.00 70.48  ? 43  DA  J C8    1 
ATOM   9651  N N7    . DA  J 7  43  ? 131.221 84.235  83.272  1.00 65.71  ? 43  DA  J N7    1 
ATOM   9652  C C5    . DA  J 7  43  ? 130.404 83.488  82.460  1.00 67.36  ? 43  DA  J C5    1 
ATOM   9653  C C6    . DA  J 7  43  ? 129.025 83.455  82.330  1.00 69.35  ? 43  DA  J C6    1 
ATOM   9654  N N6    . DA  J 7  43  ? 128.228 84.219  83.061  1.00 70.41  ? 43  DA  J N6    1 
ATOM   9655  N N1    . DA  J 7  43  ? 128.500 82.605  81.428  1.00 72.05  ? 43  DA  J N1    1 
ATOM   9656  C C2    . DA  J 7  43  ? 129.345 81.854  80.718  1.00 73.81  ? 43  DA  J C2    1 
ATOM   9657  N N3    . DA  J 7  43  ? 130.667 81.804  80.755  1.00 71.70  ? 43  DA  J N3    1 
ATOM   9658  C C4    . DA  J 7  43  ? 131.139 82.657  81.656  1.00 70.73  ? 43  DA  J C4    1 
ATOM   9659  P P     . DA  J 7  44  ? 136.673 82.043  78.482  1.00 80.08  ? 44  DA  J P     1 
ATOM   9660  O OP1   . DA  J 7  44  ? 137.416 80.971  77.776  1.00 90.35  ? 44  DA  J OP1   1 
ATOM   9661  O OP2   . DA  J 7  44  ? 137.353 83.321  78.819  1.00 88.69  ? 44  DA  J OP2   1 
ATOM   9662  O "O5'" . DA  J 7  44  ? 135.370 82.382  77.635  1.00 83.79  ? 44  DA  J "O5'" 1 
ATOM   9663  C "C5'" . DA  J 7  44  ? 134.521 81.304  77.209  1.00 80.96  ? 44  DA  J "C5'" 1 
ATOM   9664  C "C4'" . DA  J 7  44  ? 133.347 81.816  76.416  1.00 85.35  ? 44  DA  J "C4'" 1 
ATOM   9665  O "O4'" . DA  J 7  44  ? 132.359 82.357  77.324  1.00 78.22  ? 44  DA  J "O4'" 1 
ATOM   9666  C "C3'" . DA  J 7  44  ? 133.669 82.922  75.408  1.00 90.55  ? 44  DA  J "C3'" 1 
ATOM   9667  O "O3'" . DA  J 7  44  ? 132.969 82.652  74.180  1.00 93.91  ? 44  DA  J "O3'" 1 
ATOM   9668  C "C2'" . DA  J 7  44  ? 133.128 84.160  76.098  1.00 80.56  ? 44  DA  J "C2'" 1 
ATOM   9669  C "C1'" . DA  J 7  44  ? 131.927 83.604  76.833  1.00 79.05  ? 44  DA  J "C1'" 1 
ATOM   9670  N N9    . DA  J 7  44  ? 131.479 84.425  77.947  1.00 76.25  ? 44  DA  J N9    1 
ATOM   9671  C C8    . DA  J 7  44  ? 132.239 85.085  78.864  1.00 74.46  ? 44  DA  J C8    1 
ATOM   9672  N N7    . DA  J 7  44  ? 131.546 85.744  79.746  1.00 71.44  ? 44  DA  J N7    1 
ATOM   9673  C C5    . DA  J 7  44  ? 130.244 85.503  79.384  1.00 69.29  ? 44  DA  J C5    1 
ATOM   9674  C C6    . DA  J 7  44  ? 129.038 85.919  79.925  1.00 68.97  ? 44  DA  J C6    1 
ATOM   9675  N N6    . DA  J 7  44  ? 128.958 86.702  80.986  1.00 70.15  ? 44  DA  J N6    1 
ATOM   9676  N N1    . DA  J 7  44  ? 127.906 85.510  79.340  1.00 69.96  ? 44  DA  J N1    1 
ATOM   9677  C C2    . DA  J 7  44  ? 128.003 84.724  78.273  1.00 72.51  ? 44  DA  J C2    1 
ATOM   9678  N N3    . DA  J 7  44  ? 129.089 84.265  77.673  1.00 72.31  ? 44  DA  J N3    1 
ATOM   9679  C C4    . DA  J 7  44  ? 130.187 84.694  78.283  1.00 72.41  ? 44  DA  J C4    1 
ATOM   9680  P P     . DT  J 7  45  ? 133.234 83.448  72.796  1.00 83.93  ? 45  DT  J P     1 
ATOM   9681  O OP1   . DT  J 7  45  ? 133.305 82.452  71.700  1.00 97.17  ? 45  DT  J OP1   1 
ATOM   9682  O OP2   . DT  J 7  45  ? 134.350 84.414  72.988  1.00 91.38  ? 45  DT  J OP2   1 
ATOM   9683  O "O5'" . DT  J 7  45  ? 131.889 84.286  72.634  1.00 87.93  ? 45  DT  J "O5'" 1 
ATOM   9684  C "C5'" . DT  J 7  45  ? 130.660 83.613  72.314  1.00 83.77  ? 45  DT  J "C5'" 1 
ATOM   9685  C "C4'" . DT  J 7  45  ? 129.485 84.545  72.466  1.00 84.33  ? 45  DT  J "C4'" 1 
ATOM   9686  O "O4'" . DT  J 7  45  ? 129.361 84.936  73.850  1.00 79.34  ? 45  DT  J "O4'" 1 
ATOM   9687  C "C3'" . DT  J 7  45  ? 129.571 85.853  71.682  1.00 88.03  ? 45  DT  J "C3'" 1 
ATOM   9688  O "O3'" . DT  J 7  45  ? 128.785 85.758  70.474  1.00 88.50  ? 45  DT  J "O3'" 1 
ATOM   9689  C "C2'" . DT  J 7  45  ? 128.992 86.888  72.644  1.00 80.03  ? 45  DT  J "C2'" 1 
ATOM   9690  C "C1'" . DT  J 7  45  ? 128.633 86.136  73.895  1.00 77.34  ? 45  DT  J "C1'" 1 
ATOM   9691  N N1    . DT  J 7  45  ? 128.984 86.895  75.102  1.00 75.85  ? 45  DT  J N1    1 
ATOM   9692  C C2    . DT  J 7  45  ? 127.965 87.408  75.866  1.00 74.31  ? 45  DT  J C2    1 
ATOM   9693  O O2    . DT  J 7  45  ? 126.792 87.255  75.577  1.00 73.06  ? 45  DT  J O2    1 
ATOM   9694  N N3    . DT  J 7  45  ? 128.371 88.101  76.971  1.00 69.21  ? 45  DT  J N3    1 
ATOM   9695  C C4    . DT  J 7  45  ? 129.664 88.324  77.373  1.00 68.24  ? 45  DT  J C4    1 
ATOM   9696  O O4    . DT  J 7  45  ? 129.901 88.966  78.395  1.00 67.24  ? 45  DT  J O4    1 
ATOM   9697  C C5    . DT  J 7  45  ? 130.675 87.758  76.523  1.00 69.97  ? 45  DT  J C5    1 
ATOM   9698  C C7    . DT  J 7  45  ? 132.100 87.959  76.886  1.00 69.65  ? 45  DT  J C7    1 
ATOM   9699  C C6    . DT  J 7  45  ? 130.293 87.081  75.444  1.00 74.32  ? 45  DT  J C6    1 
ATOM   9700  P P     . DC  J 7  46  ? 128.694 86.946  69.374  1.00 78.54  ? 46  DC  J P     1 
ATOM   9701  O OP1   . DC  J 7  46  ? 128.275 86.362  68.077  1.00 97.18  ? 46  DC  J OP1   1 
ATOM   9702  O OP2   . DC  J 7  46  ? 129.908 87.800  69.465  1.00 88.19  ? 46  DC  J OP2   1 
ATOM   9703  O "O5'" . DC  J 7  46  ? 127.514 87.881  69.908  1.00 82.26  ? 46  DC  J "O5'" 1 
ATOM   9704  C "C5'" . DC  J 7  46  ? 126.198 87.327  70.112  1.00 85.17  ? 46  DC  J "C5'" 1 
ATOM   9705  C "C4'" . DC  J 7  46  ? 125.270 88.309  70.792  1.00 84.65  ? 46  DC  J "C4'" 1 
ATOM   9706  O "O4'" . DC  J 7  46  ? 125.774 88.659  72.102  1.00 80.12  ? 46  DC  J "O4'" 1 
ATOM   9707  C "C3'" . DC  J 7  46  ? 125.048 89.616  70.041  1.00 83.51  ? 46  DC  J "C3'" 1 
ATOM   9708  O "O3'" . DC  J 7  46  ? 123.627 89.826  69.944  1.00 83.03  ? 46  DC  J "O3'" 1 
ATOM   9709  C "C2'" . DC  J 7  46  ? 125.724 90.663  70.920  1.00 77.58  ? 46  DC  J "C2'" 1 
ATOM   9710  C "C1'" . DC  J 7  46  ? 125.674 90.053  72.304  1.00 76.04  ? 46  DC  J "C1'" 1 
ATOM   9711  N N1    . DC  J 7  46  ? 126.775 90.429  73.217  1.00 71.89  ? 46  DC  J N1    1 
ATOM   9712  C C2    . DC  J 7  46  ? 126.493 91.059  74.429  1.00 67.73  ? 46  DC  J C2    1 
ATOM   9713  O O2    . DC  J 7  46  ? 125.319 91.301  74.734  1.00 68.82  ? 46  DC  J O2    1 
ATOM   9714  N N3    . DC  J 7  46  ? 127.501 91.396  75.255  1.00 65.91  ? 46  DC  J N3    1 
ATOM   9715  C C4    . DC  J 7  46  ? 128.760 91.129  74.918  1.00 66.20  ? 46  DC  J C4    1 
ATOM   9716  N N4    . DC  J 7  46  ? 129.725 91.484  75.768  1.00 63.71  ? 46  DC  J N4    1 
ATOM   9717  C C5    . DC  J 7  46  ? 129.079 90.495  73.694  1.00 67.60  ? 46  DC  J C5    1 
ATOM   9718  C C6    . DC  J 7  46  ? 128.068 90.164  72.886  1.00 71.35  ? 46  DC  J C6    1 
ATOM   9719  P P     . DC  J 7  47  ? 122.947 90.839  68.888  1.00 89.97  ? 47  DC  J P     1 
ATOM   9720  O OP1   . DC  J 7  47  ? 121.565 90.378  68.613  1.00 89.09  ? 47  DC  J OP1   1 
ATOM   9721  O OP2   . DC  J 7  47  ? 123.896 91.106  67.776  1.00 87.82  ? 47  DC  J OP2   1 
ATOM   9722  O "O5'" . DC  J 7  47  ? 122.877 92.220  69.674  1.00 85.62  ? 47  DC  J "O5'" 1 
ATOM   9723  C "C5'" . DC  J 7  47  ? 122.097 92.361  70.872  1.00 86.58  ? 47  DC  J "C5'" 1 
ATOM   9724  C "C4'" . DC  J 7  47  ? 122.346 93.720  71.480  1.00 77.71  ? 47  DC  J "C4'" 1 
ATOM   9725  O "O4'" . DC  J 7  47  ? 123.619 93.724  72.177  1.00 75.96  ? 47  DC  J "O4'" 1 
ATOM   9726  C "C3'" . DC  J 7  47  ? 122.434 94.834  70.427  1.00 80.17  ? 47  DC  J "C3'" 1 
ATOM   9727  O "O3'" . DC  J 7  47  ? 121.838 96.068  70.843  1.00 76.04  ? 47  DC  J "O3'" 1 
ATOM   9728  C "C2'" . DC  J 7  47  ? 123.926 95.025  70.300  1.00 78.32  ? 47  DC  J "C2'" 1 
ATOM   9729  C "C1'" . DC  J 7  47  ? 124.359 94.840  71.740  1.00 70.01  ? 47  DC  J "C1'" 1 
ATOM   9730  N N1    . DC  J 7  47  ? 125.790 94.597  72.016  1.00 63.18  ? 47  DC  J N1    1 
ATOM   9731  C C2    . DC  J 7  47  ? 126.243 94.859  73.301  1.00 63.71  ? 47  DC  J C2    1 
ATOM   9732  O O2    . DC  J 7  47  ? 125.449 95.272  74.146  1.00 63.55  ? 47  DC  J O2    1 
ATOM   9733  N N3    . DC  J 7  47  ? 127.525 94.663  73.619  1.00 63.57  ? 47  DC  J N3    1 
ATOM   9734  C C4    . DC  J 7  47  ? 128.367 94.218  72.701  1.00 64.92  ? 47  DC  J C4    1 
ATOM   9735  N N4    . DC  J 7  47  ? 129.639 94.031  73.056  1.00 65.58  ? 47  DC  J N4    1 
ATOM   9736  C C5    . DC  J 7  47  ? 127.949 93.940  71.383  1.00 64.58  ? 47  DC  J C5    1 
ATOM   9737  C C6    . DC  J 7  47  ? 126.671 94.139  71.083  1.00 61.39  ? 47  DC  J C6    1 
ATOM   9738  P P     . DC  J 7  48  ? 120.251 96.325  70.831  1.00 76.02  ? 48  DC  J P     1 
ATOM   9739  O OP1   . DC  J 7  48  ? 119.548 95.034  70.993  1.00 81.41  ? 48  DC  J OP1   1 
ATOM   9740  O OP2   . DC  J 7  48  ? 119.930 97.249  69.719  1.00 80.78  ? 48  DC  J OP2   1 
ATOM   9741  O "O5'" . DC  J 7  48  ? 120.069 97.182  72.154  1.00 80.02  ? 48  DC  J "O5'" 1 
ATOM   9742  C "C5'" . DC  J 7  48  ? 120.281 96.523  73.410  1.00 82.90  ? 48  DC  J "C5'" 1 
ATOM   9743  C "C4'" . DC  J 7  48  ? 120.318 97.489  74.564  1.00 78.68  ? 48  DC  J "C4'" 1 
ATOM   9744  O "O4'" . DC  J 7  48  ? 121.690 97.746  74.934  1.00 72.71  ? 48  DC  J "O4'" 1 
ATOM   9745  C "C3'" . DC  J 7  48  ? 119.683 98.846  74.341  1.00 71.64  ? 48  DC  J "C3'" 1 
ATOM   9746  O "O3'" . DC  J 7  48  ? 119.137 99.249  75.615  1.00 75.98  ? 48  DC  J "O3'" 1 
ATOM   9747  C "C2'" . DC  J 7  48  ? 120.865 99.683  73.862  1.00 68.13  ? 48  DC  J "C2'" 1 
ATOM   9748  C "C1'" . DC  J 7  48  ? 122.091 99.036  74.509  1.00 66.06  ? 48  DC  J "C1'" 1 
ATOM   9749  N N1    . DC  J 7  48  ? 123.332 98.850  73.709  1.00 63.40  ? 48  DC  J N1    1 
ATOM   9750  C C2    . DC  J 7  48  ? 124.566 98.886  74.374  1.00 61.73  ? 48  DC  J C2    1 
ATOM   9751  O O2    . DC  J 7  48  ? 124.608 99.069  75.593  1.00 64.58  ? 48  DC  J O2    1 
ATOM   9752  N N3    . DC  J 7  48  ? 125.715 98.721  73.701  1.00 61.77  ? 48  DC  J N3    1 
ATOM   9753  C C4    . DC  J 7  48  ? 125.681 98.524  72.396  1.00 62.51  ? 48  DC  J C4    1 
ATOM   9754  N N4    . DC  J 7  48  ? 126.843 98.367  71.766  1.00 63.09  ? 48  DC  J N4    1 
ATOM   9755  C C5    . DC  J 7  48  ? 124.462 98.482  71.682  1.00 66.94  ? 48  DC  J C5    1 
ATOM   9756  C C6    . DC  J 7  48  ? 123.328 98.646  72.363  1.00 65.33  ? 48  DC  J C6    1 
ATOM   9757  P P     . DC  J 7  49  ? 118.348 100.624 75.915  1.00 87.63  ? 49  DC  J P     1 
ATOM   9758  O OP1   . DC  J 7  49  ? 117.366 100.385 77.002  1.00 81.82  ? 49  DC  J OP1   1 
ATOM   9759  O OP2   . DC  J 7  49  ? 117.928 101.253 74.635  1.00 79.45  ? 49  DC  J OP2   1 
ATOM   9760  O "O5'" . DC  J 7  49  ? 119.497 101.574 76.478  1.00 73.18  ? 49  DC  J "O5'" 1 
ATOM   9761  C "C5'" . DC  J 7  49  ? 120.197 101.166 77.666  1.00 70.80  ? 49  DC  J "C5'" 1 
ATOM   9762  C "C4'" . DC  J 7  49  ? 121.410 102.018 77.940  1.00 57.75  ? 49  DC  J "C4'" 1 
ATOM   9763  O "O4'" . DC  J 7  49  ? 122.424 101.787 76.943  1.00 58.47  ? 49  DC  J "O4'" 1 
ATOM   9764  C "C3'" . DC  J 7  49  ? 121.149 103.513 77.984  1.00 54.05  ? 49  DC  J "C3'" 1 
ATOM   9765  O "O3'" . DC  J 7  49  ? 121.571 103.978 79.290  1.00 46.90  ? 49  DC  J "O3'" 1 
ATOM   9766  C "C2'" . DC  J 7  49  ? 121.946 104.048 76.788  1.00 51.48  ? 49  DC  J "C2'" 1 
ATOM   9767  C "C1'" . DC  J 7  49  ? 123.014 103.000 76.549  1.00 50.32  ? 49  DC  J "C1'" 1 
ATOM   9768  N N1    . DC  J 7  49  ? 123.480 102.797 75.162  1.00 54.12  ? 49  DC  J N1    1 
ATOM   9769  C C2    . DC  J 7  49  ? 124.847 102.653 74.902  1.00 53.11  ? 49  DC  J C2    1 
ATOM   9770  O O2    . DC  J 7  49  ? 125.663 102.699 75.820  1.00 51.25  ? 49  DC  J O2    1 
ATOM   9771  N N3    . DC  J 7  49  ? 125.278 102.467 73.647  1.00 54.65  ? 49  DC  J N3    1 
ATOM   9772  C C4    . DC  J 7  49  ? 124.403 102.416 72.656  1.00 56.43  ? 49  DC  J C4    1 
ATOM   9773  N N4    . DC  J 7  49  ? 124.861 102.230 71.420  1.00 59.28  ? 49  DC  J N4    1 
ATOM   9774  C C5    . DC  J 7  49  ? 123.015 102.559 72.879  1.00 55.71  ? 49  DC  J C5    1 
ATOM   9775  C C6    . DC  J 7  49  ? 122.603 102.742 74.127  1.00 56.88  ? 49  DC  J C6    1 
ATOM   9776  P P     . DT  J 7  50  ? 121.640 105.528 79.709  1.00 41.07  ? 50  DT  J P     1 
ATOM   9777  O OP1   . DT  J 7  50  ? 121.216 105.740 81.101  1.00 28.50  ? 50  DT  J OP1   1 
ATOM   9778  O OP2   . DT  J 7  50  ? 120.996 106.319 78.633  1.00 47.88  ? 50  DT  J OP2   1 
ATOM   9779  O "O5'" . DT  J 7  50  ? 123.207 105.797 79.647  1.00 36.66  ? 50  DT  J "O5'" 1 
ATOM   9780  C "C5'" . DT  J 7  50  ? 124.122 105.029 80.451  1.00 27.60  ? 50  DT  J "C5'" 1 
ATOM   9781  C "C4'" . DT  J 7  50  ? 125.542 105.399 80.112  1.00 28.02  ? 50  DT  J "C4'" 1 
ATOM   9782  O "O4'" . DT  J 7  50  ? 125.838 104.980 78.765  1.00 37.84  ? 50  DT  J "O4'" 1 
ATOM   9783  C "C3'" . DT  J 7  50  ? 125.821 106.886 80.174  1.00 28.28  ? 50  DT  J "C3'" 1 
ATOM   9784  O "O3'" . DT  J 7  50  ? 126.808 107.161 81.175  1.00 27.00  ? 50  DT  J "O3'" 1 
ATOM   9785  C "C2'" . DT  J 7  50  ? 126.335 107.237 78.788  1.00 38.10  ? 50  DT  J "C2'" 1 
ATOM   9786  C "C1'" . DT  J 7  50  ? 126.656 105.932 78.137  1.00 36.97  ? 50  DT  J "C1'" 1 
ATOM   9787  N N1    . DT  J 7  50  ? 126.355 105.929 76.708  1.00 36.93  ? 50  DT  J N1    1 
ATOM   9788  C C2    . DT  J 7  50  ? 127.348 105.654 75.806  1.00 43.27  ? 50  DT  J C2    1 
ATOM   9789  O O2    . DT  J 7  50  ? 128.500 105.407 76.116  1.00 47.17  ? 50  DT  J O2    1 
ATOM   9790  N N3    . DT  J 7  50  ? 126.953 105.677 74.504  1.00 44.81  ? 50  DT  J N3    1 
ATOM   9791  C C4    . DT  J 7  50  ? 125.702 105.940 74.026  1.00 49.25  ? 50  DT  J C4    1 
ATOM   9792  O O4    . DT  J 7  50  ? 125.463 105.925 72.815  1.00 51.99  ? 50  DT  J O4    1 
ATOM   9793  C C5    . DT  J 7  50  ? 124.726 106.216 75.025  1.00 43.81  ? 50  DT  J C5    1 
ATOM   9794  C C7    . DT  J 7  50  ? 123.346 106.523 74.581  1.00 46.32  ? 50  DT  J C7    1 
ATOM   9795  C C6    . DT  J 7  50  ? 125.090 106.198 76.294  1.00 36.99  ? 50  DT  J C6    1 
ATOM   9796  P P     . DT  J 7  51  ? 127.138 108.685 81.570  1.00 31.49  ? 51  DT  J P     1 
ATOM   9797  O OP1   . DT  J 7  51  ? 127.584 108.756 82.991  1.00 34.57  ? 51  DT  J OP1   1 
ATOM   9798  O OP2   . DT  J 7  51  ? 126.023 109.564 81.147  1.00 42.76  ? 51  DT  J OP2   1 
ATOM   9799  O "O5'" . DT  J 7  51  ? 128.352 109.082 80.642  1.00 34.22  ? 51  DT  J "O5'" 1 
ATOM   9800  C "C5'" . DT  J 7  51  ? 129.627 108.493 80.827  1.00 40.08  ? 51  DT  J "C5'" 1 
ATOM   9801  C "C4'" . DT  J 7  51  ? 130.522 108.720 79.629  1.00 47.54  ? 51  DT  J "C4'" 1 
ATOM   9802  O "O4'" . DT  J 7  51  ? 129.874 108.347 78.392  1.00 44.41  ? 51  DT  J "O4'" 1 
ATOM   9803  C "C3'" . DT  J 7  51  ? 131.006 110.145 79.439  1.00 50.40  ? 51  DT  J "C3'" 1 
ATOM   9804  O "O3'" . DT  J 7  51  ?