data_6UUQ
# 
_entry.id   6UUQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.333 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6UUQ         
WWPDB D_1000245220 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6UUQ 
_pdbx_database_status.recvd_initial_deposition_date   2019-10-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Sheftic, S.' 1 ? 
'Page, R.'    2 ? 
'Peti, W.'    3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Adv' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2375-2548 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'The structure of the RCAN1:CN complex explains the inhibition of and substrate recruitment by calcineurin.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/sciadv.aba3681 
_citation.pdbx_database_id_PubMed   32936779 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, Y.'           1 ? 
primary 'Sheftic, S.R.'    2 ? 
primary 'Grigoriu, S.'     3 ? 
primary 'Schwieters, C.D.' 4 ? 
primary 'Page, R.'         5 ? 
primary 'Peti, W.'         6 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6UUQ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     57.841 
_cell.length_a_esd                 ? 
_cell.length_b                     71.159 
_cell.length_b_esd                 ? 
_cell.length_c                     92.049 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6UUQ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform' 36467.672 1   3.1.3.16 ?              
? ? 
2 polymer     man Calcipressin-1                                                            4343.842  1   ?        'V158I, H159T' 
? ? 
3 non-polymer syn 'PHOSPHATE ION'                                                           94.971    2   ?        ?              
? ? 
4 non-polymer syn 'ZINC ION'                                                                65.409    1   ?        ?              
? ? 
5 non-polymer syn 'FE (III) ION'                                                            55.845    1   ?        ?              
? ? 
6 water       nat water                                                                     18.015    313 ?        ?              
? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CAM-PRP catalytic subunit,Calmodulin-dependent calcineurin A subunit alpha isoform' 
2 
'Adapt78,Down syndrome critical region protein 1,Myocyte-enriched calcineurin-interacting protein 1,MCIP1,Regulator of calcineurin 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFE
VGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFD
CLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYP
AVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPH
;
;MGSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFE
VGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFD
CLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYP
AVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPH
;
A ? 
2 'polypeptide(L)' no no GHMNYDLLYAISKLGPGEKYELHAATDTTPSVVITVCESD GHMNYDLLYAISKLGPGEKYELHAATDTTPSVVITVCESD B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   HIS n 
1 5   ARG n 
1 6   LEU n 
1 7   THR n 
1 8   ALA n 
1 9   LYS n 
1 10  GLU n 
1 11  VAL n 
1 12  PHE n 
1 13  ASP n 
1 14  ASN n 
1 15  ASP n 
1 16  GLY n 
1 17  LYS n 
1 18  PRO n 
1 19  ARG n 
1 20  VAL n 
1 21  ASP n 
1 22  ILE n 
1 23  LEU n 
1 24  LYS n 
1 25  ALA n 
1 26  HIS n 
1 27  LEU n 
1 28  MET n 
1 29  LYS n 
1 30  GLU n 
1 31  GLY n 
1 32  ARG n 
1 33  LEU n 
1 34  GLU n 
1 35  GLU n 
1 36  SER n 
1 37  VAL n 
1 38  ALA n 
1 39  LEU n 
1 40  ARG n 
1 41  ILE n 
1 42  ILE n 
1 43  THR n 
1 44  GLU n 
1 45  GLY n 
1 46  ALA n 
1 47  SER n 
1 48  ILE n 
1 49  LEU n 
1 50  ARG n 
1 51  GLN n 
1 52  GLU n 
1 53  LYS n 
1 54  ASN n 
1 55  LEU n 
1 56  LEU n 
1 57  ASP n 
1 58  ILE n 
1 59  ASP n 
1 60  ALA n 
1 61  PRO n 
1 62  VAL n 
1 63  THR n 
1 64  VAL n 
1 65  CYS n 
1 66  GLY n 
1 67  ASP n 
1 68  ILE n 
1 69  HIS n 
1 70  GLY n 
1 71  GLN n 
1 72  PHE n 
1 73  PHE n 
1 74  ASP n 
1 75  LEU n 
1 76  MET n 
1 77  LYS n 
1 78  LEU n 
1 79  PHE n 
1 80  GLU n 
1 81  VAL n 
1 82  GLY n 
1 83  GLY n 
1 84  SER n 
1 85  PRO n 
1 86  ALA n 
1 87  ASN n 
1 88  THR n 
1 89  ARG n 
1 90  TYR n 
1 91  LEU n 
1 92  PHE n 
1 93  LEU n 
1 94  GLY n 
1 95  ASP n 
1 96  TYR n 
1 97  VAL n 
1 98  ASP n 
1 99  ARG n 
1 100 GLY n 
1 101 TYR n 
1 102 PHE n 
1 103 SER n 
1 104 ILE n 
1 105 GLU n 
1 106 CYS n 
1 107 VAL n 
1 108 LEU n 
1 109 TYR n 
1 110 LEU n 
1 111 TRP n 
1 112 ALA n 
1 113 LEU n 
1 114 LYS n 
1 115 ILE n 
1 116 LEU n 
1 117 TYR n 
1 118 PRO n 
1 119 LYS n 
1 120 THR n 
1 121 LEU n 
1 122 PHE n 
1 123 LEU n 
1 124 LEU n 
1 125 ARG n 
1 126 GLY n 
1 127 ASN n 
1 128 HIS n 
1 129 GLU n 
1 130 CYS n 
1 131 ARG n 
1 132 HIS n 
1 133 LEU n 
1 134 THR n 
1 135 GLU n 
1 136 TYR n 
1 137 PHE n 
1 138 THR n 
1 139 PHE n 
1 140 LYS n 
1 141 GLN n 
1 142 GLU n 
1 143 CYS n 
1 144 LYS n 
1 145 ILE n 
1 146 LYS n 
1 147 TYR n 
1 148 SER n 
1 149 GLU n 
1 150 ARG n 
1 151 VAL n 
1 152 TYR n 
1 153 ASP n 
1 154 ALA n 
1 155 CYS n 
1 156 MET n 
1 157 ASP n 
1 158 ALA n 
1 159 PHE n 
1 160 ASP n 
1 161 CYS n 
1 162 LEU n 
1 163 PRO n 
1 164 LEU n 
1 165 ALA n 
1 166 ALA n 
1 167 LEU n 
1 168 MET n 
1 169 ASN n 
1 170 GLN n 
1 171 GLN n 
1 172 PHE n 
1 173 LEU n 
1 174 CYS n 
1 175 VAL n 
1 176 HIS n 
1 177 GLY n 
1 178 GLY n 
1 179 LEU n 
1 180 SER n 
1 181 PRO n 
1 182 GLU n 
1 183 ILE n 
1 184 ASN n 
1 185 THR n 
1 186 LEU n 
1 187 ASP n 
1 188 ASP n 
1 189 ILE n 
1 190 ARG n 
1 191 LYS n 
1 192 LEU n 
1 193 ASP n 
1 194 ARG n 
1 195 PHE n 
1 196 LYS n 
1 197 GLU n 
1 198 PRO n 
1 199 PRO n 
1 200 ALA n 
1 201 TYR n 
1 202 GLY n 
1 203 PRO n 
1 204 MET n 
1 205 CYS n 
1 206 ASP n 
1 207 ILE n 
1 208 LEU n 
1 209 TRP n 
1 210 SER n 
1 211 ASP n 
1 212 PRO n 
1 213 LEU n 
1 214 GLU n 
1 215 ASP n 
1 216 PHE n 
1 217 GLY n 
1 218 ASN n 
1 219 GLU n 
1 220 LYS n 
1 221 THR n 
1 222 GLN n 
1 223 GLU n 
1 224 HIS n 
1 225 PHE n 
1 226 THR n 
1 227 HIS n 
1 228 ASN n 
1 229 THR n 
1 230 VAL n 
1 231 ARG n 
1 232 GLY n 
1 233 CYS n 
1 234 SER n 
1 235 TYR n 
1 236 PHE n 
1 237 TYR n 
1 238 SER n 
1 239 TYR n 
1 240 PRO n 
1 241 ALA n 
1 242 VAL n 
1 243 CYS n 
1 244 GLU n 
1 245 PHE n 
1 246 LEU n 
1 247 GLN n 
1 248 HIS n 
1 249 ASN n 
1 250 ASN n 
1 251 LEU n 
1 252 LEU n 
1 253 SER n 
1 254 ILE n 
1 255 LEU n 
1 256 ARG n 
1 257 ALA n 
1 258 HIS n 
1 259 GLU n 
1 260 ALA n 
1 261 GLN n 
1 262 ASP n 
1 263 ALA n 
1 264 GLY n 
1 265 TYR n 
1 266 ARG n 
1 267 MET n 
1 268 TYR n 
1 269 ARG n 
1 270 LYS n 
1 271 SER n 
1 272 GLN n 
1 273 THR n 
1 274 THR n 
1 275 GLY n 
1 276 PHE n 
1 277 PRO n 
1 278 SER n 
1 279 LEU n 
1 280 ILE n 
1 281 THR n 
1 282 ILE n 
1 283 PHE n 
1 284 SER n 
1 285 ALA n 
1 286 PRO n 
1 287 ASN n 
1 288 TYR n 
1 289 LEU n 
1 290 ASP n 
1 291 VAL n 
1 292 TYR n 
1 293 ASN n 
1 294 ASN n 
1 295 LYS n 
1 296 ALA n 
1 297 ALA n 
1 298 VAL n 
1 299 LEU n 
1 300 LYS n 
1 301 TYR n 
1 302 GLU n 
1 303 ASN n 
1 304 ASN n 
1 305 VAL n 
1 306 MET n 
1 307 ASN n 
1 308 ILE n 
1 309 ARG n 
1 310 GLN n 
1 311 PHE n 
1 312 ASN n 
1 313 CYS n 
1 314 SER n 
1 315 PRO n 
1 316 HIS n 
2 1   GLY n 
2 2   HIS n 
2 3   MET n 
2 4   ASN n 
2 5   TYR n 
2 6   ASP n 
2 7   LEU n 
2 8   LEU n 
2 9   TYR n 
2 10  ALA n 
2 11  ILE n 
2 12  SER n 
2 13  LYS n 
2 14  LEU n 
2 15  GLY n 
2 16  PRO n 
2 17  GLY n 
2 18  GLU n 
2 19  LYS n 
2 20  TYR n 
2 21  GLU n 
2 22  LEU n 
2 23  HIS n 
2 24  ALA n 
2 25  ALA n 
2 26  THR n 
2 27  ASP n 
2 28  THR n 
2 29  THR n 
2 30  PRO n 
2 31  SER n 
2 32  VAL n 
2 33  VAL n 
2 34  ILE n 
2 35  THR n 
2 36  VAL n 
2 37  CYS n 
2 38  GLU n 
2 39  SER n 
2 40  ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 316 Human ? 'PPP3CA, CALNA, CNA'                ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 40  Human ? 'RCAN1, ADAPT78, CSP1, DSC1, DSCR1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PP2BA_HUMAN Q08209 Q08209-2 1 
;SHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVG
GSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCL
PLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAV
CEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPH
;
26  
2 UNP RCAN1_HUMAN P53805 P53805-2 2 NYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESD 128 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6UUQ A 3 ? 316 ? Q08209 26  ? 339 ? 26  339 
2 2 6UUQ B 4 ? 40  ? P53805 128 ? 164 ? 128 164 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6UUQ MET A 1  ? UNP Q08209 ?   ?   'expression tag'      24  1 
1 6UUQ GLY A 2  ? UNP Q08209 ?   ?   'expression tag'      25  2 
2 6UUQ GLY B 1  ? UNP P53805 ?   ?   'expression tag'      125 3 
2 6UUQ HIS B 2  ? UNP P53805 ?   ?   'expression tag'      126 4 
2 6UUQ MET B 3  ? UNP P53805 ?   ?   'expression tag'      127 5 
2 6UUQ ILE B 34 ? UNP P53805 VAL 158 'engineered mutation' 158 6 
2 6UUQ THR B 35 ? UNP P53805 HIS 159 'engineered mutation' 159 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6UUQ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.32 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.00 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Sodium cacodylate, 12% Peg 8000, 0.1 M Calcium acetate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-07-27 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03320 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-D' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.03320 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-D 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            20.090 
_reflns.entry_id                         6UUQ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.8490 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33218 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            24.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.091 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.849 
_reflns_shell.d_res_low                   1.88 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1644 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.735 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.750 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                86.000 
_refine.B_iso_mean                               24.9930 
_refine.B_iso_min                                7.940 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6UUQ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.8490 
_refine.ls_d_res_low                             36.0140 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33163 
_refine.ls_number_reflns_R_free                  1703 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8700 
_refine.ls_percent_reflns_R_free                 5.1400 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1655 
_refine.ls_R_factor_R_free                       0.2049 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1635 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4f0z 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 19.5000 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1800 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.8490 
_refine_hist.d_res_low                        36.0140 
_refine_hist.number_atoms_solvent             313 
_refine_hist.number_atoms_total               2878 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       320 
_refine_hist.pdbx_B_iso_mean_ligand           23.67 
_refine_hist.pdbx_B_iso_mean_solvent          36.94 
_refine_hist.pdbx_number_atoms_protein        2553 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8490 1.9030  . . 139 2550 99.0000  . . . 0.2636 0.0000 0.2260 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9030 1.9644  . . 113 2601 100.0000 . . . 0.2866 0.0000 0.2075 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9644 2.0346  . . 127 2617 100.0000 . . . 0.2438 0.0000 0.1976 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0346 2.1161  . . 145 2567 100.0000 . . . 0.2269 0.0000 0.1830 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1161 2.2124  . . 163 2577 100.0000 . . . 0.2273 0.0000 0.1684 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2124 2.3290  . . 140 2604 100.0000 . . . 0.1967 0.0000 0.1650 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3290 2.4749  . . 140 2620 100.0000 . . . 0.2365 0.0000 0.1617 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4749 2.6659  . . 141 2601 100.0000 . . . 0.1884 0.0000 0.1634 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6659 2.9341  . . 138 2631 100.0000 . . . 0.2027 0.0000 0.1625 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9341 3.3584  . . 156 2625 100.0000 . . . 0.1845 0.0000 0.1541 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3584 4.2302  . . 129 2691 100.0000 . . . 0.2012 0.0000 0.1398 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2302 36.0140 . . 172 2776 100.0000 . . . 0.1795 0.0000 0.1594 . . . . . . . . . . . 
# 
_struct.entry_id                     6UUQ 
_struct.title                        'Structure of Calcineurin bound to RCAN1' 
_struct.pdbx_descriptor              
;Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (E.C.3.1.3.16), Calcineurin subunit B type 1, Sodium/hydrogen exchanger 1
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6UUQ 
_struct_keywords.text            'Ser/thr phosphatase, HYDROLASE, HYDROLASE-Signaling Protein complex' 
_struct_keywords.pdbx_keywords   'HYDROLASE/Signaling Protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 7   ? PHE A 12  ? THR A 30  PHE A 35  1 ? 6  
HELX_P HELX_P2  AA2 ARG A 19  ? MET A 28  ? ARG A 42  MET A 51  1 ? 10 
HELX_P HELX_P3  AA3 GLU A 34  ? GLN A 51  ? GLU A 57  GLN A 74  1 ? 18 
HELX_P HELX_P4  AA4 GLN A 71  ? GLY A 83  ? GLN A 94  GLY A 106 1 ? 13 
HELX_P HELX_P5  AA5 PHE A 102 ? TYR A 117 ? PHE A 125 TYR A 140 1 ? 16 
HELX_P HELX_P6  AA6 CYS A 130 ? PHE A 137 ? CYS A 153 PHE A 160 1 ? 8  
HELX_P HELX_P7  AA7 THR A 138 ? TYR A 147 ? THR A 161 TYR A 170 1 ? 10 
HELX_P HELX_P8  AA8 SER A 148 ? CYS A 161 ? SER A 171 CYS A 184 1 ? 14 
HELX_P HELX_P9  AA9 THR A 185 ? LYS A 191 ? THR A 208 LYS A 214 1 ? 7  
HELX_P HELX_P10 AB1 GLY A 202 ? SER A 210 ? GLY A 225 SER A 233 1 ? 9  
HELX_P HELX_P11 AB2 SER A 238 ? ASN A 249 ? SER A 261 ASN A 272 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 313 SG  ? ? ? 1_555 B CYS 37 SG ? ? A CYS 336 B CYS 161 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
metalc1  metalc ? ? A ASP 67  OD2 ? ? ? 1_555 E ZN  .  ZN ? ? A ASP 90  A ZN  403 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
metalc2  metalc ? ? A HIS 69  NE2 ? ? ? 1_555 E ZN  .  ZN ? ? A HIS 92  A ZN  403 1_555 ? ? ? ? ? ? ? 2.083 ? ? 
metalc3  metalc ? ? A ASP 95  OD2 ? ? ? 1_555 E ZN  .  ZN ? ? A ASP 118 A ZN  403 1_555 ? ? ? ? ? ? ? 2.151 ? ? 
metalc4  metalc ? ? A ASP 95  OD2 ? ? ? 1_555 F FE  .  FE ? ? A ASP 118 A FE  404 1_555 ? ? ? ? ? ? ? 2.263 ? ? 
metalc5  metalc ? ? A ASN 127 OD1 ? ? ? 1_555 F FE  .  FE ? ? A ASN 150 A FE  404 1_555 ? ? ? ? ? ? ? 2.111 ? ? 
metalc6  metalc ? ? A HIS 176 NE2 ? ? ? 1_555 F FE  .  FE ? ? A HIS 199 A FE  404 1_555 ? ? ? ? ? ? ? 2.170 ? ? 
metalc7  metalc ? ? A HIS 258 ND1 ? ? ? 1_555 F FE  .  FE ? ? A HIS 281 A FE  404 1_555 ? ? ? ? ? ? ? 2.216 ? ? 
metalc8  metalc ? ? C PO4 .   O1  ? ? ? 1_555 E ZN  .  ZN ? ? A PO4 401 A ZN  403 1_555 ? ? ? ? ? ? ? 2.074 ? ? 
metalc9  metalc ? ? C PO4 .   O2  ? ? ? 1_555 F FE  .  FE ? ? A PO4 401 A FE  404 1_555 ? ? ? ? ? ? ? 2.115 ? ? 
metalc10 metalc ? ? D PO4 .   O2  ? ? ? 1_555 E ZN  .  ZN ? ? A PO4 402 A ZN  403 1_555 ? ? ? ? ? ? ? 2.180 ? ? 
metalc11 metalc ? ? E ZN  .   ZN  ? ? ? 1_555 G HOH .  O  ? ? A ZN  403 A HOH 571 1_555 ? ? ? ? ? ? ? 2.050 ? ? 
metalc12 metalc ? ? F FE  .   FE  ? ? ? 1_555 G HOH .  O  ? ? A FE  404 A HOH 571 1_555 ? ? ? ? ? ? ? 2.117 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ALA 
_struct_mon_prot_cis.label_seq_id           60 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ALA 
_struct_mon_prot_cis.auth_seq_id            83 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    61 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     84 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 3 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? parallel      
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 55  ? ILE A 58  ? LEU A 78  ILE A 81  
AA1 2 ALA A 165 ? MET A 168 ? ALA A 188 MET A 191 
AA1 3 PHE A 172 ? CYS A 174 ? PHE A 195 CYS A 197 
AA1 4 SER A 253 ? ARG A 256 ? SER A 276 ARG A 279 
AA1 5 LEU A 279 ? ILE A 282 ? LEU A 302 ILE A 305 
AA1 6 TYR A 265 ? MET A 267 ? TYR A 288 MET A 290 
AA2 1 LEU A 121 ? LEU A 123 ? LEU A 144 LEU A 146 
AA2 2 TYR A 90  ? PHE A 92  ? TYR A 113 PHE A 115 
AA2 3 VAL A 62  ? CYS A 65  ? VAL A 85  CYS A 88  
AA2 4 ALA A 296 ? GLU A 302 ? ALA A 319 GLU A 325 
AA2 5 VAL A 305 ? PHE A 311 ? VAL A 328 PHE A 334 
AA2 6 SER B 31  ? THR B 35  ? SER B 155 THR B 159 
AA3 1 ASP A 211 ? PRO A 212 ? ASP A 234 PRO A 235 
AA3 2 TYR A 235 ? TYR A 237 ? TYR A 258 TYR A 260 
AA3 3 PHE A 225 ? HIS A 227 ? PHE A 248 HIS A 250 
AA4 1 ASN A 287 ? TYR A 288 ? ASN A 310 TYR A 311 
AA4 2 TYR A 292 ? ASN A 293 ? TYR A 315 ASN A 316 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 56  ? N LEU A 79  O LEU A 167 ? O LEU A 190 
AA1 2 3 N MET A 168 ? N MET A 191 O PHE A 172 ? O PHE A 195 
AA1 3 4 N LEU A 173 ? N LEU A 196 O LEU A 255 ? O LEU A 278 
AA1 4 5 N ARG A 256 ? N ARG A 279 O ILE A 282 ? O ILE A 305 
AA1 5 6 O THR A 281 ? O THR A 304 N ARG A 266 ? N ARG A 289 
AA2 1 2 O PHE A 122 ? O PHE A 145 N PHE A 92  ? N PHE A 115 
AA2 2 3 O LEU A 91  ? O LEU A 114 N CYS A 65  ? N CYS A 88  
AA2 3 4 N VAL A 64  ? N VAL A 87  O LEU A 299 ? O LEU A 322 
AA2 4 5 N LYS A 300 ? N LYS A 323 O ASN A 307 ? O ASN A 330 
AA2 5 6 N MET A 306 ? N MET A 329 O SER B 31  ? O SER B 155 
AA3 1 2 N ASP A 211 ? N ASP A 234 O TYR A 237 ? O TYR A 260 
AA3 2 3 O PHE A 236 ? O PHE A 259 N THR A 226 ? N THR A 249 
AA4 1 2 N ASN A 287 ? N ASN A 310 O ASN A 293 ? O ASN A 316 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PO4 401 ? 12 'binding site for residue PO4 A 401' 
AC2 Software A PO4 402 ? 7  'binding site for residue PO4 A 402' 
AC3 Software A ZN  403 ? 7  'binding site for residue ZN A 403'  
AC4 Software A FE  404 ? 7  'binding site for residue FE A 404'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 HIS A 69  ? HIS A 92  . ? 1_555 ? 
2  AC1 12 ASP A 95  ? ASP A 118 . ? 1_555 ? 
3  AC1 12 ARG A 99  ? ARG A 122 . ? 1_555 ? 
4  AC1 12 ASN A 127 ? ASN A 150 . ? 1_555 ? 
5  AC1 12 HIS A 128 ? HIS A 151 . ? 1_555 ? 
6  AC1 12 ARG A 231 ? ARG A 254 . ? 1_555 ? 
7  AC1 12 HIS A 258 ? HIS A 281 . ? 1_555 ? 
8  AC1 12 PO4 D .   ? PO4 A 402 . ? 1_555 ? 
9  AC1 12 ZN  E .   ? ZN  A 403 . ? 1_555 ? 
10 AC1 12 FE  F .   ? FE  A 404 . ? 1_555 ? 
11 AC1 12 HOH G .   ? HOH A 523 . ? 1_555 ? 
12 AC1 12 HOH G .   ? HOH A 571 . ? 1_555 ? 
13 AC2 7  ASP A 67  ? ASP A 90  . ? 1_555 ? 
14 AC2 7  HIS A 69  ? HIS A 92  . ? 1_555 ? 
15 AC2 7  ARG A 99  ? ARG A 122 . ? 1_555 ? 
16 AC2 7  PHE A 283 ? PHE A 306 . ? 1_555 ? 
17 AC2 7  PO4 C .   ? PO4 A 401 . ? 1_555 ? 
18 AC2 7  ZN  E .   ? ZN  A 403 . ? 1_555 ? 
19 AC2 7  HOH G .   ? HOH A 571 . ? 1_555 ? 
20 AC3 7  ASP A 67  ? ASP A 90  . ? 1_555 ? 
21 AC3 7  HIS A 69  ? HIS A 92  . ? 1_555 ? 
22 AC3 7  ASP A 95  ? ASP A 118 . ? 1_555 ? 
23 AC3 7  PO4 C .   ? PO4 A 401 . ? 1_555 ? 
24 AC3 7  PO4 D .   ? PO4 A 402 . ? 1_555 ? 
25 AC3 7  FE  F .   ? FE  A 404 . ? 1_555 ? 
26 AC3 7  HOH G .   ? HOH A 571 . ? 1_555 ? 
27 AC4 7  ASP A 95  ? ASP A 118 . ? 1_555 ? 
28 AC4 7  ASN A 127 ? ASN A 150 . ? 1_555 ? 
29 AC4 7  HIS A 176 ? HIS A 199 . ? 1_555 ? 
30 AC4 7  HIS A 258 ? HIS A 281 . ? 1_555 ? 
31 AC4 7  PO4 C .   ? PO4 A 401 . ? 1_555 ? 
32 AC4 7  ZN  E .   ? ZN  A 403 . ? 1_555 ? 
33 AC4 7  HOH G .   ? HOH A 571 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6UUQ 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.017289 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014053 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010864 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 3   ? 18.526 43.432  23.759 1.00 56.99 ? 26  SER A N   1 
ATOM   2    C  CA  . SER A 1 3   ? 17.444 42.647  23.178 1.00 57.91 ? 26  SER A CA  1 
ATOM   3    C  C   . SER A 1 3   ? 16.235 42.567  24.114 1.00 58.93 ? 26  SER A C   1 
ATOM   4    O  O   . SER A 1 3   ? 16.310 42.927  25.291 1.00 64.72 ? 26  SER A O   1 
ATOM   5    C  CB  . SER A 1 3   ? 17.932 41.236  22.831 1.00 70.59 ? 26  SER A CB  1 
ATOM   6    O  OG  . SER A 1 3   ? 16.869 40.415  22.366 1.00 70.39 ? 26  SER A OG  1 
ATOM   7    N  N   . HIS A 1 4   ? 15.126 42.075  23.573 1.00 46.34 ? 27  HIS A N   1 
ATOM   8    C  CA  . HIS A 1 4   ? 13.866 42.029  24.299 1.00 43.26 ? 27  HIS A CA  1 
ATOM   9    C  C   . HIS A 1 4   ? 13.871 40.885  25.307 1.00 38.04 ? 27  HIS A C   1 
ATOM   10   O  O   . HIS A 1 4   ? 14.239 39.756  24.970 1.00 44.00 ? 27  HIS A O   1 
ATOM   11   C  CB  . HIS A 1 4   ? 12.709 41.869  23.310 1.00 42.02 ? 27  HIS A CB  1 
ATOM   12   C  CG  . HIS A 1 4   ? 11.379 41.633  23.957 1.00 47.66 ? 27  HIS A CG  1 
ATOM   13   N  ND1 . HIS A 1 4   ? 10.840 42.488  24.896 1.00 51.81 ? 27  HIS A ND1 1 
ATOM   14   C  CD2 . HIS A 1 4   ? 10.474 40.638  23.792 1.00 39.69 ? 27  HIS A CD2 1 
ATOM   15   C  CE1 . HIS A 1 4   ? 9.663  42.027  25.283 1.00 48.17 ? 27  HIS A CE1 1 
ATOM   16   N  NE2 . HIS A 1 4   ? 9.417  40.907  24.627 1.00 40.00 ? 27  HIS A NE2 1 
ATOM   17   N  N   . ARG A 1 5   ? 13.472 41.183  26.544 1.00 31.53 ? 28  ARG A N   1 
ATOM   18   C  CA  . ARG A 1 5   ? 13.283 40.169  27.577 1.00 32.60 ? 28  ARG A CA  1 
ATOM   19   C  C   . ARG A 1 5   ? 11.837 39.687  27.539 1.00 36.07 ? 28  ARG A C   1 
ATOM   20   O  O   . ARG A 1 5   ? 10.916 40.478  27.761 1.00 34.55 ? 28  ARG A O   1 
ATOM   21   C  CB  . ARG A 1 5   ? 13.608 40.730  28.959 1.00 32.48 ? 28  ARG A CB  1 
ATOM   22   C  CG  . ARG A 1 5   ? 15.013 41.264  29.115 1.00 41.79 ? 28  ARG A CG  1 
ATOM   23   C  CD  . ARG A 1 5   ? 15.834 40.330  29.969 1.00 44.27 ? 28  ARG A CD  1 
ATOM   24   N  NE  . ARG A 1 5   ? 16.388 40.995  31.142 1.00 53.49 ? 28  ARG A NE  1 
ATOM   25   C  CZ  . ARG A 1 5   ? 16.958 40.357  32.160 1.00 60.54 ? 28  ARG A CZ  1 
ATOM   26   N  NH1 . ARG A 1 5   ? 17.042 39.032  32.154 1.00 46.09 ? 28  ARG A NH1 1 
ATOM   27   N  NH2 . ARG A 1 5   ? 17.441 41.044  33.189 1.00 67.22 ? 28  ARG A NH2 1 
ATOM   28   N  N   . LEU A 1 6   ? 11.639 38.397  27.268 1.00 30.70 ? 29  LEU A N   1 
ATOM   29   C  CA  . LEU A 1 6   ? 10.289 37.852  27.152 1.00 27.91 ? 29  LEU A CA  1 
ATOM   30   C  C   . LEU A 1 6   ? 9.506  38.046  28.443 1.00 30.07 ? 29  LEU A C   1 
ATOM   31   O  O   . LEU A 1 6   ? 10.026 37.839  29.544 1.00 25.10 ? 29  LEU A O   1 
ATOM   32   C  CB  . LEU A 1 6   ? 10.339 36.365  26.802 1.00 25.15 ? 29  LEU A CB  1 
ATOM   33   C  CG  . LEU A 1 6   ? 10.957 36.014  25.451 1.00 25.73 ? 29  LEU A CG  1 
ATOM   34   C  CD1 . LEU A 1 6   ? 10.659 34.574  25.062 1.00 28.35 ? 29  LEU A CD1 1 
ATOM   35   C  CD2 . LEU A 1 6   ? 10.458 36.980  24.373 1.00 38.68 ? 29  LEU A CD2 1 
ATOM   36   N  N   . THR A 1 7   ? 8.243  38.451  28.293 1.00 30.68 ? 30  THR A N   1 
ATOM   37   C  CA  . THR A 1 7   ? 7.309  38.657  29.390 1.00 27.11 ? 30  THR A CA  1 
ATOM   38   C  C   . THR A 1 7   ? 6.555  37.367  29.705 1.00 23.88 ? 30  THR A C   1 
ATOM   39   O  O   . THR A 1 7   ? 6.528  36.422  28.915 1.00 26.54 ? 30  THR A O   1 
ATOM   40   C  CB  . THR A 1 7   ? 6.288  39.732  29.029 1.00 30.67 ? 30  THR A CB  1 
ATOM   41   O  OG1 . THR A 1 7   ? 5.440  39.217  27.992 1.00 27.50 ? 30  THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 7   ? 6.976  40.998  28.527 1.00 26.86 ? 30  THR A CG2 1 
ATOM   43   N  N   . ALA A 1 8   ? 5.885  37.364  30.863 1.00 29.16 ? 31  ALA A N   1 
ATOM   44   C  CA  . ALA A 1 8   ? 5.084  36.204  31.256 1.00 31.62 ? 31  ALA A CA  1 
ATOM   45   C  C   . ALA A 1 8   ? 4.000  35.898  30.227 1.00 28.60 ? 31  ALA A C   1 
ATOM   46   O  O   . ALA A 1 8   ? 3.766  34.733  29.883 1.00 28.39 ? 31  ALA A O   1 
ATOM   47   C  CB  . ALA A 1 8   ? 4.471  36.443  32.637 1.00 29.21 ? 31  ALA A CB  1 
ATOM   48   N  N   . LYS A 1 9   ? 3.327  36.937  29.718 1.00 33.32 ? 32  LYS A N   1 
ATOM   49   C  CA  . LYS A 1 9   ? 2.296  36.726  28.708 1.00 35.44 ? 32  LYS A CA  1 
ATOM   50   C  C   . LYS A 1 9   ? 2.882  36.177  27.415 1.00 30.52 ? 32  LYS A C   1 
ATOM   51   O  O   . LYS A 1 9   ? 2.197  35.458  26.680 1.00 37.86 ? 32  LYS A O   1 
ATOM   52   C  CB  . LYS A 1 9   ? 1.547  38.037  28.438 1.00 41.84 ? 32  LYS A CB  1 
ATOM   53   N  N   . GLU A 1 10  ? 4.139  36.507  27.117 1.00 36.38 ? 33  GLU A N   1 
ATOM   54   C  CA  . GLU A 1 10  ? 4.772  35.979  25.915 1.00 27.96 ? 33  GLU A CA  1 
ATOM   55   C  C   . GLU A 1 10  ? 5.215  34.535  26.096 1.00 28.36 ? 33  GLU A C   1 
ATOM   56   O  O   . GLU A 1 10  ? 5.210  33.766  25.128 1.00 34.44 ? 33  GLU A O   1 
ATOM   57   C  CB  . GLU A 1 10  ? 5.971  36.846  25.524 1.00 33.84 ? 33  GLU A CB  1 
ATOM   58   C  CG  . GLU A 1 10  ? 5.586  38.223  24.990 1.00 38.83 ? 33  GLU A CG  1 
ATOM   59   C  CD  . GLU A 1 10  ? 6.788  39.099  24.690 1.00 44.37 ? 33  GLU A CD  1 
ATOM   60   O  OE1 . GLU A 1 10  ? 7.664  39.235  25.570 1.00 40.48 ? 33  GLU A OE1 1 
ATOM   61   O  OE2 . GLU A 1 10  ? 6.859  39.653  23.571 1.00 54.32 ? 33  GLU A OE2 1 
ATOM   62   N  N   . VAL A 1 11  ? 5.582  34.147  27.316 1.00 29.67 ? 34  VAL A N   1 
ATOM   63   C  CA  . VAL A 1 11  ? 6.133  32.814  27.566 1.00 24.34 ? 34  VAL A CA  1 
ATOM   64   C  C   . VAL A 1 11  ? 5.041  31.802  27.897 1.00 29.31 ? 34  VAL A C   1 
ATOM   65   O  O   . VAL A 1 11  ? 5.128  30.636  27.498 1.00 29.22 ? 34  VAL A O   1 
ATOM   66   C  CB  . VAL A 1 11  ? 7.193  32.895  28.688 1.00 26.07 ? 34  VAL A CB  1 
ATOM   67   C  CG1 . VAL A 1 11  ? 7.562  31.503  29.200 1.00 27.87 ? 34  VAL A CG1 1 
ATOM   68   C  CG2 . VAL A 1 11  ? 8.446  33.632  28.189 1.00 23.30 ? 34  VAL A CG2 1 
ATOM   69   N  N   . PHE A 1 12  ? 4.003  32.213  28.623 1.00 26.31 ? 35  PHE A N   1 
ATOM   70   C  CA  . PHE A 1 12  ? 2.961  31.304  29.088 1.00 25.17 ? 35  PHE A CA  1 
ATOM   71   C  C   . PHE A 1 12  ? 1.632  31.675  28.449 1.00 32.53 ? 35  PHE A C   1 
ATOM   72   O  O   . PHE A 1 12  ? 1.312  32.860  28.317 1.00 29.69 ? 35  PHE A O   1 
ATOM   73   C  CB  . PHE A 1 12  ? 2.818  31.354  30.616 1.00 26.49 ? 35  PHE A CB  1 
ATOM   74   C  CG  . PHE A 1 12  ? 4.020  30.830  31.364 1.00 24.83 ? 35  PHE A CG  1 
ATOM   75   C  CD1 . PHE A 1 12  ? 4.137  29.479  31.653 1.00 27.25 ? 35  PHE A CD1 1 
ATOM   76   C  CD2 . PHE A 1 12  ? 5.017  31.691  31.790 1.00 26.39 ? 35  PHE A CD2 1 
ATOM   77   C  CE1 . PHE A 1 12  ? 5.234  28.989  32.353 1.00 25.43 ? 35  PHE A CE1 1 
ATOM   78   C  CE2 . PHE A 1 12  ? 6.122  31.212  32.483 1.00 29.29 ? 35  PHE A CE2 1 
ATOM   79   C  CZ  . PHE A 1 12  ? 6.227  29.858  32.768 1.00 25.96 ? 35  PHE A CZ  1 
ATOM   80   N  N   . ASP A 1 13  ? 0.858  30.666  28.052 1.00 27.12 ? 36  ASP A N   1 
ATOM   81   C  CA  . ASP A 1 13  ? -0.470 30.951  27.532 1.00 32.13 ? 36  ASP A CA  1 
ATOM   82   C  C   . ASP A 1 13  ? -1.446 31.140  28.693 1.00 32.89 ? 36  ASP A C   1 
ATOM   83   O  O   . ASP A 1 13  ? -1.072 31.110  29.871 1.00 28.44 ? 36  ASP A O   1 
ATOM   84   C  CB  . ASP A 1 13  ? -0.914 29.867  26.542 1.00 29.02 ? 36  ASP A CB  1 
ATOM   85   C  CG  . ASP A 1 13  ? -1.305 28.535  27.200 1.00 34.21 ? 36  ASP A CG  1 
ATOM   86   O  OD1 . ASP A 1 13  ? -1.522 28.446  28.429 1.00 31.62 ? 36  ASP A OD1 1 
ATOM   87   O  OD2 . ASP A 1 13  ? -1.412 27.549  26.444 1.00 35.33 ? 36  ASP A OD2 1 
ATOM   88   N  N   . ASN A 1 14  ? -2.723 31.331  28.361 1.00 32.53 ? 37  ASN A N   1 
ATOM   89   C  CA  . ASN A 1 14  ? -3.697 31.646  29.397 1.00 36.97 ? 37  ASN A CA  1 
ATOM   90   C  C   . ASN A 1 14  ? -3.964 30.467  30.324 1.00 33.25 ? 37  ASN A C   1 
ATOM   91   O  O   . ASN A 1 14  ? -4.427 30.678  31.449 1.00 37.56 ? 37  ASN A O   1 
ATOM   92   C  CB  . ASN A 1 14  ? -5.003 32.130  28.764 1.00 40.59 ? 37  ASN A CB  1 
ATOM   93   C  CG  . ASN A 1 14  ? -5.977 32.662  29.792 1.00 40.04 ? 37  ASN A CG  1 
ATOM   94   O  OD1 . ASN A 1 14  ? -7.110 32.188  29.896 1.00 49.62 ? 37  ASN A OD1 1 
ATOM   95   N  ND2 . ASN A 1 14  ? -5.532 33.641  30.576 1.00 36.94 ? 37  ASN A ND2 1 
ATOM   96   N  N   . ASP A 1 15  ? -3.684 29.243  29.882 1.00 31.47 ? 38  ASP A N   1 
ATOM   97   C  CA  . ASP A 1 15  ? -3.819 28.054  30.714 1.00 30.55 ? 38  ASP A CA  1 
ATOM   98   C  C   . ASP A 1 15  ? -2.556 27.748  31.502 1.00 34.84 ? 38  ASP A C   1 
ATOM   99   O  O   . ASP A 1 15  ? -2.516 26.741  32.216 1.00 30.83 ? 38  ASP A O   1 
ATOM   100  C  CB  . ASP A 1 15  ? -4.179 26.843  29.854 1.00 30.48 ? 38  ASP A CB  1 
ATOM   101  C  CG  . ASP A 1 15  ? -5.540 26.975  29.202 1.00 49.88 ? 38  ASP A CG  1 
ATOM   102  O  OD1 . ASP A 1 15  ? -6.464 27.505  29.861 1.00 43.22 ? 38  ASP A OD1 1 
ATOM   103  O  OD2 . ASP A 1 15  ? -5.680 26.547  28.035 1.00 47.82 ? 38  ASP A OD2 1 
ATOM   104  N  N   . GLY A 1 16  ? -1.530 28.584  31.383 1.00 33.57 ? 39  GLY A N   1 
ATOM   105  C  CA  . GLY A 1 16  ? -0.271 28.338  32.057 1.00 38.16 ? 39  GLY A CA  1 
ATOM   106  C  C   . GLY A 1 16  ? 0.685  27.430  31.321 1.00 32.00 ? 39  GLY A C   1 
ATOM   107  O  O   . GLY A 1 16  ? 1.731  27.077  31.880 1.00 29.70 ? 39  GLY A O   1 
ATOM   108  N  N   . LYS A 1 17  ? 0.361  27.031  30.093 1.00 25.26 ? 40  LYS A N   1 
ATOM   109  C  CA  . LYS A 1 17  ? 1.268  26.185  29.328 1.00 27.31 ? 40  LYS A CA  1 
ATOM   110  C  C   . LYS A 1 17  ? 2.413  27.024  28.775 1.00 29.45 ? 40  LYS A C   1 
ATOM   111  O  O   . LYS A 1 17  ? 2.171  28.090  28.194 1.00 30.81 ? 40  LYS A O   1 
ATOM   112  C  CB  . LYS A 1 17  ? 0.542  25.487  28.183 1.00 29.57 ? 40  LYS A CB  1 
ATOM   113  C  CG  . LYS A 1 17  ? -0.497 24.459  28.616 1.00 36.17 ? 40  LYS A CG  1 
ATOM   114  C  CD  . LYS A 1 17  ? -1.038 23.713  27.401 1.00 46.47 ? 40  LYS A CD  1 
ATOM   115  C  CE  . LYS A 1 17  ? -1.941 22.558  27.804 1.00 52.91 ? 40  LYS A CE  1 
ATOM   116  N  NZ  . LYS A 1 17  ? -3.058 23.024  28.669 1.00 64.05 ? 40  LYS A NZ  1 
ATOM   117  N  N   . PRO A 1 18  ? 3.662  26.599  28.959 1.00 28.48 ? 41  PRO A N   1 
ATOM   118  C  CA  . PRO A 1 18  ? 4.776  27.316  28.328 1.00 25.16 ? 41  PRO A CA  1 
ATOM   119  C  C   . PRO A 1 18  ? 4.695  27.182  26.816 1.00 21.20 ? 41  PRO A C   1 
ATOM   120  O  O   . PRO A 1 18  ? 4.367  26.112  26.289 1.00 22.98 ? 41  PRO A O   1 
ATOM   121  C  CB  . PRO A 1 18  ? 6.027  26.614  28.885 1.00 28.02 ? 41  PRO A CB  1 
ATOM   122  C  CG  . PRO A 1 18  ? 5.564  25.772  30.021 1.00 28.68 ? 41  PRO A CG  1 
ATOM   123  C  CD  . PRO A 1 18  ? 4.111  25.452  29.770 1.00 23.75 ? 41  PRO A CD  1 
ATOM   124  N  N   . ARG A 1 19  ? 4.981  28.283  26.120 1.00 22.73 ? 42  ARG A N   1 
ATOM   125  C  CA  . ARG A 1 19  ? 5.076  28.290  24.658 1.00 25.15 ? 42  ARG A CA  1 
ATOM   126  C  C   . ARG A 1 19  ? 6.506  27.916  24.280 1.00 23.78 ? 42  ARG A C   1 
ATOM   127  O  O   . ARG A 1 19  ? 7.367  28.782  24.083 1.00 23.36 ? 42  ARG A O   1 
ATOM   128  C  CB  . ARG A 1 19  ? 4.695  29.654  24.094 1.00 21.33 ? 42  ARG A CB  1 
ATOM   129  C  CG  . ARG A 1 19  ? 3.294  30.129  24.443 1.00 29.63 ? 42  ARG A CG  1 
ATOM   130  C  CD  . ARG A 1 19  ? 2.874  31.263  23.507 1.00 36.53 ? 42  ARG A CD  1 
ATOM   131  N  NE  . ARG A 1 19  ? 1.503  31.706  23.753 1.00 36.88 ? 42  ARG A NE  1 
ATOM   132  C  CZ  . ARG A 1 19  ? 1.175  32.667  24.612 1.00 38.11 ? 42  ARG A CZ  1 
ATOM   133  N  NH1 . ARG A 1 19  ? 2.118  33.283  25.312 1.00 36.79 ? 42  ARG A NH1 1 
ATOM   134  N  NH2 . ARG A 1 19  ? -0.098 33.011  24.776 1.00 38.89 ? 42  ARG A NH2 1 
ATOM   135  N  N   . VAL A 1 20  ? 6.762  26.610  24.159 1.00 27.08 ? 43  VAL A N   1 
ATOM   136  C  CA  . VAL A 1 20  ? 8.143  26.146  24.038 1.00 23.37 ? 43  VAL A CA  1 
ATOM   137  C  C   . VAL A 1 20  ? 8.740  26.436  22.665 1.00 28.28 ? 43  VAL A C   1 
ATOM   138  O  O   . VAL A 1 20  ? 9.965  26.514  22.536 1.00 28.68 ? 43  VAL A O   1 
ATOM   139  C  CB  . VAL A 1 20  ? 8.242  24.646  24.368 1.00 24.56 ? 43  VAL A CB  1 
ATOM   140  C  CG1 . VAL A 1 20  ? 7.991  24.417  25.865 1.00 23.93 ? 43  VAL A CG1 1 
ATOM   141  C  CG2 . VAL A 1 20  ? 7.266  23.860  23.526 1.00 25.51 ? 43  VAL A CG2 1 
ATOM   142  N  N   . ASP A 1 21  ? 7.922  26.586  21.622 1.00 26.68 ? 44  ASP A N   1 
ATOM   143  C  CA  . ASP A 1 21  ? 8.485  26.980  20.330 1.00 36.80 ? 44  ASP A CA  1 
ATOM   144  C  C   . ASP A 1 21  ? 8.988  28.421  20.358 1.00 32.50 ? 44  ASP A C   1 
ATOM   145  O  O   . ASP A 1 21  ? 10.053 28.723  19.806 1.00 31.03 ? 44  ASP A O   1 
ATOM   146  C  CB  . ASP A 1 21  ? 7.458  26.785  19.219 1.00 40.76 ? 44  ASP A CB  1 
ATOM   147  C  CG  . ASP A 1 21  ? 7.198  25.325  18.926 1.00 48.54 ? 44  ASP A CG  1 
ATOM   148  O  OD1 . ASP A 1 21  ? 8.068  24.493  19.262 1.00 51.39 ? 44  ASP A OD1 1 
ATOM   149  O  OD2 . ASP A 1 21  ? 6.131  25.007  18.357 1.00 62.26 ? 44  ASP A OD2 1 
ATOM   150  N  N   . ILE A 1 22  ? 8.235  29.323  20.991 1.00 25.85 ? 45  ILE A N   1 
ATOM   151  C  CA  . ILE A 1 22  ? 8.699  30.693  21.200 1.00 26.92 ? 45  ILE A CA  1 
ATOM   152  C  C   . ILE A 1 22  ? 9.972  30.698  22.038 1.00 31.45 ? 45  ILE A C   1 
ATOM   153  O  O   . ILE A 1 22  ? 10.947 31.390  21.721 1.00 25.87 ? 45  ILE A O   1 
ATOM   154  C  CB  . ILE A 1 22  ? 7.595  31.533  21.869 1.00 29.33 ? 45  ILE A CB  1 
ATOM   155  C  CG1 . ILE A 1 22  ? 6.342  31.596  20.988 1.00 33.57 ? 45  ILE A CG1 1 
ATOM   156  C  CG2 . ILE A 1 22  ? 8.106  32.927  22.224 1.00 39.00 ? 45  ILE A CG2 1 
ATOM   157  C  CD1 . ILE A 1 22  ? 6.591  32.141  19.602 1.00 38.85 ? 45  ILE A CD1 1 
ATOM   158  N  N   . LEU A 1 23  ? 9.967  29.940  23.135 1.00 24.61 ? 46  LEU A N   1 
ATOM   159  C  CA  . LEU A 1 23  ? 11.140 29.839  24.001 1.00 22.70 ? 46  LEU A CA  1 
ATOM   160  C  C   . LEU A 1 23  ? 12.355 29.344  23.226 1.00 23.34 ? 46  LEU A C   1 
ATOM   161  O  O   . LEU A 1 23  ? 13.457 29.899  23.342 1.00 20.86 ? 46  LEU A O   1 
ATOM   162  C  CB  . LEU A 1 23  ? 10.822 28.893  25.157 1.00 22.78 ? 46  LEU A CB  1 
ATOM   163  C  CG  . LEU A 1 23  ? 11.252 29.183  26.586 1.00 37.38 ? 46  LEU A CG  1 
ATOM   164  C  CD1 . LEU A 1 23  ? 11.091 30.645  26.929 1.00 28.34 ? 46  LEU A CD1 1 
ATOM   165  C  CD2 . LEU A 1 23  ? 10.399 28.333  27.510 1.00 31.72 ? 46  LEU A CD2 1 
ATOM   166  N  N   . LYS A 1 24  ? 12.167 28.284  22.438 1.00 23.87 ? 47  LYS A N   1 
ATOM   167  C  CA  . LYS A 1 24  ? 13.273 27.678  21.706 1.00 23.06 ? 47  LYS A CA  1 
ATOM   168  C  C   . LYS A 1 24  ? 13.937 28.691  20.775 1.00 28.10 ? 47  LYS A C   1 
ATOM   169  O  O   . LYS A 1 24  ? 15.164 28.863  20.796 1.00 22.96 ? 47  LYS A O   1 
ATOM   170  C  CB  . LYS A 1 24  ? 12.740 26.455  20.952 1.00 29.29 ? 47  LYS A CB  1 
ATOM   171  C  CG  . LYS A 1 24  ? 13.438 26.041  19.676 1.00 36.50 ? 47  LYS A CG  1 
ATOM   172  C  CD  . LYS A 1 24  ? 12.788 24.748  19.151 1.00 40.12 ? 47  LYS A CD  1 
ATOM   173  C  CE  . LYS A 1 24  ? 12.894 24.606  17.635 1.00 57.13 ? 47  LYS A CE  1 
ATOM   174  N  NZ  . LYS A 1 24  ? 13.863 23.549  17.197 1.00 54.93 ? 47  LYS A NZ  1 
ATOM   175  N  N   . ALA A 1 25  ? 13.132 29.411  19.990 1.00 27.30 ? 48  ALA A N   1 
ATOM   176  C  CA  . ALA A 1 25  ? 13.671 30.385  19.039 1.00 27.84 ? 48  ALA A CA  1 
ATOM   177  C  C   . ALA A 1 25  ? 14.407 31.516  19.743 1.00 26.31 ? 48  ALA A C   1 
ATOM   178  O  O   . ALA A 1 25  ? 15.421 32.016  19.241 1.00 32.64 ? 48  ALA A O   1 
ATOM   179  C  CB  . ALA A 1 25  ? 12.539 30.947  18.176 1.00 25.20 ? 48  ALA A CB  1 
ATOM   180  N  N   . HIS A 1 26  ? 13.900 31.952  20.892 1.00 27.15 ? 49  HIS A N   1 
ATOM   181  C  CA  . HIS A 1 26  ? 14.505 33.065  21.612 1.00 22.19 ? 49  HIS A CA  1 
ATOM   182  C  C   . HIS A 1 26  ? 15.759 32.633  22.368 1.00 30.50 ? 49  HIS A C   1 
ATOM   183  O  O   . HIS A 1 26  ? 16.782 33.336  22.350 1.00 25.62 ? 49  HIS A O   1 
ATOM   184  C  CB  . HIS A 1 26  ? 13.472 33.655  22.566 1.00 21.33 ? 49  HIS A CB  1 
ATOM   185  C  CG  . HIS A 1 26  ? 13.903 34.922  23.229 1.00 23.58 ? 49  HIS A CG  1 
ATOM   186  N  ND1 . HIS A 1 26  ? 14.027 36.115  22.548 1.00 25.62 ? 49  HIS A ND1 1 
ATOM   187  C  CD2 . HIS A 1 26  ? 14.215 35.191  24.518 1.00 21.46 ? 49  HIS A CD2 1 
ATOM   188  C  CE1 . HIS A 1 26  ? 14.408 37.060  23.387 1.00 23.13 ? 49  HIS A CE1 1 
ATOM   189  N  NE2 . HIS A 1 26  ? 14.532 36.526  24.588 1.00 26.86 ? 49  HIS A NE2 1 
ATOM   190  N  N   . LEU A 1 27  ? 15.703 31.472  23.026 1.00 23.52 ? 50  LEU A N   1 
ATOM   191  C  CA  . LEU A 1 27  ? 16.816 31.037  23.862 1.00 27.31 ? 50  LEU A CA  1 
ATOM   192  C  C   . LEU A 1 27  ? 18.065 30.719  23.047 1.00 20.53 ? 50  LEU A C   1 
ATOM   193  O  O   . LEU A 1 27  ? 19.184 30.951  23.516 1.00 23.42 ? 50  LEU A O   1 
ATOM   194  C  CB  . LEU A 1 27  ? 16.402 29.820  24.686 1.00 24.32 ? 50  LEU A CB  1 
ATOM   195  C  CG  . LEU A 1 27  ? 15.433 30.124  25.830 1.00 16.49 ? 50  LEU A CG  1 
ATOM   196  C  CD1 . LEU A 1 27  ? 15.010 28.798  26.495 1.00 22.20 ? 50  LEU A CD1 1 
ATOM   197  C  CD2 . LEU A 1 27  ? 16.074 31.055  26.837 1.00 23.33 ? 50  LEU A CD2 1 
ATOM   198  N  N   . MET A 1 28  ? 17.913 30.190  21.843 1.00 17.69 ? 51  MET A N   1 
ATOM   199  C  CA  A MET A 1 28  ? 19.088 29.833  21.058 0.49 29.53 ? 51  MET A CA  1 
ATOM   200  C  CA  B MET A 1 28  ? 19.104 29.834  21.087 0.51 29.48 ? 51  MET A CA  1 
ATOM   201  C  C   . MET A 1 28  ? 19.896 31.056  20.651 1.00 34.12 ? 51  MET A C   1 
ATOM   202  O  O   . MET A 1 28  ? 21.089 30.929  20.355 1.00 28.70 ? 51  MET A O   1 
ATOM   203  C  CB  A MET A 1 28  ? 18.671 29.055  19.815 0.49 26.77 ? 51  MET A CB  1 
ATOM   204  C  CB  B MET A 1 28  ? 18.724 29.009  19.872 0.51 26.80 ? 51  MET A CB  1 
ATOM   205  C  CG  A MET A 1 28  ? 17.690 29.811  18.962 0.49 32.98 ? 51  MET A CG  1 
ATOM   206  C  CG  B MET A 1 28  ? 17.774 29.715  18.971 0.51 32.88 ? 51  MET A CG  1 
ATOM   207  S  SD  A MET A 1 28  ? 17.795 29.384  17.223 0.49 39.19 ? 51  MET A SD  1 
ATOM   208  S  SD  B MET A 1 28  ? 17.689 28.810  17.442 0.51 40.91 ? 51  MET A SD  1 
ATOM   209  C  CE  A MET A 1 28  ? 16.591 30.520  16.521 0.49 33.09 ? 51  MET A CE  1 
ATOM   210  C  CE  B MET A 1 28  ? 17.707 27.118  18.055 0.51 28.06 ? 51  MET A CE  1 
ATOM   211  N  N   . LYS A 1 29  ? 19.266 32.228  20.610 1.00 28.03 ? 52  LYS A N   1 
ATOM   212  C  CA  . LYS A 1 29  ? 19.960 33.478  20.349 1.00 25.74 ? 52  LYS A CA  1 
ATOM   213  C  C   . LYS A 1 29  ? 20.549 34.057  21.616 1.00 31.50 ? 52  LYS A C   1 
ATOM   214  O  O   . LYS A 1 29  ? 20.954 35.224  21.629 1.00 33.12 ? 52  LYS A O   1 
ATOM   215  C  CB  . LYS A 1 29  ? 19.005 34.480  19.695 1.00 22.83 ? 52  LYS A CB  1 
ATOM   216  C  CG  . LYS A 1 29  ? 18.277 33.898  18.491 1.00 26.92 ? 52  LYS A CG  1 
ATOM   217  C  CD  . LYS A 1 29  ? 17.424 34.926  17.762 1.00 33.71 ? 52  LYS A CD  1 
ATOM   218  C  CE  . LYS A 1 29  ? 16.221 35.350  18.575 1.00 32.05 ? 52  LYS A CE  1 
ATOM   219  N  NZ  . LYS A 1 29  ? 15.264 36.126  17.747 1.00 40.09 ? 52  LYS A NZ  1 
ATOM   220  N  N   . GLU A 1 30  ? 20.622 33.253  22.677 1.00 24.38 ? 53  GLU A N   1 
ATOM   221  C  CA  . GLU A 1 30  ? 20.916 33.724  24.021 1.00 20.75 ? 53  GLU A CA  1 
ATOM   222  C  C   . GLU A 1 30  ? 19.932 34.789  24.460 1.00 21.38 ? 53  GLU A C   1 
ATOM   223  O  O   . GLU A 1 30  ? 20.239 35.589  25.348 1.00 24.39 ? 53  GLU A O   1 
ATOM   224  C  CB  . GLU A 1 30  ? 22.346 34.261  24.146 1.00 36.37 ? 53  GLU A CB  1 
ATOM   225  C  CG  . GLU A 1 30  ? 23.377 33.234  24.490 1.00 29.69 ? 53  GLU A CG  1 
ATOM   226  C  CD  . GLU A 1 30  ? 24.759 33.835  24.551 1.00 30.89 ? 53  GLU A CD  1 
ATOM   227  O  OE1 . GLU A 1 30  ? 25.292 34.197  23.478 1.00 23.09 ? 53  GLU A OE1 1 
ATOM   228  O  OE2 . GLU A 1 30  ? 25.295 33.970  25.675 1.00 32.65 ? 53  GLU A OE2 1 
ATOM   229  N  N   . GLY A 1 31  ? 18.756 34.813  23.838 1.00 26.21 ? 54  GLY A N   1 
ATOM   230  C  CA  . GLY A 1 31  ? 17.721 35.726  24.289 1.00 29.66 ? 54  GLY A CA  1 
ATOM   231  C  C   . GLY A 1 31  ? 17.322 35.423  25.721 1.00 28.67 ? 54  GLY A C   1 
ATOM   232  O  O   . GLY A 1 31  ? 17.252 34.264  26.138 1.00 28.95 ? 54  GLY A O   1 
ATOM   233  N  N   . ARG A 1 32  ? 17.064 36.481  26.482 1.00 23.47 ? 55  ARG A N   1 
ATOM   234  C  CA  . ARG A 1 32  ? 16.764 36.360  27.897 1.00 24.05 ? 55  ARG A CA  1 
ATOM   235  C  C   . ARG A 1 32  ? 15.274 36.532  28.154 1.00 29.37 ? 55  ARG A C   1 
ATOM   236  O  O   . ARG A 1 32  ? 14.549 37.153  27.373 1.00 25.35 ? 55  ARG A O   1 
ATOM   237  C  CB  . ARG A 1 32  ? 17.566 37.380  28.706 1.00 25.66 ? 55  ARG A CB  1 
ATOM   238  C  CG  . ARG A 1 32  ? 19.025 36.964  28.861 1.00 29.96 ? 55  ARG A CG  1 
ATOM   239  C  CD  . ARG A 1 32  ? 19.969 38.132  29.013 1.00 40.86 ? 55  ARG A CD  1 
ATOM   240  N  NE  . ARG A 1 32  ? 19.669 38.935  30.191 1.00 57.92 ? 55  ARG A NE  1 
ATOM   241  C  CZ  . ARG A 1 32  ? 20.489 39.851  30.697 1.00 57.47 ? 55  ARG A CZ  1 
ATOM   242  N  NH1 . ARG A 1 32  ? 21.675 40.074  30.130 1.00 46.35 ? 55  ARG A NH1 1 
ATOM   243  N  NH2 . ARG A 1 32  ? 20.128 40.533  31.776 1.00 43.14 ? 55  ARG A NH2 1 
ATOM   244  N  N   . LEU A 1 33  ? 14.826 35.951  29.255 1.00 23.72 ? 56  LEU A N   1 
ATOM   245  C  CA  . LEU A 1 33  ? 13.499 36.197  29.786 1.00 27.35 ? 56  LEU A CA  1 
ATOM   246  C  C   . LEU A 1 33  ? 13.590 37.275  30.853 1.00 28.98 ? 56  LEU A C   1 
ATOM   247  O  O   . LEU A 1 33  ? 14.667 37.557  31.385 1.00 27.78 ? 56  LEU A O   1 
ATOM   248  C  CB  . LEU A 1 33  ? 12.912 34.915  30.390 1.00 25.72 ? 56  LEU A CB  1 
ATOM   249  C  CG  . LEU A 1 33  ? 13.089 33.600  29.624 1.00 25.13 ? 56  LEU A CG  1 
ATOM   250  C  CD1 . LEU A 1 33  ? 12.456 32.468  30.415 1.00 19.06 ? 56  LEU A CD1 1 
ATOM   251  C  CD2 . LEU A 1 33  ? 12.510 33.658  28.227 1.00 24.04 ? 56  LEU A CD2 1 
ATOM   252  N  N   . GLU A 1 34  ? 12.446 37.883  31.168 1.00 27.34 ? 57  GLU A N   1 
ATOM   253  C  CA  . GLU A 1 34  ? 12.380 38.661  32.395 1.00 26.18 ? 57  GLU A CA  1 
ATOM   254  C  C   . GLU A 1 34  ? 12.762 37.771  33.566 1.00 25.30 ? 57  GLU A C   1 
ATOM   255  O  O   . GLU A 1 34  ? 12.434 36.580  33.590 1.00 25.61 ? 57  GLU A O   1 
ATOM   256  C  CB  . GLU A 1 34  ? 10.977 39.237  32.608 1.00 29.53 ? 57  GLU A CB  1 
ATOM   257  C  CG  . GLU A 1 34  ? 10.655 40.428  31.720 1.00 30.45 ? 57  GLU A CG  1 
ATOM   258  C  CD  . GLU A 1 34  ? 9.352  41.114  32.105 1.00 44.63 ? 57  GLU A CD  1 
ATOM   259  O  OE1 . GLU A 1 34  ? 8.640  40.617  33.011 1.00 42.49 ? 57  GLU A OE1 1 
ATOM   260  O  OE2 . GLU A 1 34  ? 9.047  42.159  31.494 1.00 48.64 ? 57  GLU A OE2 1 
ATOM   261  N  N   . GLU A 1 35  ? 13.449 38.355  34.547 1.00 26.70 ? 58  GLU A N   1 
ATOM   262  C  CA  . GLU A 1 35  ? 13.947 37.562  35.669 1.00 29.91 ? 58  GLU A CA  1 
ATOM   263  C  C   . GLU A 1 35  ? 12.813 36.871  36.421 1.00 35.42 ? 58  GLU A C   1 
ATOM   264  O  O   . GLU A 1 35  ? 12.965 35.728  36.872 1.00 24.42 ? 58  GLU A O   1 
ATOM   265  C  CB  . GLU A 1 35  ? 14.757 38.447  36.611 1.00 34.11 ? 58  GLU A CB  1 
ATOM   266  C  CG  . GLU A 1 35  ? 15.681 37.684  37.537 1.00 36.44 ? 58  GLU A CG  1 
ATOM   267  C  CD  . GLU A 1 35  ? 15.370 37.930  38.999 1.00 46.05 ? 58  GLU A CD  1 
ATOM   268  O  OE1 . GLU A 1 35  ? 14.293 38.490  39.296 1.00 56.67 ? 58  GLU A OE1 1 
ATOM   269  O  OE2 . GLU A 1 35  ? 16.201 37.564  39.856 1.00 44.35 ? 58  GLU A OE2 1 
ATOM   270  N  N   . SER A 1 36  ? 11.667 37.548  36.573 1.00 26.30 ? 59  SER A N   1 
ATOM   271  C  CA  . SER A 1 36  ? 10.520 36.920  37.229 1.00 25.39 ? 59  SER A CA  1 
ATOM   272  C  C   . SER A 1 36  ? 9.988  35.739  36.428 1.00 25.04 ? 59  SER A C   1 
ATOM   273  O  O   . SER A 1 36  ? 9.473  34.769  37.009 1.00 24.63 ? 59  SER A O   1 
ATOM   274  C  CB  . SER A 1 36  ? 9.406  37.945  37.421 1.00 28.35 ? 59  SER A CB  1 
ATOM   275  O  OG  . SER A 1 36  ? 8.995  38.435  36.151 1.00 33.29 ? 59  SER A OG  1 
ATOM   276  N  N   . VAL A 1 37  ? 10.091 35.806  35.100 1.00 21.45 ? 60  VAL A N   1 
ATOM   277  C  CA  . VAL A 1 37  ? 9.592  34.717  34.270 1.00 21.56 ? 60  VAL A CA  1 
ATOM   278  C  C   . VAL A 1 37  ? 10.528 33.512  34.349 1.00 29.48 ? 60  VAL A C   1 
ATOM   279  O  O   . VAL A 1 37  ? 10.077 32.365  34.440 1.00 20.33 ? 60  VAL A O   1 
ATOM   280  C  CB  . VAL A 1 37  ? 9.394  35.201  32.823 1.00 25.03 ? 60  VAL A CB  1 
ATOM   281  C  CG1 . VAL A 1 37  ? 8.845  34.076  31.949 1.00 25.33 ? 60  VAL A CG1 1 
ATOM   282  C  CG2 . VAL A 1 37  ? 8.445  36.404  32.795 1.00 28.68 ? 60  VAL A CG2 1 
ATOM   283  N  N   . ALA A 1 38  ? 11.842 33.752  34.321 1.00 22.39 ? 61  ALA A N   1 
ATOM   284  C  CA  . ALA A 1 38  ? 12.804 32.673  34.542 1.00 25.14 ? 61  ALA A CA  1 
ATOM   285  C  C   . ALA A 1 38  ? 12.583 32.004  35.895 1.00 18.97 ? 61  ALA A C   1 
ATOM   286  O  O   . ALA A 1 38  ? 12.582 30.769  36.002 1.00 20.26 ? 61  ALA A O   1 
ATOM   287  C  CB  . ALA A 1 38  ? 14.231 33.224  34.436 1.00 22.77 ? 61  ALA A CB  1 
ATOM   288  N  N   . LEU A 1 39  ? 12.385 32.807  36.944 1.00 18.67 ? 62  LEU A N   1 
ATOM   289  C  CA  . LEU A 1 39  ? 12.096 32.261  38.267 1.00 22.86 ? 62  LEU A CA  1 
ATOM   290  C  C   . LEU A 1 39  ? 10.824 31.422  38.260 1.00 23.93 ? 62  LEU A C   1 
ATOM   291  O  O   . LEU A 1 39  ? 10.759 30.376  38.921 1.00 18.99 ? 62  LEU A O   1 
ATOM   292  C  CB  . LEU A 1 39  ? 11.972 33.391  39.288 1.00 23.92 ? 62  LEU A CB  1 
ATOM   293  C  CG  . LEU A 1 39  ? 13.259 33.874  39.948 1.00 33.99 ? 62  LEU A CG  1 
ATOM   294  C  CD1 . LEU A 1 39  ? 12.949 34.983  40.946 1.00 28.85 ? 62  LEU A CD1 1 
ATOM   295  C  CD2 . LEU A 1 39  ? 13.948 32.703  40.637 1.00 31.89 ? 62  LEU A CD2 1 
ATOM   296  N  N   . ARG A 1 40  ? 9.806  31.860  37.515 1.00 22.63 ? 63  ARG A N   1 
ATOM   297  C  CA  . ARG A 1 40  ? 8.579  31.073  37.402 1.00 21.08 ? 63  ARG A CA  1 
ATOM   298  C  C   . ARG A 1 40  ? 8.844  29.714  36.757 1.00 20.08 ? 63  ARG A C   1 
ATOM   299  O  O   . ARG A 1 40  ? 8.355  28.684  37.232 1.00 20.06 ? 63  ARG A O   1 
ATOM   300  C  CB  . ARG A 1 40  ? 7.534  31.846  36.602 1.00 20.95 ? 63  ARG A CB  1 
ATOM   301  C  CG  . ARG A 1 40  ? 6.210  31.105  36.480 1.00 26.23 ? 63  ARG A CG  1 
ATOM   302  C  CD  . ARG A 1 40  ? 5.101  32.026  35.965 1.00 27.08 ? 63  ARG A CD  1 
ATOM   303  N  NE  . ARG A 1 40  ? 3.971  31.252  35.453 1.00 28.12 ? 63  ARG A NE  1 
ATOM   304  C  CZ  . ARG A 1 40  ? 3.000  31.762  34.704 1.00 33.97 ? 63  ARG A CZ  1 
ATOM   305  N  NH1 . ARG A 1 40  ? 3.015  33.054  34.378 1.00 26.49 ? 63  ARG A NH1 1 
ATOM   306  N  NH2 . ARG A 1 40  ? 2.020  30.981  34.275 1.00 24.34 ? 63  ARG A NH2 1 
ATOM   307  N  N   . ILE A 1 41  ? 9.611  29.690  35.663 1.00 18.67 ? 64  ILE A N   1 
ATOM   308  C  CA  . ILE A 1 41  ? 9.904  28.413  35.007 1.00 16.50 ? 64  ILE A CA  1 
ATOM   309  C  C   . ILE A 1 41  ? 10.664 27.494  35.951 1.00 16.08 ? 64  ILE A C   1 
ATOM   310  O  O   . ILE A 1 41  ? 10.315 26.321  36.123 1.00 16.91 ? 64  ILE A O   1 
ATOM   311  C  CB  . ILE A 1 41  ? 10.686 28.639  33.703 1.00 20.15 ? 64  ILE A CB  1 
ATOM   312  C  CG1 . ILE A 1 41  ? 9.790  29.324  32.668 1.00 21.43 ? 64  ILE A CG1 1 
ATOM   313  C  CG2 . ILE A 1 41  ? 11.255 27.299  33.173 1.00 18.34 ? 64  ILE A CG2 1 
ATOM   314  C  CD1 . ILE A 1 41  ? 10.521 29.735  31.408 1.00 25.33 ? 64  ILE A CD1 1 
ATOM   315  N  N   . ILE A 1 42  ? 11.720 28.015  36.573 1.00 18.94 ? 65  ILE A N   1 
ATOM   316  C  CA  . ILE A 1 42  ? 12.562 27.192  37.436 1.00 15.17 ? 65  ILE A CA  1 
ATOM   317  C  C   . ILE A 1 42  ? 11.758 26.634  38.609 1.00 18.06 ? 65  ILE A C   1 
ATOM   318  O  O   . ILE A 1 42  ? 11.837 25.439  38.923 1.00 15.72 ? 65  ILE A O   1 
ATOM   319  C  CB  . ILE A 1 42  ? 13.773 28.017  37.907 1.00 16.97 ? 65  ILE A CB  1 
ATOM   320  C  CG1 . ILE A 1 42  ? 14.685 28.329  36.718 1.00 16.97 ? 65  ILE A CG1 1 
ATOM   321  C  CG2 . ILE A 1 42  ? 14.523 27.293  39.011 1.00 14.94 ? 65  ILE A CG2 1 
ATOM   322  C  CD1 . ILE A 1 42  ? 15.673 29.483  36.979 1.00 20.17 ? 65  ILE A CD1 1 
ATOM   323  N  N   . THR A 1 43  ? 10.952 27.479  39.263 1.00 17.94 ? 66  THR A N   1 
ATOM   324  C  CA  . THR A 1 43  ? 10.283 27.023  40.475 1.00 17.32 ? 66  THR A CA  1 
ATOM   325  C  C   . THR A 1 43  ? 9.080  26.140  40.170 1.00 14.30 ? 66  THR A C   1 
ATOM   326  O  O   . THR A 1 43  ? 8.787  25.231  40.951 1.00 16.98 ? 66  THR A O   1 
ATOM   327  C  CB  . THR A 1 43  ? 9.832  28.204  41.344 1.00 18.21 ? 66  THR A CB  1 
ATOM   328  O  OG1 . THR A 1 43  ? 9.001  29.074  40.568 1.00 20.50 ? 66  THR A OG1 1 
ATOM   329  C  CG2 . THR A 1 43  ? 11.038 28.957  41.888 1.00 19.63 ? 66  THR A CG2 1 
ATOM   330  N  N   . GLU A 1 44  ? 8.354  26.406  39.084 1.00 17.23 ? 67  GLU A N   1 
ATOM   331  C  CA  . GLU A 1 44  ? 7.259  25.510  38.706 1.00 15.90 ? 67  GLU A CA  1 
ATOM   332  C  C   . GLU A 1 44  ? 7.796  24.122  38.367 1.00 18.17 ? 67  GLU A C   1 
ATOM   333  O  O   . GLU A 1 44  ? 7.260  23.100  38.820 1.00 13.75 ? 67  GLU A O   1 
ATOM   334  C  CB  . GLU A 1 44  ? 6.473  26.100  37.531 1.00 17.82 ? 67  GLU A CB  1 
ATOM   335  C  CG  . GLU A 1 44  ? 5.544  27.250  37.935 1.00 21.05 ? 67  GLU A CG  1 
ATOM   336  C  CD  . GLU A 1 44  ? 4.611  27.748  36.821 1.00 23.21 ? 67  GLU A CD  1 
ATOM   337  O  OE1 . GLU A 1 44  ? 4.598  27.170  35.712 1.00 20.66 ? 67  GLU A OE1 1 
ATOM   338  O  OE2 . GLU A 1 44  ? 3.876  28.731  37.071 1.00 21.89 ? 67  GLU A OE2 1 
ATOM   339  N  N   . GLY A 1 45  ? 8.864  24.067  37.568 1.00 14.86 ? 68  GLY A N   1 
ATOM   340  C  CA  . GLY A 1 45  ? 9.497  22.784  37.302 1.00 16.01 ? 68  GLY A CA  1 
ATOM   341  C  C   . GLY A 1 45  ? 9.994  22.116  38.570 1.00 14.33 ? 68  GLY A C   1 
ATOM   342  O  O   . GLY A 1 45  ? 9.793  20.916  38.771 1.00 16.50 ? 68  GLY A O   1 
ATOM   343  N  N   . ALA A 1 46  ? 10.651 22.884  39.446 1.00 13.83 ? 69  ALA A N   1 
ATOM   344  C  CA  . ALA A 1 46  ? 11.135 22.320  40.706 1.00 16.75 ? 69  ALA A CA  1 
ATOM   345  C  C   . ALA A 1 46  ? 10.002 21.709  41.517 1.00 18.95 ? 69  ALA A C   1 
ATOM   346  O  O   . ALA A 1 46  ? 10.154 20.623  42.097 1.00 17.80 ? 69  ALA A O   1 
ATOM   347  C  CB  . ALA A 1 46  ? 11.849 23.393  41.533 1.00 15.55 ? 69  ALA A CB  1 
ATOM   348  N  N   . SER A 1 47  ? 8.853  22.386  41.572 1.00 18.11 ? 70  SER A N   1 
ATOM   349  C  CA  A SER A 1 47  ? 7.739  21.867  42.359 0.62 16.59 ? 70  SER A CA  1 
ATOM   350  C  CA  B SER A 1 47  ? 7.743  21.863  42.362 0.38 16.59 ? 70  SER A CA  1 
ATOM   351  C  C   . SER A 1 47  ? 7.214  20.555  41.790 1.00 16.74 ? 70  SER A C   1 
ATOM   352  O  O   . SER A 1 47  ? 6.763  19.691  42.549 1.00 16.78 ? 70  SER A O   1 
ATOM   353  C  CB  A SER A 1 47  ? 6.624  22.910  42.439 0.62 17.19 ? 70  SER A CB  1 
ATOM   354  C  CB  B SER A 1 47  ? 6.619  22.897  42.457 0.38 17.21 ? 70  SER A CB  1 
ATOM   355  O  OG  A SER A 1 47  ? 7.060  24.055  43.157 0.62 18.46 ? 70  SER A OG  1 
ATOM   356  O  OG  B SER A 1 47  ? 5.895  22.992  41.245 0.38 15.56 ? 70  SER A OG  1 
ATOM   357  N  N   . ILE A 1 48  ? 7.274  20.380  40.467 1.00 14.70 ? 71  ILE A N   1 
ATOM   358  C  CA  . ILE A 1 48  ? 6.879  19.102  39.874 1.00 11.32 ? 71  ILE A CA  1 
ATOM   359  C  C   . ILE A 1 48  ? 7.895  18.020  40.228 1.00 13.46 ? 71  ILE A C   1 
ATOM   360  O  O   . ILE A 1 48  ? 7.532  16.929  40.677 1.00 16.55 ? 71  ILE A O   1 
ATOM   361  C  CB  . ILE A 1 48  ? 6.712  19.242  38.352 1.00 14.40 ? 71  ILE A CB  1 
ATOM   362  C  CG1 . ILE A 1 48  ? 5.601  20.243  38.019 1.00 15.40 ? 71  ILE A CG1 1 
ATOM   363  C  CG2 . ILE A 1 48  ? 6.439  17.862  37.706 1.00 15.68 ? 71  ILE A CG2 1 
ATOM   364  C  CD1 . ILE A 1 48  ? 5.607  20.697  36.563 1.00 19.04 ? 71  ILE A CD1 1 
ATOM   365  N  N   . LEU A 1 49  ? 9.188  18.321  40.054 1.00 14.63 ? 72  LEU A N   1 
ATOM   366  C  CA  . LEU A 1 49  ? 10.244 17.368  40.401 1.00 14.49 ? 72  LEU A CA  1 
ATOM   367  C  C   . LEU A 1 49  ? 10.174 16.952  41.863 1.00 13.63 ? 72  LEU A C   1 
ATOM   368  O  O   . LEU A 1 49  ? 10.415 15.789  42.197 1.00 15.49 ? 72  LEU A O   1 
ATOM   369  C  CB  . LEU A 1 49  ? 11.617 17.985  40.105 1.00 14.64 ? 72  LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 49  ? 11.852 18.274  38.623 1.00 15.42 ? 72  LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 49  ? 13.045 19.193  38.432 1.00 16.66 ? 72  LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 49  ? 12.051 16.934  37.879 1.00 15.89 ? 72  LEU A CD2 1 
ATOM   373  N  N   . ARG A 1 50  ? 9.851  17.890  42.749 1.00 14.56 ? 73  ARG A N   1 
ATOM   374  C  CA  . ARG A 1 50  ? 9.826  17.589  44.178 1.00 15.32 ? 73  ARG A CA  1 
ATOM   375  C  C   . ARG A 1 50  ? 8.790  16.527  44.517 1.00 19.00 ? 73  ARG A C   1 
ATOM   376  O  O   . ARG A 1 50  ? 8.989  15.744  45.450 1.00 16.71 ? 73  ARG A O   1 
ATOM   377  C  CB  . ARG A 1 50  ? 9.557  18.872  44.979 1.00 19.41 ? 73  ARG A CB  1 
ATOM   378  C  CG  . ARG A 1 50  ? 9.123  18.634  46.418 1.00 27.65 ? 73  ARG A CG  1 
ATOM   379  C  CD  . ARG A 1 50  ? 9.138  19.912  47.237 1.00 27.00 ? 73  ARG A CD  1 
ATOM   380  N  NE  . ARG A 1 50  ? 10.505 20.401  47.360 1.00 40.49 ? 73  ARG A NE  1 
ATOM   381  C  CZ  . ARG A 1 50  ? 11.344 20.049  48.329 1.00 37.08 ? 73  ARG A CZ  1 
ATOM   382  N  NH1 . ARG A 1 50  ? 10.951 19.212  49.287 1.00 39.69 ? 73  ARG A NH1 1 
ATOM   383  N  NH2 . ARG A 1 50  ? 12.577 20.542  48.340 1.00 31.96 ? 73  ARG A NH2 1 
ATOM   384  N  N   . GLN A 1 51  ? 7.690  16.468  43.769 1.00 16.22 ? 74  GLN A N   1 
ATOM   385  C  CA  . GLN A 1 51  ? 6.677  15.458  44.048 1.00 13.51 ? 74  GLN A CA  1 
ATOM   386  C  C   . GLN A 1 51  ? 7.054  14.079  43.522 1.00 22.08 ? 74  GLN A C   1 
ATOM   387  O  O   . GLN A 1 51  ? 6.369  13.102  43.842 1.00 17.78 ? 74  GLN A O   1 
ATOM   388  C  CB  . GLN A 1 51  ? 5.331  15.896  43.458 1.00 17.32 ? 74  GLN A CB  1 
ATOM   389  C  CG  . GLN A 1 51  ? 4.770  17.160  44.085 1.00 19.53 ? 74  GLN A CG  1 
ATOM   390  C  CD  . GLN A 1 51  ? 3.288  17.338  43.792 1.00 25.33 ? 74  GLN A CD  1 
ATOM   391  O  OE1 . GLN A 1 51  ? 2.863  17.266  42.644 1.00 28.84 ? 74  GLN A OE1 1 
ATOM   392  N  NE2 . GLN A 1 51  ? 2.498  17.547  44.836 1.00 28.51 ? 74  GLN A NE2 1 
ATOM   393  N  N   . GLU A 1 52  ? 8.123  13.969  42.742 1.00 14.67 ? 75  GLU A N   1 
ATOM   394  C  CA  . GLU A 1 52  ? 8.496  12.677  42.185 1.00 15.20 ? 75  GLU A CA  1 
ATOM   395  C  C   . GLU A 1 52  ? 9.335  11.854  43.173 1.00 15.93 ? 75  GLU A C   1 
ATOM   396  O  O   . GLU A 1 52  ? 9.953  12.379  44.103 1.00 16.58 ? 75  GLU A O   1 
ATOM   397  C  CB  . GLU A 1 52  ? 9.249  12.883  40.866 1.00 18.34 ? 75  GLU A CB  1 
ATOM   398  C  CG  . GLU A 1 52  ? 8.369  13.526  39.803 1.00 18.80 ? 75  GLU A CG  1 
ATOM   399  C  CD  . GLU A 1 52  ? 9.059  13.696  38.461 1.00 21.20 ? 75  GLU A CD  1 
ATOM   400  O  OE1 . GLU A 1 52  ? 10.281 13.965  38.429 1.00 23.72 ? 75  GLU A OE1 1 
ATOM   401  O  OE2 . GLU A 1 52  ? 8.368  13.568  37.431 1.00 26.41 ? 75  GLU A OE2 1 
ATOM   402  N  N   . LYS A 1 53  ? 9.333  10.536  42.964 1.00 16.62 ? 76  LYS A N   1 
ATOM   403  C  CA  . LYS A 1 53  ? 10.098 9.603   43.788 1.00 17.19 ? 76  LYS A CA  1 
ATOM   404  C  C   . LYS A 1 53  ? 11.594 9.712   43.488 1.00 17.78 ? 76  LYS A C   1 
ATOM   405  O  O   . LYS A 1 53  ? 11.995 10.173  42.418 1.00 17.04 ? 76  LYS A O   1 
ATOM   406  C  CB  . LYS A 1 53  ? 9.652  8.164   43.521 1.00 19.21 ? 76  LYS A CB  1 
ATOM   407  C  CG  . LYS A 1 53  ? 8.198  7.874   43.844 1.00 31.26 ? 76  LYS A CG  1 
ATOM   408  C  CD  . LYS A 1 53  ? 7.985  7.760   45.328 1.00 32.52 ? 76  LYS A CD  1 
ATOM   409  C  CE  . LYS A 1 53  ? 6.529  7.436   45.630 1.00 44.73 ? 76  LYS A CE  1 
ATOM   410  N  NZ  . LYS A 1 53  ? 6.012  6.354   44.732 1.00 54.12 ? 76  LYS A NZ  1 
ATOM   411  N  N   . ASN A 1 54  ? 12.423 9.284   44.455 1.00 13.92 ? 77  ASN A N   1 
ATOM   412  C  CA  . ASN A 1 54  ? 13.864 9.157   44.208 1.00 16.64 ? 77  ASN A CA  1 
ATOM   413  C  C   . ASN A 1 54  ? 14.129 8.296   42.987 1.00 17.88 ? 77  ASN A C   1 
ATOM   414  O  O   . ASN A 1 54  ? 15.049 8.565   42.201 1.00 14.26 ? 77  ASN A O   1 
ATOM   415  C  CB  . ASN A 1 54  ? 14.582 8.497   45.387 1.00 16.73 ? 77  ASN A CB  1 
ATOM   416  C  CG  . ASN A 1 54  ? 14.664 9.369   46.615 1.00 14.80 ? 77  ASN A CG  1 
ATOM   417  O  OD1 . ASN A 1 54  ? 14.238 10.532  46.617 1.00 16.88 ? 77  ASN A OD1 1 
ATOM   418  N  ND2 . ASN A 1 54  ? 15.232 8.807   47.679 1.00 16.92 ? 77  ASN A ND2 1 
ATOM   419  N  N   . LEU A 1 55  ? 13.365 7.214   42.862 1.00 16.32 ? 78  LEU A N   1 
ATOM   420  C  CA  . LEU A 1 55  ? 13.529 6.199   41.832 1.00 15.23 ? 78  LEU A CA  1 
ATOM   421  C  C   . LEU A 1 55  ? 12.264 6.226   40.995 1.00 16.27 ? 78  LEU A C   1 
ATOM   422  O  O   . LEU A 1 55  ? 11.201 5.789   41.451 1.00 17.49 ? 78  LEU A O   1 
ATOM   423  C  CB  . LEU A 1 55  ? 13.759 4.817   42.456 1.00 14.60 ? 78  LEU A CB  1 
ATOM   424  C  CG  . LEU A 1 55  ? 13.868 3.620   41.510 1.00 12.50 ? 78  LEU A CG  1 
ATOM   425  C  CD1 . LEU A 1 55  ? 15.129 3.681   40.620 1.00 14.48 ? 78  LEU A CD1 1 
ATOM   426  C  CD2 . LEU A 1 55  ? 13.836 2.317   42.305 1.00 16.30 ? 78  LEU A CD2 1 
ATOM   427  N  N   . LEU A 1 56  ? 12.366 6.765   39.788 1.00 13.60 ? 79  LEU A N   1 
ATOM   428  C  CA  . LEU A 1 56  ? 11.195 6.895   38.933 1.00 15.84 ? 79  LEU A CA  1 
ATOM   429  C  C   . LEU A 1 56  ? 10.783 5.534   38.372 1.00 14.82 ? 79  LEU A C   1 
ATOM   430  O  O   . LEU A 1 56  ? 11.613 4.647   38.163 1.00 20.42 ? 79  LEU A O   1 
ATOM   431  C  CB  . LEU A 1 56  ? 11.479 7.855   37.784 1.00 15.11 ? 79  LEU A CB  1 
ATOM   432  C  CG  . LEU A 1 56  ? 11.879 9.287   38.151 1.00 14.36 ? 79  LEU A CG  1 
ATOM   433  C  CD1 . LEU A 1 56  ? 12.196 10.088  36.885 1.00 17.05 ? 79  LEU A CD1 1 
ATOM   434  C  CD2 . LEU A 1 56  ? 10.768 9.976   38.958 1.00 15.90 ? 79  LEU A CD2 1 
ATOM   435  N  N   . ASP A 1 57  ? 9.477  5.371   38.151 1.00 15.37 ? 80  ASP A N   1 
ATOM   436  C  CA  . ASP A 1 57  ? 8.925  4.221   37.432 1.00 20.33 ? 80  ASP A CA  1 
ATOM   437  C  C   . ASP A 1 57  ? 8.567  4.683   36.028 1.00 23.41 ? 80  ASP A C   1 
ATOM   438  O  O   . ASP A 1 57  ? 7.582  5.403   35.845 1.00 25.73 ? 80  ASP A O   1 
ATOM   439  C  CB  . ASP A 1 57  ? 7.671  3.688   38.121 1.00 25.80 ? 80  ASP A CB  1 
ATOM   440  C  CG  . ASP A 1 57  ? 7.943  3.160   39.493 1.00 40.80 ? 80  ASP A CG  1 
ATOM   441  O  OD1 . ASP A 1 57  ? 8.776  2.234   39.603 1.00 35.18 ? 80  ASP A OD1 1 
ATOM   442  O  OD2 . ASP A 1 57  ? 7.324  3.676   40.456 1.00 44.72 ? 80  ASP A OD2 1 
ATOM   443  N  N   . ILE A 1 58  ? 9.340  4.268   35.033 1.00 17.60 ? 81  ILE A N   1 
ATOM   444  C  CA  . ILE A 1 58  ? 9.144  4.746   33.670 1.00 16.92 ? 81  ILE A CA  1 
ATOM   445  C  C   . ILE A 1 58  ? 8.884  3.547   32.769 1.00 20.43 ? 81  ILE A C   1 
ATOM   446  O  O   . ILE A 1 58  ? 9.750  2.679   32.623 1.00 17.97 ? 81  ILE A O   1 
ATOM   447  C  CB  . ILE A 1 58  ? 10.352 5.553   33.172 1.00 21.62 ? 81  ILE A CB  1 
ATOM   448  C  CG1 . ILE A 1 58  ? 10.612 6.732   34.117 1.00 25.33 ? 81  ILE A CG1 1 
ATOM   449  C  CG2 . ILE A 1 58  ? 10.110 6.051   31.753 1.00 23.37 ? 81  ILE A CG2 1 
ATOM   450  C  CD1 . ILE A 1 58  ? 11.673 7.675   33.649 1.00 29.16 ? 81  ILE A CD1 1 
ATOM   451  N  N   . ASP A 1 59  ? 7.703  3.511   32.163 1.00 19.39 ? 82  ASP A N   1 
ATOM   452  C  CA  . ASP A 1 59  ? 7.357  2.472   31.200 1.00 28.14 ? 82  ASP A CA  1 
ATOM   453  C  C   . ASP A 1 59  ? 7.993  2.739   29.843 1.00 22.92 ? 82  ASP A C   1 
ATOM   454  O  O   . ASP A 1 59  ? 8.200  3.887   29.445 1.00 20.07 ? 82  ASP A O   1 
ATOM   455  C  CB  . ASP A 1 59  ? 5.840  2.388   31.010 1.00 30.73 ? 82  ASP A CB  1 
ATOM   456  C  CG  . ASP A 1 59  ? 5.126  1.859   32.229 1.00 42.39 ? 82  ASP A CG  1 
ATOM   457  O  OD1 . ASP A 1 59  ? 5.811  1.463   33.198 1.00 42.90 ? 82  ASP A OD1 1 
ATOM   458  O  OD2 . ASP A 1 59  ? 3.874  1.843   32.218 1.00 55.51 ? 82  ASP A OD2 1 
ATOM   459  N  N   . ALA A 1 60  ? 8.300  1.663   29.125 1.00 21.10 ? 83  ALA A N   1 
ATOM   460  C  CA  . ALA A 1 60  ? 8.600  1.801   27.714 1.00 21.24 ? 83  ALA A CA  1 
ATOM   461  C  C   . ALA A 1 60  ? 7.312  2.150   26.968 1.00 25.12 ? 83  ALA A C   1 
ATOM   462  O  O   . ALA A 1 60  ? 6.216  1.850   27.446 1.00 28.56 ? 83  ALA A O   1 
ATOM   463  C  CB  . ALA A 1 60  ? 9.213  0.511   27.173 1.00 22.66 ? 83  ALA A CB  1 
ATOM   464  N  N   . PRO A 1 61  ? 7.408  2.816   25.806 1.00 25.19 ? 84  PRO A N   1 
ATOM   465  C  CA  . PRO A 1 61  ? 8.620  3.256   25.112 1.00 24.14 ? 84  PRO A CA  1 
ATOM   466  C  C   . PRO A 1 61  ? 9.204  4.523   25.730 1.00 22.81 ? 84  PRO A C   1 
ATOM   467  O  O   . PRO A 1 61  ? 8.459  5.336   26.276 1.00 20.97 ? 84  PRO A O   1 
ATOM   468  C  CB  . PRO A 1 61  ? 8.119  3.528   23.701 1.00 26.80 ? 84  PRO A CB  1 
ATOM   469  C  CG  . PRO A 1 61  ? 6.729  4.043   23.929 1.00 29.25 ? 84  PRO A CG  1 
ATOM   470  C  CD  . PRO A 1 61  ? 6.193  3.292   25.117 1.00 25.18 ? 84  PRO A CD  1 
ATOM   471  N  N   . VAL A 1 62  ? 10.521 4.698   25.639 1.00 21.42 ? 85  VAL A N   1 
ATOM   472  C  CA  . VAL A 1 62  ? 11.152 5.902   26.157 1.00 17.19 ? 85  VAL A CA  1 
ATOM   473  C  C   . VAL A 1 62  ? 12.452 6.119   25.406 1.00 18.57 ? 85  VAL A C   1 
ATOM   474  O  O   . VAL A 1 62  ? 13.126 5.162   25.008 1.00 19.69 ? 85  VAL A O   1 
ATOM   475  C  CB  . VAL A 1 62  ? 11.382 5.803   27.688 1.00 15.32 ? 85  VAL A CB  1 
ATOM   476  C  CG1 . VAL A 1 62  ? 12.267 4.630   28.017 1.00 18.13 ? 85  VAL A CG1 1 
ATOM   477  C  CG2 . VAL A 1 62  ? 11.981 7.120   28.240 1.00 15.40 ? 85  VAL A CG2 1 
ATOM   478  N  N   . THR A 1 63  ? 12.807 7.389   25.212 1.00 16.34 ? 86  THR A N   1 
ATOM   479  C  CA  . THR A 1 63  ? 14.104 7.761   24.669 1.00 14.79 ? 86  THR A CA  1 
ATOM   480  C  C   . THR A 1 63  ? 14.998 8.225   25.813 1.00 15.85 ? 86  THR A C   1 
ATOM   481  O  O   . THR A 1 63  ? 14.649 9.171   26.531 1.00 15.93 ? 86  THR A O   1 
ATOM   482  C  CB  . THR A 1 63  ? 13.956 8.854   23.614 1.00 20.39 ? 86  THR A CB  1 
ATOM   483  O  OG1 . THR A 1 63  ? 13.109 8.374   22.562 1.00 19.74 ? 86  THR A OG1 1 
ATOM   484  C  CG2 . THR A 1 63  ? 15.310 9.216   23.043 1.00 18.68 ? 86  THR A CG2 1 
ATOM   485  N  N   . VAL A 1 64  ? 16.141 7.561   25.982 1.00 15.01 ? 87  VAL A N   1 
ATOM   486  C  CA  . VAL A 1 64  ? 17.051 7.821   27.097 1.00 15.80 ? 87  VAL A CA  1 
ATOM   487  C  C   . VAL A 1 64  ? 18.240 8.628   26.586 1.00 13.99 ? 87  VAL A C   1 
ATOM   488  O  O   . VAL A 1 64  ? 18.850 8.275   25.567 1.00 16.01 ? 87  VAL A O   1 
ATOM   489  C  CB  . VAL A 1 64  ? 17.516 6.514   27.759 1.00 14.48 ? 87  VAL A CB  1 
ATOM   490  C  CG1 . VAL A 1 64  ? 18.422 6.823   28.954 1.00 14.22 ? 87  VAL A CG1 1 
ATOM   491  C  CG2 . VAL A 1 64  ? 16.312 5.663   28.202 1.00 15.05 ? 87  VAL A CG2 1 
ATOM   492  N  N   . CYS A 1 65  ? 18.564 9.716   27.290 1.00 13.41 ? 88  CYS A N   1 
ATOM   493  C  CA  . CYS A 1 65  ? 19.563 10.680  26.842 1.00 13.15 ? 88  CYS A CA  1 
ATOM   494  C  C   . CYS A 1 65  ? 20.595 10.898  27.936 1.00 17.35 ? 88  CYS A C   1 
ATOM   495  O  O   . CYS A 1 65  ? 20.241 11.003  29.114 1.00 14.52 ? 88  CYS A O   1 
ATOM   496  C  CB  . CYS A 1 65  ? 18.914 12.018  26.486 1.00 15.73 ? 88  CYS A CB  1 
ATOM   497  S  SG  . CYS A 1 65  ? 17.492 11.840  25.401 1.00 18.18 ? 88  CYS A SG  1 
ATOM   498  N  N   . GLY A 1 66  ? 21.865 10.966  27.538 1.00 14.99 ? 89  GLY A N   1 
ATOM   499  C  CA  . GLY A 1 66  ? 22.963 11.294  28.431 1.00 14.00 ? 89  GLY A CA  1 
ATOM   500  C  C   . GLY A 1 66  ? 23.272 12.780  28.459 1.00 15.16 ? 89  GLY A C   1 
ATOM   501  O  O   . GLY A 1 66  ? 22.396 13.622  28.255 1.00 16.86 ? 89  GLY A O   1 
ATOM   502  N  N   . ASP A 1 67  ? 24.544 13.100  28.697 1.00 16.42 ? 90  ASP A N   1 
ATOM   503  C  CA  . ASP A 1 67  ? 24.950 14.465  29.046 1.00 12.93 ? 90  ASP A CA  1 
ATOM   504  C  C   . ASP A 1 67  ? 24.595 15.474  27.956 1.00 16.88 ? 90  ASP A C   1 
ATOM   505  O  O   . ASP A 1 67  ? 24.708 15.189  26.759 1.00 17.07 ? 90  ASP A O   1 
ATOM   506  C  CB  . ASP A 1 67  ? 26.459 14.545  29.271 1.00 16.92 ? 90  ASP A CB  1 
ATOM   507  C  CG  . ASP A 1 67  ? 26.955 13.692  30.428 1.00 15.50 ? 90  ASP A CG  1 
ATOM   508  O  OD1 . ASP A 1 67  ? 26.383 12.625  30.710 1.00 17.38 ? 90  ASP A OD1 1 
ATOM   509  O  OD2 . ASP A 1 67  ? 27.969 14.093  31.030 1.00 16.60 ? 90  ASP A OD2 1 
ATOM   510  N  N   . ILE A 1 68  ? 24.215 16.678  28.389 1.00 11.36 ? 91  ILE A N   1 
ATOM   511  C  CA  . ILE A 1 68  ? 23.940 17.808  27.500 1.00 11.50 ? 91  ILE A CA  1 
ATOM   512  C  C   . ILE A 1 68  ? 24.974 18.918  27.666 1.00 14.97 ? 91  ILE A C   1 
ATOM   513  O  O   . ILE A 1 68  ? 25.455 19.483  26.679 1.00 17.96 ? 91  ILE A O   1 
ATOM   514  C  CB  . ILE A 1 68  ? 22.514 18.357  27.754 1.00 14.17 ? 91  ILE A CB  1 
ATOM   515  C  CG1 . ILE A 1 68  ? 21.453 17.267  27.559 1.00 13.74 ? 91  ILE A CG1 1 
ATOM   516  C  CG2 . ILE A 1 68  ? 22.244 19.575  26.888 1.00 15.99 ? 91  ILE A CG2 1 
ATOM   517  C  CD1 . ILE A 1 68  ? 21.522 16.560  26.229 1.00 16.13 ? 91  ILE A CD1 1 
ATOM   518  N  N   . HIS A 1 69  ? 25.302 19.260  28.910 1.00 12.41 ? 92  HIS A N   1 
ATOM   519  C  CA  . HIS A 1 69  ? 26.346 20.241  29.245 1.00 13.23 ? 92  HIS A CA  1 
ATOM   520  C  C   . HIS A 1 69  ? 26.168 21.560  28.493 1.00 19.10 ? 92  HIS A C   1 
ATOM   521  O  O   . HIS A 1 69  ? 27.089 22.073  27.852 1.00 14.41 ? 92  HIS A O   1 
ATOM   522  C  CB  . HIS A 1 69  ? 27.738 19.659  29.017 1.00 12.86 ? 92  HIS A CB  1 
ATOM   523  C  CG  . HIS A 1 69  ? 28.179 18.767  30.128 1.00 14.05 ? 92  HIS A CG  1 
ATOM   524  N  ND1 . HIS A 1 69  ? 28.235 19.198  31.435 1.00 15.11 ? 92  HIS A ND1 1 
ATOM   525  C  CD2 . HIS A 1 69  ? 28.520 17.456  30.147 1.00 16.94 ? 92  HIS A CD2 1 
ATOM   526  C  CE1 . HIS A 1 69  ? 28.611 18.193  32.212 1.00 17.19 ? 92  HIS A CE1 1 
ATOM   527  N  NE2 . HIS A 1 69  ? 28.798 17.129  31.453 1.00 15.20 ? 92  HIS A NE2 1 
ATOM   528  N  N   . GLY A 1 70  ? 24.960 22.108  28.568 1.00 15.32 ? 93  GLY A N   1 
ATOM   529  C  CA  . GLY A 1 70  ? 24.746 23.463  28.084 1.00 15.21 ? 93  GLY A CA  1 
ATOM   530  C  C   . GLY A 1 70  ? 24.857 23.637  26.583 1.00 16.52 ? 93  GLY A C   1 
ATOM   531  O  O   . GLY A 1 70  ? 24.967 24.765  26.109 1.00 18.71 ? 93  GLY A O   1 
ATOM   532  N  N   . GLN A 1 71  ? 24.823 22.554  25.811 1.00 16.07 ? 94  GLN A N   1 
ATOM   533  C  CA  . GLN A 1 71  ? 24.992 22.657  24.363 1.00 15.97 ? 94  GLN A CA  1 
ATOM   534  C  C   . GLN A 1 71  ? 23.620 22.705  23.697 1.00 16.81 ? 94  GLN A C   1 
ATOM   535  O  O   . GLN A 1 71  ? 23.101 21.721  23.170 1.00 18.16 ? 94  GLN A O   1 
ATOM   536  C  CB  . GLN A 1 71  ? 25.863 21.514  23.867 1.00 19.19 ? 94  GLN A CB  1 
ATOM   537  C  CG  . GLN A 1 71  ? 27.235 21.609  24.502 1.00 18.85 ? 94  GLN A CG  1 
ATOM   538  C  CD  . GLN A 1 71  ? 28.128 20.440  24.164 1.00 23.74 ? 94  GLN A CD  1 
ATOM   539  O  OE1 . GLN A 1 71  ? 29.038 20.568  23.355 1.00 27.44 ? 94  GLN A OE1 1 
ATOM   540  N  NE2 . GLN A 1 71  ? 27.880 19.296  24.793 1.00 20.72 ? 94  GLN A NE2 1 
ATOM   541  N  N   . PHE A 1 72  ? 23.047 23.910  23.697 1.00 17.88 ? 95  PHE A N   1 
ATOM   542  C  CA  . PHE A 1 72  ? 21.641 24.078  23.342 1.00 16.95 ? 95  PHE A CA  1 
ATOM   543  C  C   . PHE A 1 72  ? 21.361 23.674  21.896 1.00 16.09 ? 95  PHE A C   1 
ATOM   544  O  O   . PHE A 1 72  ? 20.298 23.113  21.595 1.00 16.29 ? 95  PHE A O   1 
ATOM   545  C  CB  . PHE A 1 72  ? 21.231 25.532  23.587 1.00 18.22 ? 95  PHE A CB  1 
ATOM   546  C  CG  . PHE A 1 72  ? 19.738 25.748  23.570 1.00 22.74 ? 95  PHE A CG  1 
ATOM   547  C  CD1 . PHE A 1 72  ? 18.973 25.463  24.691 1.00 24.49 ? 95  PHE A CD1 1 
ATOM   548  C  CD2 . PHE A 1 72  ? 19.102 26.224  22.435 1.00 22.22 ? 95  PHE A CD2 1 
ATOM   549  C  CE1 . PHE A 1 72  ? 17.605 25.655  24.681 1.00 24.99 ? 95  PHE A CE1 1 
ATOM   550  C  CE2 . PHE A 1 72  ? 17.729 26.415  22.422 1.00 21.00 ? 95  PHE A CE2 1 
ATOM   551  C  CZ  . PHE A 1 72  ? 16.983 26.133  23.545 1.00 21.86 ? 95  PHE A CZ  1 
ATOM   552  N  N   . PHE A 1 73  ? 22.294 23.950  20.980 1.00 16.94 ? 96  PHE A N   1 
ATOM   553  C  CA  . PHE A 1 73  ? 22.039 23.589  19.590 1.00 16.93 ? 96  PHE A CA  1 
ATOM   554  C  C   . PHE A 1 73  ? 22.009 22.081  19.410 1.00 16.62 ? 96  PHE A C   1 
ATOM   555  O  O   . PHE A 1 73  ? 21.259 21.574  18.576 1.00 19.10 ? 96  PHE A O   1 
ATOM   556  C  CB  . PHE A 1 73  ? 23.082 24.229  18.670 1.00 19.16 ? 96  PHE A CB  1 
ATOM   557  C  CG  . PHE A 1 73  ? 22.853 25.689  18.466 1.00 17.60 ? 96  PHE A CG  1 
ATOM   558  C  CD1 . PHE A 1 73  ? 21.933 26.125  17.529 1.00 19.67 ? 96  PHE A CD1 1 
ATOM   559  C  CD2 . PHE A 1 73  ? 23.532 26.628  19.234 1.00 18.74 ? 96  PHE A CD2 1 
ATOM   560  C  CE1 . PHE A 1 73  ? 21.693 27.487  17.344 1.00 22.48 ? 96  PHE A CE1 1 
ATOM   561  C  CE2 . PHE A 1 73  ? 23.300 27.987  19.060 1.00 23.17 ? 96  PHE A CE2 1 
ATOM   562  C  CZ  . PHE A 1 73  ? 22.369 28.415  18.116 1.00 19.81 ? 96  PHE A CZ  1 
ATOM   563  N  N   . ASP A 1 74  ? 22.806 21.352  20.184 1.00 15.79 ? 97  ASP A N   1 
ATOM   564  C  CA  . ASP A 1 74  ? 22.751 19.900  20.089 1.00 17.36 ? 97  ASP A CA  1 
ATOM   565  C  C   . ASP A 1 74  ? 21.521 19.339  20.791 1.00 16.63 ? 97  ASP A C   1 
ATOM   566  O  O   . ASP A 1 74  ? 20.978 18.318  20.354 1.00 18.98 ? 97  ASP A O   1 
ATOM   567  C  CB  . ASP A 1 74  ? 24.048 19.317  20.647 1.00 18.49 ? 97  ASP A CB  1 
ATOM   568  C  CG  . ASP A 1 74  ? 25.267 19.858  19.907 1.00 22.04 ? 97  ASP A CG  1 
ATOM   569  O  OD1 . ASP A 1 74  ? 25.360 19.627  18.681 1.00 20.70 ? 97  ASP A OD1 1 
ATOM   570  O  OD2 . ASP A 1 74  ? 26.103 20.542  20.532 1.00 23.65 ? 97  ASP A OD2 1 
ATOM   571  N  N   . LEU A 1 75  ? 21.065 19.994  21.859 1.00 17.08 ? 98  LEU A N   1 
ATOM   572  C  CA  . LEU A 1 75  ? 19.795 19.608  22.473 1.00 13.85 ? 98  LEU A CA  1 
ATOM   573  C  C   . LEU A 1 75  ? 18.649 19.761  21.479 1.00 21.09 ? 98  LEU A C   1 
ATOM   574  O  O   . LEU A 1 75  ? 17.765 18.901  21.400 1.00 18.33 ? 98  LEU A O   1 
ATOM   575  C  CB  . LEU A 1 75  ? 19.549 20.453  23.726 1.00 14.29 ? 98  LEU A CB  1 
ATOM   576  C  CG  . LEU A 1 75  ? 18.228 20.209  24.474 1.00 15.16 ? 98  LEU A CG  1 
ATOM   577  C  CD1 . LEU A 1 75  ? 18.214 18.782  25.043 1.00 18.00 ? 98  LEU A CD1 1 
ATOM   578  C  CD2 . LEU A 1 75  ? 18.016 21.233  25.576 1.00 19.82 ? 98  LEU A CD2 1 
ATOM   579  N  N   . MET A 1 76  ? 18.651 20.847  20.696 1.00 18.49 ? 99  MET A N   1 
ATOM   580  C  CA  A MET A 1 76  ? 17.623 21.002  19.671 0.52 20.55 ? 99  MET A CA  1 
ATOM   581  C  CA  B MET A 1 76  ? 17.629 21.003  19.664 0.48 20.55 ? 99  MET A CA  1 
ATOM   582  C  C   . MET A 1 76  ? 17.684 19.863  18.660 1.00 21.36 ? 99  MET A C   1 
ATOM   583  O  O   . MET A 1 76  ? 16.641 19.328  18.256 1.00 23.06 ? 99  MET A O   1 
ATOM   584  C  CB  A MET A 1 76  ? 17.766 22.362  18.979 0.52 22.29 ? 99  MET A CB  1 
ATOM   585  C  CB  B MET A 1 76  ? 17.791 22.350  18.961 0.48 22.29 ? 99  MET A CB  1 
ATOM   586  C  CG  A MET A 1 76  ? 17.613 23.555  19.923 0.52 20.83 ? 99  MET A CG  1 
ATOM   587  C  CG  B MET A 1 76  ? 17.484 23.546  19.844 0.48 20.86 ? 99  MET A CG  1 
ATOM   588  S  SD  A MET A 1 76  ? 17.214 25.129  19.118 0.52 26.22 ? 99  MET A SD  1 
ATOM   589  S  SD  B MET A 1 76  ? 15.902 23.375  20.690 0.48 22.88 ? 99  MET A SD  1 
ATOM   590  C  CE  A MET A 1 76  ? 18.682 25.450  18.159 0.52 27.63 ? 99  MET A CE  1 
ATOM   591  C  CE  B MET A 1 76  ? 16.446 22.843  22.316 0.48 25.26 ? 99  MET A CE  1 
ATOM   592  N  N   . LYS A 1 77  ? 18.894 19.464  18.254 1.00 21.33 ? 100 LYS A N   1 
ATOM   593  C  CA  . LYS A 1 77  ? 19.043 18.363  17.306 1.00 20.59 ? 100 LYS A CA  1 
ATOM   594  C  C   . LYS A 1 77  ? 18.582 17.043  17.912 1.00 22.51 ? 100 LYS A C   1 
ATOM   595  O  O   . LYS A 1 77  ? 17.953 16.219  17.233 1.00 21.94 ? 100 LYS A O   1 
ATOM   596  C  CB  . LYS A 1 77  ? 20.503 18.258  16.856 1.00 23.02 ? 100 LYS A CB  1 
ATOM   597  C  CG  . LYS A 1 77  ? 20.733 17.305  15.689 1.00 24.86 ? 100 LYS A CG  1 
ATOM   598  C  CD  . LYS A 1 77  ? 19.933 17.758  14.470 1.00 33.21 ? 100 LYS A CD  1 
ATOM   599  C  CE  . LYS A 1 77  ? 20.511 17.221  13.170 1.00 47.31 ? 100 LYS A CE  1 
ATOM   600  N  NZ  . LYS A 1 77  ? 20.556 15.735  13.144 1.00 56.75 ? 100 LYS A NZ  1 
ATOM   601  N  N   . LEU A 1 78  ? 18.907 16.821  19.186 1.00 19.87 ? 101 LEU A N   1 
ATOM   602  C  CA  . LEU A 1 78  ? 18.518 15.592  19.874 1.00 19.90 ? 101 LEU A CA  1 
ATOM   603  C  C   . LEU A 1 78  ? 17.011 15.371  19.804 1.00 18.93 ? 101 LEU A C   1 
ATOM   604  O  O   . LEU A 1 78  ? 16.549 14.251  19.550 1.00 19.04 ? 101 LEU A O   1 
ATOM   605  C  CB  . LEU A 1 78  ? 18.997 15.663  21.329 1.00 20.19 ? 101 LEU A CB  1 
ATOM   606  C  CG  . LEU A 1 78  ? 18.645 14.630  22.404 1.00 18.08 ? 101 LEU A CG  1 
ATOM   607  C  CD1 . LEU A 1 78  ? 19.633 14.815  23.547 1.00 18.88 ? 101 LEU A CD1 1 
ATOM   608  C  CD2 . LEU A 1 78  ? 17.210 14.780  22.922 1.00 22.04 ? 101 LEU A CD2 1 
ATOM   609  N  N   . PHE A 1 79  ? 16.228 16.422  20.050 1.00 19.60 ? 102 PHE A N   1 
ATOM   610  C  CA  . PHE A 1 79  ? 14.777 16.286  19.964 1.00 19.92 ? 102 PHE A CA  1 
ATOM   611  C  C   . PHE A 1 79  ? 14.319 15.999  18.538 1.00 30.46 ? 102 PHE A C   1 
ATOM   612  O  O   . PHE A 1 79  ? 13.362 15.245  18.345 1.00 33.15 ? 102 PHE A O   1 
ATOM   613  C  CB  . PHE A 1 79  ? 14.089 17.541  20.505 1.00 18.67 ? 102 PHE A CB  1 
ATOM   614  C  CG  . PHE A 1 79  ? 14.115 17.644  22.007 1.00 21.95 ? 102 PHE A CG  1 
ATOM   615  C  CD1 . PHE A 1 79  ? 13.558 16.646  22.786 1.00 19.58 ? 102 PHE A CD1 1 
ATOM   616  C  CD2 . PHE A 1 79  ? 14.699 18.729  22.636 1.00 20.83 ? 102 PHE A CD2 1 
ATOM   617  C  CE1 . PHE A 1 79  ? 13.586 16.725  24.172 1.00 19.78 ? 102 PHE A CE1 1 
ATOM   618  C  CE2 . PHE A 1 79  ? 14.725 18.822  24.020 1.00 20.22 ? 102 PHE A CE2 1 
ATOM   619  C  CZ  . PHE A 1 79  ? 14.173 17.811  24.789 1.00 16.12 ? 102 PHE A CZ  1 
ATOM   620  N  N   . GLU A 1 80  ? 14.981 16.575  17.529 1.00 23.49 ? 103 GLU A N   1 
ATOM   621  C  CA  . GLU A 1 80  ? 14.668 16.205  16.149 1.00 30.44 ? 103 GLU A CA  1 
ATOM   622  C  C   . GLU A 1 80  ? 14.908 14.721  15.920 1.00 27.19 ? 103 GLU A C   1 
ATOM   623  O  O   . GLU A 1 80  ? 14.059 14.021  15.363 1.00 30.81 ? 103 GLU A O   1 
ATOM   624  C  CB  . GLU A 1 80  ? 15.497 17.037  15.173 1.00 30.48 ? 103 GLU A CB  1 
ATOM   625  C  CG  . GLU A 1 80  ? 15.131 18.500  15.157 1.00 38.27 ? 103 GLU A CG  1 
ATOM   626  C  CD  . GLU A 1 80  ? 15.989 19.289  14.191 1.00 53.26 ? 103 GLU A CD  1 
ATOM   627  O  OE1 . GLU A 1 80  ? 16.784 18.662  13.454 1.00 49.04 ? 103 GLU A OE1 1 
ATOM   628  O  OE2 . GLU A 1 80  ? 15.869 20.534  14.176 1.00 56.78 ? 103 GLU A OE2 1 
ATOM   629  N  N   . VAL A 1 81  ? 16.049 14.216  16.389 1.00 28.41 ? 104 VAL A N   1 
ATOM   630  C  CA  . VAL A 1 81  ? 16.389 12.809  16.208 1.00 30.10 ? 104 VAL A CA  1 
ATOM   631  C  C   . VAL A 1 81  ? 15.494 11.915  17.058 1.00 33.85 ? 104 VAL A C   1 
ATOM   632  O  O   . VAL A 1 81  ? 15.054 10.853  16.612 1.00 36.00 ? 104 VAL A O   1 
ATOM   633  C  CB  . VAL A 1 81  ? 17.879 12.592  16.533 1.00 30.42 ? 104 VAL A CB  1 
ATOM   634  C  CG1 . VAL A 1 81  ? 18.247 11.110  16.467 1.00 29.55 ? 104 VAL A CG1 1 
ATOM   635  C  CG2 . VAL A 1 81  ? 18.742 13.417  15.589 1.00 31.33 ? 104 VAL A CG2 1 
ATOM   636  N  N   . GLY A 1 82  ? 15.219 12.315  18.292 1.00 25.09 ? 105 GLY A N   1 
ATOM   637  C  CA  . GLY A 1 82  ? 14.531 11.422  19.206 1.00 30.20 ? 105 GLY A CA  1 
ATOM   638  C  C   . GLY A 1 82  ? 13.016 11.461  19.116 1.00 28.02 ? 105 GLY A C   1 
ATOM   639  O  O   . GLY A 1 82  ? 12.345 10.540  19.589 1.00 34.21 ? 105 GLY A O   1 
ATOM   640  N  N   . GLY A 1 83  ? 12.471 12.514  18.535 1.00 29.84 ? 106 GLY A N   1 
ATOM   641  C  CA  . GLY A 1 83  ? 11.036 12.679  18.435 1.00 35.05 ? 106 GLY A CA  1 
ATOM   642  C  C   . GLY A 1 83  ? 10.544 13.822  19.309 1.00 33.72 ? 106 GLY A C   1 
ATOM   643  O  O   . GLY A 1 83  ? 11.139 14.156  20.342 1.00 24.53 ? 106 GLY A O   1 
ATOM   644  N  N   . SER A 1 84  ? 9.441  14.427  18.895 1.00 29.86 ? 107 SER A N   1 
ATOM   645  C  CA  . SER A 1 84  ? 8.919  15.572  19.622 1.00 27.18 ? 107 SER A CA  1 
ATOM   646  C  C   . SER A 1 84  ? 8.428  15.151  21.006 1.00 23.86 ? 107 SER A C   1 
ATOM   647  O  O   . SER A 1 84  ? 7.756  14.121  21.144 1.00 22.09 ? 107 SER A O   1 
ATOM   648  C  CB  . SER A 1 84  ? 7.771  16.225  18.857 1.00 32.44 ? 107 SER A CB  1 
ATOM   649  O  OG  . SER A 1 84  ? 7.068  17.122  19.699 1.00 30.29 ? 107 SER A OG  1 
ATOM   650  N  N   . PRO A 1 85  ? 8.728  15.934  22.044 1.00 22.87 ? 108 PRO A N   1 
ATOM   651  C  CA  . PRO A 1 85  ? 8.208  15.613  23.383 1.00 21.36 ? 108 PRO A CA  1 
ATOM   652  C  C   . PRO A 1 85  ? 6.693  15.639  23.448 1.00 25.27 ? 108 PRO A C   1 
ATOM   653  O  O   . PRO A 1 85  ? 6.115  15.096  24.397 1.00 23.40 ? 108 PRO A O   1 
ATOM   654  C  CB  . PRO A 1 85  ? 8.819  16.709  24.273 1.00 22.03 ? 108 PRO A CB  1 
ATOM   655  C  CG  . PRO A 1 85  ? 9.925  17.325  23.458 1.00 27.56 ? 108 PRO A CG  1 
ATOM   656  C  CD  . PRO A 1 85  ? 9.509  17.183  22.033 1.00 30.32 ? 108 PRO A CD  1 
ATOM   657  N  N   . ALA A 1 86  ? 6.031  16.249  22.460 1.00 24.11 ? 109 ALA A N   1 
ATOM   658  C  CA  . ALA A 1 86  ? 4.574  16.228  22.404 1.00 25.58 ? 109 ALA A CA  1 
ATOM   659  C  C   . ALA A 1 86  ? 4.024  14.816  22.261 1.00 28.30 ? 109 ALA A C   1 
ATOM   660  O  O   . ALA A 1 86  ? 2.886  14.566  22.662 1.00 26.76 ? 109 ALA A O   1 
ATOM   661  C  CB  . ALA A 1 86  ? 4.080  17.110  21.250 1.00 28.15 ? 109 ALA A CB  1 
ATOM   662  N  N   . ASN A 1 87  ? 4.810  13.877  21.716 1.00 23.56 ? 110 ASN A N   1 
ATOM   663  C  CA  . ASN A 1 87  ? 4.330  12.509  21.563 1.00 32.97 ? 110 ASN A CA  1 
ATOM   664  C  C   . ASN A 1 87  ? 5.418  11.479  21.853 1.00 32.00 ? 110 ASN A C   1 
ATOM   665  O  O   . ASN A 1 87  ? 5.277  10.318  21.451 1.00 25.64 ? 110 ASN A O   1 
ATOM   666  C  CB  . ASN A 1 87  ? 3.769  12.291  20.150 1.00 34.69 ? 110 ASN A CB  1 
ATOM   667  C  CG  . ASN A 1 87  ? 4.779  12.613  19.059 1.00 38.63 ? 110 ASN A CG  1 
ATOM   668  O  OD1 . ASN A 1 87  ? 5.909  12.121  19.068 1.00 43.89 ? 110 ASN A OD1 1 
ATOM   669  N  ND2 . ASN A 1 87  ? 4.375  13.450  18.112 1.00 50.80 ? 110 ASN A ND2 1 
ATOM   670  N  N   . THR A 1 88  ? 6.500  11.871  22.528 1.00 27.08 ? 111 THR A N   1 
ATOM   671  C  CA  . THR A 1 88  ? 7.615  10.974  22.817 1.00 28.16 ? 111 THR A CA  1 
ATOM   672  C  C   . THR A 1 88  ? 7.956  11.063  24.294 1.00 21.91 ? 111 THR A C   1 
ATOM   673  O  O   . THR A 1 88  ? 8.109  12.166  24.829 1.00 23.01 ? 111 THR A O   1 
ATOM   674  C  CB  . THR A 1 88  ? 8.854  11.339  21.993 1.00 27.91 ? 111 THR A CB  1 
ATOM   675  O  OG1 . THR A 1 88  ? 8.490  11.465  20.614 1.00 27.82 ? 111 THR A OG1 1 
ATOM   676  C  CG2 . THR A 1 88  ? 9.946  10.278  22.153 1.00 23.58 ? 111 THR A CG2 1 
ATOM   677  N  N   . ARG A 1 89  ? 8.099  9.913   24.941 1.00 19.06 ? 112 ARG A N   1 
ATOM   678  C  CA  . ARG A 1 89  ? 8.548  9.879   26.327 1.00 21.42 ? 112 ARG A CA  1 
ATOM   679  C  C   . ARG A 1 89  ? 10.069 9.976   26.390 1.00 18.24 ? 112 ARG A C   1 
ATOM   680  O  O   . ARG A 1 89  ? 10.777 9.339   25.607 1.00 16.00 ? 112 ARG A O   1 
ATOM   681  C  CB  . ARG A 1 89  ? 8.062  8.600   27.006 1.00 22.35 ? 112 ARG A CB  1 
ATOM   682  C  CG  . ARG A 1 89  ? 6.542  8.472   26.942 1.00 28.48 ? 112 ARG A CG  1 
ATOM   683  C  CD  . ARG A 1 89  ? 6.078  7.032   27.051 1.00 28.79 ? 112 ARG A CD  1 
ATOM   684  N  NE  . ARG A 1 89  ? 6.523  6.398   28.285 1.00 30.57 ? 112 ARG A NE  1 
ATOM   685  C  CZ  . ARG A 1 89  ? 6.008  6.656   29.479 1.00 34.63 ? 112 ARG A CZ  1 
ATOM   686  N  NH1 . ARG A 1 89  ? 5.031  7.545   29.602 1.00 36.61 ? 112 ARG A NH1 1 
ATOM   687  N  NH2 . ARG A 1 89  ? 6.474  6.031   30.555 1.00 41.24 ? 112 ARG A NH2 1 
ATOM   688  N  N   . TYR A 1 90  ? 10.567 10.780  27.331 1.00 16.48 ? 113 TYR A N   1 
ATOM   689  C  CA  . TYR A 1 90  ? 11.986 11.102  27.414 1.00 14.80 ? 113 TYR A CA  1 
ATOM   690  C  C   . TYR A 1 90  ? 12.478 10.888  28.831 1.00 15.89 ? 113 TYR A C   1 
ATOM   691  O  O   . TYR A 1 90  ? 11.762 11.185  29.795 1.00 14.85 ? 113 TYR A O   1 
ATOM   692  C  CB  . TYR A 1 90  ? 12.255 12.563  27.022 1.00 17.53 ? 113 TYR A CB  1 
ATOM   693  C  CG  . TYR A 1 90  ? 12.542 12.773  25.555 1.00 18.02 ? 113 TYR A CG  1 
ATOM   694  C  CD1 . TYR A 1 90  ? 13.822 12.575  25.046 1.00 18.52 ? 113 TYR A CD1 1 
ATOM   695  C  CD2 . TYR A 1 90  ? 11.536 13.156  24.676 1.00 18.39 ? 113 TYR A CD2 1 
ATOM   696  C  CE1 . TYR A 1 90  ? 14.094 12.752  23.695 1.00 22.27 ? 113 TYR A CE1 1 
ATOM   697  C  CE2 . TYR A 1 90  ? 11.801 13.347  23.328 1.00 21.40 ? 113 TYR A CE2 1 
ATOM   698  C  CZ  . TYR A 1 90  ? 13.080 13.142  22.844 1.00 20.83 ? 113 TYR A CZ  1 
ATOM   699  O  OH  . TYR A 1 90  ? 13.337 13.333  21.499 1.00 22.28 ? 113 TYR A OH  1 
ATOM   700  N  N   . LEU A 1 91  ? 13.712 10.392  28.947 1.00 14.45 ? 114 LEU A N   1 
ATOM   701  C  CA  . LEU A 1 91  ? 14.415 10.300  30.218 1.00 11.95 ? 114 LEU A CA  1 
ATOM   702  C  C   . LEU A 1 91  ? 15.816 10.859  30.021 1.00 14.39 ? 114 LEU A C   1 
ATOM   703  O  O   . LEU A 1 91  ? 16.588 10.309  29.231 1.00 16.17 ? 114 LEU A O   1 
ATOM   704  C  CB  . LEU A 1 91  ? 14.478 8.847   30.708 1.00 12.58 ? 114 LEU A CB  1 
ATOM   705  C  CG  . LEU A 1 91  ? 15.377 8.597   31.931 1.00 15.54 ? 114 LEU A CG  1 
ATOM   706  C  CD1 . LEU A 1 91  ? 14.879 9.419   33.126 1.00 14.29 ? 114 LEU A CD1 1 
ATOM   707  C  CD2 . LEU A 1 91  ? 15.406 7.120   32.260 1.00 16.29 ? 114 LEU A CD2 1 
ATOM   708  N  N   . PHE A 1 92  ? 16.142 11.944  30.727 1.00 12.41 ? 115 PHE A N   1 
ATOM   709  C  CA  . PHE A 1 92  ? 17.486 12.511  30.698 1.00 11.09 ? 115 PHE A CA  1 
ATOM   710  C  C   . PHE A 1 92  ? 18.254 12.089  31.943 1.00 12.48 ? 115 PHE A C   1 
ATOM   711  O  O   . PHE A 1 92  ? 17.696 12.066  33.041 1.00 11.92 ? 115 PHE A O   1 
ATOM   712  C  CB  . PHE A 1 92  ? 17.432 14.034  30.616 1.00 12.41 ? 115 PHE A CB  1 
ATOM   713  C  CG  . PHE A 1 92  ? 17.008 14.544  29.271 1.00 15.02 ? 115 PHE A CG  1 
ATOM   714  C  CD1 . PHE A 1 92  ? 15.667 14.571  28.916 1.00 16.40 ? 115 PHE A CD1 1 
ATOM   715  C  CD2 . PHE A 1 92  ? 17.947 15.004  28.366 1.00 15.09 ? 115 PHE A CD2 1 
ATOM   716  C  CE1 . PHE A 1 92  ? 15.271 15.049  27.670 1.00 16.38 ? 115 PHE A CE1 1 
ATOM   717  C  CE2 . PHE A 1 92  ? 17.558 15.479  27.117 1.00 16.53 ? 115 PHE A CE2 1 
ATOM   718  C  CZ  . PHE A 1 92  ? 16.227 15.496  26.769 1.00 16.17 ? 115 PHE A CZ  1 
ATOM   719  N  N   . LEU A 1 93  ? 19.543 11.787  31.778 1.00 10.72 ? 116 LEU A N   1 
ATOM   720  C  CA  . LEU A 1 93  ? 20.331 11.226  32.864 1.00 11.49 ? 116 LEU A CA  1 
ATOM   721  C  C   . LEU A 1 93  ? 21.224 12.252  33.563 1.00 11.38 ? 116 LEU A C   1 
ATOM   722  O  O   . LEU A 1 93  ? 22.099 11.851  34.334 1.00 14.47 ? 116 LEU A O   1 
ATOM   723  C  CB  . LEU A 1 93  ? 21.183 10.056  32.357 1.00 11.80 ? 116 LEU A CB  1 
ATOM   724  C  CG  . LEU A 1 93  ? 20.408 8.900   31.700 1.00 14.90 ? 116 LEU A CG  1 
ATOM   725  C  CD1 . LEU A 1 93  ? 21.384 7.802   31.186 1.00 12.82 ? 116 LEU A CD1 1 
ATOM   726  C  CD2 . LEU A 1 93  ? 19.309 8.300   32.621 1.00 13.88 ? 116 LEU A CD2 1 
ATOM   727  N  N   . GLY A 1 94  ? 21.029 13.545  33.327 1.00 10.57 ? 117 GLY A N   1 
ATOM   728  C  CA  . GLY A 1 94  ? 21.701 14.590  34.102 1.00 8.96  ? 117 GLY A CA  1 
ATOM   729  C  C   . GLY A 1 94  ? 22.813 15.289  33.324 1.00 13.20 ? 117 GLY A C   1 
ATOM   730  O  O   . GLY A 1 94  ? 22.996 15.087  32.122 1.00 13.76 ? 117 GLY A O   1 
ATOM   731  N  N   . ASP A 1 95  ? 23.578 16.120  34.053 1.00 10.93 ? 118 ASP A N   1 
ATOM   732  C  CA  . ASP A 1 95  ? 24.652 16.969  33.492 1.00 11.47 ? 118 ASP A CA  1 
ATOM   733  C  C   . ASP A 1 95  ? 24.102 17.874  32.383 1.00 11.48 ? 118 ASP A C   1 
ATOM   734  O  O   . ASP A 1 95  ? 24.494 17.805  31.213 1.00 13.12 ? 118 ASP A O   1 
ATOM   735  C  CB  . ASP A 1 95  ? 25.861 16.138  33.001 1.00 14.03 ? 118 ASP A CB  1 
ATOM   736  C  CG  . ASP A 1 95  ? 26.849 15.788  34.133 1.00 12.93 ? 118 ASP A CG  1 
ATOM   737  O  OD1 . ASP A 1 95  ? 26.470 15.994  35.310 1.00 13.86 ? 118 ASP A OD1 1 
ATOM   738  O  OD2 . ASP A 1 95  ? 27.985 15.287  33.855 1.00 13.48 ? 118 ASP A OD2 1 
ATOM   739  N  N   . TYR A 1 96  ? 23.159 18.729  32.785 1.00 11.38 ? 119 TYR A N   1 
ATOM   740  C  CA  . TYR A 1 96  ? 22.559 19.718  31.895 1.00 10.15 ? 119 TYR A CA  1 
ATOM   741  C  C   . TYR A 1 96  ? 23.408 20.970  31.757 1.00 11.49 ? 119 TYR A C   1 
ATOM   742  O  O   . TYR A 1 96  ? 23.239 21.697  30.777 1.00 16.07 ? 119 TYR A O   1 
ATOM   743  C  CB  . TYR A 1 96  ? 21.171 20.129  32.414 1.00 12.10 ? 119 TYR A CB  1 
ATOM   744  C  CG  . TYR A 1 96  ? 20.346 18.924  32.745 1.00 13.60 ? 119 TYR A CG  1 
ATOM   745  C  CD1 . TYR A 1 96  ? 19.957 18.042  31.745 1.00 15.05 ? 119 TYR A CD1 1 
ATOM   746  C  CD2 . TYR A 1 96  ? 20.015 18.623  34.059 1.00 12.82 ? 119 TYR A CD2 1 
ATOM   747  C  CE1 . TYR A 1 96  ? 19.236 16.903  32.047 1.00 12.13 ? 119 TYR A CE1 1 
ATOM   748  C  CE2 . TYR A 1 96  ? 19.305 17.478  34.369 1.00 14.30 ? 119 TYR A CE2 1 
ATOM   749  C  CZ  . TYR A 1 96  ? 18.916 16.627  33.357 1.00 13.51 ? 119 TYR A CZ  1 
ATOM   750  O  OH  . TYR A 1 96  ? 18.199 15.485  33.649 1.00 11.99 ? 119 TYR A OH  1 
ATOM   751  N  N   . VAL A 1 97  ? 24.282 21.241  32.723 1.00 13.93 ? 120 VAL A N   1 
ATOM   752  C  CA  . VAL A 1 97  ? 24.974 22.519  32.820 1.00 15.79 ? 120 VAL A CA  1 
ATOM   753  C  C   . VAL A 1 97  ? 26.483 22.282  32.824 1.00 15.10 ? 120 VAL A C   1 
ATOM   754  O  O   . VAL A 1 97  ? 26.960 21.154  32.978 1.00 14.45 ? 120 VAL A O   1 
ATOM   755  C  CB  . VAL A 1 97  ? 24.538 23.320  34.065 1.00 16.36 ? 120 VAL A CB  1 
ATOM   756  C  CG1 . VAL A 1 97  ? 23.039 23.557  34.044 1.00 13.75 ? 120 VAL A CG1 1 
ATOM   757  C  CG2 . VAL A 1 97  ? 24.949 22.613  35.353 1.00 14.55 ? 120 VAL A CG2 1 
ATOM   758  N  N   . ASP A 1 98  ? 27.221 23.386  32.656 1.00 14.61 ? 121 ASP A N   1 
ATOM   759  C  CA  . ASP A 1 98  ? 28.681 23.492  32.685 1.00 16.79 ? 121 ASP A CA  1 
ATOM   760  C  C   . ASP A 1 98  ? 29.297 23.015  31.376 1.00 19.64 ? 121 ASP A C   1 
ATOM   761  O  O   . ASP A 1 98  ? 28.659 22.283  30.603 1.00 17.39 ? 121 ASP A O   1 
ATOM   762  C  CB  . ASP A 1 98  ? 29.297 22.724  33.870 1.00 17.54 ? 121 ASP A CB  1 
ATOM   763  C  CG  . ASP A 1 98  ? 28.956 23.344  35.215 1.00 19.61 ? 121 ASP A CG  1 
ATOM   764  O  OD1 . ASP A 1 98  ? 28.743 24.573  35.269 1.00 22.70 ? 121 ASP A OD1 1 
ATOM   765  O  OD2 . ASP A 1 98  ? 28.903 22.602  36.228 1.00 19.46 ? 121 ASP A OD2 1 
ATOM   766  N  N   . ARG A 1 99  ? 30.535 23.455  31.125 1.00 16.47 ? 122 ARG A N   1 
ATOM   767  C  CA  . ARG A 1 99  ? 31.338 23.089  29.960 1.00 19.89 ? 122 ARG A CA  1 
ATOM   768  C  C   . ARG A 1 99  ? 30.855 23.793  28.698 1.00 25.93 ? 122 ARG A C   1 
ATOM   769  O  O   . ARG A 1 99  ? 31.627 24.525  28.074 1.00 26.72 ? 122 ARG A O   1 
ATOM   770  C  CB  . ARG A 1 99  ? 31.375 21.568  29.770 1.00 22.12 ? 122 ARG A CB  1 
ATOM   771  C  CG  . ARG A 1 99  ? 32.066 20.854  30.938 1.00 27.77 ? 122 ARG A CG  1 
ATOM   772  C  CD  . ARG A 1 99  ? 33.413 20.234  30.515 1.00 61.73 ? 122 ARG A CD  1 
ATOM   773  N  NE  . ARG A 1 99  ? 34.173 19.665  31.635 1.00 59.54 ? 122 ARG A NE  1 
ATOM   774  C  CZ  . ARG A 1 99  ? 33.760 18.641  32.381 1.00 49.74 ? 122 ARG A CZ  1 
ATOM   775  N  NH1 . ARG A 1 99  ? 32.583 18.082  32.143 1.00 40.55 ? 122 ARG A NH1 1 
ATOM   776  N  NH2 . ARG A 1 99  ? 34.510 18.182  33.379 1.00 40.79 ? 122 ARG A NH2 1 
ATOM   777  N  N   . GLY A 1 100 ? 29.599 23.605  28.314 1.00 17.74 ? 123 GLY A N   1 
ATOM   778  C  CA  . GLY A 1 100 ? 29.068 24.280  27.147 1.00 17.05 ? 123 GLY A CA  1 
ATOM   779  C  C   . GLY A 1 100 ? 28.789 25.753  27.419 1.00 23.28 ? 123 GLY A C   1 
ATOM   780  O  O   . GLY A 1 100 ? 29.042 26.286  28.501 1.00 20.24 ? 123 GLY A O   1 
ATOM   781  N  N   . TYR A 1 101 ? 28.207 26.410  26.415 1.00 16.39 ? 124 TYR A N   1 
ATOM   782  C  CA  A TYR A 1 101 ? 28.042 27.862  26.434 0.49 23.67 ? 124 TYR A CA  1 
ATOM   783  C  CA  B TYR A 1 101 ? 28.047 27.859  26.454 0.51 23.66 ? 124 TYR A CA  1 
ATOM   784  C  C   . TYR A 1 101 ? 26.633 28.319  26.788 1.00 22.47 ? 124 TYR A C   1 
ATOM   785  O  O   . TYR A 1 101 ? 26.442 29.507  27.101 1.00 21.11 ? 124 TYR A O   1 
ATOM   786  C  CB  A TYR A 1 101 ? 28.416 28.466  25.070 0.49 27.10 ? 124 TYR A CB  1 
ATOM   787  C  CB  B TYR A 1 101 ? 28.470 28.471  25.112 0.51 27.11 ? 124 TYR A CB  1 
ATOM   788  C  CG  A TYR A 1 101 ? 29.885 28.387  24.715 0.49 26.71 ? 124 TYR A CG  1 
ATOM   789  C  CG  B TYR A 1 101 ? 28.677 29.958  25.194 0.51 28.00 ? 124 TYR A CG  1 
ATOM   790  C  CD1 A TYR A 1 101 ? 30.820 29.174  25.373 0.49 35.47 ? 124 TYR A CD1 1 
ATOM   791  C  CD1 B TYR A 1 101 ? 29.605 30.490  26.076 0.51 33.46 ? 124 TYR A CD1 1 
ATOM   792  C  CD2 A TYR A 1 101 ? 30.335 27.538  23.708 0.49 31.67 ? 124 TYR A CD2 1 
ATOM   793  C  CD2 B TYR A 1 101 ? 27.939 30.833  24.405 0.51 27.68 ? 124 TYR A CD2 1 
ATOM   794  C  CE1 A TYR A 1 101 ? 32.163 29.110  25.052 0.49 37.19 ? 124 TYR A CE1 1 
ATOM   795  C  CE1 B TYR A 1 101 ? 29.797 31.848  26.173 0.51 32.15 ? 124 TYR A CE1 1 
ATOM   796  C  CE2 A TYR A 1 101 ? 31.680 27.467  23.380 0.49 35.74 ? 124 TYR A CE2 1 
ATOM   797  C  CE2 B TYR A 1 101 ? 28.129 32.197  24.489 0.51 27.50 ? 124 TYR A CE2 1 
ATOM   798  C  CZ  A TYR A 1 101 ? 32.587 28.258  24.055 0.49 35.22 ? 124 TYR A CZ  1 
ATOM   799  C  CZ  B TYR A 1 101 ? 29.065 32.699  25.374 0.51 33.05 ? 124 TYR A CZ  1 
ATOM   800  O  OH  A TYR A 1 101 ? 33.924 28.200  23.740 0.49 31.57 ? 124 TYR A OH  1 
ATOM   801  O  OH  B TYR A 1 101 ? 29.270 34.055  25.477 0.51 27.82 ? 124 TYR A OH  1 
ATOM   802  N  N   . PHE A 1 102 ? 25.653 27.429  26.749 1.00 17.56 ? 125 PHE A N   1 
ATOM   803  C  CA  . PHE A 1 102 ? 24.251 27.793  26.904 1.00 17.58 ? 125 PHE A CA  1 
ATOM   804  C  C   . PHE A 1 102 ? 23.585 27.006  28.031 1.00 17.41 ? 125 PHE A C   1 
ATOM   805  O  O   . PHE A 1 102 ? 22.493 26.459  27.864 1.00 18.20 ? 125 PHE A O   1 
ATOM   806  C  CB  . PHE A 1 102 ? 23.507 27.562  25.593 1.00 17.41 ? 125 PHE A CB  1 
ATOM   807  C  CG  . PHE A 1 102 ? 24.119 28.276  24.420 1.00 20.57 ? 125 PHE A CG  1 
ATOM   808  C  CD1 . PHE A 1 102 ? 23.969 29.646  24.270 1.00 28.70 ? 125 PHE A CD1 1 
ATOM   809  C  CD2 . PHE A 1 102 ? 24.843 27.579  23.467 1.00 22.32 ? 125 PHE A CD2 1 
ATOM   810  C  CE1 . PHE A 1 102 ? 24.533 30.304  23.188 1.00 32.03 ? 125 PHE A CE1 1 
ATOM   811  C  CE2 . PHE A 1 102 ? 25.403 28.230  22.386 1.00 28.46 ? 125 PHE A CE2 1 
ATOM   812  C  CZ  . PHE A 1 102 ? 25.250 29.592  22.245 1.00 27.11 ? 125 PHE A CZ  1 
ATOM   813  N  N   . SER A 1 103 ? 24.203 26.996  29.217 1.00 16.77 ? 126 SER A N   1 
ATOM   814  C  CA  . SER A 1 103 ? 23.681 26.197  30.325 1.00 21.04 ? 126 SER A CA  1 
ATOM   815  C  C   . SER A 1 103 ? 22.329 26.712  30.818 1.00 19.73 ? 126 SER A C   1 
ATOM   816  O  O   . SER A 1 103 ? 21.400 25.923  31.026 1.00 15.39 ? 126 SER A O   1 
ATOM   817  C  CB  . SER A 1 103 ? 24.689 26.160  31.479 1.00 16.27 ? 126 SER A CB  1 
ATOM   818  O  OG  . SER A 1 103 ? 25.886 25.505  31.088 1.00 18.88 ? 126 SER A OG  1 
ATOM   819  N  N   . ILE A 1 104 ? 22.194 28.028  31.038 1.00 16.09 ? 127 ILE A N   1 
ATOM   820  C  CA  . ILE A 1 104 ? 20.918 28.478  31.593 1.00 17.15 ? 127 ILE A CA  1 
ATOM   821  C  C   . ILE A 1 104 ? 19.815 28.316  30.558 1.00 18.67 ? 127 ILE A C   1 
ATOM   822  O  O   . ILE A 1 104 ? 18.661 28.043  30.906 1.00 18.08 ? 127 ILE A O   1 
ATOM   823  C  CB  . ILE A 1 104 ? 20.998 29.920  32.135 1.00 17.12 ? 127 ILE A CB  1 
ATOM   824  C  CG1 . ILE A 1 104 ? 19.708 30.272  32.891 1.00 14.59 ? 127 ILE A CG1 1 
ATOM   825  C  CG2 . ILE A 1 104 ? 21.257 30.927  31.010 1.00 21.18 ? 127 ILE A CG2 1 
ATOM   826  C  CD1 . ILE A 1 104 ? 19.413 29.366  34.102 1.00 19.58 ? 127 ILE A CD1 1 
ATOM   827  N  N   . GLU A 1 105 ? 20.151 28.439  29.275 1.00 17.07 ? 128 GLU A N   1 
ATOM   828  C  CA  . GLU A 1 105 ? 19.171 28.209  28.223 1.00 18.56 ? 128 GLU A CA  1 
ATOM   829  C  C   . GLU A 1 105 ? 18.701 26.756  28.207 1.00 20.44 ? 128 GLU A C   1 
ATOM   830  O  O   . GLU A 1 105 ? 17.507 26.485  28.022 1.00 18.77 ? 128 GLU A O   1 
ATOM   831  C  CB  . GLU A 1 105 ? 19.767 28.604  26.872 1.00 17.05 ? 128 GLU A CB  1 
ATOM   832  C  CG  . GLU A 1 105 ? 20.025 30.121  26.695 1.00 20.27 ? 128 GLU A CG  1 
ATOM   833  C  CD  . GLU A 1 105 ? 21.310 30.633  27.364 1.00 33.64 ? 128 GLU A CD  1 
ATOM   834  O  OE1 . GLU A 1 105 ? 22.117 29.830  27.897 1.00 21.40 ? 128 GLU A OE1 1 
ATOM   835  O  OE2 . GLU A 1 105 ? 21.514 31.864  27.354 1.00 29.53 ? 128 GLU A OE2 1 
ATOM   836  N  N   . CYS A 1 106 ? 19.621 25.804  28.387 1.00 16.81 ? 129 CYS A N   1 
ATOM   837  C  CA  . CYS A 1 106 ? 19.206 24.403  28.445 1.00 14.72 ? 129 CYS A CA  1 
ATOM   838  C  C   . CYS A 1 106 ? 18.307 24.151  29.646 1.00 15.54 ? 129 CYS A C   1 
ATOM   839  O  O   . CYS A 1 106 ? 17.294 23.455  29.529 1.00 15.74 ? 129 CYS A O   1 
ATOM   840  C  CB  . CYS A 1 106 ? 20.416 23.476  28.492 1.00 16.29 ? 129 CYS A CB  1 
ATOM   841  S  SG  . CYS A 1 106 ? 21.359 23.447  26.951 1.00 19.29 ? 129 CYS A SG  1 
ATOM   842  N  N   . VAL A 1 107 ? 18.664 24.703  30.808 1.00 15.08 ? 130 VAL A N   1 
ATOM   843  C  CA  . VAL A 1 107 ? 17.841 24.531  32.007 1.00 14.52 ? 130 VAL A CA  1 
ATOM   844  C  C   . VAL A 1 107 ? 16.436 25.087  31.781 1.00 18.87 ? 130 VAL A C   1 
ATOM   845  O  O   . VAL A 1 107 ? 15.432 24.414  32.043 1.00 13.95 ? 130 VAL A O   1 
ATOM   846  C  CB  . VAL A 1 107 ? 18.520 25.190  33.225 1.00 14.10 ? 130 VAL A CB  1 
ATOM   847  C  CG1 . VAL A 1 107 ? 17.527 25.313  34.392 1.00 17.10 ? 130 VAL A CG1 1 
ATOM   848  C  CG2 . VAL A 1 107 ? 19.738 24.381  33.674 1.00 15.47 ? 130 VAL A CG2 1 
ATOM   849  N  N   . LEU A 1 108 ? 16.340 26.328  31.299 1.00 16.07 ? 131 LEU A N   1 
ATOM   850  C  CA  . LEU A 1 108 ? 15.022 26.947  31.151 1.00 16.60 ? 131 LEU A CA  1 
ATOM   851  C  C   . LEU A 1 108 ? 14.166 26.184  30.150 1.00 15.73 ? 131 LEU A C   1 
ATOM   852  O  O   . LEU A 1 108 ? 12.956 26.008  30.352 1.00 17.71 ? 131 LEU A O   1 
ATOM   853  C  CB  . LEU A 1 108 ? 15.169 28.408  30.722 1.00 16.49 ? 131 LEU A CB  1 
ATOM   854  C  CG  . LEU A 1 108 ? 15.734 29.341  31.794 1.00 19.40 ? 131 LEU A CG  1 
ATOM   855  C  CD1 . LEU A 1 108 ? 16.162 30.692  31.180 1.00 17.28 ? 131 LEU A CD1 1 
ATOM   856  C  CD2 . LEU A 1 108 ? 14.707 29.553  32.917 1.00 19.87 ? 131 LEU A CD2 1 
ATOM   857  N  N   . TYR A 1 109 ? 14.779 25.688  29.080 1.00 14.99 ? 132 TYR A N   1 
ATOM   858  C  CA  . TYR A 1 109 ? 14.009 24.962  28.080 1.00 17.72 ? 132 TYR A CA  1 
ATOM   859  C  C   . TYR A 1 109 ? 13.566 23.595  28.591 1.00 18.35 ? 132 TYR A C   1 
ATOM   860  O  O   . TYR A 1 109 ? 12.423 23.183  28.368 1.00 14.65 ? 132 TYR A O   1 
ATOM   861  C  CB  . TYR A 1 109 ? 14.824 24.817  26.805 1.00 18.88 ? 132 TYR A CB  1 
ATOM   862  C  CG  . TYR A 1 109 ? 14.013 24.290  25.660 1.00 19.27 ? 132 TYR A CG  1 
ATOM   863  C  CD1 . TYR A 1 109 ? 12.983 25.038  25.122 1.00 23.97 ? 132 TYR A CD1 1 
ATOM   864  C  CD2 . TYR A 1 109 ? 14.278 23.048  25.114 1.00 25.47 ? 132 TYR A CD2 1 
ATOM   865  C  CE1 . TYR A 1 109 ? 12.231 24.563  24.078 1.00 23.60 ? 132 TYR A CE1 1 
ATOM   866  C  CE2 . TYR A 1 109 ? 13.530 22.563  24.057 1.00 28.96 ? 132 TYR A CE2 1 
ATOM   867  C  CZ  . TYR A 1 109 ? 12.513 23.330  23.544 1.00 26.28 ? 132 TYR A CZ  1 
ATOM   868  O  OH  . TYR A 1 109 ? 11.769 22.862  22.496 1.00 35.24 ? 132 TYR A OH  1 
ATOM   869  N  N   . LEU A 1 110 ? 14.453 22.868  29.270 1.00 13.00 ? 133 LEU A N   1 
ATOM   870  C  CA  . LEU A 1 110 ? 14.059 21.551  29.763 1.00 15.05 ? 133 LEU A CA  1 
ATOM   871  C  C   . LEU A 1 110 ? 13.042 21.671  30.895 1.00 14.76 ? 133 LEU A C   1 
ATOM   872  O  O   . LEU A 1 110 ? 12.109 20.855  30.995 1.00 14.11 ? 133 LEU A O   1 
ATOM   873  C  CB  . LEU A 1 110 ? 15.292 20.771  30.217 1.00 14.83 ? 133 LEU A CB  1 
ATOM   874  C  CG  . LEU A 1 110 ? 16.171 20.216  29.087 1.00 13.92 ? 133 LEU A CG  1 
ATOM   875  C  CD1 . LEU A 1 110 ? 17.521 19.787  29.653 1.00 18.70 ? 133 LEU A CD1 1 
ATOM   876  C  CD2 . LEU A 1 110 ? 15.491 19.038  28.376 1.00 16.62 ? 133 LEU A CD2 1 
ATOM   877  N  N   . TRP A 1 111 ? 13.199 22.679  31.756 1.00 12.71 ? 134 TRP A N   1 
ATOM   878  C  CA  . TRP A 1 111 ? 12.214 22.888  32.813 1.00 15.79 ? 134 TRP A CA  1 
ATOM   879  C  C   . TRP A 1 111 ? 10.857 23.256  32.222 1.00 16.89 ? 134 TRP A C   1 
ATOM   880  O  O   . TRP A 1 111 ? 9.816  22.783  32.697 1.00 15.81 ? 134 TRP A O   1 
ATOM   881  C  CB  . TRP A 1 111 ? 12.708 23.968  33.781 1.00 14.86 ? 134 TRP A CB  1 
ATOM   882  C  CG  . TRP A 1 111 ? 13.327 23.428  35.056 1.00 16.26 ? 134 TRP A CG  1 
ATOM   883  C  CD1 . TRP A 1 111 ? 12.900 23.663  36.333 1.00 19.86 ? 134 TRP A CD1 1 
ATOM   884  C  CD2 . TRP A 1 111 ? 14.465 22.550  35.170 1.00 15.51 ? 134 TRP A CD2 1 
ATOM   885  N  NE1 . TRP A 1 111 ? 13.706 22.997  37.230 1.00 17.51 ? 134 TRP A NE1 1 
ATOM   886  C  CE2 . TRP A 1 111 ? 14.667 22.305  36.544 1.00 17.37 ? 134 TRP A CE2 1 
ATOM   887  C  CE3 . TRP A 1 111 ? 15.330 21.950  34.241 1.00 17.57 ? 134 TRP A CE3 1 
ATOM   888  C  CZ2 . TRP A 1 111 ? 15.696 21.478  37.018 1.00 16.73 ? 134 TRP A CZ2 1 
ATOM   889  C  CZ3 . TRP A 1 111 ? 16.356 21.140  34.713 1.00 17.12 ? 134 TRP A CZ3 1 
ATOM   890  C  CH2 . TRP A 1 111 ? 16.524 20.906  36.092 1.00 16.10 ? 134 TRP A CH2 1 
ATOM   891  N  N   . ALA A 1 112 ? 10.853 24.088  31.174 1.00 15.41 ? 135 ALA A N   1 
ATOM   892  C  CA  . ALA A 1 112 ? 9.613  24.409  30.468 1.00 18.67 ? 135 ALA A CA  1 
ATOM   893  C  C   . ALA A 1 112 ? 8.955  23.155  29.900 1.00 17.64 ? 135 ALA A C   1 
ATOM   894  O  O   . ALA A 1 112 ? 7.741  22.966  30.023 1.00 16.25 ? 135 ALA A O   1 
ATOM   895  C  CB  . ALA A 1 112 ? 9.890  25.412  29.351 1.00 18.19 ? 135 ALA A CB  1 
ATOM   896  N  N   . LEU A 1 113 ? 9.748  22.284  29.275 1.00 16.42 ? 136 LEU A N   1 
ATOM   897  C  CA  . LEU A 1 113 ? 9.203  21.033  28.761 1.00 13.52 ? 136 LEU A CA  1 
ATOM   898  C  C   . LEU A 1 113 ? 8.663  20.159  29.889 1.00 19.65 ? 136 LEU A C   1 
ATOM   899  O  O   . LEU A 1 113 ? 7.661  19.463  29.709 1.00 17.09 ? 136 LEU A O   1 
ATOM   900  C  CB  . LEU A 1 113 ? 10.270 20.279  27.969 1.00 14.67 ? 136 LEU A CB  1 
ATOM   901  C  CG  . LEU A 1 113 ? 10.580 20.859  26.586 1.00 18.33 ? 136 LEU A CG  1 
ATOM   902  C  CD1 . LEU A 1 113 ? 11.775 20.130  25.979 1.00 18.78 ? 136 LEU A CD1 1 
ATOM   903  C  CD2 . LEU A 1 113 ? 9.344  20.748  25.676 1.00 20.84 ? 136 LEU A CD2 1 
ATOM   904  N  N   . LYS A 1 114 ? 9.320  20.172  31.057 1.00 15.44 ? 137 LYS A N   1 
ATOM   905  C  CA  . LYS A 1 114 ? 8.814  19.384  32.181 1.00 14.33 ? 137 LYS A CA  1 
ATOM   906  C  C   . LYS A 1 114 ? 7.470  19.922  32.667 1.00 14.09 ? 137 LYS A C   1 
ATOM   907  O  O   . LYS A 1 114 ? 6.570  19.144  33.007 1.00 17.05 ? 137 LYS A O   1 
ATOM   908  C  CB  . LYS A 1 114 ? 9.840  19.374  33.322 1.00 15.49 ? 137 LYS A CB  1 
ATOM   909  C  CG  . LYS A 1 114 ? 9.412  18.565  34.543 1.00 13.27 ? 137 LYS A CG  1 
ATOM   910  C  CD  . LYS A 1 114 ? 9.168  17.109  34.202 1.00 13.73 ? 137 LYS A CD  1 
ATOM   911  C  CE  . LYS A 1 114 ? 8.956  16.260  35.447 1.00 14.39 ? 137 LYS A CE  1 
ATOM   912  N  NZ  . LYS A 1 114 ? 8.637  14.823  35.114 1.00 18.20 ? 137 LYS A NZ  1 
ATOM   913  N  N   . ILE A 1 115 ? 7.318  21.252  32.694 1.00 16.51 ? 138 ILE A N   1 
ATOM   914  C  CA  . ILE A 1 115 ? 6.039  21.865  33.054 1.00 17.22 ? 138 ILE A CA  1 
ATOM   915  C  C   . ILE A 1 115 ? 4.961  21.453  32.061 1.00 19.75 ? 138 ILE A C   1 
ATOM   916  O  O   . ILE A 1 115 ? 3.825  21.141  32.439 1.00 18.91 ? 138 ILE A O   1 
ATOM   917  C  CB  . ILE A 1 115 ? 6.183  23.401  33.111 1.00 16.96 ? 138 ILE A CB  1 
ATOM   918  C  CG1 . ILE A 1 115 ? 7.114  23.825  34.251 1.00 15.17 ? 138 ILE A CG1 1 
ATOM   919  C  CG2 . ILE A 1 115 ? 4.792  24.081  33.218 1.00 18.34 ? 138 ILE A CG2 1 
ATOM   920  C  CD1 . ILE A 1 115 ? 7.594  25.257  34.146 1.00 17.65 ? 138 ILE A CD1 1 
ATOM   921  N  N   . LEU A 1 116 ? 5.305  21.448  30.775 1.00 16.53 ? 139 LEU A N   1 
ATOM   922  C  CA  . LEU A 1 116 ? 4.335  21.165  29.725 1.00 22.37 ? 139 LEU A CA  1 
ATOM   923  C  C   . LEU A 1 116 ? 3.994  19.681  29.647 1.00 23.14 ? 139 LEU A C   1 
ATOM   924  O  O   . LEU A 1 116 ? 2.836  19.326  29.390 1.00 20.47 ? 139 LEU A O   1 
ATOM   925  C  CB  . LEU A 1 116 ? 4.881  21.677  28.389 1.00 21.62 ? 139 LEU A CB  1 
ATOM   926  C  CG  . LEU A 1 116 ? 4.009  21.604  27.131 1.00 30.18 ? 139 LEU A CG  1 
ATOM   927  C  CD1 . LEU A 1 116 ? 2.657  22.266  27.368 1.00 31.90 ? 139 LEU A CD1 1 
ATOM   928  C  CD2 . LEU A 1 116 ? 4.730  22.276  25.960 1.00 24.73 ? 139 LEU A CD2 1 
ATOM   929  N  N   . TYR A 1 117 ? 4.979  18.804  29.871 1.00 16.73 ? 140 TYR A N   1 
ATOM   930  C  CA  . TYR A 1 117 ? 4.803  17.350  29.761 1.00 17.75 ? 140 TYR A CA  1 
ATOM   931  C  C   . TYR A 1 117 ? 5.239  16.654  31.049 1.00 17.62 ? 140 TYR A C   1 
ATOM   932  O  O   . TYR A 1 117 ? 6.158  15.829  31.041 1.00 18.55 ? 140 TYR A O   1 
ATOM   933  C  CB  . TYR A 1 117 ? 5.589  16.795  28.571 1.00 19.81 ? 140 TYR A CB  1 
ATOM   934  C  CG  . TYR A 1 117 ? 5.303  17.500  27.260 1.00 21.82 ? 140 TYR A CG  1 
ATOM   935  C  CD1 . TYR A 1 117 ? 4.065  17.366  26.639 1.00 24.96 ? 140 TYR A CD1 1 
ATOM   936  C  CD2 . TYR A 1 117 ? 6.270  18.301  26.642 1.00 24.99 ? 140 TYR A CD2 1 
ATOM   937  C  CE1 . TYR A 1 117 ? 3.791  18.011  25.452 1.00 27.61 ? 140 TYR A CE1 1 
ATOM   938  C  CE2 . TYR A 1 117 ? 6.001  18.952  25.439 1.00 22.39 ? 140 TYR A CE2 1 
ATOM   939  C  CZ  . TYR A 1 117 ? 4.754  18.800  24.855 1.00 25.50 ? 140 TYR A CZ  1 
ATOM   940  O  OH  . TYR A 1 117 ? 4.461  19.432  23.671 1.00 26.42 ? 140 TYR A OH  1 
ATOM   941  N  N   . PRO A 1 118 ? 4.571  16.932  32.174 1.00 19.27 ? 141 PRO A N   1 
ATOM   942  C  CA  . PRO A 1 118 ? 5.087  16.443  33.465 1.00 19.27 ? 141 PRO A CA  1 
ATOM   943  C  C   . PRO A 1 118 ? 5.087  14.940  33.598 1.00 19.75 ? 141 PRO A C   1 
ATOM   944  O  O   . PRO A 1 118 ? 5.857  14.407  34.407 1.00 19.89 ? 141 PRO A O   1 
ATOM   945  C  CB  . PRO A 1 118 ? 4.138  17.089  34.491 1.00 20.54 ? 141 PRO A CB  1 
ATOM   946  C  CG  . PRO A 1 118 ? 2.874  17.345  33.727 1.00 23.30 ? 141 PRO A CG  1 
ATOM   947  C  CD  . PRO A 1 118 ? 3.330  17.712  32.338 1.00 20.05 ? 141 PRO A CD  1 
ATOM   948  N  N   . LYS A 1 119 ? 4.271  14.238  32.826 1.00 19.69 ? 142 LYS A N   1 
ATOM   949  C  CA  . LYS A 1 119 ? 4.135  12.799  32.960 1.00 21.78 ? 142 LYS A CA  1 
ATOM   950  C  C   . LYS A 1 119 ? 4.840  12.022  31.859 1.00 17.88 ? 142 LYS A C   1 
ATOM   951  O  O   . LYS A 1 119 ? 4.784  10.793  31.872 1.00 20.76 ? 142 LYS A O   1 
ATOM   952  C  CB  . LYS A 1 119 ? 2.650  12.413  32.985 1.00 26.27 ? 142 LYS A CB  1 
ATOM   953  C  CG  . LYS A 1 119 ? 1.874  13.022  34.143 1.00 29.17 ? 142 LYS A CG  1 
ATOM   954  C  CD  . LYS A 1 119 ? 2.351  12.447  35.472 1.00 39.64 ? 142 LYS A CD  1 
ATOM   955  C  CE  . LYS A 1 119 ? 1.512  12.965  36.641 1.00 59.51 ? 142 LYS A CE  1 
ATOM   956  N  NZ  . LYS A 1 119 ? 0.059  12.671  36.467 1.00 59.46 ? 142 LYS A NZ  1 
ATOM   957  N  N   . THR A 1 120 ? 5.495  12.693  30.904 1.00 17.02 ? 143 THR A N   1 
ATOM   958  C  CA  . THR A 1 120 ? 6.173  11.983  29.821 1.00 16.86 ? 143 THR A CA  1 
ATOM   959  C  C   . THR A 1 120 ? 7.614  12.414  29.595 1.00 21.77 ? 143 THR A C   1 
ATOM   960  O  O   . THR A 1 120 ? 8.324  11.740  28.844 1.00 21.69 ? 143 THR A O   1 
ATOM   961  C  CB  . THR A 1 120 ? 5.410  12.140  28.491 1.00 21.10 ? 143 THR A CB  1 
ATOM   962  O  OG1 . THR A 1 120 ? 5.347  13.523  28.132 1.00 19.34 ? 143 THR A OG1 1 
ATOM   963  C  CG2 . THR A 1 120 ? 3.987  11.575  28.601 1.00 22.99 ? 143 THR A CG2 1 
ATOM   964  N  N   . LEU A 1 121 ? 8.071  13.498  30.209 1.00 17.45 ? 144 LEU A N   1 
ATOM   965  C  CA  . LEU A 1 121 ? 9.465  13.911  30.109 1.00 17.39 ? 144 LEU A CA  1 
ATOM   966  C  C   . LEU A 1 121 ? 10.052 13.894  31.509 1.00 16.05 ? 144 LEU A C   1 
ATOM   967  O  O   . LEU A 1 121 ? 9.494  14.510  32.423 1.00 16.11 ? 144 LEU A O   1 
ATOM   968  C  CB  . LEU A 1 121 ? 9.596  15.297  29.466 1.00 18.03 ? 144 LEU A CB  1 
ATOM   969  C  CG  . LEU A 1 121 ? 11.042 15.777  29.229 1.00 17.70 ? 144 LEU A CG  1 
ATOM   970  C  CD1 . LEU A 1 121 ? 11.172 16.403  27.833 1.00 17.82 ? 144 LEU A CD1 1 
ATOM   971  C  CD2 . LEU A 1 121 ? 11.431 16.791  30.317 1.00 17.30 ? 144 LEU A CD2 1 
ATOM   972  N  N   . PHE A 1 122 ? 11.151 13.158  31.687 1.00 14.72 ? 145 PHE A N   1 
ATOM   973  C  CA  . PHE A 1 122 ? 11.734 12.954  33.006 1.00 15.17 ? 145 PHE A CA  1 
ATOM   974  C  C   . PHE A 1 122 ? 13.198 13.369  33.018 1.00 16.25 ? 145 PHE A C   1 
ATOM   975  O  O   . PHE A 1 122 ? 13.918 13.161  32.041 1.00 13.99 ? 145 PHE A O   1 
ATOM   976  C  CB  . PHE A 1 122 ? 11.574 11.493  33.438 1.00 13.21 ? 145 PHE A CB  1 
ATOM   977  C  CG  . PHE A 1 122 ? 10.130 11.082  33.532 1.00 14.74 ? 145 PHE A CG  1 
ATOM   978  C  CD1 . PHE A 1 122 ? 9.382  11.425  34.649 1.00 15.96 ? 145 PHE A CD1 1 
ATOM   979  C  CD2 . PHE A 1 122 ? 9.504  10.440  32.476 1.00 20.70 ? 145 PHE A CD2 1 
ATOM   980  C  CE1 . PHE A 1 122 ? 8.035  11.077  34.742 1.00 20.87 ? 145 PHE A CE1 1 
ATOM   981  C  CE2 . PHE A 1 122 ? 8.155  10.081  32.563 1.00 22.87 ? 145 PHE A CE2 1 
ATOM   982  C  CZ  . PHE A 1 122 ? 7.427  10.400  33.691 1.00 23.75 ? 145 PHE A CZ  1 
ATOM   983  N  N   . LEU A 1 123 ? 13.618 13.955  34.134 1.00 13.27 ? 146 LEU A N   1 
ATOM   984  C  CA  . LEU A 1 123 ? 14.958 14.501  34.323 1.00 13.47 ? 146 LEU A CA  1 
ATOM   985  C  C   . LEU A 1 123 ? 15.561 13.894  35.576 1.00 12.68 ? 146 LEU A C   1 
ATOM   986  O  O   . LEU A 1 123 ? 14.942 13.951  36.645 1.00 12.76 ? 146 LEU A O   1 
ATOM   987  C  CB  . LEU A 1 123 ? 14.910 16.024  34.478 1.00 12.61 ? 146 LEU A CB  1 
ATOM   988  C  CG  . LEU A 1 123 ? 14.224 16.773  33.328 1.00 14.34 ? 146 LEU A CG  1 
ATOM   989  C  CD1 . LEU A 1 123 ? 14.015 18.257  33.707 1.00 15.24 ? 146 LEU A CD1 1 
ATOM   990  C  CD2 . LEU A 1 123 ? 15.060 16.649  32.069 1.00 13.50 ? 146 LEU A CD2 1 
ATOM   991  N  N   . LEU A 1 124 ? 16.756 13.315  35.452 1.00 12.28 ? 147 LEU A N   1 
ATOM   992  C  CA  . LEU A 1 124 ? 17.516 12.873  36.613 1.00 7.94  ? 147 LEU A CA  1 
ATOM   993  C  C   . LEU A 1 124 ? 18.619 13.880  36.948 1.00 11.66 ? 147 LEU A C   1 
ATOM   994  O  O   . LEU A 1 124 ? 18.993 14.739  36.139 1.00 11.43 ? 147 LEU A O   1 
ATOM   995  C  CB  . LEU A 1 124 ? 18.152 11.494  36.385 1.00 10.11 ? 147 LEU A CB  1 
ATOM   996  C  CG  . LEU A 1 124 ? 17.242 10.333  35.984 1.00 12.35 ? 147 LEU A CG  1 
ATOM   997  C  CD1 . LEU A 1 124 ? 18.073 9.047   36.038 1.00 10.55 ? 147 LEU A CD1 1 
ATOM   998  C  CD2 . LEU A 1 124 ? 16.040 10.245  36.924 1.00 14.28 ? 147 LEU A CD2 1 
ATOM   999  N  N   . ARG A 1 125 ? 19.175 13.724  38.148 1.00 12.40 ? 148 ARG A N   1 
ATOM   1000 C  CA  . ARG A 1 125 ? 20.301 14.537  38.579 1.00 11.47 ? 148 ARG A CA  1 
ATOM   1001 C  C   . ARG A 1 125 ? 21.624 13.949  38.082 1.00 13.19 ? 148 ARG A C   1 
ATOM   1002 O  O   . ARG A 1 125 ? 21.854 12.740  38.182 1.00 13.86 ? 148 ARG A O   1 
ATOM   1003 C  CB  . ARG A 1 125 ? 20.305 14.636  40.104 1.00 14.51 ? 148 ARG A CB  1 
ATOM   1004 C  CG  . ARG A 1 125 ? 21.154 15.780  40.628 1.00 12.02 ? 148 ARG A CG  1 
ATOM   1005 C  CD  . ARG A 1 125 ? 20.944 15.955  42.133 1.00 12.69 ? 148 ARG A CD  1 
ATOM   1006 N  NE  . ARG A 1 125 ? 21.451 17.251  42.571 1.00 14.80 ? 148 ARG A NE  1 
ATOM   1007 C  CZ  . ARG A 1 125 ? 21.333 17.719  43.810 1.00 14.72 ? 148 ARG A CZ  1 
ATOM   1008 N  NH1 . ARG A 1 125 ? 20.730 16.987  44.738 1.00 13.12 ? 148 ARG A NH1 1 
ATOM   1009 N  NH2 . ARG A 1 125 ? 21.831 18.920  44.117 1.00 15.13 ? 148 ARG A NH2 1 
ATOM   1010 N  N   . GLY A 1 126 ? 22.500 14.810  37.543 1.00 11.04 ? 149 GLY A N   1 
ATOM   1011 C  CA  . GLY A 1 126 ? 23.874 14.434  37.270 1.00 11.90 ? 149 GLY A CA  1 
ATOM   1012 C  C   . GLY A 1 126 ? 24.788 15.061  38.313 1.00 14.83 ? 149 GLY A C   1 
ATOM   1013 O  O   . GLY A 1 126 ? 24.353 15.863  39.137 1.00 13.04 ? 149 GLY A O   1 
ATOM   1014 N  N   . ASN A 1 127 ? 26.076 14.693  38.267 1.00 12.32 ? 150 ASN A N   1 
ATOM   1015 C  CA  . ASN A 1 127 ? 26.983 15.254  39.269 1.00 13.17 ? 150 ASN A CA  1 
ATOM   1016 C  C   . ASN A 1 127 ? 27.180 16.760  39.109 1.00 11.66 ? 150 ASN A C   1 
ATOM   1017 O  O   . ASN A 1 127 ? 27.518 17.432  40.097 1.00 13.84 ? 150 ASN A O   1 
ATOM   1018 C  CB  . ASN A 1 127 ? 28.346 14.537  39.269 1.00 12.64 ? 150 ASN A CB  1 
ATOM   1019 C  CG  . ASN A 1 127 ? 29.041 14.551  37.914 1.00 14.71 ? 150 ASN A CG  1 
ATOM   1020 O  OD1 . ASN A 1 127 ? 28.455 14.193  36.903 1.00 12.19 ? 150 ASN A OD1 1 
ATOM   1021 N  ND2 . ASN A 1 127 ? 30.327 14.915  37.906 1.00 13.57 ? 150 ASN A ND2 1 
ATOM   1022 N  N   . HIS A 1 128 ? 26.947 17.325  37.918 1.00 10.82 ? 151 HIS A N   1 
ATOM   1023 C  CA  . HIS A 1 128 ? 27.095 18.774  37.785 1.00 10.65 ? 151 HIS A CA  1 
ATOM   1024 C  C   . HIS A 1 128 ? 25.917 19.563  38.341 1.00 15.64 ? 151 HIS A C   1 
ATOM   1025 O  O   . HIS A 1 128 ? 26.034 20.785  38.507 1.00 15.39 ? 151 HIS A O   1 
ATOM   1026 C  CB  . HIS A 1 128 ? 27.302 19.172  36.321 1.00 13.87 ? 151 HIS A CB  1 
ATOM   1027 C  CG  . HIS A 1 128 ? 28.719 19.012  35.874 1.00 14.53 ? 151 HIS A CG  1 
ATOM   1028 N  ND1 . HIS A 1 128 ? 29.572 20.082  35.699 1.00 16.55 ? 151 HIS A ND1 1 
ATOM   1029 C  CD2 . HIS A 1 128 ? 29.452 17.899  35.634 1.00 14.29 ? 151 HIS A CD2 1 
ATOM   1030 C  CE1 . HIS A 1 128 ? 30.762 19.636  35.333 1.00 19.86 ? 151 HIS A CE1 1 
ATOM   1031 N  NE2 . HIS A 1 128 ? 30.715 18.314  35.283 1.00 17.43 ? 151 HIS A NE2 1 
ATOM   1032 N  N   . GLU A 1 129 ? 24.789 18.915  38.629 1.00 13.96 ? 152 GLU A N   1 
ATOM   1033 C  CA  . GLU A 1 129 ? 23.618 19.633  39.135 1.00 12.53 ? 152 GLU A CA  1 
ATOM   1034 C  C   . GLU A 1 129 ? 23.752 19.849  40.644 1.00 13.09 ? 152 GLU A C   1 
ATOM   1035 O  O   . GLU A 1 129 ? 22.984 19.320  41.452 1.00 13.45 ? 152 GLU A O   1 
ATOM   1036 C  CB  . GLU A 1 129 ? 22.341 18.873  38.798 1.00 13.51 ? 152 GLU A CB  1 
ATOM   1037 C  CG  . GLU A 1 129 ? 21.794 19.188  37.393 1.00 14.68 ? 152 GLU A CG  1 
ATOM   1038 C  CD  . GLU A 1 129 ? 22.604 18.515  36.298 1.00 14.48 ? 152 GLU A CD  1 
ATOM   1039 O  OE1 . GLU A 1 129 ? 22.817 17.282  36.376 1.00 15.31 ? 152 GLU A OE1 1 
ATOM   1040 O  OE2 . GLU A 1 129 ? 23.050 19.216  35.352 1.00 17.35 ? 152 GLU A OE2 1 
ATOM   1041 N  N   . CYS A 1 130 ? 24.753 20.649  41.022 1.00 13.79 ? 153 CYS A N   1 
ATOM   1042 C  CA  . CYS A 1 130 ? 24.997 20.903  42.436 1.00 13.14 ? 153 CYS A CA  1 
ATOM   1043 C  C   . CYS A 1 130 ? 25.726 22.231  42.602 1.00 17.06 ? 153 CYS A C   1 
ATOM   1044 O  O   . CYS A 1 130 ? 26.204 22.832  41.638 1.00 16.30 ? 153 CYS A O   1 
ATOM   1045 C  CB  . CYS A 1 130 ? 25.801 19.770  43.090 1.00 14.23 ? 153 CYS A CB  1 
ATOM   1046 S  SG  . CYS A 1 130 ? 27.527 19.674  42.545 1.00 17.65 ? 153 CYS A SG  1 
ATOM   1047 N  N   . ARG A 1 131 ? 25.819 22.665  43.863 1.00 13.07 ? 154 ARG A N   1 
ATOM   1048 C  CA  . ARG A 1 131 ? 26.451 23.942  44.177 1.00 14.52 ? 154 ARG A CA  1 
ATOM   1049 C  C   . ARG A 1 131 ? 27.959 23.885  43.952 1.00 15.35 ? 154 ARG A C   1 
ATOM   1050 O  O   . ARG A 1 131 ? 28.550 24.805  43.372 1.00 16.37 ? 154 ARG A O   1 
ATOM   1051 C  CB  . ARG A 1 131 ? 26.142 24.318  45.632 1.00 16.63 ? 154 ARG A CB  1 
ATOM   1052 C  CG  . ARG A 1 131 ? 24.661 24.637  45.884 1.00 15.29 ? 154 ARG A CG  1 
ATOM   1053 C  CD  . ARG A 1 131 ? 24.247 24.461  47.347 1.00 21.96 ? 154 ARG A CD  1 
ATOM   1054 N  NE  . ARG A 1 131 ? 22.801 24.658  47.478 1.00 18.24 ? 154 ARG A NE  1 
ATOM   1055 C  CZ  . ARG A 1 131 ? 21.904 23.689  47.336 1.00 18.57 ? 154 ARG A CZ  1 
ATOM   1056 N  NH1 . ARG A 1 131 ? 22.303 22.447  47.075 1.00 15.61 ? 154 ARG A NH1 1 
ATOM   1057 N  NH2 . ARG A 1 131 ? 20.608 23.962  47.439 1.00 19.35 ? 154 ARG A NH2 1 
ATOM   1058 N  N   . HIS A 1 132 ? 28.603 22.811  44.399 1.00 16.54 ? 155 HIS A N   1 
ATOM   1059 C  CA  A HIS A 1 132 ? 30.060 22.767  44.345 0.45 19.13 ? 155 HIS A CA  1 
ATOM   1060 C  CA  B HIS A 1 132 ? 30.060 22.753  44.346 0.55 19.13 ? 155 HIS A CA  1 
ATOM   1061 C  C   . HIS A 1 132 ? 30.570 22.856  42.911 1.00 17.77 ? 155 HIS A C   1 
ATOM   1062 O  O   . HIS A 1 132 ? 31.506 23.610  42.623 1.00 19.05 ? 155 HIS A O   1 
ATOM   1063 C  CB  A HIS A 1 132 ? 30.594 21.503  45.014 0.45 17.93 ? 155 HIS A CB  1 
ATOM   1064 C  CB  B HIS A 1 132 ? 30.559 21.470  45.015 0.55 17.91 ? 155 HIS A CB  1 
ATOM   1065 C  CG  A HIS A 1 132 ? 32.087 21.398  44.963 0.45 18.80 ? 155 HIS A CG  1 
ATOM   1066 C  CG  B HIS A 1 132 ? 30.607 21.550  46.511 0.55 20.58 ? 155 HIS A CG  1 
ATOM   1067 N  ND1 A HIS A 1 132 ? 32.917 22.363  45.495 0.45 24.65 ? 155 HIS A ND1 1 
ATOM   1068 N  ND1 B HIS A 1 132 ? 29.591 21.082  47.316 0.55 18.64 ? 155 HIS A ND1 1 
ATOM   1069 C  CD2 A HIS A 1 132 ? 32.901 20.462  44.419 0.45 22.17 ? 155 HIS A CD2 1 
ATOM   1070 C  CD2 B HIS A 1 132 ? 31.549 22.050  47.348 0.55 21.33 ? 155 HIS A CD2 1 
ATOM   1071 C  CE1 A HIS A 1 132 ? 34.176 22.019  45.294 0.45 17.44 ? 155 HIS A CE1 1 
ATOM   1072 C  CE1 B HIS A 1 132 ? 29.904 21.287  48.584 0.55 23.71 ? 155 HIS A CE1 1 
ATOM   1073 N  NE2 A HIS A 1 132 ? 34.194 20.869  44.643 0.45 17.25 ? 155 HIS A NE2 1 
ATOM   1074 N  NE2 B HIS A 1 132 ? 31.086 21.875  48.631 0.55 22.14 ? 155 HIS A NE2 1 
ATOM   1075 N  N   . LEU A 1 133 ? 29.965 22.095  41.991 1.00 16.14 ? 156 LEU A N   1 
ATOM   1076 C  CA  . LEU A 1 133 ? 30.497 22.063  40.630 1.00 16.66 ? 156 LEU A CA  1 
ATOM   1077 C  C   . LEU A 1 133 ? 30.101 23.296  39.829 1.00 17.92 ? 156 LEU A C   1 
ATOM   1078 O  O   . LEU A 1 133 ? 30.893 23.779  39.012 1.00 16.55 ? 156 LEU A O   1 
ATOM   1079 C  CB  . LEU A 1 133 ? 30.054 20.788  39.898 1.00 16.76 ? 156 LEU A CB  1 
ATOM   1080 C  CG  . LEU A 1 133 ? 31.110 19.678  39.930 1.00 16.55 ? 156 LEU A CG  1 
ATOM   1081 C  CD1 . LEU A 1 133 ? 31.386 19.237  41.367 1.00 22.16 ? 156 LEU A CD1 1 
ATOM   1082 C  CD2 . LEU A 1 133 ? 30.736 18.481  39.035 1.00 19.12 ? 156 LEU A CD2 1 
ATOM   1083 N  N   . THR A 1 134 ? 28.885 23.814  40.028 1.00 16.10 ? 157 THR A N   1 
ATOM   1084 C  CA  . THR A 1 134 ? 28.494 25.001  39.279 1.00 13.56 ? 157 THR A CA  1 
ATOM   1085 C  C   . THR A 1 134 ? 29.227 26.238  39.769 1.00 18.28 ? 157 THR A C   1 
ATOM   1086 O  O   . THR A 1 134 ? 29.344 27.210  39.017 1.00 18.72 ? 157 THR A O   1 
ATOM   1087 C  CB  . THR A 1 134 ? 26.991 25.250  39.360 1.00 13.94 ? 157 THR A CB  1 
ATOM   1088 O  OG1 . THR A 1 134 ? 26.591 25.328  40.738 1.00 14.07 ? 157 THR A OG1 1 
ATOM   1089 C  CG2 . THR A 1 134 ? 26.223 24.113  38.638 1.00 12.26 ? 157 THR A CG2 1 
ATOM   1090 N  N   . GLU A 1 135 ? 29.713 26.213  41.011 1.00 18.41 ? 158 GLU A N   1 
ATOM   1091 C  CA  . GLU A 1 135 ? 30.604 27.262  41.499 1.00 24.35 ? 158 GLU A CA  1 
ATOM   1092 C  C   . GLU A 1 135 ? 31.997 27.115  40.902 1.00 23.01 ? 158 GLU A C   1 
ATOM   1093 O  O   . GLU A 1 135 ? 32.645 28.116  40.573 1.00 22.97 ? 158 GLU A O   1 
ATOM   1094 C  CB  . GLU A 1 135 ? 30.652 27.224  43.033 1.00 21.38 ? 158 GLU A CB  1 
ATOM   1095 C  CG  . GLU A 1 135 ? 31.992 27.627  43.646 1.00 47.27 ? 158 GLU A CG  1 
ATOM   1096 C  CD  . GLU A 1 135 ? 32.073 29.098  44.002 1.00 51.61 ? 158 GLU A CD  1 
ATOM   1097 O  OE1 . GLU A 1 135 ? 32.218 29.411  45.203 1.00 58.73 ? 158 GLU A OE1 1 
ATOM   1098 O  OE2 . GLU A 1 135 ? 31.989 29.943  43.085 1.00 69.09 ? 158 GLU A OE2 1 
ATOM   1099 N  N   . TYR A 1 136 ? 32.465 25.875  40.738 1.00 19.26 ? 159 TYR A N   1 
ATOM   1100 C  CA  . TYR A 1 136 ? 33.816 25.646  40.228 1.00 22.62 ? 159 TYR A CA  1 
ATOM   1101 C  C   . TYR A 1 136 ? 33.890 25.899  38.725 1.00 27.65 ? 159 TYR A C   1 
ATOM   1102 O  O   . TYR A 1 136 ? 34.835 26.530  38.238 1.00 25.00 ? 159 TYR A O   1 
ATOM   1103 C  CB  . TYR A 1 136 ? 34.261 24.222  40.574 1.00 22.29 ? 159 TYR A CB  1 
ATOM   1104 C  CG  . TYR A 1 136 ? 35.626 23.847  40.049 1.00 28.73 ? 159 TYR A CG  1 
ATOM   1105 C  CD1 . TYR A 1 136 ? 36.772 24.110  40.790 1.00 42.09 ? 159 TYR A CD1 1 
ATOM   1106 C  CD2 . TYR A 1 136 ? 35.770 23.223  38.815 1.00 31.31 ? 159 TYR A CD2 1 
ATOM   1107 C  CE1 . TYR A 1 136 ? 38.032 23.763  40.313 1.00 40.45 ? 159 TYR A CE1 1 
ATOM   1108 C  CE2 . TYR A 1 136 ? 37.021 22.873  38.328 1.00 42.50 ? 159 TYR A CE2 1 
ATOM   1109 C  CZ  . TYR A 1 136 ? 38.149 23.147  39.084 1.00 52.45 ? 159 TYR A CZ  1 
ATOM   1110 O  OH  . TYR A 1 136 ? 39.395 22.803  38.608 1.00 60.21 ? 159 TYR A OH  1 
ATOM   1111 N  N   . PHE A 1 137 ? 32.906 25.412  37.967 1.00 19.56 ? 160 PHE A N   1 
ATOM   1112 C  CA  . PHE A 1 137 ? 32.820 25.728  36.546 1.00 20.11 ? 160 PHE A CA  1 
ATOM   1113 C  C   . PHE A 1 137 ? 32.090 27.059  36.375 1.00 20.43 ? 160 PHE A C   1 
ATOM   1114 O  O   . PHE A 1 137 ? 32.182 27.925  37.251 1.00 25.07 ? 160 PHE A O   1 
ATOM   1115 C  CB  . PHE A 1 137 ? 32.140 24.586  35.777 1.00 19.15 ? 160 PHE A CB  1 
ATOM   1116 C  CG  . PHE A 1 137 ? 32.937 23.296  35.783 1.00 21.18 ? 160 PHE A CG  1 
ATOM   1117 C  CD1 . PHE A 1 137 ? 33.892 23.054  34.807 1.00 29.61 ? 160 PHE A CD1 1 
ATOM   1118 C  CD2 . PHE A 1 137 ? 32.738 22.337  36.774 1.00 20.93 ? 160 PHE A CD2 1 
ATOM   1119 C  CE1 . PHE A 1 137 ? 34.632 21.882  34.811 1.00 27.53 ? 160 PHE A CE1 1 
ATOM   1120 C  CE2 . PHE A 1 137 ? 33.477 21.166  36.786 1.00 23.01 ? 160 PHE A CE2 1 
ATOM   1121 C  CZ  . PHE A 1 137 ? 34.422 20.937  35.804 1.00 25.68 ? 160 PHE A CZ  1 
ATOM   1122 N  N   . THR A 1 138 ? 31.358 27.248  35.277 1.00 22.47 ? 161 THR A N   1 
ATOM   1123 C  CA  . THR A 1 138 ? 30.891 28.583  34.931 1.00 25.90 ? 161 THR A CA  1 
ATOM   1124 C  C   . THR A 1 138 ? 29.423 28.854  35.245 1.00 31.11 ? 161 THR A C   1 
ATOM   1125 O  O   . THR A 1 138 ? 29.004 30.012  35.161 1.00 23.09 ? 161 THR A O   1 
ATOM   1126 C  CB  . THR A 1 138 ? 31.129 28.865  33.439 1.00 24.45 ? 161 THR A CB  1 
ATOM   1127 O  OG1 . THR A 1 138 ? 30.420 27.900  32.650 1.00 26.28 ? 161 THR A OG1 1 
ATOM   1128 C  CG2 . THR A 1 138 ? 32.624 28.813  33.109 1.00 28.93 ? 161 THR A CG2 1 
ATOM   1129 N  N   . PHE A 1 139 ? 28.628 27.842  35.604 1.00 21.05 ? 162 PHE A N   1 
ATOM   1130 C  CA  . PHE A 1 139 ? 27.183 28.062  35.662 1.00 20.32 ? 162 PHE A CA  1 
ATOM   1131 C  C   . PHE A 1 139 ? 26.814 29.149  36.671 1.00 21.85 ? 162 PHE A C   1 
ATOM   1132 O  O   . PHE A 1 139 ? 25.964 30.002  36.386 1.00 23.18 ? 162 PHE A O   1 
ATOM   1133 C  CB  . PHE A 1 139 ? 26.458 26.755  35.981 1.00 17.31 ? 162 PHE A CB  1 
ATOM   1134 C  CG  . PHE A 1 139 ? 24.956 26.875  35.970 1.00 17.73 ? 162 PHE A CG  1 
ATOM   1135 C  CD1 . PHE A 1 139 ? 24.284 27.252  34.808 1.00 19.30 ? 162 PHE A CD1 1 
ATOM   1136 C  CD2 . PHE A 1 139 ? 24.215 26.599  37.109 1.00 16.27 ? 162 PHE A CD2 1 
ATOM   1137 C  CE1 . PHE A 1 139 ? 22.891 27.352  34.783 1.00 19.81 ? 162 PHE A CE1 1 
ATOM   1138 C  CE2 . PHE A 1 139 ? 22.812 26.703  37.092 1.00 18.35 ? 162 PHE A CE2 1 
ATOM   1139 C  CZ  . PHE A 1 139 ? 22.157 27.076  35.928 1.00 17.93 ? 162 PHE A CZ  1 
ATOM   1140 N  N   . LYS A 1 140 ? 27.433 29.136  37.853 1.00 19.88 ? 163 LYS A N   1 
ATOM   1141 C  CA  . LYS A 1 140 ? 27.094 30.132  38.868 1.00 21.71 ? 163 LYS A CA  1 
ATOM   1142 C  C   . LYS A 1 140 ? 27.333 31.544  38.363 1.00 25.58 ? 163 LYS A C   1 
ATOM   1143 O  O   . LYS A 1 140 ? 26.516 32.442  38.597 1.00 26.50 ? 163 LYS A O   1 
ATOM   1144 C  CB  . LYS A 1 140 ? 27.895 29.905  40.150 1.00 26.05 ? 163 LYS A CB  1 
ATOM   1145 C  CG  . LYS A 1 140 ? 27.678 31.021  41.191 1.00 27.87 ? 163 LYS A CG  1 
ATOM   1146 C  CD  . LYS A 1 140 ? 28.089 30.587  42.586 1.00 28.35 ? 163 LYS A CD  1 
ATOM   1147 C  CE  . LYS A 1 140 ? 27.879 31.717  43.597 1.00 41.26 ? 163 LYS A CE  1 
ATOM   1148 N  NZ  . LYS A 1 140 ? 28.150 31.271  44.990 1.00 39.24 ? 163 LYS A NZ  1 
ATOM   1149 N  N   . GLN A 1 141 ? 28.450 31.758  37.668 1.00 28.39 ? 164 GLN A N   1 
ATOM   1150 C  CA  . GLN A 1 141 ? 28.757 33.081  37.138 1.00 29.61 ? 164 GLN A CA  1 
ATOM   1151 C  C   . GLN A 1 141 ? 27.781 33.474  36.036 1.00 31.61 ? 164 GLN A C   1 
ATOM   1152 O  O   . GLN A 1 141 ? 27.306 34.614  36.000 1.00 29.90 ? 164 GLN A O   1 
ATOM   1153 C  CB  . GLN A 1 141 ? 30.202 33.108  36.638 1.00 32.42 ? 164 GLN A CB  1 
ATOM   1154 C  CG  . GLN A 1 141 ? 31.228 33.071  37.774 1.00 39.42 ? 164 GLN A CG  1 
ATOM   1155 C  CD  . GLN A 1 141 ? 32.596 32.568  37.333 1.00 50.95 ? 164 GLN A CD  1 
ATOM   1156 O  OE1 . GLN A 1 141 ? 32.732 31.437  36.858 1.00 40.55 ? 164 GLN A OE1 1 
ATOM   1157 N  NE2 . GLN A 1 141 ? 33.620 33.408  37.496 1.00 44.74 ? 164 GLN A NE2 1 
ATOM   1158 N  N   . GLU A 1 142 ? 27.447 32.538  35.146 1.00 26.90 ? 165 GLU A N   1 
ATOM   1159 C  CA  . GLU A 1 142 ? 26.508 32.840  34.069 1.00 26.59 ? 165 GLU A CA  1 
ATOM   1160 C  C   . GLU A 1 142 ? 25.135 33.228  34.609 1.00 26.57 ? 165 GLU A C   1 
ATOM   1161 O  O   . GLU A 1 142 ? 24.505 34.164  34.101 1.00 31.92 ? 165 GLU A O   1 
ATOM   1162 C  CB  . GLU A 1 142 ? 26.394 31.645  33.131 1.00 26.01 ? 165 GLU A CB  1 
ATOM   1163 C  CG  . GLU A 1 142 ? 27.708 31.235  32.521 1.00 30.83 ? 165 GLU A CG  1 
ATOM   1164 C  CD  . GLU A 1 142 ? 27.677 29.816  31.980 1.00 39.02 ? 165 GLU A CD  1 
ATOM   1165 O  OE1 . GLU A 1 142 ? 26.638 29.138  32.149 1.00 31.77 ? 165 GLU A OE1 1 
ATOM   1166 O  OE2 . GLU A 1 142 ? 28.690 29.379  31.392 1.00 34.05 ? 165 GLU A OE2 1 
ATOM   1167 N  N   . CYS A 1 143 ? 24.654 32.524  35.639 1.00 23.71 ? 166 CYS A N   1 
ATOM   1168 C  CA  . CYS A 1 143 ? 23.371 32.877  36.245 1.00 20.67 ? 166 CYS A CA  1 
ATOM   1169 C  C   . CYS A 1 143 ? 23.379 34.307  36.766 1.00 34.47 ? 166 CYS A C   1 
ATOM   1170 O  O   . CYS A 1 143 ? 22.448 35.081  36.506 1.00 31.04 ? 166 CYS A O   1 
ATOM   1171 C  CB  . CYS A 1 143 ? 23.045 31.927  37.389 1.00 22.28 ? 166 CYS A CB  1 
ATOM   1172 S  SG  . CYS A 1 143 ? 22.489 30.328  36.849 1.00 26.35 ? 166 CYS A SG  1 
ATOM   1173 N  N   . LYS A 1 144 ? 24.406 34.654  37.549 1.00 31.53 ? 167 LYS A N   1 
ATOM   1174 C  CA  . LYS A 1 144 ? 24.507 35.995  38.119 1.00 30.76 ? 167 LYS A CA  1 
ATOM   1175 C  C   . LYS A 1 144 ? 24.574 37.054  37.027 1.00 36.38 ? 167 LYS A C   1 
ATOM   1176 O  O   . LYS A 1 144 ? 23.992 38.137  37.166 1.00 42.63 ? 167 LYS A O   1 
ATOM   1177 C  CB  . LYS A 1 144 ? 25.744 36.100  39.013 1.00 29.21 ? 167 LYS A CB  1 
ATOM   1178 C  CG  . LYS A 1 144 ? 25.702 35.319  40.304 1.00 43.16 ? 167 LYS A CG  1 
ATOM   1179 C  CD  . LYS A 1 144 ? 26.924 35.677  41.137 1.00 47.39 ? 167 LYS A CD  1 
ATOM   1180 C  CE  . LYS A 1 144 ? 26.746 35.311  42.595 1.00 54.00 ? 167 LYS A CE  1 
ATOM   1181 N  NZ  . LYS A 1 144 ? 27.799 35.950  43.439 1.00 59.85 ? 167 LYS A NZ  1 
ATOM   1182 N  N   . ILE A 1 145 ? 25.295 36.764  35.943 1.00 29.03 ? 168 ILE A N   1 
ATOM   1183 C  CA  . ILE A 1 145 ? 25.421 37.714  34.840 1.00 26.82 ? 168 ILE A CA  1 
ATOM   1184 C  C   . ILE A 1 145 ? 24.075 37.934  34.162 1.00 36.37 ? 168 ILE A C   1 
ATOM   1185 O  O   . ILE A 1 145 ? 23.538 39.047  34.155 1.00 33.91 ? 168 ILE A O   1 
ATOM   1186 C  CB  . ILE A 1 145 ? 26.470 37.224  33.825 1.00 29.01 ? 168 ILE A CB  1 
ATOM   1187 C  CG1 . ILE A 1 145 ? 27.872 37.225  34.445 1.00 32.23 ? 168 ILE A CG1 1 
ATOM   1188 C  CG2 . ILE A 1 145 ? 26.426 38.062  32.556 1.00 32.76 ? 168 ILE A CG2 1 
ATOM   1189 C  CD1 . ILE A 1 145 ? 28.141 38.392  35.364 1.00 37.62 ? 168 ILE A CD1 1 
ATOM   1190 N  N   . LYS A 1 146 ? 23.517 36.872  33.570 1.00 26.64 ? 169 LYS A N   1 
ATOM   1191 C  CA  . LYS A 1 146 ? 22.323 36.985  32.734 1.00 31.43 ? 169 LYS A CA  1 
ATOM   1192 C  C   . LYS A 1 146 ? 21.052 37.192  33.536 1.00 33.71 ? 169 LYS A C   1 
ATOM   1193 O  O   . LYS A 1 146 ? 20.072 37.724  33.000 1.00 33.47 ? 169 LYS A O   1 
ATOM   1194 C  CB  . LYS A 1 146 ? 22.170 35.735  31.870 1.00 32.20 ? 169 LYS A CB  1 
ATOM   1195 C  CG  . LYS A 1 146 ? 23.362 35.469  31.001 1.00 30.76 ? 169 LYS A CG  1 
ATOM   1196 C  CD  . LYS A 1 146 ? 23.107 34.308  30.066 1.00 28.12 ? 169 LYS A CD  1 
ATOM   1197 C  CE  . LYS A 1 146 ? 24.088 34.360  28.915 1.00 31.55 ? 169 LYS A CE  1 
ATOM   1198 N  NZ  . LYS A 1 146 ? 24.016 33.163  28.048 1.00 27.08 ? 169 LYS A NZ  1 
ATOM   1199 N  N   . TYR A 1 147 ? 21.044 36.775  34.795 1.00 25.38 ? 170 TYR A N   1 
ATOM   1200 C  CA  . TYR A 1 147 ? 19.860 36.897  35.622 1.00 26.75 ? 170 TYR A CA  1 
ATOM   1201 C  C   . TYR A 1 147 ? 20.246 37.465  36.976 1.00 36.84 ? 170 TYR A C   1 
ATOM   1202 O  O   . TYR A 1 147 ? 20.399 38.682  37.112 1.00 41.14 ? 170 TYR A O   1 
ATOM   1203 C  CB  . TYR A 1 147 ? 19.150 35.541  35.720 1.00 24.26 ? 170 TYR A CB  1 
ATOM   1204 C  CG  . TYR A 1 147 ? 18.523 35.177  34.393 1.00 28.51 ? 170 TYR A CG  1 
ATOM   1205 C  CD1 . TYR A 1 147 ? 17.304 35.731  34.003 1.00 23.37 ? 170 TYR A CD1 1 
ATOM   1206 C  CD2 . TYR A 1 147 ? 19.166 34.326  33.509 1.00 25.38 ? 170 TYR A CD2 1 
ATOM   1207 C  CE1 . TYR A 1 147 ? 16.737 35.425  32.772 1.00 24.46 ? 170 TYR A CE1 1 
ATOM   1208 C  CE2 . TYR A 1 147 ? 18.606 34.009  32.282 1.00 20.04 ? 170 TYR A CE2 1 
ATOM   1209 C  CZ  . TYR A 1 147 ? 17.388 34.559  31.919 1.00 25.17 ? 170 TYR A CZ  1 
ATOM   1210 O  OH  . TYR A 1 147 ? 16.833 34.248  30.691 1.00 23.44 ? 170 TYR A OH  1 
ATOM   1211 N  N   . SER A 1 148 ? 20.429 36.614  37.975 1.00 33.44 ? 171 SER A N   1 
ATOM   1212 C  CA  . SER A 1 148 ? 20.755 37.109  39.305 1.00 35.50 ? 171 SER A CA  1 
ATOM   1213 C  C   . SER A 1 148 ? 21.154 35.928  40.170 1.00 35.50 ? 171 SER A C   1 
ATOM   1214 O  O   . SER A 1 148 ? 20.958 34.767  39.803 1.00 31.80 ? 171 SER A O   1 
ATOM   1215 C  CB  . SER A 1 148 ? 19.578 37.845  39.942 1.00 32.99 ? 171 SER A CB  1 
ATOM   1216 O  OG  . SER A 1 148 ? 18.543 36.932  40.253 1.00 33.02 ? 171 SER A OG  1 
ATOM   1217 N  N   . GLU A 1 149 ? 21.695 36.249  41.342 1.00 30.69 ? 172 GLU A N   1 
ATOM   1218 C  CA  . GLU A 1 149 ? 21.994 35.223  42.327 1.00 31.56 ? 172 GLU A CA  1 
ATOM   1219 C  C   . GLU A 1 149 ? 20.726 34.533  42.813 1.00 32.29 ? 172 GLU A C   1 
ATOM   1220 O  O   . GLU A 1 149 ? 20.763 33.345  43.148 1.00 29.93 ? 172 GLU A O   1 
ATOM   1221 C  CB  . GLU A 1 149 ? 22.758 35.842  43.493 1.00 33.49 ? 172 GLU A CB  1 
ATOM   1222 C  CG  . GLU A 1 149 ? 23.292 34.850  44.509 1.00 50.99 ? 172 GLU A CG  1 
ATOM   1223 C  CD  . GLU A 1 149 ? 24.189 35.516  45.541 1.00 73.98 ? 172 GLU A CD  1 
ATOM   1224 O  OE1 . GLU A 1 149 ? 24.363 36.755  45.473 1.00 86.00 ? 172 GLU A OE1 1 
ATOM   1225 O  OE2 . GLU A 1 149 ? 24.722 34.804  46.418 1.00 70.53 ? 172 GLU A OE2 1 
ATOM   1226 N  N   . ARG A 1 150 ? 19.597 35.253  42.852 1.00 27.63 ? 173 ARG A N   1 
ATOM   1227 C  CA  . ARG A 1 150 ? 18.332 34.616  43.204 1.00 28.80 ? 173 ARG A CA  1 
ATOM   1228 C  C   . ARG A 1 150 ? 17.968 33.536  42.194 1.00 25.32 ? 173 ARG A C   1 
ATOM   1229 O  O   . ARG A 1 150 ? 17.422 32.489  42.563 1.00 25.52 ? 173 ARG A O   1 
ATOM   1230 C  CB  . ARG A 1 150 ? 17.215 35.660  43.295 1.00 33.71 ? 173 ARG A CB  1 
ATOM   1231 N  N   . VAL A 1 151 ? 18.256 33.776  40.915 1.00 24.59 ? 174 VAL A N   1 
ATOM   1232 C  CA  . VAL A 1 151 ? 17.995 32.760  39.904 1.00 24.22 ? 174 VAL A CA  1 
ATOM   1233 C  C   . VAL A 1 151 ? 18.954 31.584  40.060 1.00 29.79 ? 174 VAL A C   1 
ATOM   1234 O  O   . VAL A 1 151 ? 18.558 30.421  39.908 1.00 21.18 ? 174 VAL A O   1 
ATOM   1235 C  CB  . VAL A 1 151 ? 18.066 33.372  38.497 1.00 25.89 ? 174 VAL A CB  1 
ATOM   1236 C  CG1 . VAL A 1 151 ? 18.269 32.276  37.452 1.00 22.41 ? 174 VAL A CG1 1 
ATOM   1237 C  CG2 . VAL A 1 151 ? 16.775 34.126  38.208 1.00 27.68 ? 174 VAL A CG2 1 
ATOM   1238 N  N   . TYR A 1 152 ? 20.224 31.858  40.372 1.00 26.51 ? 175 TYR A N   1 
ATOM   1239 C  CA  . TYR A 1 152 ? 21.155 30.770  40.661 1.00 23.56 ? 175 TYR A CA  1 
ATOM   1240 C  C   . TYR A 1 152 ? 20.672 29.944  41.846 1.00 23.98 ? 175 TYR A C   1 
ATOM   1241 O  O   . TYR A 1 152 ? 20.631 28.707  41.784 1.00 17.89 ? 175 TYR A O   1 
ATOM   1242 C  CB  . TYR A 1 152 ? 22.561 31.321  40.922 1.00 21.72 ? 175 TYR A CB  1 
ATOM   1243 C  CG  . TYR A 1 152 ? 23.546 30.254  41.364 1.00 22.81 ? 175 TYR A CG  1 
ATOM   1244 C  CD1 . TYR A 1 152 ? 24.039 29.321  40.459 1.00 19.44 ? 175 TYR A CD1 1 
ATOM   1245 C  CD2 . TYR A 1 152 ? 23.965 30.166  42.691 1.00 23.10 ? 175 TYR A CD2 1 
ATOM   1246 C  CE1 . TYR A 1 152 ? 24.939 28.330  40.864 1.00 18.44 ? 175 TYR A CE1 1 
ATOM   1247 C  CE2 . TYR A 1 152 ? 24.870 29.177  43.104 1.00 20.88 ? 175 TYR A CE2 1 
ATOM   1248 C  CZ  . TYR A 1 152 ? 25.352 28.267  42.182 1.00 22.66 ? 175 TYR A CZ  1 
ATOM   1249 O  OH  . TYR A 1 152 ? 26.243 27.285  42.584 1.00 19.62 ? 175 TYR A OH  1 
ATOM   1250 N  N   . ASP A 1 153 ? 20.295 30.614  42.938 1.00 19.55 ? 176 ASP A N   1 
ATOM   1251 C  CA  . ASP A 1 153 ? 19.817 29.905  44.121 1.00 25.61 ? 176 ASP A CA  1 
ATOM   1252 C  C   . ASP A 1 153 ? 18.576 29.075  43.810 1.00 18.49 ? 176 ASP A C   1 
ATOM   1253 O  O   . ASP A 1 153 ? 18.407 27.974  44.348 1.00 21.60 ? 176 ASP A O   1 
ATOM   1254 C  CB  . ASP A 1 153 ? 19.518 30.900  45.245 1.00 27.66 ? 176 ASP A CB  1 
ATOM   1255 C  CG  . ASP A 1 153 ? 20.775 31.512  45.843 1.00 38.90 ? 176 ASP A CG  1 
ATOM   1256 O  OD1 . ASP A 1 153 ? 21.892 31.048  45.514 1.00 34.04 ? 176 ASP A OD1 1 
ATOM   1257 O  OD2 . ASP A 1 153 ? 20.640 32.461  46.649 1.00 42.07 ? 176 ASP A OD2 1 
ATOM   1258 N  N   . ALA A 1 154 ? 17.690 29.592  42.954 1.00 23.40 ? 177 ALA A N   1 
ATOM   1259 C  CA  . ALA A 1 154 ? 16.497 28.837  42.581 1.00 21.93 ? 177 ALA A CA  1 
ATOM   1260 C  C   . ALA A 1 154 ? 16.870 27.578  41.800 1.00 18.01 ? 177 ALA A C   1 
ATOM   1261 O  O   . ALA A 1 154 ? 16.269 26.513  42.000 1.00 17.65 ? 177 ALA A O   1 
ATOM   1262 C  CB  . ALA A 1 154 ? 15.557 29.717  41.762 1.00 21.84 ? 177 ALA A CB  1 
ATOM   1263 N  N   . CYS A 1 155 ? 17.860 27.689  40.907 1.00 15.17 ? 178 CYS A N   1 
ATOM   1264 C  CA  . CYS A 1 155 ? 18.351 26.518  40.184 1.00 17.04 ? 178 CYS A CA  1 
ATOM   1265 C  C   . CYS A 1 155 ? 18.953 25.498  41.135 1.00 15.70 ? 178 CYS A C   1 
ATOM   1266 O  O   . CYS A 1 155 ? 18.741 24.288  40.976 1.00 15.36 ? 178 CYS A O   1 
ATOM   1267 C  CB  . CYS A 1 155 ? 19.387 26.931  39.141 1.00 15.39 ? 178 CYS A CB  1 
ATOM   1268 S  SG  . CYS A 1 155 ? 18.715 27.727  37.706 1.00 19.69 ? 178 CYS A SG  1 
ATOM   1269 N  N   . MET A 1 156 ? 19.710 25.966  42.134 1.00 14.94 ? 179 MET A N   1 
ATOM   1270 C  CA  . MET A 1 156 ? 20.298 25.042  43.097 1.00 14.87 ? 179 MET A CA  1 
ATOM   1271 C  C   . MET A 1 156 ? 19.217 24.319  43.882 1.00 18.01 ? 179 MET A C   1 
ATOM   1272 O  O   . MET A 1 156 ? 19.300 23.105  44.086 1.00 15.02 ? 179 MET A O   1 
ATOM   1273 C  CB  . MET A 1 156 ? 21.251 25.786  44.035 1.00 17.43 ? 179 MET A CB  1 
ATOM   1274 C  CG  . MET A 1 156 ? 22.468 26.385  43.322 1.00 17.51 ? 179 MET A CG  1 
ATOM   1275 S  SD  . MET A 1 156 ? 23.437 25.121  42.415 1.00 17.42 ? 179 MET A SD  1 
ATOM   1276 C  CE  . MET A 1 156 ? 22.958 25.489  40.731 1.00 13.28 ? 179 MET A CE  1 
ATOM   1277 N  N   . ASP A 1 157 ? 18.189 25.047  44.330 1.00 18.70 ? 180 ASP A N   1 
ATOM   1278 C  CA  . ASP A 1 157 ? 17.069 24.393  44.997 1.00 19.00 ? 180 ASP A CA  1 
ATOM   1279 C  C   . ASP A 1 157 ? 16.329 23.453  44.046 1.00 15.37 ? 180 ASP A C   1 
ATOM   1280 O  O   . ASP A 1 157 ? 15.880 22.375  44.455 1.00 16.54 ? 180 ASP A O   1 
ATOM   1281 C  CB  . ASP A 1 157 ? 16.101 25.441  45.561 1.00 24.97 ? 180 ASP A CB  1 
ATOM   1282 C  CG  . ASP A 1 157 ? 16.716 26.277  46.684 1.00 31.10 ? 180 ASP A CG  1 
ATOM   1283 O  OD1 . ASP A 1 157 ? 17.601 25.772  47.407 1.00 30.71 ? 180 ASP A OD1 1 
ATOM   1284 O  OD2 . ASP A 1 157 ? 16.309 27.447  46.835 1.00 35.15 ? 180 ASP A OD2 1 
ATOM   1285 N  N   . ALA A 1 158 ? 16.178 23.851  42.778 1.00 14.27 ? 181 ALA A N   1 
ATOM   1286 C  CA  . ALA A 1 158 ? 15.512 22.972  41.817 1.00 16.63 ? 181 ALA A CA  1 
ATOM   1287 C  C   . ALA A 1 158 ? 16.322 21.708  41.582 1.00 16.36 ? 181 ALA A C   1 
ATOM   1288 O  O   . ALA A 1 158 ? 15.757 20.610  41.493 1.00 15.25 ? 181 ALA A O   1 
ATOM   1289 C  CB  . ALA A 1 158 ? 15.272 23.699  40.496 1.00 12.96 ? 181 ALA A CB  1 
ATOM   1290 N  N   . PHE A 1 159 ? 17.647 21.841  41.468 1.00 15.23 ? 182 PHE A N   1 
ATOM   1291 C  CA  . PHE A 1 159 ? 18.491 20.663  41.272 1.00 17.13 ? 182 PHE A CA  1 
ATOM   1292 C  C   . PHE A 1 159 ? 18.368 19.684  42.438 1.00 16.01 ? 182 PHE A C   1 
ATOM   1293 O  O   . PHE A 1 159 ? 18.389 18.463  42.232 1.00 14.49 ? 182 PHE A O   1 
ATOM   1294 C  CB  . PHE A 1 159 ? 19.955 21.078  41.083 1.00 11.39 ? 182 PHE A CB  1 
ATOM   1295 C  CG  . PHE A 1 159 ? 20.243 21.784  39.771 1.00 13.04 ? 182 PHE A CG  1 
ATOM   1296 C  CD1 . PHE A 1 159 ? 19.292 21.854  38.767 1.00 13.74 ? 182 PHE A CD1 1 
ATOM   1297 C  CD2 . PHE A 1 159 ? 21.484 22.363  39.549 1.00 11.70 ? 182 PHE A CD2 1 
ATOM   1298 C  CE1 . PHE A 1 159 ? 19.557 22.499  37.568 1.00 15.73 ? 182 PHE A CE1 1 
ATOM   1299 C  CE2 . PHE A 1 159 ? 21.770 23.007  38.351 1.00 16.06 ? 182 PHE A CE2 1 
ATOM   1300 C  CZ  . PHE A 1 159 ? 20.804 23.075  37.350 1.00 17.86 ? 182 PHE A CZ  1 
ATOM   1301 N  N   . ASP A 1 160 ? 18.249 20.201  43.674 1.00 12.44 ? 183 ASP A N   1 
ATOM   1302 C  CA  . ASP A 1 160 ? 18.026 19.345  44.838 1.00 16.29 ? 183 ASP A CA  1 
ATOM   1303 C  C   . ASP A 1 160 ? 16.791 18.474  44.663 1.00 15.03 ? 183 ASP A C   1 
ATOM   1304 O  O   . ASP A 1 160 ? 16.704 17.400  45.264 1.00 15.25 ? 183 ASP A O   1 
ATOM   1305 C  CB  . ASP A 1 160 ? 17.845 20.179  46.121 1.00 17.05 ? 183 ASP A CB  1 
ATOM   1306 C  CG  . ASP A 1 160 ? 19.136 20.812  46.633 1.00 24.98 ? 183 ASP A CG  1 
ATOM   1307 O  OD1 . ASP A 1 160 ? 20.238 20.537  46.105 1.00 19.78 ? 183 ASP A OD1 1 
ATOM   1308 O  OD2 . ASP A 1 160 ? 19.035 21.601  47.600 1.00 21.31 ? 183 ASP A OD2 1 
ATOM   1309 N  N   . CYS A 1 161 ? 15.813 18.940  43.887 1.00 15.77 ? 184 CYS A N   1 
ATOM   1310 C  CA  . CYS A 1 161 ? 14.576 18.195  43.672 1.00 16.41 ? 184 CYS A CA  1 
ATOM   1311 C  C   . CYS A 1 161 ? 14.697 17.121  42.601 1.00 13.27 ? 184 CYS A C   1 
ATOM   1312 O  O   . CYS A 1 161 ? 13.798 16.277  42.503 1.00 12.75 ? 184 CYS A O   1 
ATOM   1313 C  CB  . CYS A 1 161 ? 13.444 19.149  43.279 1.00 14.86 ? 184 CYS A CB  1 
ATOM   1314 S  SG  . CYS A 1 161 ? 13.067 20.394  44.550 1.00 20.93 ? 184 CYS A SG  1 
ATOM   1315 N  N   . LEU A 1 162 ? 15.775 17.118  41.813 1.00 15.31 ? 185 LEU A N   1 
ATOM   1316 C  CA  . LEU A 1 162 ? 15.894 16.147  40.723 1.00 12.44 ? 185 LEU A CA  1 
ATOM   1317 C  C   . LEU A 1 162 ? 15.906 14.718  41.262 1.00 12.54 ? 185 LEU A C   1 
ATOM   1318 O  O   . LEU A 1 162 ? 16.683 14.411  42.177 1.00 14.66 ? 185 LEU A O   1 
ATOM   1319 C  CB  . LEU A 1 162 ? 17.166 16.400  39.904 1.00 11.45 ? 185 LEU A CB  1 
ATOM   1320 C  CG  . LEU A 1 162 ? 17.037 17.591  38.958 1.00 11.56 ? 185 LEU A CG  1 
ATOM   1321 C  CD1 . LEU A 1 162 ? 18.415 18.065  38.464 1.00 11.79 ? 185 LEU A CD1 1 
ATOM   1322 C  CD2 . LEU A 1 162 ? 16.164 17.179  37.784 1.00 11.23 ? 185 LEU A CD2 1 
ATOM   1323 N  N   . PRO A 1 163 ? 15.081 13.821  40.724 1.00 11.64 ? 186 PRO A N   1 
ATOM   1324 C  CA  . PRO A 1 163 ? 15.201 12.402  41.080 1.00 11.91 ? 186 PRO A CA  1 
ATOM   1325 C  C   . PRO A 1 163 ? 16.598 11.869  40.781 1.00 15.07 ? 186 PRO A C   1 
ATOM   1326 O  O   . PRO A 1 163 ? 17.344 12.413  39.959 1.00 12.98 ? 186 PRO A O   1 
ATOM   1327 C  CB  . PRO A 1 163 ? 14.139 11.718  40.201 1.00 14.13 ? 186 PRO A CB  1 
ATOM   1328 C  CG  . PRO A 1 163 ? 13.084 12.820  39.976 1.00 13.41 ? 186 PRO A CG  1 
ATOM   1329 C  CD  . PRO A 1 163 ? 13.936 14.089  39.836 1.00 11.18 ? 186 PRO A CD  1 
ATOM   1330 N  N   . LEU A 1 164 ? 16.951 10.783  41.469 1.00 14.09 ? 187 LEU A N   1 
ATOM   1331 C  CA  . LEU A 1 164 ? 18.293 10.220  41.369 1.00 11.82 ? 187 LEU A CA  1 
ATOM   1332 C  C   . LEU A 1 164 ? 18.402 9.070   40.383 1.00 12.28 ? 187 LEU A C   1 
ATOM   1333 O  O   . LEU A 1 164 ? 19.511 8.779   39.915 1.00 11.65 ? 187 LEU A O   1 
ATOM   1334 C  CB  . LEU A 1 164 ? 18.776 9.721   42.732 1.00 13.70 ? 187 LEU A CB  1 
ATOM   1335 C  CG  . LEU A 1 164 ? 18.853 10.776  43.834 1.00 14.89 ? 187 LEU A CG  1 
ATOM   1336 C  CD1 . LEU A 1 164 ? 19.330 10.094  45.109 1.00 16.42 ? 187 LEU A CD1 1 
ATOM   1337 C  CD2 . LEU A 1 164 ? 19.791 11.925  43.431 1.00 14.54 ? 187 LEU A CD2 1 
ATOM   1338 N  N   . ALA A 1 165 ? 17.293 8.417   40.055 1.00 11.30 ? 188 ALA A N   1 
ATOM   1339 C  CA  . ALA A 1 165 ? 17.395 7.200   39.267 1.00 14.24 ? 188 ALA A CA  1 
ATOM   1340 C  C   . ALA A 1 165 ? 16.039 6.892   38.665 1.00 13.48 ? 188 ALA A C   1 
ATOM   1341 O  O   . ALA A 1 165 ? 15.010 7.445   39.074 1.00 13.99 ? 188 ALA A O   1 
ATOM   1342 C  CB  . ALA A 1 165 ? 17.885 6.021   40.123 1.00 13.96 ? 188 ALA A CB  1 
ATOM   1343 N  N   . ALA A 1 166 ? 16.046 5.974   37.697 1.00 13.38 ? 189 ALA A N   1 
ATOM   1344 C  CA  . ALA A 1 166 ? 14.809 5.506   37.088 1.00 15.07 ? 189 ALA A CA  1 
ATOM   1345 C  C   . ALA A 1 166 ? 14.861 3.999   36.943 1.00 19.38 ? 189 ALA A C   1 
ATOM   1346 O  O   . ALA A 1 166 ? 15.890 3.436   36.565 1.00 14.97 ? 189 ALA A O   1 
ATOM   1347 C  CB  . ALA A 1 166 ? 14.565 6.143   35.702 1.00 14.33 ? 189 ALA A CB  1 
ATOM   1348 N  N   . LEU A 1 167 ? 13.753 3.353   37.262 1.00 14.28 ? 190 LEU A N   1 
ATOM   1349 C  CA  . LEU A 1 167 ? 13.556 1.949   36.937 1.00 17.97 ? 190 LEU A CA  1 
ATOM   1350 C  C   . LEU A 1 167 ? 12.735 1.911   35.653 1.00 19.95 ? 190 LEU A C   1 
ATOM   1351 O  O   . LEU A 1 167 ? 11.571 2.324   35.645 1.00 17.88 ? 190 LEU A O   1 
ATOM   1352 C  CB  . LEU A 1 167 ? 12.856 1.225   38.081 1.00 15.80 ? 190 LEU A CB  1 
ATOM   1353 C  CG  . LEU A 1 167 ? 12.457 -0.219  37.779 1.00 20.31 ? 190 LEU A CG  1 
ATOM   1354 C  CD1 . LEU A 1 167 ? 13.679 -1.086  37.557 1.00 21.91 ? 190 LEU A CD1 1 
ATOM   1355 C  CD2 . LEU A 1 167 ? 11.616 -0.749  38.934 1.00 23.52 ? 190 LEU A CD2 1 
ATOM   1356 N  N   . MET A 1 168 ? 13.340 1.437   34.565 1.00 18.11 ? 191 MET A N   1 
ATOM   1357 C  CA  . MET A 1 168 ? 12.743 1.572   33.243 1.00 18.02 ? 191 MET A CA  1 
ATOM   1358 C  C   . MET A 1 168 ? 12.253 0.212   32.764 1.00 16.24 ? 191 MET A C   1 
ATOM   1359 O  O   . MET A 1 168 ? 13.025 -0.753  32.707 1.00 18.32 ? 191 MET A O   1 
ATOM   1360 C  CB  . MET A 1 168 ? 13.727 2.194   32.253 1.00 19.78 ? 191 MET A CB  1 
ATOM   1361 C  CG  . MET A 1 168 ? 13.050 2.720   31.003 1.00 21.29 ? 191 MET A CG  1 
ATOM   1362 S  SD  . MET A 1 168 ? 13.105 1.475   29.699 1.00 22.53 ? 191 MET A SD  1 
ATOM   1363 C  CE  . MET A 1 168 ? 14.754 1.776   29.041 1.00 18.29 ? 191 MET A CE  1 
ATOM   1364 N  N   . ASN A 1 169 ? 10.953 0.141   32.473 1.00 20.81 ? 192 ASN A N   1 
ATOM   1365 C  CA  . ASN A 1 169 ? 10.285 -1.075  32.017 1.00 19.75 ? 192 ASN A CA  1 
ATOM   1366 C  C   . ASN A 1 169 ? 10.512 -2.250  32.961 1.00 23.53 ? 192 ASN A C   1 
ATOM   1367 O  O   . ASN A 1 169 ? 10.491 -3.409  32.536 1.00 22.74 ? 192 ASN A O   1 
ATOM   1368 C  CB  . ASN A 1 169 ? 10.722 -1.449  30.602 1.00 17.68 ? 192 ASN A CB  1 
ATOM   1369 C  CG  . ASN A 1 169 ? 9.640  -2.178  29.856 1.00 33.05 ? 192 ASN A CG  1 
ATOM   1370 O  OD1 . ASN A 1 169 ? 8.497  -1.737  29.853 1.00 28.85 ? 192 ASN A OD1 1 
ATOM   1371 N  ND2 . ASN A 1 169 ? 9.978  -3.308  29.248 1.00 27.66 ? 192 ASN A ND2 1 
ATOM   1372 N  N   . GLN A 1 170 ? 10.748 -1.961  34.242 1.00 17.44 ? 193 GLN A N   1 
ATOM   1373 C  CA  . GLN A 1 170 ? 11.047 -2.979  35.251 1.00 19.12 ? 193 GLN A CA  1 
ATOM   1374 C  C   . GLN A 1 170 ? 12.254 -3.840  34.871 1.00 23.92 ? 193 GLN A C   1 
ATOM   1375 O  O   . GLN A 1 170 ? 12.450 -4.930  35.422 1.00 21.79 ? 193 GLN A O   1 
ATOM   1376 C  CB  . GLN A 1 170 ? 9.824  -3.861  35.524 1.00 26.41 ? 193 GLN A CB  1 
ATOM   1377 C  CG  . GLN A 1 170 ? 8.675  -3.099  36.168 1.00 30.82 ? 193 GLN A CG  1 
ATOM   1378 C  CD  . GLN A 1 170 ? 7.513  -3.996  36.549 1.00 46.40 ? 193 GLN A CD  1 
ATOM   1379 O  OE1 . GLN A 1 170 ? 7.375  -5.109  36.041 1.00 59.50 ? 193 GLN A OE1 1 
ATOM   1380 N  NE2 . GLN A 1 170 ? 6.669  -3.510  37.448 1.00 57.74 ? 193 GLN A NE2 1 
ATOM   1381 N  N   . GLN A 1 171 ? 13.092 -3.352  33.960 1.00 20.33 ? 194 GLN A N   1 
ATOM   1382 C  CA  . GLN A 1 171 ? 14.250 -4.091  33.470 1.00 17.60 ? 194 GLN A CA  1 
ATOM   1383 C  C   . GLN A 1 171 ? 15.573 -3.363  33.638 1.00 18.68 ? 194 GLN A C   1 
ATOM   1384 O  O   . GLN A 1 171 ? 16.610 -4.021  33.752 1.00 17.23 ? 194 GLN A O   1 
ATOM   1385 C  CB  . GLN A 1 171 ? 14.098 -4.401  31.974 1.00 24.10 ? 194 GLN A CB  1 
ATOM   1386 C  CG  . GLN A 1 171 ? 12.897 -5.214  31.585 1.00 28.17 ? 194 GLN A CG  1 
ATOM   1387 C  CD  . GLN A 1 171 ? 12.799 -5.355  30.081 1.00 26.02 ? 194 GLN A CD  1 
ATOM   1388 O  OE1 . GLN A 1 171 ? 12.393 -4.417  29.372 1.00 28.30 ? 194 GLN A OE1 1 
ATOM   1389 N  NE2 . GLN A 1 171 ? 13.182 -6.524  29.578 1.00 31.42 ? 194 GLN A NE2 1 
ATOM   1390 N  N   . PHE A 1 172 ? 15.578 -2.032  33.596 1.00 14.90 ? 195 PHE A N   1 
ATOM   1391 C  CA  . PHE A 1 172 ? 16.817 -1.267  33.551 1.00 13.48 ? 195 PHE A CA  1 
ATOM   1392 C  C   . PHE A 1 172 ? 16.860 -0.287  34.709 1.00 12.98 ? 195 PHE A C   1 
ATOM   1393 O  O   . PHE A 1 172 ? 15.884 0.428   34.957 1.00 16.96 ? 195 PHE A O   1 
ATOM   1394 C  CB  . PHE A 1 172 ? 16.944 -0.501  32.233 1.00 16.38 ? 195 PHE A CB  1 
ATOM   1395 C  CG  . PHE A 1 172 ? 16.898 -1.380  31.025 1.00 19.42 ? 195 PHE A CG  1 
ATOM   1396 C  CD1 . PHE A 1 172 ? 18.011 -2.120  30.652 1.00 20.53 ? 195 PHE A CD1 1 
ATOM   1397 C  CD2 . PHE A 1 172 ? 15.737 -1.484  30.273 1.00 19.84 ? 195 PHE A CD2 1 
ATOM   1398 C  CE1 . PHE A 1 172 ? 17.972 -2.943  29.540 1.00 25.52 ? 195 PHE A CE1 1 
ATOM   1399 C  CE2 . PHE A 1 172 ? 15.692 -2.302  29.155 1.00 22.89 ? 195 PHE A CE2 1 
ATOM   1400 C  CZ  . PHE A 1 172 ? 16.803 -3.041  28.800 1.00 23.47 ? 195 PHE A CZ  1 
ATOM   1401 N  N   . LEU A 1 173 ? 17.995 -0.240  35.392 1.00 13.59 ? 196 LEU A N   1 
ATOM   1402 C  CA  . LEU A 1 173 ? 18.274 0.838   36.325 1.00 13.43 ? 196 LEU A CA  1 
ATOM   1403 C  C   . LEU A 1 173 ? 19.041 1.906   35.563 1.00 13.71 ? 196 LEU A C   1 
ATOM   1404 O  O   . LEU A 1 173 ? 20.078 1.612   34.953 1.00 14.35 ? 196 LEU A O   1 
ATOM   1405 C  CB  . LEU A 1 173 ? 19.077 0.345   37.523 1.00 16.68 ? 196 LEU A CB  1 
ATOM   1406 C  CG  . LEU A 1 173 ? 19.568 1.483   38.431 1.00 16.24 ? 196 LEU A CG  1 
ATOM   1407 C  CD1 . LEU A 1 173 ? 18.384 2.235   39.099 1.00 15.24 ? 196 LEU A CD1 1 
ATOM   1408 C  CD2 . LEU A 1 173 ? 20.541 0.932   39.469 1.00 16.76 ? 196 LEU A CD2 1 
ATOM   1409 N  N   . CYS A 1 174 ? 18.523 3.129   35.580 1.00 13.24 ? 197 CYS A N   1 
ATOM   1410 C  CA  . CYS A 1 174 ? 19.126 4.246   34.867 1.00 13.32 ? 197 CYS A CA  1 
ATOM   1411 C  C   . CYS A 1 174 ? 19.590 5.276   35.883 1.00 12.73 ? 197 CYS A C   1 
ATOM   1412 O  O   . CYS A 1 174 ? 18.798 5.706   36.721 1.00 10.82 ? 197 CYS A O   1 
ATOM   1413 C  CB  . CYS A 1 174 ? 18.130 4.887   33.901 1.00 14.36 ? 197 CYS A CB  1 
ATOM   1414 S  SG  . CYS A 1 174 ? 17.174 3.679   32.894 1.00 16.51 ? 197 CYS A SG  1 
ATOM   1415 N  N   . VAL A 1 175 ? 20.860 5.677   35.793 1.00 11.40 ? 198 VAL A N   1 
ATOM   1416 C  CA  . VAL A 1 175 ? 21.470 6.654   36.697 1.00 9.84  ? 198 VAL A CA  1 
ATOM   1417 C  C   . VAL A 1 175 ? 22.500 7.447   35.898 1.00 12.75 ? 198 VAL A C   1 
ATOM   1418 O  O   . VAL A 1 175 ? 22.918 7.048   34.817 1.00 11.48 ? 198 VAL A O   1 
ATOM   1419 C  CB  . VAL A 1 175 ? 22.149 5.994   37.917 1.00 12.18 ? 198 VAL A CB  1 
ATOM   1420 C  CG1 . VAL A 1 175 ? 21.124 5.445   38.903 1.00 14.18 ? 198 VAL A CG1 1 
ATOM   1421 C  CG2 . VAL A 1 175 ? 23.078 4.872   37.469 1.00 14.38 ? 198 VAL A CG2 1 
ATOM   1422 N  N   . HIS A 1 176 ? 22.933 8.582   36.434 1.00 10.78 ? 199 HIS A N   1 
ATOM   1423 C  CA  . HIS A 1 176 ? 23.990 9.309   35.744 1.00 13.39 ? 199 HIS A CA  1 
ATOM   1424 C  C   . HIS A 1 176 ? 25.310 8.550   35.807 1.00 11.09 ? 199 HIS A C   1 
ATOM   1425 O  O   . HIS A 1 176 ? 25.950 8.305   34.775 1.00 11.16 ? 199 HIS A O   1 
ATOM   1426 C  CB  . HIS A 1 176 ? 24.169 10.708  36.340 1.00 12.73 ? 199 HIS A CB  1 
ATOM   1427 C  CG  . HIS A 1 176 ? 25.198 11.515  35.617 1.00 10.23 ? 199 HIS A CG  1 
ATOM   1428 N  ND1 . HIS A 1 176 ? 24.980 12.027  34.356 1.00 10.61 ? 199 HIS A ND1 1 
ATOM   1429 C  CD2 . HIS A 1 176 ? 26.462 11.874  35.958 1.00 10.57 ? 199 HIS A CD2 1 
ATOM   1430 C  CE1 . HIS A 1 176 ? 26.058 12.678  33.954 1.00 13.78 ? 199 HIS A CE1 1 
ATOM   1431 N  NE2 . HIS A 1 176 ? 26.972 12.602  34.907 1.00 8.93  ? 199 HIS A NE2 1 
ATOM   1432 N  N   . GLY A 1 177 ? 25.731 8.168   37.011 1.00 10.71 ? 200 GLY A N   1 
ATOM   1433 C  CA  . GLY A 1 177 ? 27.058 7.616   37.210 1.00 10.41 ? 200 GLY A CA  1 
ATOM   1434 C  C   . GLY A 1 177 ? 27.059 6.109   37.333 1.00 16.46 ? 200 GLY A C   1 
ATOM   1435 O  O   . GLY A 1 177 ? 27.586 5.417   36.463 1.00 11.69 ? 200 GLY A O   1 
ATOM   1436 N  N   . GLY A 1 178 ? 26.489 5.581   38.410 1.00 13.82 ? 201 GLY A N   1 
ATOM   1437 C  CA  . GLY A 1 178 ? 26.484 4.143   38.545 1.00 12.56 ? 201 GLY A CA  1 
ATOM   1438 C  C   . GLY A 1 178 ? 26.107 3.643   39.919 1.00 15.16 ? 201 GLY A C   1 
ATOM   1439 O  O   . GLY A 1 178 ? 25.204 4.184   40.567 1.00 15.47 ? 201 GLY A O   1 
ATOM   1440 N  N   . LEU A 1 179 ? 26.792 2.587   40.356 1.00 13.35 ? 202 LEU A N   1 
ATOM   1441 C  CA  . LEU A 1 179 ? 26.452 1.866   41.570 1.00 14.91 ? 202 LEU A CA  1 
ATOM   1442 C  C   . LEU A 1 179 ? 27.270 2.381   42.752 1.00 16.81 ? 202 LEU A C   1 
ATOM   1443 O  O   . LEU A 1 179 ? 28.137 3.246   42.617 1.00 16.53 ? 202 LEU A O   1 
ATOM   1444 C  CB  . LEU A 1 179 ? 26.682 0.364   41.373 1.00 17.38 ? 202 LEU A CB  1 
ATOM   1445 C  CG  . LEU A 1 179 ? 25.790 -0.308  40.335 1.00 17.76 ? 202 LEU A CG  1 
ATOM   1446 C  CD1 . LEU A 1 179 ? 26.098 -1.813  40.262 1.00 18.41 ? 202 LEU A CD1 1 
ATOM   1447 C  CD2 . LEU A 1 179 ? 24.327 -0.068  40.690 1.00 19.04 ? 202 LEU A CD2 1 
ATOM   1448 N  N   . SER A 1 180 ? 27.003 1.798   43.927 1.00 18.84 ? 203 SER A N   1 
ATOM   1449 C  CA  . SER A 1 180 ? 27.576 2.190   45.204 1.00 18.31 ? 203 SER A CA  1 
ATOM   1450 C  C   . SER A 1 180 ? 27.780 0.934   46.031 1.00 18.84 ? 203 SER A C   1 
ATOM   1451 O  O   . SER A 1 180 ? 26.919 0.047   45.992 1.00 17.99 ? 203 SER A O   1 
ATOM   1452 C  CB  . SER A 1 180 ? 26.643 3.136   45.968 1.00 17.51 ? 203 SER A CB  1 
ATOM   1453 O  OG  . SER A 1 180 ? 27.123 3.399   47.278 1.00 19.11 ? 203 SER A OG  1 
ATOM   1454 N  N   . PRO A 1 181 ? 28.849 0.845   46.827 1.00 18.91 ? 204 PRO A N   1 
ATOM   1455 C  CA  . PRO A 1 181 ? 28.933 -0.269  47.784 1.00 22.17 ? 204 PRO A CA  1 
ATOM   1456 C  C   . PRO A 1 181 ? 27.793 -0.261  48.780 1.00 23.32 ? 204 PRO A C   1 
ATOM   1457 O  O   . PRO A 1 181 ? 27.531 -1.295  49.405 1.00 24.20 ? 204 PRO A O   1 
ATOM   1458 C  CB  . PRO A 1 181 ? 30.296 -0.061  48.469 1.00 22.77 ? 204 PRO A CB  1 
ATOM   1459 C  CG  . PRO A 1 181 ? 30.616 1.371   48.272 1.00 21.40 ? 204 PRO A CG  1 
ATOM   1460 C  CD  . PRO A 1 181 ? 30.005 1.750   46.936 1.00 20.36 ? 204 PRO A CD  1 
ATOM   1461 N  N   . GLU A 1 182 ? 27.073 0.854   48.918 1.00 21.09 ? 205 GLU A N   1 
ATOM   1462 C  CA  . GLU A 1 182 ? 25.939 0.938   49.828 1.00 25.71 ? 205 GLU A CA  1 
ATOM   1463 C  C   . GLU A 1 182 ? 24.591 0.918   49.111 1.00 25.33 ? 205 GLU A C   1 
ATOM   1464 O  O   . GLU A 1 182 ? 23.573 1.279   49.707 1.00 27.36 ? 205 GLU A O   1 
ATOM   1465 C  CB  . GLU A 1 182 ? 26.055 2.192   50.696 1.00 24.79 ? 205 GLU A CB  1 
ATOM   1466 C  CG  . GLU A 1 182 ? 27.318 2.217   51.540 1.00 29.98 ? 205 GLU A CG  1 
ATOM   1467 C  CD  . GLU A 1 182 ? 27.425 3.465   52.388 1.00 34.96 ? 205 GLU A CD  1 
ATOM   1468 O  OE1 . GLU A 1 182 ? 26.619 3.614   53.331 1.00 44.33 ? 205 GLU A OE1 1 
ATOM   1469 O  OE2 . GLU A 1 182 ? 28.306 4.303   52.101 1.00 42.10 ? 205 GLU A OE2 1 
ATOM   1470 N  N   . ILE A 1 183 ? 24.556 0.514   47.852 1.00 21.08 ? 206 ILE A N   1 
ATOM   1471 C  CA  . ILE A 1 183 ? 23.304 0.364   47.125 1.00 19.72 ? 206 ILE A CA  1 
ATOM   1472 C  C   . ILE A 1 183 ? 23.284 -1.056  46.586 1.00 22.12 ? 206 ILE A C   1 
ATOM   1473 O  O   . ILE A 1 183 ? 23.880 -1.354  45.542 1.00 22.42 ? 206 ILE A O   1 
ATOM   1474 C  CB  . ILE A 1 183 ? 23.150 1.402   46.017 1.00 20.06 ? 206 ILE A CB  1 
ATOM   1475 C  CG1 . ILE A 1 183 ? 22.991 2.771   46.664 1.00 23.26 ? 206 ILE A CG1 1 
ATOM   1476 C  CG2 . ILE A 1 183 ? 21.928 1.087   45.141 1.00 21.62 ? 206 ILE A CG2 1 
ATOM   1477 C  CD1 . ILE A 1 183 ? 23.133 3.859   45.715 1.00 23.01 ? 206 ILE A CD1 1 
ATOM   1478 N  N   . ASN A 1 184 ? 22.637 -1.951  47.327 1.00 22.02 ? 207 ASN A N   1 
ATOM   1479 C  CA  . ASN A 1 184 ? 22.544 -3.339  46.924 1.00 19.41 ? 207 ASN A CA  1 
ATOM   1480 C  C   . ASN A 1 184 ? 21.148 -3.728  46.485 1.00 21.61 ? 207 ASN A C   1 
ATOM   1481 O  O   . ASN A 1 184 ? 20.987 -4.773  45.849 1.00 23.56 ? 207 ASN A O   1 
ATOM   1482 C  CB  . ASN A 1 184 ? 23.018 -4.237  48.070 1.00 23.11 ? 207 ASN A CB  1 
ATOM   1483 C  CG  . ASN A 1 184 ? 24.392 -3.852  48.548 1.00 28.98 ? 207 ASN A CG  1 
ATOM   1484 O  OD1 . ASN A 1 184 ? 24.557 -3.321  49.647 1.00 34.75 ? 207 ASN A OD1 1 
ATOM   1485 N  ND2 . ASN A 1 184 ? 25.387 -4.069  47.699 1.00 26.10 ? 207 ASN A ND2 1 
ATOM   1486 N  N   . THR A 1 185 ? 20.144 -2.907  46.781 1.00 19.33 ? 208 THR A N   1 
ATOM   1487 C  CA  . THR A 1 185 ? 18.777 -3.158  46.348 1.00 19.56 ? 208 THR A CA  1 
ATOM   1488 C  C   . THR A 1 185 ? 18.175 -1.858  45.846 1.00 21.22 ? 208 THR A C   1 
ATOM   1489 O  O   . THR A 1 185 ? 18.676 -0.768  46.137 1.00 19.79 ? 208 THR A O   1 
ATOM   1490 C  CB  . THR A 1 185 ? 17.898 -3.683  47.480 1.00 22.25 ? 208 THR A CB  1 
ATOM   1491 O  OG1 . THR A 1 185 ? 17.748 -2.638  48.445 1.00 21.93 ? 208 THR A OG1 1 
ATOM   1492 C  CG2 . THR A 1 185 ? 18.518 -4.895  48.140 1.00 24.43 ? 208 THR A CG2 1 
ATOM   1493 N  N   . LEU A 1 186 ? 17.069 -1.970  45.107 1.00 19.31 ? 209 LEU A N   1 
ATOM   1494 C  CA  . LEU A 1 186 ? 16.388 -0.752  44.676 1.00 19.98 ? 209 LEU A CA  1 
ATOM   1495 C  C   . LEU A 1 186 ? 15.845 0.034   45.869 1.00 26.99 ? 209 LEU A C   1 
ATOM   1496 O  O   . LEU A 1 186 ? 15.823 1.270   45.837 1.00 18.50 ? 209 LEU A O   1 
ATOM   1497 C  CB  . LEU A 1 186 ? 15.270 -1.084  43.688 1.00 20.86 ? 209 LEU A CB  1 
ATOM   1498 C  CG  . LEU A 1 186 ? 15.671 -1.632  42.319 1.00 20.43 ? 209 LEU A CG  1 
ATOM   1499 C  CD1 . LEU A 1 186 ? 14.430 -1.825  41.459 1.00 29.47 ? 209 LEU A CD1 1 
ATOM   1500 C  CD2 . LEU A 1 186 ? 16.698 -0.743  41.612 1.00 21.09 ? 209 LEU A CD2 1 
ATOM   1501 N  N   . ASP A 1 187 ? 15.432 -0.656  46.943 1.00 20.81 ? 210 ASP A N   1 
ATOM   1502 C  CA  . ASP A 1 187 ? 14.984 0.058   48.138 1.00 23.27 ? 210 ASP A CA  1 
ATOM   1503 C  C   . ASP A 1 187 ? 16.087 0.924   48.731 1.00 18.43 ? 210 ASP A C   1 
ATOM   1504 O  O   . ASP A 1 187 ? 15.796 1.948   49.363 1.00 23.03 ? 210 ASP A O   1 
ATOM   1505 C  CB  . ASP A 1 187 ? 14.466 -0.920  49.195 1.00 22.92 ? 210 ASP A CB  1 
ATOM   1506 C  CG  . ASP A 1 187 ? 13.029 -1.322  48.949 1.00 33.08 ? 210 ASP A CG  1 
ATOM   1507 O  OD1 . ASP A 1 187 ? 12.339 -0.593  48.204 1.00 34.19 ? 210 ASP A OD1 1 
ATOM   1508 O  OD2 . ASP A 1 187 ? 12.591 -2.362  49.490 1.00 52.23 ? 210 ASP A OD2 1 
ATOM   1509 N  N   . ASP A 1 188 ? 17.353 0.535   48.548 1.00 19.69 ? 211 ASP A N   1 
ATOM   1510 C  CA  . ASP A 1 188 ? 18.447 1.375   49.026 1.00 17.28 ? 211 ASP A CA  1 
ATOM   1511 C  C   . ASP A 1 188 ? 18.410 2.759   48.383 1.00 22.42 ? 211 ASP A C   1 
ATOM   1512 O  O   . ASP A 1 188 ? 18.788 3.750   49.019 1.00 20.72 ? 211 ASP A O   1 
ATOM   1513 C  CB  . ASP A 1 188 ? 19.794 0.700   48.759 1.00 23.61 ? 211 ASP A CB  1 
ATOM   1514 C  CG  . ASP A 1 188 ? 20.069 -0.452  49.717 1.00 29.27 ? 211 ASP A CG  1 
ATOM   1515 O  OD1 . ASP A 1 188 ? 19.463 -0.464  50.804 1.00 28.56 ? 211 ASP A OD1 1 
ATOM   1516 O  OD2 . ASP A 1 188 ? 20.897 -1.326  49.390 1.00 25.40 ? 211 ASP A OD2 1 
ATOM   1517 N  N   . ILE A 1 189 ? 17.971 2.844   47.128 1.00 17.67 ? 212 ILE A N   1 
ATOM   1518 C  CA  . ILE A 1 189 ? 17.815 4.146   46.480 1.00 18.26 ? 212 ILE A CA  1 
ATOM   1519 C  C   . ILE A 1 189 ? 16.573 4.852   47.013 1.00 16.55 ? 212 ILE A C   1 
ATOM   1520 O  O   . ILE A 1 189 ? 16.580 6.066   47.257 1.00 17.20 ? 212 ILE A O   1 
ATOM   1521 C  CB  . ILE A 1 189 ? 17.754 3.971   44.947 1.00 17.19 ? 212 ILE A CB  1 
ATOM   1522 C  CG1 . ILE A 1 189 ? 19.000 3.235   44.431 1.00 16.96 ? 212 ILE A CG1 1 
ATOM   1523 C  CG2 . ILE A 1 189 ? 17.598 5.325   44.252 1.00 19.07 ? 212 ILE A CG2 1 
ATOM   1524 C  CD1 . ILE A 1 189 ? 18.946 2.894   42.955 1.00 19.99 ? 212 ILE A CD1 1 
ATOM   1525 N  N   . ARG A 1 190 ? 15.489 4.100   47.203 1.00 17.14 ? 213 ARG A N   1 
ATOM   1526 C  CA  . ARG A 1 190 ? 14.229 4.700   47.631 1.00 18.67 ? 213 ARG A CA  1 
ATOM   1527 C  C   . ARG A 1 190 ? 14.344 5.374   48.993 1.00 18.83 ? 213 ARG A C   1 
ATOM   1528 O  O   . ARG A 1 190 ? 13.638 6.354   49.254 1.00 20.38 ? 213 ARG A O   1 
ATOM   1529 C  CB  . ARG A 1 190 ? 13.128 3.632   47.660 1.00 21.96 ? 213 ARG A CB  1 
ATOM   1530 C  CG  . ARG A 1 190 ? 12.851 2.988   46.304 1.00 19.92 ? 213 ARG A CG  1 
ATOM   1531 C  CD  . ARG A 1 190 ? 11.595 2.117   46.332 1.00 26.81 ? 213 ARG A CD  1 
ATOM   1532 N  NE  . ARG A 1 190 ? 11.253 1.630   44.998 1.00 26.60 ? 213 ARG A NE  1 
ATOM   1533 C  CZ  . ARG A 1 190 ? 11.513 0.402   44.555 1.00 28.94 ? 213 ARG A CZ  1 
ATOM   1534 N  NH1 . ARG A 1 190 ? 12.116 -0.485  45.345 1.00 29.25 ? 213 ARG A NH1 1 
ATOM   1535 N  NH2 . ARG A 1 190 ? 11.165 0.058   43.319 1.00 24.69 ? 213 ARG A NH2 1 
ATOM   1536 N  N   . LYS A 1 191 ? 15.218 4.870   49.874 1.00 19.90 ? 214 LYS A N   1 
ATOM   1537 C  CA  . LYS A 1 191 ? 15.293 5.365   51.249 1.00 23.05 ? 214 LYS A CA  1 
ATOM   1538 C  C   . LYS A 1 191 ? 16.164 6.609   51.403 1.00 29.79 ? 214 LYS A C   1 
ATOM   1539 O  O   . LYS A 1 191 ? 16.198 7.196   52.493 1.00 21.59 ? 214 LYS A O   1 
ATOM   1540 C  CB  . LYS A 1 191 ? 15.820 4.263   52.172 1.00 27.13 ? 214 LYS A CB  1 
ATOM   1541 C  CG  . LYS A 1 191 ? 17.231 3.832   51.821 1.00 34.83 ? 214 LYS A CG  1 
ATOM   1542 C  CD  . LYS A 1 191 ? 17.858 2.883   52.837 1.00 46.25 ? 214 LYS A CD  1 
ATOM   1543 C  CE  . LYS A 1 191 ? 19.254 2.475   52.368 1.00 46.09 ? 214 LYS A CE  1 
ATOM   1544 N  NZ  . LYS A 1 191 ? 19.942 3.601   51.636 1.00 26.36 ? 214 LYS A NZ  1 
ATOM   1545 N  N   . LEU A 1 192 ? 16.864 7.027   50.355 1.00 19.38 ? 215 LEU A N   1 
ATOM   1546 C  CA  . LEU A 1 192 ? 17.733 8.192   50.453 1.00 21.02 ? 215 LEU A CA  1 
ATOM   1547 C  C   . LEU A 1 192 ? 16.931 9.475   50.635 1.00 20.24 ? 215 LEU A C   1 
ATOM   1548 O  O   . LEU A 1 192 ? 15.799 9.610   50.158 1.00 20.45 ? 215 LEU A O   1 
ATOM   1549 C  CB  . LEU A 1 192 ? 18.602 8.320   49.197 1.00 18.59 ? 215 LEU A CB  1 
ATOM   1550 C  CG  . LEU A 1 192 ? 19.566 7.175   48.892 1.00 19.77 ? 215 LEU A CG  1 
ATOM   1551 C  CD1 . LEU A 1 192 ? 20.212 7.378   47.522 1.00 18.83 ? 215 LEU A CD1 1 
ATOM   1552 C  CD2 . LEU A 1 192 ? 20.619 7.049   49.992 1.00 23.48 ? 215 LEU A CD2 1 
ATOM   1553 N  N   . ASP A 1 193 ? 17.546 10.435  51.323 1.00 22.63 ? 216 ASP A N   1 
ATOM   1554 C  CA  . ASP A 1 193 ? 17.099 11.822  51.306 1.00 20.53 ? 216 ASP A CA  1 
ATOM   1555 C  C   . ASP A 1 193 ? 17.873 12.544  50.206 1.00 17.82 ? 216 ASP A C   1 
ATOM   1556 O  O   . ASP A 1 193 ? 19.069 12.835  50.365 1.00 19.38 ? 216 ASP A O   1 
ATOM   1557 C  CB  . ASP A 1 193 ? 17.327 12.478  52.670 1.00 23.87 ? 216 ASP A CB  1 
ATOM   1558 C  CG  . ASP A 1 193 ? 16.980 13.969  52.681 1.00 28.43 ? 216 ASP A CG  1 
ATOM   1559 O  OD1 . ASP A 1 193 ? 16.306 14.454  51.743 1.00 26.96 ? 216 ASP A OD1 1 
ATOM   1560 O  OD2 . ASP A 1 193 ? 17.395 14.663  53.639 1.00 31.74 ? 216 ASP A OD2 1 
ATOM   1561 N  N   . ARG A 1 194 ? 17.200 12.845  49.091 1.00 16.53 ? 217 ARG A N   1 
ATOM   1562 C  CA  . ARG A 1 194 ? 17.883 13.478  47.967 1.00 15.82 ? 217 ARG A CA  1 
ATOM   1563 C  C   . ARG A 1 194 ? 17.834 14.996  48.010 1.00 17.54 ? 217 ARG A C   1 
ATOM   1564 O  O   . ARG A 1 194 ? 18.523 15.647  47.210 1.00 15.56 ? 217 ARG A O   1 
ATOM   1565 C  CB  . ARG A 1 194 ? 17.289 12.999  46.633 1.00 14.47 ? 217 ARG A CB  1 
ATOM   1566 C  CG  . ARG A 1 194 ? 15.980 13.687  46.232 1.00 15.79 ? 217 ARG A CG  1 
ATOM   1567 C  CD  . ARG A 1 194 ? 15.469 13.084  44.914 1.00 15.51 ? 217 ARG A CD  1 
ATOM   1568 N  NE  . ARG A 1 194 ? 14.393 13.856  44.292 1.00 14.08 ? 217 ARG A NE  1 
ATOM   1569 C  CZ  . ARG A 1 194 ? 13.102 13.542  44.391 1.00 16.50 ? 217 ARG A CZ  1 
ATOM   1570 N  NH1 . ARG A 1 194 ? 12.729 12.495  45.119 1.00 14.81 ? 217 ARG A NH1 1 
ATOM   1571 N  NH2 . ARG A 1 194 ? 12.181 14.279  43.776 1.00 14.77 ? 217 ARG A NH2 1 
ATOM   1572 N  N   . PHE A 1 195 ? 17.041 15.587  48.907 1.00 17.56 ? 218 PHE A N   1 
ATOM   1573 C  CA  . PHE A 1 195 ? 16.780 17.026  48.844 1.00 15.57 ? 218 PHE A CA  1 
ATOM   1574 C  C   . PHE A 1 195 ? 17.893 17.783  49.564 1.00 25.87 ? 218 PHE A C   1 
ATOM   1575 O  O   . PHE A 1 195 ? 17.704 18.392  50.621 1.00 20.25 ? 218 PHE A O   1 
ATOM   1576 C  CB  . PHE A 1 195 ? 15.403 17.347  49.417 1.00 17.12 ? 218 PHE A CB  1 
ATOM   1577 C  CG  . PHE A 1 195 ? 14.285 16.703  48.655 1.00 17.02 ? 218 PHE A CG  1 
ATOM   1578 C  CD1 . PHE A 1 195 ? 13.932 17.169  47.406 1.00 21.17 ? 218 PHE A CD1 1 
ATOM   1579 C  CD2 . PHE A 1 195 ? 13.615 15.609  49.170 1.00 30.90 ? 218 PHE A CD2 1 
ATOM   1580 C  CE1 . PHE A 1 195 ? 12.910 16.562  46.683 1.00 23.59 ? 218 PHE A CE1 1 
ATOM   1581 C  CE2 . PHE A 1 195 ? 12.594 15.001  48.454 1.00 31.15 ? 218 PHE A CE2 1 
ATOM   1582 C  CZ  . PHE A 1 195 ? 12.239 15.490  47.210 1.00 23.86 ? 218 PHE A CZ  1 
ATOM   1583 N  N   . LYS A 1 196 ? 19.069 17.761  48.938 1.00 14.78 ? 219 LYS A N   1 
ATOM   1584 C  CA  . LYS A 1 196 ? 20.255 18.368  49.518 1.00 15.22 ? 219 LYS A CA  1 
ATOM   1585 C  C   . LYS A 1 196 ? 21.361 18.414  48.474 1.00 17.49 ? 219 LYS A C   1 
ATOM   1586 O  O   . LYS A 1 196 ? 21.309 17.728  47.444 1.00 15.81 ? 219 LYS A O   1 
ATOM   1587 C  CB  . LYS A 1 196 ? 20.732 17.593  50.747 1.00 21.05 ? 219 LYS A CB  1 
ATOM   1588 C  CG  . LYS A 1 196 ? 21.102 16.130  50.474 1.00 19.75 ? 219 LYS A CG  1 
ATOM   1589 C  CD  . LYS A 1 196 ? 21.036 15.381  51.789 1.00 31.37 ? 219 LYS A CD  1 
ATOM   1590 C  CE  . LYS A 1 196 ? 21.964 14.209  51.852 1.00 35.96 ? 219 LYS A CE  1 
ATOM   1591 N  NZ  . LYS A 1 196 ? 21.885 13.624  53.226 1.00 31.19 ? 219 LYS A NZ  1 
ATOM   1592 N  N   . GLU A 1 197 ? 22.363 19.231  48.761 1.00 14.68 ? 220 GLU A N   1 
ATOM   1593 C  CA  . GLU A 1 197 ? 23.625 19.147  48.036 1.00 16.89 ? 220 GLU A CA  1 
ATOM   1594 C  C   . GLU A 1 197 ? 24.191 17.731  48.168 1.00 15.19 ? 220 GLU A C   1 
ATOM   1595 O  O   . GLU A 1 197 ? 24.159 17.161  49.268 1.00 17.75 ? 220 GLU A O   1 
ATOM   1596 C  CB  . GLU A 1 197 ? 24.610 20.181  48.598 1.00 19.09 ? 220 GLU A CB  1 
ATOM   1597 C  CG  . GLU A 1 197 ? 26.018 20.118  48.011 1.00 18.52 ? 220 GLU A CG  1 
ATOM   1598 C  CD  . GLU A 1 197 ? 26.110 20.776  46.643 1.00 16.25 ? 220 GLU A CD  1 
ATOM   1599 O  OE1 . GLU A 1 197 ? 25.080 21.316  46.157 1.00 15.58 ? 220 GLU A OE1 1 
ATOM   1600 O  OE2 . GLU A 1 197 ? 27.219 20.755  46.055 1.00 17.32 ? 220 GLU A OE2 1 
ATOM   1601 N  N   . PRO A 1 198 ? 24.680 17.118  47.087 1.00 16.09 ? 221 PRO A N   1 
ATOM   1602 C  CA  . PRO A 1 198 ? 25.222 15.760  47.195 1.00 15.65 ? 221 PRO A CA  1 
ATOM   1603 C  C   . PRO A 1 198 ? 26.388 15.742  48.163 1.00 17.82 ? 221 PRO A C   1 
ATOM   1604 O  O   . PRO A 1 198 ? 27.289 16.588  48.061 1.00 17.72 ? 221 PRO A O   1 
ATOM   1605 C  CB  . PRO A 1 198 ? 25.681 15.435  45.757 1.00 13.66 ? 221 PRO A CB  1 
ATOM   1606 C  CG  . PRO A 1 198 ? 24.896 16.356  44.883 1.00 16.58 ? 221 PRO A CG  1 
ATOM   1607 C  CD  . PRO A 1 198 ? 24.774 17.629  45.708 1.00 14.17 ? 221 PRO A CD  1 
ATOM   1608 N  N   . PRO A 1 199 ? 26.396 14.826  49.131 1.00 18.48 ? 222 PRO A N   1 
ATOM   1609 C  CA  . PRO A 1 199 ? 27.518 14.772  50.082 1.00 20.65 ? 222 PRO A CA  1 
ATOM   1610 C  C   . PRO A 1 199 ? 28.821 14.428  49.374 1.00 22.79 ? 222 PRO A C   1 
ATOM   1611 O  O   . PRO A 1 199 ? 28.849 13.991  48.222 1.00 17.37 ? 222 PRO A O   1 
ATOM   1612 C  CB  . PRO A 1 199 ? 27.117 13.670  51.074 1.00 16.22 ? 222 PRO A CB  1 
ATOM   1613 C  CG  . PRO A 1 199 ? 25.632 13.500  50.896 1.00 25.71 ? 222 PRO A CG  1 
ATOM   1614 C  CD  . PRO A 1 199 ? 25.359 13.824  49.441 1.00 22.37 ? 222 PRO A CD  1 
ATOM   1615 N  N   . ALA A 1 200 ? 29.923 14.619  50.098 1.00 17.95 ? 223 ALA A N   1 
ATOM   1616 C  CA  . ALA A 1 200 ? 31.245 14.321  49.552 1.00 18.60 ? 223 ALA A CA  1 
ATOM   1617 C  C   . ALA A 1 200 ? 31.484 12.822  49.389 1.00 19.09 ? 223 ALA A C   1 
ATOM   1618 O  O   . ALA A 1 200 ? 32.368 12.425  48.616 1.00 18.58 ? 223 ALA A O   1 
ATOM   1619 C  CB  . ALA A 1 200 ? 32.321 14.930  50.451 1.00 19.97 ? 223 ALA A CB  1 
ATOM   1620 N  N   . TYR A 1 201 ? 30.725 11.991  50.097 1.00 16.62 ? 224 TYR A N   1 
ATOM   1621 C  CA  . TYR A 1 201 ? 30.827 10.539  50.012 1.00 17.66 ? 224 TYR A CA  1 
ATOM   1622 C  C   . TYR A 1 201 ? 29.480 9.948   50.397 1.00 17.54 ? 224 TYR A C   1 
ATOM   1623 O  O   . TYR A 1 201 ? 28.623 10.633  50.964 1.00 18.46 ? 224 TYR A O   1 
ATOM   1624 C  CB  . TYR A 1 201 ? 31.933 10.000  50.929 1.00 18.59 ? 224 TYR A CB  1 
ATOM   1625 C  CG  . TYR A 1 201 ? 31.760 10.474  52.357 1.00 16.02 ? 224 TYR A CG  1 
ATOM   1626 C  CD1 . TYR A 1 201 ? 31.013 9.739   53.270 1.00 19.81 ? 224 TYR A CD1 1 
ATOM   1627 C  CD2 . TYR A 1 201 ? 32.323 11.671  52.782 1.00 18.79 ? 224 TYR A CD2 1 
ATOM   1628 C  CE1 . TYR A 1 201 ? 30.843 10.180  54.572 1.00 21.83 ? 224 TYR A CE1 1 
ATOM   1629 C  CE2 . TYR A 1 201 ? 32.160 12.114  54.073 1.00 19.81 ? 224 TYR A CE2 1 
ATOM   1630 C  CZ  . TYR A 1 201 ? 31.424 11.371  54.964 1.00 23.28 ? 224 TYR A CZ  1 
ATOM   1631 O  OH  . TYR A 1 201 ? 31.272 11.829  56.253 1.00 22.96 ? 224 TYR A OH  1 
ATOM   1632 N  N   . GLY A 1 202 ? 29.296 8.666   50.084 1.00 15.82 ? 225 GLY A N   1 
ATOM   1633 C  CA  . GLY A 1 202 ? 28.066 7.976   50.412 1.00 16.46 ? 225 GLY A CA  1 
ATOM   1634 C  C   . GLY A 1 202 ? 27.254 7.588   49.184 1.00 19.29 ? 225 GLY A C   1 
ATOM   1635 O  O   . GLY A 1 202 ? 27.630 7.881   48.047 1.00 16.78 ? 225 GLY A O   1 
ATOM   1636 N  N   . PRO A 1 203 ? 26.113 6.928   49.405 1.00 18.20 ? 226 PRO A N   1 
ATOM   1637 C  CA  . PRO A 1 203 ? 25.350 6.357   48.270 1.00 17.18 ? 226 PRO A CA  1 
ATOM   1638 C  C   . PRO A 1 203 ? 24.865 7.390   47.266 1.00 15.77 ? 226 PRO A C   1 
ATOM   1639 O  O   . PRO A 1 203 ? 24.930 7.150   46.053 1.00 15.73 ? 226 PRO A O   1 
ATOM   1640 C  CB  . PRO A 1 203 ? 24.156 5.656   48.946 1.00 20.62 ? 226 PRO A CB  1 
ATOM   1641 C  CG  . PRO A 1 203 ? 24.410 5.691   50.424 1.00 26.12 ? 226 PRO A CG  1 
ATOM   1642 C  CD  . PRO A 1 203 ? 25.457 6.729   50.707 1.00 23.21 ? 226 PRO A CD  1 
ATOM   1643 N  N   . MET A 1 204 ? 24.358 8.532   47.735 1.00 16.32 ? 227 MET A N   1 
ATOM   1644 C  CA  . MET A 1 204 ? 23.913 9.567   46.805 1.00 16.22 ? 227 MET A CA  1 
ATOM   1645 C  C   . MET A 1 204 ? 25.073 10.075  45.963 1.00 16.80 ? 227 MET A C   1 
ATOM   1646 O  O   . MET A 1 204 ? 24.944 10.258  44.745 1.00 17.80 ? 227 MET A O   1 
ATOM   1647 C  CB  . MET A 1 204 ? 23.271 10.722  47.575 1.00 17.92 ? 227 MET A CB  1 
ATOM   1648 C  CG  . MET A 1 204 ? 22.811 11.857  46.691 1.00 17.80 ? 227 MET A CG  1 
ATOM   1649 S  SD  . MET A 1 204 ? 21.883 13.066  47.656 1.00 18.33 ? 227 MET A SD  1 
ATOM   1650 C  CE  . MET A 1 204 ? 21.573 14.326  46.437 1.00 14.85 ? 227 MET A CE  1 
ATOM   1651 N  N   . CYS A 1 205 ? 26.215 10.331  46.602 1.00 15.00 ? 228 CYS A N   1 
ATOM   1652 C  CA  . CYS A 1 205 ? 27.415 10.696  45.858 1.00 14.60 ? 228 CYS A CA  1 
ATOM   1653 C  C   . CYS A 1 205 ? 27.732 9.655   44.788 1.00 14.91 ? 228 CYS A C   1 
ATOM   1654 O  O   . CYS A 1 205 ? 27.966 9.997   43.622 1.00 12.50 ? 228 CYS A O   1 
ATOM   1655 C  CB  . CYS A 1 205 ? 28.602 10.853  46.819 1.00 14.99 ? 228 CYS A CB  1 
ATOM   1656 S  SG  . CYS A 1 205 ? 30.207 11.024  46.004 1.00 18.11 ? 228 CYS A SG  1 
ATOM   1657 N  N   . ASP A 1 206 ? 27.725 8.370   45.166 1.00 14.50 ? 229 ASP A N   1 
ATOM   1658 C  CA  . ASP A 1 206 ? 28.179 7.328   44.245 1.00 14.55 ? 229 ASP A CA  1 
ATOM   1659 C  C   . ASP A 1 206 ? 27.253 7.200   43.039 1.00 15.87 ? 229 ASP A C   1 
ATOM   1660 O  O   . ASP A 1 206 ? 27.718 6.951   41.921 1.00 15.11 ? 229 ASP A O   1 
ATOM   1661 C  CB  . ASP A 1 206 ? 28.267 5.981   44.962 1.00 13.39 ? 229 ASP A CB  1 
ATOM   1662 C  CG  . ASP A 1 206 ? 29.297 5.965   46.091 1.00 16.56 ? 229 ASP A CG  1 
ATOM   1663 O  OD1 . ASP A 1 206 ? 30.276 6.742   46.040 1.00 18.31 ? 229 ASP A OD1 1 
ATOM   1664 O  OD2 . ASP A 1 206 ? 29.117 5.154   47.029 1.00 16.12 ? 229 ASP A OD2 1 
ATOM   1665 N  N   . ILE A 1 207 ? 25.937 7.310   43.256 1.00 12.19 ? 230 ILE A N   1 
ATOM   1666 C  CA  . ILE A 1 207 ? 24.992 7.256   42.139 1.00 15.93 ? 230 ILE A CA  1 
ATOM   1667 C  C   . ILE A 1 207 ? 25.367 8.276   41.075 1.00 15.76 ? 230 ILE A C   1 
ATOM   1668 O  O   . ILE A 1 207 ? 25.298 8.000   39.869 1.00 12.95 ? 230 ILE A O   1 
ATOM   1669 C  CB  . ILE A 1 207 ? 23.551 7.490   42.631 1.00 14.34 ? 230 ILE A CB  1 
ATOM   1670 C  CG1 . ILE A 1 207 ? 23.059 6.302   43.440 1.00 14.46 ? 230 ILE A CG1 1 
ATOM   1671 C  CG2 . ILE A 1 207 ? 22.608 7.710   41.440 1.00 16.57 ? 230 ILE A CG2 1 
ATOM   1672 C  CD1 . ILE A 1 207 ? 21.690 6.529   44.063 1.00 19.36 ? 230 ILE A CD1 1 
ATOM   1673 N  N   . LEU A 1 208 ? 25.750 9.479   41.505 1.00 11.60 ? 231 LEU A N   1 
ATOM   1674 C  CA  . LEU A 1 208 ? 26.050 10.563  40.578 1.00 10.97 ? 231 LEU A CA  1 
ATOM   1675 C  C   . LEU A 1 208 ? 27.473 10.519  40.031 1.00 12.45 ? 231 LEU A C   1 
ATOM   1676 O  O   . LEU A 1 208 ? 27.733 11.127  38.987 1.00 14.01 ? 231 LEU A O   1 
ATOM   1677 C  CB  . LEU A 1 208 ? 25.833 11.920  41.261 1.00 13.80 ? 231 LEU A CB  1 
ATOM   1678 C  CG  . LEU A 1 208 ? 24.461 12.187  41.882 1.00 13.72 ? 231 LEU A CG  1 
ATOM   1679 C  CD1 . LEU A 1 208 ? 24.484 13.532  42.625 1.00 15.61 ? 231 LEU A CD1 1 
ATOM   1680 C  CD2 . LEU A 1 208 ? 23.396 12.212  40.818 1.00 17.51 ? 231 LEU A CD2 1 
ATOM   1681 N  N   . TRP A 1 209 ? 28.401 9.833   40.703 1.00 13.56 ? 232 TRP A N   1 
ATOM   1682 C  CA  . TRP A 1 209 ? 29.818 10.005  40.410 1.00 12.53 ? 232 TRP A CA  1 
ATOM   1683 C  C   . TRP A 1 209 ? 30.566 8.763   39.922 1.00 13.23 ? 232 TRP A C   1 
ATOM   1684 O  O   . TRP A 1 209 ? 31.608 8.923   39.280 1.00 12.96 ? 232 TRP A O   1 
ATOM   1685 C  CB  . TRP A 1 209 ? 30.553 10.541  41.651 1.00 13.49 ? 232 TRP A CB  1 
ATOM   1686 C  CG  . TRP A 1 209 ? 30.424 12.034  41.819 1.00 14.00 ? 232 TRP A CG  1 
ATOM   1687 C  CD1 . TRP A 1 209 ? 29.479 12.710  42.554 1.00 14.91 ? 232 TRP A CD1 1 
ATOM   1688 C  CD2 . TRP A 1 209 ? 31.280 13.030  41.250 1.00 15.97 ? 232 TRP A CD2 1 
ATOM   1689 N  NE1 . TRP A 1 209 ? 29.703 14.071  42.470 1.00 17.10 ? 232 TRP A NE1 1 
ATOM   1690 C  CE2 . TRP A 1 209 ? 30.798 14.291  41.672 1.00 16.13 ? 232 TRP A CE2 1 
ATOM   1691 C  CE3 . TRP A 1 209 ? 32.400 12.981  40.406 1.00 13.24 ? 232 TRP A CE3 1 
ATOM   1692 C  CZ2 . TRP A 1 209 ? 31.408 15.489  41.287 1.00 16.47 ? 232 TRP A CZ2 1 
ATOM   1693 C  CZ3 . TRP A 1 209 ? 33.000 14.172  40.025 1.00 16.47 ? 232 TRP A CZ3 1 
ATOM   1694 C  CH2 . TRP A 1 209 ? 32.506 15.406  40.466 1.00 16.59 ? 232 TRP A CH2 1 
ATOM   1695 N  N   . SER A 1 210 ? 30.088 7.554   40.198 1.00 14.46 ? 233 SER A N   1 
ATOM   1696 C  CA  . SER A 1 210 ? 30.933 6.382   39.993 1.00 10.92 ? 233 SER A CA  1 
ATOM   1697 C  C   . SER A 1 210 ? 31.036 6.017   38.507 1.00 12.30 ? 233 SER A C   1 
ATOM   1698 O  O   . SER A 1 210 ? 30.212 6.412   37.685 1.00 11.85 ? 233 SER A O   1 
ATOM   1699 C  CB  . SER A 1 210 ? 30.408 5.191   40.799 1.00 13.16 ? 233 SER A CB  1 
ATOM   1700 O  OG  . SER A 1 210 ? 29.065 4.857   40.454 1.00 12.73 ? 233 SER A OG  1 
ATOM   1701 N  N   . ASP A 1 211 ? 32.067 5.239   38.180 1.00 10.79 ? 234 ASP A N   1 
ATOM   1702 C  CA  . ASP A 1 211 ? 32.417 4.827   36.827 1.00 13.72 ? 234 ASP A CA  1 
ATOM   1703 C  C   . ASP A 1 211 ? 32.688 3.335   36.810 1.00 14.90 ? 234 ASP A C   1 
ATOM   1704 O  O   . ASP A 1 211 ? 33.143 2.780   37.811 1.00 14.71 ? 234 ASP A O   1 
ATOM   1705 C  CB  . ASP A 1 211 ? 33.694 5.517   36.314 1.00 12.04 ? 234 ASP A CB  1 
ATOM   1706 C  CG  . ASP A 1 211 ? 33.535 7.002   36.106 1.00 14.26 ? 234 ASP A CG  1 
ATOM   1707 O  OD1 . ASP A 1 211 ? 32.607 7.421   35.377 1.00 14.23 ? 234 ASP A OD1 1 
ATOM   1708 O  OD2 . ASP A 1 211 ? 34.369 7.746   36.664 1.00 16.42 ? 234 ASP A OD2 1 
ATOM   1709 N  N   . PRO A 1 212 ? 32.507 2.676   35.670 1.00 13.47 ? 235 PRO A N   1 
ATOM   1710 C  CA  . PRO A 1 212 ? 33.088 1.334   35.518 1.00 11.60 ? 235 PRO A CA  1 
ATOM   1711 C  C   . PRO A 1 212 ? 34.606 1.411   35.512 1.00 15.19 ? 235 PRO A C   1 
ATOM   1712 O  O   . PRO A 1 212 ? 35.196 2.401   35.077 1.00 17.04 ? 235 PRO A O   1 
ATOM   1713 C  CB  . PRO A 1 212 ? 32.561 0.864   34.159 1.00 13.84 ? 235 PRO A CB  1 
ATOM   1714 C  CG  . PRO A 1 212 ? 32.367 2.173   33.372 1.00 12.03 ? 235 PRO A CG  1 
ATOM   1715 C  CD  . PRO A 1 212 ? 31.924 3.191   34.413 1.00 15.24 ? 235 PRO A CD  1 
ATOM   1716 N  N   . LEU A 1 213 ? 35.237 0.344   36.000 1.00 15.72 ? 236 LEU A N   1 
ATOM   1717 C  CA  . LEU A 1 213 ? 36.688 0.218   35.895 1.00 14.91 ? 236 LEU A CA  1 
ATOM   1718 C  C   . LEU A 1 213 ? 37.138 0.403   34.454 1.00 18.34 ? 236 LEU A C   1 
ATOM   1719 O  O   . LEU A 1 213 ? 36.432 0.040   33.511 1.00 15.47 ? 236 LEU A O   1 
ATOM   1720 C  CB  . LEU A 1 213 ? 37.141 -1.164  36.383 1.00 16.69 ? 236 LEU A CB  1 
ATOM   1721 C  CG  . LEU A 1 213 ? 37.165 -1.480  37.874 1.00 17.60 ? 236 LEU A CG  1 
ATOM   1722 C  CD1 . LEU A 1 213 ? 37.258 -3.003  38.074 1.00 19.82 ? 236 LEU A CD1 1 
ATOM   1723 C  CD2 . LEU A 1 213 ? 38.344 -0.787  38.526 1.00 22.28 ? 236 LEU A CD2 1 
ATOM   1724 N  N   . GLU A 1 214 ? 38.339 0.965   34.288 1.00 18.85 ? 237 GLU A N   1 
ATOM   1725 C  CA  . GLU A 1 214 ? 38.951 1.022   32.966 1.00 23.28 ? 237 GLU A CA  1 
ATOM   1726 C  C   . GLU A 1 214 ? 38.972 -0.355  32.297 1.00 21.48 ? 237 GLU A C   1 
ATOM   1727 O  O   . GLU A 1 214 ? 38.691 -0.478  31.096 1.00 16.83 ? 237 GLU A O   1 
ATOM   1728 C  CB  . GLU A 1 214 ? 40.370 1.585   33.077 1.00 25.48 ? 237 GLU A CB  1 
ATOM   1729 C  CG  . GLU A 1 214 ? 41.152 1.546   31.774 1.00 34.06 ? 237 GLU A CG  1 
ATOM   1730 C  CD  . GLU A 1 214 ? 40.755 2.655   30.820 1.00 47.07 ? 237 GLU A CD  1 
ATOM   1731 O  OE1 . GLU A 1 214 ? 39.998 3.559   31.238 1.00 48.57 ? 237 GLU A OE1 1 
ATOM   1732 O  OE2 . GLU A 1 214 ? 41.202 2.629   29.652 1.00 52.52 ? 237 GLU A OE2 1 
ATOM   1733 N  N   . ASP A 1 215 ? 39.305 -1.403  33.051 1.00 19.73 ? 238 ASP A N   1 
ATOM   1734 C  CA  A ASP A 1 215 ? 39.350 -2.760  32.513 0.61 22.53 ? 238 ASP A CA  1 
ATOM   1735 C  CA  B ASP A 1 215 ? 39.353 -2.763  32.524 0.39 22.55 ? 238 ASP A CA  1 
ATOM   1736 C  C   . ASP A 1 215 ? 38.085 -3.555  32.833 1.00 21.57 ? 238 ASP A C   1 
ATOM   1737 O  O   . ASP A 1 215 ? 38.135 -4.787  32.949 1.00 22.15 ? 238 ASP A O   1 
ATOM   1738 C  CB  A ASP A 1 215 ? 40.598 -3.492  33.015 0.61 24.30 ? 238 ASP A CB  1 
ATOM   1739 C  CB  B ASP A 1 215 ? 40.583 -3.495  33.061 0.39 24.31 ? 238 ASP A CB  1 
ATOM   1740 C  CG  A ASP A 1 215 ? 40.694 -3.518  34.527 0.61 26.58 ? 238 ASP A CG  1 
ATOM   1741 C  CG  B ASP A 1 215 ? 41.881 -2.909  32.544 0.39 24.12 ? 238 ASP A CG  1 
ATOM   1742 O  OD1 A ASP A 1 215 ? 39.990 -2.717  35.180 0.61 28.19 ? 238 ASP A OD1 1 
ATOM   1743 O  OD1 B ASP A 1 215 ? 41.840 -2.095  31.597 0.39 30.68 ? 238 ASP A OD1 1 
ATOM   1744 O  OD2 A ASP A 1 215 ? 41.479 -4.321  35.069 0.61 29.96 ? 238 ASP A OD2 1 
ATOM   1745 O  OD2 B ASP A 1 215 ? 42.944 -3.264  33.086 0.39 29.81 ? 238 ASP A OD2 1 
ATOM   1746 N  N   . PHE A 1 216 ? 36.949 -2.871  32.968 1.00 19.30 ? 239 PHE A N   1 
ATOM   1747 C  CA  . PHE A 1 216 ? 35.651 -3.489  33.214 1.00 14.18 ? 239 PHE A CA  1 
ATOM   1748 C  C   . PHE A 1 216 ? 35.461 -4.732  32.358 1.00 17.77 ? 239 PHE A C   1 
ATOM   1749 O  O   . PHE A 1 216 ? 35.565 -4.670  31.128 1.00 19.22 ? 239 PHE A O   1 
ATOM   1750 C  CB  . PHE A 1 216 ? 34.538 -2.474  32.910 1.00 14.05 ? 239 PHE A CB  1 
ATOM   1751 C  CG  . PHE A 1 216 ? 33.154 -2.941  33.283 1.00 19.63 ? 239 PHE A CG  1 
ATOM   1752 C  CD1 . PHE A 1 216 ? 32.643 -2.704  34.556 1.00 15.50 ? 239 PHE A CD1 1 
ATOM   1753 C  CD2 . PHE A 1 216 ? 32.348 -3.589  32.353 1.00 16.44 ? 239 PHE A CD2 1 
ATOM   1754 C  CE1 . PHE A 1 216 ? 31.343 -3.121  34.906 1.00 17.80 ? 239 PHE A CE1 1 
ATOM   1755 C  CE2 . PHE A 1 216 ? 31.051 -4.008  32.690 1.00 16.40 ? 239 PHE A CE2 1 
ATOM   1756 C  CZ  . PHE A 1 216 ? 30.547 -3.773  33.969 1.00 14.08 ? 239 PHE A CZ  1 
ATOM   1757 N  N   . GLY A 1 217 ? 35.180 -5.863  33.012 1.00 16.44 ? 240 GLY A N   1 
ATOM   1758 C  CA  . GLY A 1 217 ? 34.965 -7.130  32.333 1.00 21.72 ? 240 GLY A CA  1 
ATOM   1759 C  C   . GLY A 1 217 ? 36.184 -8.031  32.275 1.00 20.39 ? 240 GLY A C   1 
ATOM   1760 O  O   . GLY A 1 217 ? 36.060 -9.203  31.880 1.00 22.83 ? 240 GLY A O   1 
ATOM   1761 N  N   . ASN A 1 218 ? 37.351 -7.525  32.659 1.00 23.13 ? 241 ASN A N   1 
ATOM   1762 C  CA  . ASN A 1 218 ? 38.577 -8.313  32.705 1.00 32.94 ? 241 ASN A CA  1 
ATOM   1763 C  C   . ASN A 1 218 ? 39.377 -7.886  33.934 1.00 32.67 ? 241 ASN A C   1 
ATOM   1764 O  O   . ASN A 1 218 ? 40.518 -7.436  33.859 1.00 33.49 ? 241 ASN A O   1 
ATOM   1765 C  CB  . ASN A 1 218 ? 39.371 -8.134  31.422 1.00 35.29 ? 241 ASN A CB  1 
ATOM   1766 C  CG  . ASN A 1 218 ? 40.620 -9.003  31.363 1.00 41.06 ? 241 ASN A CG  1 
ATOM   1767 O  OD1 . ASN A 1 218 ? 40.537 -10.233 31.311 1.00 50.40 ? 241 ASN A OD1 1 
ATOM   1768 N  ND2 . ASN A 1 218 ? 41.783 -8.361  31.337 1.00 42.87 ? 241 ASN A ND2 1 
ATOM   1769 N  N   . GLU A 1 219 ? 38.736 -8.016  35.090 1.00 34.57 ? 242 GLU A N   1 
ATOM   1770 C  CA  . GLU A 1 219 ? 39.328 -7.576  36.343 1.00 38.49 ? 242 GLU A CA  1 
ATOM   1771 C  C   . GLU A 1 219 ? 40.486 -8.486  36.731 1.00 37.66 ? 242 GLU A C   1 
ATOM   1772 O  O   . GLU A 1 219 ? 40.395 -9.709  36.615 1.00 35.68 ? 242 GLU A O   1 
ATOM   1773 C  CB  . GLU A 1 219 ? 38.271 -7.573  37.449 1.00 38.97 ? 242 GLU A CB  1 
ATOM   1774 C  CG  . GLU A 1 219 ? 37.216 -6.484  37.320 1.00 34.76 ? 242 GLU A CG  1 
ATOM   1775 C  CD  . GLU A 1 219 ? 36.219 -6.701  36.175 1.00 22.12 ? 242 GLU A CD  1 
ATOM   1776 O  OE1 . GLU A 1 219 ? 36.150 -7.800  35.591 1.00 29.01 ? 242 GLU A OE1 1 
ATOM   1777 O  OE2 . GLU A 1 219 ? 35.492 -5.755  35.870 1.00 18.78 ? 242 GLU A OE2 1 
ATOM   1778 N  N   . LYS A 1 220 ? 41.579 -7.874  37.195 1.00 45.06 ? 243 LYS A N   1 
ATOM   1779 C  CA  . LYS A 1 220 ? 42.720 -8.620  37.711 1.00 51.67 ? 243 LYS A CA  1 
ATOM   1780 C  C   . LYS A 1 220 ? 42.512 -9.066  39.150 1.00 50.93 ? 243 LYS A C   1 
ATOM   1781 O  O   . LYS A 1 220 ? 43.159 -10.023 39.590 1.00 48.70 ? 243 LYS A O   1 
ATOM   1782 C  CB  . LYS A 1 220 ? 43.994 -7.773  37.615 1.00 36.90 ? 243 LYS A CB  1 
ATOM   1783 N  N   . THR A 1 221 ? 41.635 -8.394  39.887 1.00 52.99 ? 244 THR A N   1 
ATOM   1784 C  CA  . THR A 1 221 ? 41.328 -8.718  41.273 1.00 55.14 ? 244 THR A CA  1 
ATOM   1785 C  C   . THR A 1 221 ? 39.827 -8.968  41.409 1.00 53.26 ? 244 THR A C   1 
ATOM   1786 O  O   . THR A 1 221 ? 39.086 -9.011  40.422 1.00 52.74 ? 244 THR A O   1 
ATOM   1787 C  CB  . THR A 1 221 ? 41.775 -7.598  42.216 1.00 53.92 ? 244 THR A CB  1 
ATOM   1788 O  OG1 . THR A 1 221 ? 40.933 -6.454  42.022 1.00 57.29 ? 244 THR A OG1 1 
ATOM   1789 C  CG2 . THR A 1 221 ? 43.231 -7.216  41.961 1.00 44.00 ? 244 THR A CG2 1 
ATOM   1790 N  N   . GLN A 1 222 ? 39.380 -9.116  42.657 1.00 45.52 ? 245 GLN A N   1 
ATOM   1791 C  CA  . GLN A 1 222 ? 37.980 -9.382  42.959 1.00 44.03 ? 245 GLN A CA  1 
ATOM   1792 C  C   . GLN A 1 222 ? 37.327 -8.239  43.733 1.00 35.20 ? 245 GLN A C   1 
ATOM   1793 O  O   . GLN A 1 222 ? 36.267 -8.436  44.338 1.00 40.68 ? 245 GLN A O   1 
ATOM   1794 C  CB  . GLN A 1 222 ? 37.845 -10.694 43.737 1.00 53.45 ? 245 GLN A CB  1 
ATOM   1795 N  N   . GLU A 1 223 ? 37.922 -7.048  43.721 1.00 37.57 ? 246 GLU A N   1 
ATOM   1796 C  CA  . GLU A 1 223 ? 37.389 -5.920  44.482 1.00 31.43 ? 246 GLU A CA  1 
ATOM   1797 C  C   . GLU A 1 223 ? 36.248 -5.265  43.707 1.00 27.07 ? 246 GLU A C   1 
ATOM   1798 O  O   . GLU A 1 223 ? 36.468 -4.675  42.644 1.00 26.83 ? 246 GLU A O   1 
ATOM   1799 C  CB  . GLU A 1 223 ? 38.496 -4.919  44.784 1.00 40.19 ? 246 GLU A CB  1 
ATOM   1800 C  CG  . GLU A 1 223 ? 38.673 -4.661  46.269 1.00 47.30 ? 246 GLU A CG  1 
ATOM   1801 C  CD  . GLU A 1 223 ? 39.932 -3.890  46.577 1.00 63.83 ? 246 GLU A CD  1 
ATOM   1802 O  OE1 . GLU A 1 223 ? 40.811 -3.808  45.688 1.00 58.22 ? 246 GLU A OE1 1 
ATOM   1803 O  OE2 . GLU A 1 223 ? 40.038 -3.367  47.708 1.00 71.40 ? 246 GLU A OE2 1 
ATOM   1804 N  N   . HIS A 1 224 ? 35.031 -5.349  44.254 1.00 22.36 ? 247 HIS A N   1 
ATOM   1805 C  CA  . HIS A 1 224 ? 33.858 -4.846  43.546 1.00 22.72 ? 247 HIS A CA  1 
ATOM   1806 C  C   . HIS A 1 224 ? 33.908 -3.334  43.372 1.00 25.12 ? 247 HIS A C   1 
ATOM   1807 O  O   . HIS A 1 224 ? 33.554 -2.814  42.304 1.00 20.38 ? 247 HIS A O   1 
ATOM   1808 C  CB  . HIS A 1 224 ? 32.585 -5.255  44.285 1.00 20.79 ? 247 HIS A CB  1 
ATOM   1809 C  CG  . HIS A 1 224 ? 32.207 -6.686  44.069 1.00 23.51 ? 247 HIS A CG  1 
ATOM   1810 N  ND1 . HIS A 1 224 ? 30.946 -7.176  44.334 1.00 28.30 ? 247 HIS A ND1 1 
ATOM   1811 C  CD2 . HIS A 1 224 ? 32.926 -7.733  43.598 1.00 30.34 ? 247 HIS A CD2 1 
ATOM   1812 C  CE1 . HIS A 1 224 ? 30.906 -8.463  44.039 1.00 25.56 ? 247 HIS A CE1 1 
ATOM   1813 N  NE2 . HIS A 1 224 ? 32.094 -8.825  43.589 1.00 33.24 ? 247 HIS A NE2 1 
ATOM   1814 N  N   . PHE A 1 225 ? 34.326 -2.615  44.407 1.00 19.86 ? 248 PHE A N   1 
ATOM   1815 C  CA  . PHE A 1 225 ? 34.398 -1.161  44.364 1.00 19.96 ? 248 PHE A CA  1 
ATOM   1816 C  C   . PHE A 1 225 ? 35.787 -0.733  44.798 1.00 21.88 ? 248 PHE A C   1 
ATOM   1817 O  O   . PHE A 1 225 ? 36.276 -1.165  45.848 1.00 25.71 ? 248 PHE A O   1 
ATOM   1818 C  CB  . PHE A 1 225 ? 33.328 -0.527  45.261 1.00 20.93 ? 248 PHE A CB  1 
ATOM   1819 C  CG  . PHE A 1 225 ? 31.928 -0.739  44.762 1.00 21.63 ? 248 PHE A CG  1 
ATOM   1820 C  CD1 . PHE A 1 225 ? 31.204 -1.865  45.140 1.00 20.76 ? 248 PHE A CD1 1 
ATOM   1821 C  CD2 . PHE A 1 225 ? 31.342 0.179   43.895 1.00 18.77 ? 248 PHE A CD2 1 
ATOM   1822 C  CE1 . PHE A 1 225 ? 29.911 -2.074  44.673 1.00 21.11 ? 248 PHE A CE1 1 
ATOM   1823 C  CE2 . PHE A 1 225 ? 30.056 -0.018  43.425 1.00 17.27 ? 248 PHE A CE2 1 
ATOM   1824 C  CZ  . PHE A 1 225 ? 29.336 -1.148  43.810 1.00 19.92 ? 248 PHE A CZ  1 
ATOM   1825 N  N   . THR A 1 226 ? 36.426 0.092   43.985 1.00 20.28 ? 249 THR A N   1 
ATOM   1826 C  CA  . THR A 1 226 ? 37.744 0.618   44.298 1.00 19.22 ? 249 THR A CA  1 
ATOM   1827 C  C   . THR A 1 226 ? 37.696 2.131   44.174 1.00 24.35 ? 249 THR A C   1 
ATOM   1828 O  O   . THR A 1 226 ? 36.964 2.673   43.343 1.00 20.50 ? 249 THR A O   1 
ATOM   1829 C  CB  . THR A 1 226 ? 38.813 0.030   43.362 1.00 30.79 ? 249 THR A CB  1 
ATOM   1830 O  OG1 . THR A 1 226 ? 38.417 0.234   42.004 1.00 30.99 ? 249 THR A OG1 1 
ATOM   1831 C  CG2 . THR A 1 226 ? 38.960 -1.459  43.593 1.00 28.00 ? 249 THR A CG2 1 
ATOM   1832 N  N   . HIS A 1 227 ? 38.477 2.825   44.996 1.00 22.44 ? 250 HIS A N   1 
ATOM   1833 C  CA  A HIS A 1 227 ? 38.432 4.289   45.030 0.46 22.59 ? 250 HIS A CA  1 
ATOM   1834 C  CA  B HIS A 1 227 ? 38.327 4.267   45.004 0.54 22.58 ? 250 HIS A CA  1 
ATOM   1835 C  C   . HIS A 1 227 ? 38.720 4.859   43.650 1.00 22.91 ? 250 HIS A C   1 
ATOM   1836 O  O   . HIS A 1 227 ? 39.662 4.422   42.986 1.00 22.10 ? 250 HIS A O   1 
ATOM   1837 C  CB  A HIS A 1 227 ? 39.449 4.834   46.039 0.46 23.66 ? 250 HIS A CB  1 
ATOM   1838 C  CB  B HIS A 1 227 ? 39.094 4.853   46.185 0.54 23.48 ? 250 HIS A CB  1 
ATOM   1839 C  CG  A HIS A 1 227 ? 39.854 6.256   45.783 0.46 23.47 ? 250 HIS A CG  1 
ATOM   1840 C  CG  B HIS A 1 227 ? 38.514 4.435   47.503 0.54 17.36 ? 250 HIS A CG  1 
ATOM   1841 N  ND1 A HIS A 1 227 ? 39.060 7.331   46.121 0.46 24.08 ? 250 HIS A ND1 1 
ATOM   1842 N  ND1 B HIS A 1 227 ? 37.453 5.091   48.093 0.54 20.12 ? 250 HIS A ND1 1 
ATOM   1843 C  CD2 A HIS A 1 227 ? 40.966 6.778   45.212 0.46 24.58 ? 250 HIS A CD2 1 
ATOM   1844 C  CD2 B HIS A 1 227 ? 38.799 3.385   48.310 0.54 15.69 ? 250 HIS A CD2 1 
ATOM   1845 C  CE1 A HIS A 1 227 ? 39.665 8.452   45.772 0.46 23.74 ? 250 HIS A CE1 1 
ATOM   1846 C  CE1 B HIS A 1 227 ? 37.133 4.483   49.221 0.54 18.36 ? 250 HIS A CE1 1 
ATOM   1847 N  NE2 A HIS A 1 227 ? 40.825 8.144   45.220 0.46 24.21 ? 250 HIS A NE2 1 
ATOM   1848 N  NE2 B HIS A 1 227 ? 37.933 3.442   49.375 0.54 20.99 ? 250 HIS A NE2 1 
ATOM   1849 N  N   . ASN A 1 228 ? 37.904 5.817   43.208 1.00 21.51 ? 251 ASN A N   1 
ATOM   1850 C  CA  . ASN A 1 228 ? 37.956 6.342   41.840 1.00 21.18 ? 251 ASN A CA  1 
ATOM   1851 C  C   . ASN A 1 228 ? 39.005 7.443   41.764 1.00 24.80 ? 251 ASN A C   1 
ATOM   1852 O  O   . ASN A 1 228 ? 38.758 8.583   42.168 1.00 23.71 ? 251 ASN A O   1 
ATOM   1853 C  CB  . ASN A 1 228 ? 36.577 6.849   41.418 1.00 17.00 ? 251 ASN A CB  1 
ATOM   1854 C  CG  . ASN A 1 228 ? 36.497 7.211   39.929 1.00 19.83 ? 251 ASN A CG  1 
ATOM   1855 O  OD1 . ASN A 1 228 ? 37.426 7.784   39.354 1.00 16.81 ? 251 ASN A OD1 1 
ATOM   1856 N  ND2 . ASN A 1 228 ? 35.361 6.890   39.312 1.00 15.29 ? 251 ASN A ND2 1 
ATOM   1857 N  N   . THR A 1 229 ? 40.171 7.099   41.208 1.00 27.37 ? 252 THR A N   1 
ATOM   1858 C  CA  . THR A 1 229 ? 41.305 8.004   41.095 1.00 34.07 ? 252 THR A CA  1 
ATOM   1859 C  C   . THR A 1 229 ? 41.179 8.991   39.939 1.00 30.30 ? 252 THR A C   1 
ATOM   1860 O  O   . THR A 1 229 ? 41.954 9.948   39.882 1.00 36.72 ? 252 THR A O   1 
ATOM   1861 C  CB  . THR A 1 229 ? 42.599 7.191   40.945 1.00 33.78 ? 252 THR A CB  1 
ATOM   1862 O  OG1 . THR A 1 229 ? 42.476 6.288   39.839 1.00 34.60 ? 252 THR A OG1 1 
ATOM   1863 C  CG2 . THR A 1 229 ? 42.861 6.388   42.203 1.00 25.22 ? 252 THR A CG2 1 
ATOM   1864 N  N   . VAL A 1 230 ? 40.237 8.785   39.020 1.00 27.88 ? 253 VAL A N   1 
ATOM   1865 C  CA  . VAL A 1 230 ? 39.967 9.785   37.991 1.00 26.46 ? 253 VAL A CA  1 
ATOM   1866 C  C   . VAL A 1 230 ? 39.124 10.921  38.561 1.00 26.63 ? 253 VAL A C   1 
ATOM   1867 O  O   . VAL A 1 230 ? 39.444 12.103  38.391 1.00 28.63 ? 253 VAL A O   1 
ATOM   1868 C  CB  . VAL A 1 230 ? 39.285 9.127   36.777 1.00 29.66 ? 253 VAL A CB  1 
ATOM   1869 C  CG1 . VAL A 1 230 ? 38.828 10.180  35.776 1.00 29.60 ? 253 VAL A CG1 1 
ATOM   1870 C  CG2 . VAL A 1 230 ? 40.218 8.104   36.120 1.00 33.34 ? 253 VAL A CG2 1 
ATOM   1871 N  N   . ARG A 1 231 ? 38.039 10.583  39.258 1.00 21.42 ? 254 ARG A N   1 
ATOM   1872 C  CA  . ARG A 1 231 ? 37.154 11.600  39.818 1.00 19.85 ? 254 ARG A CA  1 
ATOM   1873 C  C   . ARG A 1 231 ? 37.700 12.218  41.097 1.00 23.87 ? 254 ARG A C   1 
ATOM   1874 O  O   . ARG A 1 231 ? 37.294 13.332  41.452 1.00 25.83 ? 254 ARG A O   1 
ATOM   1875 C  CB  . ARG A 1 231 ? 35.775 10.994  40.110 1.00 19.75 ? 254 ARG A CB  1 
ATOM   1876 C  CG  . ARG A 1 231 ? 35.146 10.270  38.923 1.00 16.60 ? 254 ARG A CG  1 
ATOM   1877 C  CD  . ARG A 1 231 ? 34.816 11.243  37.792 1.00 19.23 ? 254 ARG A CD  1 
ATOM   1878 N  NE  . ARG A 1 231 ? 34.178 10.537  36.685 1.00 15.54 ? 254 ARG A NE  1 
ATOM   1879 C  CZ  . ARG A 1 231 ? 33.651 11.126  35.623 1.00 15.67 ? 254 ARG A CZ  1 
ATOM   1880 N  NH1 . ARG A 1 231 ? 33.683 12.444  35.515 1.00 14.70 ? 254 ARG A NH1 1 
ATOM   1881 N  NH2 . ARG A 1 231 ? 33.084 10.386  34.672 1.00 13.21 ? 254 ARG A NH2 1 
ATOM   1882 N  N   . GLY A 1 232 ? 38.581 11.521  41.813 1.00 21.78 ? 255 GLY A N   1 
ATOM   1883 C  CA  . GLY A 1 232 ? 38.955 11.970  43.142 1.00 26.96 ? 255 GLY A CA  1 
ATOM   1884 C  C   . GLY A 1 232 ? 37.884 11.791  44.197 1.00 35.53 ? 255 GLY A C   1 
ATOM   1885 O  O   . GLY A 1 232 ? 38.055 12.278  45.323 1.00 32.47 ? 255 GLY A O   1 
ATOM   1886 N  N   . CYS A 1 233 ? 36.778 11.127  43.867 1.00 23.00 ? 256 CYS A N   1 
ATOM   1887 C  CA  . CYS A 1 233 ? 35.762 10.759  44.842 1.00 23.61 ? 256 CYS A CA  1 
ATOM   1888 C  C   . CYS A 1 233 ? 35.040 9.526   44.313 1.00 21.67 ? 256 CYS A C   1 
ATOM   1889 O  O   . CYS A 1 233 ? 35.240 9.119   43.168 1.00 22.03 ? 256 CYS A O   1 
ATOM   1890 C  CB  . CYS A 1 233 ? 34.793 11.918  45.108 1.00 22.14 ? 256 CYS A CB  1 
ATOM   1891 S  SG  . CYS A 1 233 ? 33.726 12.371  43.690 1.00 25.63 ? 256 CYS A SG  1 
ATOM   1892 N  N   . SER A 1 234 ? 34.228 8.915   45.169 1.00 18.41 ? 257 SER A N   1 
ATOM   1893 C  CA  . SER A 1 234 ? 33.383 7.764   44.814 1.00 16.34 ? 257 SER A CA  1 
ATOM   1894 C  C   . SER A 1 234 ? 34.271 6.609   44.328 1.00 17.85 ? 257 SER A C   1 
ATOM   1895 O  O   . SER A 1 234 ? 35.430 6.474   44.751 1.00 18.86 ? 257 SER A O   1 
ATOM   1896 C  CB  . SER A 1 234 ? 32.301 8.201   43.827 1.00 16.45 ? 257 SER A CB  1 
ATOM   1897 O  OG  . SER A 1 234 ? 31.404 7.131   43.554 1.00 15.84 ? 257 SER A OG  1 
ATOM   1898 N  N   . TYR A 1 235 ? 33.751 5.777   43.421 1.00 16.31 ? 258 TYR A N   1 
ATOM   1899 C  CA  . TYR A 1 235 ? 34.342 4.474   43.141 1.00 18.07 ? 258 TYR A CA  1 
ATOM   1900 C  C   . TYR A 1 235 ? 34.354 4.152   41.655 1.00 17.16 ? 258 TYR A C   1 
ATOM   1901 O  O   . TYR A 1 235 ? 33.629 4.745   40.848 1.00 14.73 ? 258 TYR A O   1 
ATOM   1902 C  CB  . TYR A 1 235 ? 33.582 3.352   43.856 1.00 15.33 ? 258 TYR A CB  1 
ATOM   1903 C  CG  . TYR A 1 235 ? 33.590 3.515   45.347 1.00 19.00 ? 258 TYR A CG  1 
ATOM   1904 C  CD1 . TYR A 1 235 ? 34.634 3.008   46.102 1.00 19.80 ? 258 TYR A CD1 1 
ATOM   1905 C  CD2 . TYR A 1 235 ? 32.570 4.206   46.002 1.00 16.49 ? 258 TYR A CD2 1 
ATOM   1906 C  CE1 . TYR A 1 235 ? 34.661 3.158   47.464 1.00 21.00 ? 258 TYR A CE1 1 
ATOM   1907 C  CE2 . TYR A 1 235 ? 32.591 4.364   47.373 1.00 21.40 ? 258 TYR A CE2 1 
ATOM   1908 C  CZ  . TYR A 1 235 ? 33.647 3.836   48.100 1.00 24.61 ? 258 TYR A CZ  1 
ATOM   1909 O  OH  . TYR A 1 235 ? 33.699 3.983   49.468 1.00 25.96 ? 258 TYR A OH  1 
ATOM   1910 N  N   . PHE A 1 236 ? 35.230 3.206   41.311 1.00 16.98 ? 259 PHE A N   1 
ATOM   1911 C  CA  . PHE A 1 236 ? 35.089 2.382   40.120 1.00 18.95 ? 259 PHE A CA  1 
ATOM   1912 C  C   . PHE A 1 236 ? 34.351 1.109   40.500 1.00 19.88 ? 259 PHE A C   1 
ATOM   1913 O  O   . PHE A 1 236 ? 34.680 0.481   41.511 1.00 18.86 ? 259 PHE A O   1 
ATOM   1914 C  CB  . PHE A 1 236 ? 36.446 1.982   39.550 1.00 16.74 ? 259 PHE A CB  1 
ATOM   1915 C  CG  . PHE A 1 236 ? 37.252 3.109   39.005 1.00 20.63 ? 259 PHE A CG  1 
ATOM   1916 C  CD1 . PHE A 1 236 ? 36.824 3.812   37.891 1.00 18.60 ? 259 PHE A CD1 1 
ATOM   1917 C  CD2 . PHE A 1 236 ? 38.485 3.427   39.569 1.00 22.76 ? 259 PHE A CD2 1 
ATOM   1918 C  CE1 . PHE A 1 236 ? 37.593 4.837   37.369 1.00 19.93 ? 259 PHE A CE1 1 
ATOM   1919 C  CE2 . PHE A 1 236 ? 39.257 4.453   39.046 1.00 27.83 ? 259 PHE A CE2 1 
ATOM   1920 C  CZ  . PHE A 1 236 ? 38.807 5.157   37.945 1.00 25.27 ? 259 PHE A CZ  1 
ATOM   1921 N  N   . TYR A 1 237 ? 33.377 0.707   39.685 1.00 15.78 ? 260 TYR A N   1 
ATOM   1922 C  CA  . TYR A 1 237 ? 32.703 -0.566  39.917 1.00 16.11 ? 260 TYR A CA  1 
ATOM   1923 C  C   . TYR A 1 237 ? 33.123 -1.595  38.874 1.00 16.80 ? 260 TYR A C   1 
ATOM   1924 O  O   . TYR A 1 237 ? 33.383 -1.260  37.719 1.00 14.68 ? 260 TYR A O   1 
ATOM   1925 C  CB  . TYR A 1 237 ? 31.175 -0.412  39.931 1.00 16.19 ? 260 TYR A CB  1 
ATOM   1926 C  CG  . TYR A 1 237 ? 30.561 0.454   38.842 1.00 16.21 ? 260 TYR A CG  1 
ATOM   1927 C  CD1 . TYR A 1 237 ? 30.236 -0.080  37.589 1.00 13.13 ? 260 TYR A CD1 1 
ATOM   1928 C  CD2 . TYR A 1 237 ? 30.270 1.797   39.083 1.00 11.81 ? 260 TYR A CD2 1 
ATOM   1929 C  CE1 . TYR A 1 237 ? 29.637 0.708   36.595 1.00 12.94 ? 260 TYR A CE1 1 
ATOM   1930 C  CE2 . TYR A 1 237 ? 29.685 2.606   38.093 1.00 11.26 ? 260 TYR A CE2 1 
ATOM   1931 C  CZ  . TYR A 1 237 ? 29.367 2.047   36.861 1.00 15.23 ? 260 TYR A CZ  1 
ATOM   1932 O  OH  . TYR A 1 237 ? 28.791 2.839   35.905 1.00 13.68 ? 260 TYR A OH  1 
ATOM   1933 N  N   . SER A 1 238 ? 33.196 -2.855  39.299 1.00 20.12 ? 261 SER A N   1 
ATOM   1934 C  CA  . SER A 1 238 ? 33.661 -3.946  38.455 1.00 17.16 ? 261 SER A CA  1 
ATOM   1935 C  C   . SER A 1 238 ? 32.486 -4.653  37.782 1.00 16.59 ? 261 SER A C   1 
ATOM   1936 O  O   . SER A 1 238 ? 31.320 -4.471  38.137 1.00 13.67 ? 261 SER A O   1 
ATOM   1937 C  CB  . SER A 1 238 ? 34.464 -4.952  39.289 1.00 18.85 ? 261 SER A CB  1 
ATOM   1938 O  OG  . SER A 1 238 ? 33.584 -5.658  40.151 1.00 19.39 ? 261 SER A OG  1 
ATOM   1939 N  N   . TYR A 1 239 ? 32.813 -5.480  36.795 1.00 16.44 ? 262 TYR A N   1 
ATOM   1940 C  CA  . TYR A 1 239 ? 31.789 -6.280  36.126 1.00 19.83 ? 262 TYR A CA  1 
ATOM   1941 C  C   . TYR A 1 239 ? 31.108 -7.265  37.071 1.00 16.60 ? 262 TYR A C   1 
ATOM   1942 O  O   . TYR A 1 239 ? 29.865 -7.337  37.063 1.00 15.41 ? 262 TYR A O   1 
ATOM   1943 C  CB  . TYR A 1 239 ? 32.429 -6.959  34.907 1.00 19.01 ? 262 TYR A CB  1 
ATOM   1944 C  CG  . TYR A 1 239 ? 31.638 -8.065  34.242 1.00 17.65 ? 262 TYR A CG  1 
ATOM   1945 C  CD1 . TYR A 1 239 ? 30.625 -7.780  33.332 1.00 19.12 ? 262 TYR A CD1 1 
ATOM   1946 C  CD2 . TYR A 1 239 ? 31.965 -9.401  34.469 1.00 24.17 ? 262 TYR A CD2 1 
ATOM   1947 C  CE1 . TYR A 1 239 ? 29.929 -8.792  32.701 1.00 17.97 ? 262 TYR A CE1 1 
ATOM   1948 C  CE2 . TYR A 1 239 ? 31.284 -10.418 33.845 1.00 21.65 ? 262 TYR A CE2 1 
ATOM   1949 C  CZ  . TYR A 1 239 ? 30.271 -10.115 32.961 1.00 23.48 ? 262 TYR A CZ  1 
ATOM   1950 O  OH  . TYR A 1 239 ? 29.593 -11.135 32.338 1.00 22.95 ? 262 TYR A OH  1 
ATOM   1951 N  N   . PRO A 1 240 ? 31.825 -8.027  37.909 1.00 17.21 ? 263 PRO A N   1 
ATOM   1952 C  CA  . PRO A 1 240 ? 31.115 -8.819  38.931 1.00 21.41 ? 263 PRO A CA  1 
ATOM   1953 C  C   . PRO A 1 240 ? 30.229 -7.973  39.837 1.00 24.01 ? 263 PRO A C   1 
ATOM   1954 O  O   . PRO A 1 240 ? 29.139 -8.416  40.215 1.00 21.60 ? 263 PRO A O   1 
ATOM   1955 C  CB  . PRO A 1 240 ? 32.259 -9.490  39.710 1.00 24.20 ? 263 PRO A CB  1 
ATOM   1956 C  CG  . PRO A 1 240 ? 33.407 -9.534  38.742 1.00 25.60 ? 263 PRO A CG  1 
ATOM   1957 C  CD  . PRO A 1 240 ? 33.284 -8.247  37.959 1.00 18.69 ? 263 PRO A CD  1 
ATOM   1958 N  N   . ALA A 1 241 ? 30.660 -6.758  40.190 1.00 18.43 ? 264 ALA A N   1 
ATOM   1959 C  CA  . ALA A 1 241 ? 29.815 -5.900  41.018 1.00 18.67 ? 264 ALA A CA  1 
ATOM   1960 C  C   . ALA A 1 241 ? 28.485 -5.627  40.329 1.00 16.79 ? 264 ALA A C   1 
ATOM   1961 O  O   . ALA A 1 241 ? 27.413 -5.744  40.940 1.00 18.65 ? 264 ALA A O   1 
ATOM   1962 C  CB  . ALA A 1 241 ? 30.541 -4.593  41.333 1.00 16.21 ? 264 ALA A CB  1 
ATOM   1963 N  N   . VAL A 1 242 ? 28.532 -5.267  39.046 1.00 17.92 ? 265 VAL A N   1 
ATOM   1964 C  CA  . VAL A 1 242 ? 27.307 -4.962  38.305 1.00 16.72 ? 265 VAL A CA  1 
ATOM   1965 C  C   . VAL A 1 242 ? 26.436 -6.206  38.163 1.00 18.12 ? 265 VAL A C   1 
ATOM   1966 O  O   . VAL A 1 242 ? 25.220 -6.168  38.394 1.00 16.56 ? 265 VAL A O   1 
ATOM   1967 C  CB  . VAL A 1 242 ? 27.654 -4.368  36.929 1.00 17.13 ? 265 VAL A CB  1 
ATOM   1968 C  CG1 . VAL A 1 242 ? 26.405 -4.294  36.060 1.00 16.97 ? 265 VAL A CG1 1 
ATOM   1969 C  CG2 . VAL A 1 242 ? 28.292 -2.974  37.088 1.00 14.95 ? 265 VAL A CG2 1 
ATOM   1970 N  N   . CYS A 1 243 ? 27.038 -7.324  37.750 1.00 16.90 ? 266 CYS A N   1 
ATOM   1971 C  CA  . CYS A 1 243 ? 26.241 -8.520  37.485 1.00 20.15 ? 266 CYS A CA  1 
ATOM   1972 C  C   . CYS A 1 243 ? 25.551 -9.017  38.749 1.00 18.94 ? 266 CYS A C   1 
ATOM   1973 O  O   . CYS A 1 243 ? 24.390 -9.446  38.712 1.00 20.26 ? 266 CYS A O   1 
ATOM   1974 C  CB  . CYS A 1 243 ? 27.128 -9.606  36.886 1.00 20.41 ? 266 CYS A CB  1 
ATOM   1975 S  SG  . CYS A 1 243 ? 27.640 -9.222  35.188 1.00 24.16 ? 266 CYS A SG  1 
ATOM   1976 N  N   . GLU A 1 244 ? 26.245 -8.941  39.879 1.00 18.11 ? 267 GLU A N   1 
ATOM   1977 C  CA  . GLU A 1 244 ? 25.646 -9.313  41.156 1.00 24.53 ? 267 GLU A CA  1 
ATOM   1978 C  C   . GLU A 1 244 ? 24.454 -8.423  41.497 1.00 24.42 ? 267 GLU A C   1 
ATOM   1979 O  O   . GLU A 1 244 ? 23.418 -8.914  41.968 1.00 21.14 ? 267 GLU A O   1 
ATOM   1980 C  CB  . GLU A 1 244 ? 26.709 -9.239  42.246 1.00 24.26 ? 267 GLU A CB  1 
ATOM   1981 C  CG  . GLU A 1 244 ? 26.173 -9.277  43.659 1.00 43.80 ? 267 GLU A CG  1 
ATOM   1982 C  CD  . GLU A 1 244 ? 27.270 -9.516  44.678 1.00 53.10 ? 267 GLU A CD  1 
ATOM   1983 O  OE1 . GLU A 1 244 ? 28.155 -10.364 44.411 1.00 52.63 ? 267 GLU A OE1 1 
ATOM   1984 O  OE2 . GLU A 1 244 ? 27.250 -8.847  45.734 1.00 50.57 ? 267 GLU A OE2 1 
ATOM   1985 N  N   . PHE A 1 245 ? 24.582 -7.111  41.276 1.00 17.71 ? 268 PHE A N   1 
ATOM   1986 C  CA  . PHE A 1 245 ? 23.446 -6.215  41.473 1.00 18.41 ? 268 PHE A CA  1 
ATOM   1987 C  C   . PHE A 1 245 ? 22.291 -6.580  40.543 1.00 17.99 ? 268 PHE A C   1 
ATOM   1988 O  O   . PHE A 1 245 ? 21.131 -6.648  40.968 1.00 19.50 ? 268 PHE A O   1 
ATOM   1989 C  CB  . PHE A 1 245 ? 23.884 -4.760  41.257 1.00 18.16 ? 268 PHE A CB  1 
ATOM   1990 C  CG  . PHE A 1 245 ? 22.801 -3.760  41.538 1.00 19.29 ? 268 PHE A CG  1 
ATOM   1991 C  CD1 . PHE A 1 245 ? 22.621 -3.254  42.818 1.00 18.65 ? 268 PHE A CD1 1 
ATOM   1992 C  CD2 . PHE A 1 245 ? 21.943 -3.344  40.528 1.00 18.69 ? 268 PHE A CD2 1 
ATOM   1993 C  CE1 . PHE A 1 245 ? 21.606 -2.344  43.082 1.00 17.83 ? 268 PHE A CE1 1 
ATOM   1994 C  CE2 . PHE A 1 245 ? 20.934 -2.439  40.782 1.00 18.74 ? 268 PHE A CE2 1 
ATOM   1995 C  CZ  . PHE A 1 245 ? 20.767 -1.931  42.065 1.00 21.73 ? 268 PHE A CZ  1 
ATOM   1996 N  N   . LEU A 1 246 ? 22.592 -6.822  39.264 1.00 17.49 ? 269 LEU A N   1 
ATOM   1997 C  CA  . LEU A 1 246 ? 21.547 -7.149  38.297 1.00 20.74 ? 269 LEU A CA  1 
ATOM   1998 C  C   . LEU A 1 246 ? 20.817 -8.428  38.691 1.00 18.55 ? 269 LEU A C   1 
ATOM   1999 O  O   . LEU A 1 246 ? 19.581 -8.481  38.675 1.00 21.48 ? 269 LEU A O   1 
ATOM   2000 C  CB  . LEU A 1 246 ? 22.150 -7.290  36.898 1.00 17.32 ? 269 LEU A CB  1 
ATOM   2001 C  CG  . LEU A 1 246 ? 22.802 -6.037  36.308 1.00 18.26 ? 269 LEU A CG  1 
ATOM   2002 C  CD1 . LEU A 1 246 ? 23.345 -6.358  34.929 1.00 18.41 ? 269 LEU A CD1 1 
ATOM   2003 C  CD2 . LEU A 1 246 ? 21.797 -4.871  36.249 1.00 18.82 ? 269 LEU A CD2 1 
ATOM   2004 N  N   . GLN A 1 247 ? 21.572 -9.469  39.041 1.00 21.25 ? 270 GLN A N   1 
ATOM   2005 C  CA  . GLN A 1 247 ? 20.964 -10.749 39.397 1.00 21.69 ? 270 GLN A CA  1 
ATOM   2006 C  C   . GLN A 1 247 ? 20.127 -10.621 40.667 1.00 20.22 ? 270 GLN A C   1 
ATOM   2007 O  O   . GLN A 1 247 ? 18.971 -11.058 40.706 1.00 26.31 ? 270 GLN A O   1 
ATOM   2008 C  CB  . GLN A 1 247 ? 22.047 -11.817 39.555 1.00 25.37 ? 270 GLN A CB  1 
ATOM   2009 N  N   . HIS A 1 248 ? 20.687 -9.999  41.708 1.00 23.46 ? 271 HIS A N   1 
ATOM   2010 C  CA  A HIS A 1 248 ? 19.966 -9.863  42.970 0.58 27.29 ? 271 HIS A CA  1 
ATOM   2011 C  CA  B HIS A 1 248 ? 19.960 -9.877  42.965 0.42 27.26 ? 271 HIS A CA  1 
ATOM   2012 C  C   . HIS A 1 248 ? 18.665 -9.090  42.799 1.00 31.55 ? 271 HIS A C   1 
ATOM   2013 O  O   . HIS A 1 248 ? 17.681 -9.367  43.494 1.00 32.94 ? 271 HIS A O   1 
ATOM   2014 C  CB  A HIS A 1 248 ? 20.855 -9.172  44.007 0.58 25.02 ? 271 HIS A CB  1 
ATOM   2015 C  CB  B HIS A 1 248 ? 20.853 -9.231  44.026 0.42 25.10 ? 271 HIS A CB  1 
ATOM   2016 C  CG  A HIS A 1 248 ? 20.243 -9.089  45.372 0.58 29.07 ? 271 HIS A CG  1 
ATOM   2017 C  CG  B HIS A 1 248 ? 21.846 -10.174 44.635 0.42 31.23 ? 271 HIS A CG  1 
ATOM   2018 N  ND1 A HIS A 1 248 ? 20.056 -10.195 46.174 0.58 34.29 ? 271 HIS A ND1 1 
ATOM   2019 N  ND1 B HIS A 1 248 ? 23.128 -10.323 44.154 0.42 36.90 ? 271 HIS A ND1 1 
ATOM   2020 C  CD2 A HIS A 1 248 ? 19.780 -8.031  46.080 0.58 29.28 ? 271 HIS A CD2 1 
ATOM   2021 C  CD2 B HIS A 1 248 ? 21.738 -11.025 45.684 0.42 33.55 ? 271 HIS A CD2 1 
ATOM   2022 C  CE1 A HIS A 1 248 ? 19.505 -9.822  47.315 0.58 32.32 ? 271 HIS A CE1 1 
ATOM   2023 C  CE1 B HIS A 1 248 ? 23.770 -11.219 44.883 0.42 31.29 ? 271 HIS A CE1 1 
ATOM   2024 N  NE2 A HIS A 1 248 ? 19.327 -8.514  47.283 0.58 30.19 ? 271 HIS A NE2 1 
ATOM   2025 N  NE2 B HIS A 1 248 ? 22.949 -11.660 45.818 0.42 30.71 ? 271 HIS A NE2 1 
ATOM   2026 N  N   . ASN A 1 249 ? 18.632 -8.126  41.881 1.00 21.77 ? 272 ASN A N   1 
ATOM   2027 C  CA  . ASN A 1 249 ? 17.478 -7.255  41.720 1.00 24.91 ? 272 ASN A CA  1 
ATOM   2028 C  C   . ASN A 1 249 ? 16.646 -7.581  40.491 1.00 21.34 ? 272 ASN A C   1 
ATOM   2029 O  O   . ASN A 1 249 ? 15.748 -6.807  40.152 1.00 22.58 ? 272 ASN A O   1 
ATOM   2030 C  CB  . ASN A 1 249 ? 17.937 -5.796  41.695 1.00 24.61 ? 272 ASN A CB  1 
ATOM   2031 C  CG  . ASN A 1 249 ? 18.499 -5.358  43.029 1.00 24.12 ? 272 ASN A CG  1 
ATOM   2032 O  OD1 . ASN A 1 249 ? 17.743 -5.011  43.935 1.00 29.58 ? 272 ASN A OD1 1 
ATOM   2033 N  ND2 . ASN A 1 249 ? 19.824 -5.397  43.170 1.00 20.13 ? 272 ASN A ND2 1 
ATOM   2034 N  N   . ASN A 1 250 ? 16.919 -8.708  39.827 1.00 26.00 ? 273 ASN A N   1 
ATOM   2035 C  CA  A ASN A 1 250 ? 16.146 -9.158  38.670 0.40 22.31 ? 273 ASN A CA  1 
ATOM   2036 C  CA  B ASN A 1 250 ? 16.150 -9.161  38.666 0.60 22.24 ? 273 ASN A CA  1 
ATOM   2037 C  C   . ASN A 1 250 ? 16.086 -8.080  37.589 1.00 24.04 ? 273 ASN A C   1 
ATOM   2038 O  O   . ASN A 1 250 ? 15.026 -7.767  37.044 1.00 24.46 ? 273 ASN A O   1 
ATOM   2039 C  CB  A ASN A 1 250 ? 14.743 -9.596  39.094 0.40 27.22 ? 273 ASN A CB  1 
ATOM   2040 C  CB  B ASN A 1 250 ? 14.746 -9.606  39.077 0.60 27.25 ? 273 ASN A CB  1 
ATOM   2041 C  CG  A ASN A 1 250 ? 14.764 -10.784 40.038 0.40 25.86 ? 273 ASN A CG  1 
ATOM   2042 C  CG  B ASN A 1 250 ? 14.022 -10.341 37.965 0.60 29.23 ? 273 ASN A CG  1 
ATOM   2043 O  OD1 A ASN A 1 250 ? 14.974 -11.920 39.616 0.40 29.96 ? 273 ASN A OD1 1 
ATOM   2044 O  OD1 B ASN A 1 250 ? 14.641 -11.045 37.167 0.60 29.40 ? 273 ASN A OD1 1 
ATOM   2045 N  ND2 A ASN A 1 250 ? 14.553 -10.526 41.324 0.40 26.73 ? 273 ASN A ND2 1 
ATOM   2046 N  ND2 B ASN A 1 250 ? 12.706 -10.168 37.897 0.60 32.58 ? 273 ASN A ND2 1 
ATOM   2047 N  N   . LEU A 1 251 ? 17.249 -7.509  37.276 1.00 18.19 ? 274 LEU A N   1 
ATOM   2048 C  CA  . LEU A 1 251 ? 17.364 -6.497  36.244 1.00 20.28 ? 274 LEU A CA  1 
ATOM   2049 C  C   . LEU A 1 251 ? 18.251 -6.987  35.110 1.00 17.85 ? 274 LEU A C   1 
ATOM   2050 O  O   . LEU A 1 251 ? 19.083 -7.882  35.276 1.00 20.52 ? 274 LEU A O   1 
ATOM   2051 C  CB  . LEU A 1 251 ? 17.936 -5.192  36.804 1.00 15.77 ? 274 LEU A CB  1 
ATOM   2052 C  CG  . LEU A 1 251 ? 17.100 -4.513  37.885 1.00 21.45 ? 274 LEU A CG  1 
ATOM   2053 C  CD1 . LEU A 1 251 ? 17.904 -3.371  38.496 1.00 20.39 ? 274 LEU A CD1 1 
ATOM   2054 C  CD2 . LEU A 1 251 ? 15.777 -4.014  37.314 1.00 21.71 ? 274 LEU A CD2 1 
ATOM   2055 N  N   . LEU A 1 252 ? 18.083 -6.348  33.958 1.00 17.32 ? 275 LEU A N   1 
ATOM   2056 C  CA  . LEU A 1 252 ? 18.792 -6.712  32.745 1.00 18.52 ? 275 LEU A CA  1 
ATOM   2057 C  C   . LEU A 1 252 ? 20.083 -5.922  32.546 1.00 20.51 ? 275 LEU A C   1 
ATOM   2058 O  O   . LEU A 1 252 ? 21.088 -6.494  32.112 1.00 16.06 ? 275 LEU A O   1 
ATOM   2059 C  CB  . LEU A 1 252 ? 17.870 -6.507  31.550 1.00 25.17 ? 275 LEU A CB  1 
ATOM   2060 C  CG  . LEU A 1 252 ? 18.406 -7.053  30.245 1.00 28.79 ? 275 LEU A CG  1 
ATOM   2061 C  CD1 . LEU A 1 252 ? 18.636 -8.551  30.384 1.00 23.01 ? 275 LEU A CD1 1 
ATOM   2062 C  CD2 . LEU A 1 252 ? 17.405 -6.740  29.169 1.00 33.15 ? 275 LEU A CD2 1 
ATOM   2063 N  N   . SER A 1 253 ? 20.087 -4.620  32.841 1.00 16.02 ? 276 SER A N   1 
ATOM   2064 C  CA  . SER A 1 253 ? 21.276 -3.822  32.586 1.00 9.81  ? 276 SER A CA  1 
ATOM   2065 C  C   . SER A 1 253 ? 21.190 -2.505  33.346 1.00 13.21 ? 276 SER A C   1 
ATOM   2066 O  O   . SER A 1 253 ? 20.127 -2.108  33.829 1.00 14.95 ? 276 SER A O   1 
ATOM   2067 C  CB  . SER A 1 253 ? 21.460 -3.544  31.090 1.00 14.73 ? 276 SER A CB  1 
ATOM   2068 O  OG  . SER A 1 253 ? 22.710 -2.922  30.840 1.00 18.21 ? 276 SER A OG  1 
ATOM   2069 N  N   . ILE A 1 254 ? 22.337 -1.839  33.437 1.00 15.02 ? 277 ILE A N   1 
ATOM   2070 C  CA  . ILE A 1 254 ? 22.441 -0.478  33.954 1.00 11.80 ? 277 ILE A CA  1 
ATOM   2071 C  C   . ILE A 1 254 ? 22.700 0.455   32.780 1.00 13.18 ? 277 ILE A C   1 
ATOM   2072 O  O   . ILE A 1 254 ? 23.652 0.251   32.009 1.00 13.30 ? 277 ILE A O   1 
ATOM   2073 C  CB  . ILE A 1 254 ? 23.556 -0.353  35.001 1.00 13.37 ? 277 ILE A CB  1 
ATOM   2074 C  CG1 . ILE A 1 254 ? 23.235 -1.262  36.196 1.00 17.34 ? 277 ILE A CG1 1 
ATOM   2075 C  CG2 . ILE A 1 254 ? 23.710 1.105   35.444 1.00 13.58 ? 277 ILE A CG2 1 
ATOM   2076 C  CD1 . ILE A 1 254 ? 24.290 -1.256  37.227 1.00 24.73 ? 277 ILE A CD1 1 
ATOM   2077 N  N   . LEU A 1 255 ? 21.849 1.467   32.644 1.00 12.47 ? 278 LEU A N   1 
ATOM   2078 C  CA  . LEU A 1 255 ? 21.991 2.509   31.636 1.00 12.69 ? 278 LEU A CA  1 
ATOM   2079 C  C   . LEU A 1 255 ? 22.468 3.761   32.354 1.00 13.54 ? 278 LEU A C   1 
ATOM   2080 O  O   . LEU A 1 255 ? 21.818 4.209   33.301 1.00 13.08 ? 278 LEU A O   1 
ATOM   2081 C  CB  . LEU A 1 255 ? 20.665 2.774   30.927 1.00 11.98 ? 278 LEU A CB  1 
ATOM   2082 C  CG  . LEU A 1 255 ? 19.933 1.518   30.463 1.00 21.28 ? 278 LEU A CG  1 
ATOM   2083 C  CD1 . LEU A 1 255 ? 18.653 1.906   29.748 1.00 19.31 ? 278 LEU A CD1 1 
ATOM   2084 C  CD2 . LEU A 1 255 ? 20.846 0.717   29.559 1.00 19.64 ? 278 LEU A CD2 1 
ATOM   2085 N  N   . ARG A 1 256 ? 23.605 4.305   31.928 1.00 12.81 ? 279 ARG A N   1 
ATOM   2086 C  CA  . ARG A 1 256 ? 24.171 5.459   32.612 1.00 10.14 ? 279 ARG A CA  1 
ATOM   2087 C  C   . ARG A 1 256 ? 24.854 6.346   31.583 1.00 10.72 ? 279 ARG A C   1 
ATOM   2088 O  O   . ARG A 1 256 ? 24.874 6.043   30.384 1.00 11.59 ? 279 ARG A O   1 
ATOM   2089 C  CB  . ARG A 1 256 ? 25.109 5.020   33.750 1.00 12.17 ? 279 ARG A CB  1 
ATOM   2090 C  CG  . ARG A 1 256 ? 26.150 3.963   33.360 1.00 15.07 ? 279 ARG A CG  1 
ATOM   2091 C  CD  . ARG A 1 256 ? 27.379 4.584   32.718 1.00 12.08 ? 279 ARG A CD  1 
ATOM   2092 N  NE  . ARG A 1 256 ? 28.197 5.256   33.724 1.00 13.89 ? 279 ARG A NE  1 
ATOM   2093 C  CZ  . ARG A 1 256 ? 29.469 5.608   33.566 1.00 13.35 ? 279 ARG A CZ  1 
ATOM   2094 N  NH1 . ARG A 1 256 ? 30.103 5.367   32.417 1.00 12.99 ? 279 ARG A NH1 1 
ATOM   2095 N  NH2 . ARG A 1 256 ? 30.116 6.176   34.577 1.00 10.92 ? 279 ARG A NH2 1 
ATOM   2096 N  N   . ALA A 1 257 ? 25.375 7.477   32.050 1.00 13.57 ? 280 ALA A N   1 
ATOM   2097 C  CA  . ALA A 1 257 ? 26.001 8.442   31.154 1.00 10.52 ? 280 ALA A CA  1 
ATOM   2098 C  C   . ALA A 1 257 ? 27.404 8.769   31.665 1.00 13.15 ? 280 ALA A C   1 
ATOM   2099 O  O   . ALA A 1 257 ? 28.209 7.850   31.858 1.00 12.83 ? 280 ALA A O   1 
ATOM   2100 C  CB  . ALA A 1 257 ? 25.109 9.682   31.037 1.00 11.99 ? 280 ALA A CB  1 
ATOM   2101 N  N   . HIS A 1 258 ? 27.728 10.057  31.844 1.00 10.86 ? 281 HIS A N   1 
ATOM   2102 C  CA  . HIS A 1 258 ? 28.819 10.481  32.732 1.00 11.01 ? 281 HIS A CA  1 
ATOM   2103 C  C   . HIS A 1 258 ? 30.218 10.344  32.120 1.00 12.75 ? 281 HIS A C   1 
ATOM   2104 O  O   . HIS A 1 258 ? 31.120 11.104  32.493 1.00 15.26 ? 281 HIS A O   1 
ATOM   2105 C  CB  . HIS A 1 258 ? 28.704 9.717   34.067 1.00 12.36 ? 281 HIS A CB  1 
ATOM   2106 C  CG  . HIS A 1 258 ? 29.580 10.219  35.178 1.00 14.56 ? 281 HIS A CG  1 
ATOM   2107 N  ND1 . HIS A 1 258 ? 29.776 11.560  35.450 1.00 13.03 ? 281 HIS A ND1 1 
ATOM   2108 C  CD2 . HIS A 1 258 ? 30.285 9.540   36.118 1.00 12.24 ? 281 HIS A CD2 1 
ATOM   2109 C  CE1 . HIS A 1 258 ? 30.572 11.684  36.497 1.00 11.64 ? 281 HIS A CE1 1 
ATOM   2110 N  NE2 . HIS A 1 258 ? 30.901 10.473  36.920 1.00 14.22 ? 281 HIS A NE2 1 
ATOM   2111 N  N   . GLU A 1 259 ? 30.427 9.428   31.166 1.00 12.46 ? 282 GLU A N   1 
ATOM   2112 C  CA  . GLU A 1 259 ? 31.715 9.301   30.479 1.00 13.14 ? 282 GLU A CA  1 
ATOM   2113 C  C   . GLU A 1 259 ? 31.522 9.398   28.971 1.00 13.17 ? 282 GLU A C   1 
ATOM   2114 O  O   . GLU A 1 259 ? 30.808 8.582   28.377 1.00 13.17 ? 282 GLU A O   1 
ATOM   2115 C  CB  . GLU A 1 259 ? 32.396 7.980   30.831 1.00 13.68 ? 282 GLU A CB  1 
ATOM   2116 C  CG  . GLU A 1 259 ? 32.925 7.918   32.238 1.00 14.06 ? 282 GLU A CG  1 
ATOM   2117 C  CD  . GLU A 1 259 ? 33.579 6.594   32.497 1.00 19.54 ? 282 GLU A CD  1 
ATOM   2118 O  OE1 . GLU A 1 259 ? 32.889 5.568   32.347 1.00 16.33 ? 282 GLU A OE1 1 
ATOM   2119 O  OE2 . GLU A 1 259 ? 34.783 6.573   32.817 1.00 18.42 ? 282 GLU A OE2 1 
ATOM   2120 N  N   . ALA A 1 260 ? 32.187 10.369  28.353 1.00 12.78 ? 283 ALA A N   1 
ATOM   2121 C  CA  . ALA A 1 260 ? 32.092 10.548  26.907 1.00 20.43 ? 283 ALA A CA  1 
ATOM   2122 C  C   . ALA A 1 260 ? 32.677 9.349   26.164 1.00 18.08 ? 283 ALA A C   1 
ATOM   2123 O  O   . ALA A 1 260 ? 33.632 8.711   26.614 1.00 17.62 ? 283 ALA A O   1 
ATOM   2124 C  CB  . ALA A 1 260 ? 32.814 11.832  26.485 1.00 19.69 ? 283 ALA A CB  1 
ATOM   2125 N  N   . GLN A 1 261 ? 32.087 9.046   25.007 1.00 17.89 ? 284 GLN A N   1 
ATOM   2126 C  CA  . GLN A 1 261 ? 32.464 7.892   24.199 1.00 16.51 ? 284 GLN A CA  1 
ATOM   2127 C  C   . GLN A 1 261 ? 32.664 8.323   22.749 1.00 20.57 ? 284 GLN A C   1 
ATOM   2128 O  O   . GLN A 1 261 ? 32.003 9.249   22.261 1.00 19.22 ? 284 GLN A O   1 
ATOM   2129 C  CB  . GLN A 1 261 ? 31.393 6.787   24.255 1.00 16.71 ? 284 GLN A CB  1 
ATOM   2130 C  CG  . GLN A 1 261 ? 30.974 6.360   25.663 1.00 16.18 ? 284 GLN A CG  1 
ATOM   2131 C  CD  . GLN A 1 261 ? 32.093 5.672   26.413 1.00 19.12 ? 284 GLN A CD  1 
ATOM   2132 O  OE1 . GLN A 1 261 ? 32.888 4.926   25.832 1.00 18.04 ? 284 GLN A OE1 1 
ATOM   2133 N  NE2 . GLN A 1 261 ? 32.174 5.927   27.711 1.00 18.29 ? 284 GLN A NE2 1 
ATOM   2134 N  N   . ASP A 1 262 ? 33.549 7.607   22.048 1.00 20.85 ? 285 ASP A N   1 
ATOM   2135 C  CA  . ASP A 1 262 ? 33.877 7.963   20.665 1.00 21.83 ? 285 ASP A CA  1 
ATOM   2136 C  C   . ASP A 1 262 ? 32.633 8.062   19.790 1.00 18.99 ? 285 ASP A C   1 
ATOM   2137 O  O   . ASP A 1 262 ? 32.498 8.994   18.988 1.00 24.33 ? 285 ASP A O   1 
ATOM   2138 C  CB  . ASP A 1 262 ? 34.849 6.937   20.071 1.00 27.01 ? 285 ASP A CB  1 
ATOM   2139 C  CG  . ASP A 1 262 ? 36.277 7.096   20.583 1.00 37.17 ? 285 ASP A CG  1 
ATOM   2140 O  OD1 . ASP A 1 262 ? 36.563 8.045   21.343 1.00 46.31 ? 285 ASP A OD1 1 
ATOM   2141 O  OD2 . ASP A 1 262 ? 37.126 6.257   20.220 1.00 49.12 ? 285 ASP A OD2 1 
ATOM   2142 N  N   . ALA A 1 263 ? 31.710 7.116   19.928 1.00 21.24 ? 286 ALA A N   1 
ATOM   2143 C  CA  . ALA A 1 263 ? 30.537 7.046   19.067 1.00 22.59 ? 286 ALA A CA  1 
ATOM   2144 C  C   . ALA A 1 263 ? 29.271 7.582   19.727 1.00 22.83 ? 286 ALA A C   1 
ATOM   2145 O  O   . ALA A 1 263 ? 28.203 7.545   19.107 1.00 20.96 ? 286 ALA A O   1 
ATOM   2146 C  CB  . ALA A 1 263 ? 30.305 5.603   18.612 1.00 25.97 ? 286 ALA A CB  1 
ATOM   2147 N  N   . GLY A 1 264 ? 29.361 8.084   20.955 1.00 17.10 ? 287 GLY A N   1 
ATOM   2148 C  CA  . GLY A 1 264 ? 28.186 8.516   21.691 1.00 17.68 ? 287 GLY A CA  1 
ATOM   2149 C  C   . GLY A 1 264 ? 27.559 7.440   22.555 1.00 16.19 ? 287 GLY A C   1 
ATOM   2150 O  O   . GLY A 1 264 ? 26.531 7.700   23.205 1.00 19.36 ? 287 GLY A O   1 
ATOM   2151 N  N   . TYR A 1 265 ? 28.122 6.234   22.566 1.00 15.31 ? 288 TYR A N   1 
ATOM   2152 C  CA  . TYR A 1 265 ? 27.586 5.151   23.378 1.00 16.19 ? 288 TYR A CA  1 
ATOM   2153 C  C   . TYR A 1 265 ? 28.675 4.110   23.559 1.00 16.94 ? 288 TYR A C   1 
ATOM   2154 O  O   . TYR A 1 265 ? 29.654 4.076   22.811 1.00 17.80 ? 288 TYR A O   1 
ATOM   2155 C  CB  . TYR A 1 265 ? 26.352 4.510   22.733 1.00 15.93 ? 288 TYR A CB  1 
ATOM   2156 C  CG  . TYR A 1 265 ? 26.715 3.787   21.463 1.00 17.84 ? 288 TYR A CG  1 
ATOM   2157 C  CD1 . TYR A 1 265 ? 26.782 4.475   20.260 1.00 20.89 ? 288 TYR A CD1 1 
ATOM   2158 C  CD2 . TYR A 1 265 ? 27.040 2.434   21.469 1.00 24.62 ? 288 TYR A CD2 1 
ATOM   2159 C  CE1 . TYR A 1 265 ? 27.145 3.843   19.100 1.00 27.50 ? 288 TYR A CE1 1 
ATOM   2160 C  CE2 . TYR A 1 265 ? 27.414 1.790   20.296 1.00 29.19 ? 288 TYR A CE2 1 
ATOM   2161 C  CZ  . TYR A 1 265 ? 27.456 2.507   19.121 1.00 24.26 ? 288 TYR A CZ  1 
ATOM   2162 O  OH  . TYR A 1 265 ? 27.817 1.900   17.947 1.00 37.28 ? 288 TYR A OH  1 
ATOM   2163 N  N   . ARG A 1 266 ? 28.473 3.231   24.535 1.00 14.64 ? 289 ARG A N   1 
ATOM   2164 C  CA  . ARG A 1 266 ? 29.302 2.042   24.644 1.00 13.24 ? 289 ARG A CA  1 
ATOM   2165 C  C   . ARG A 1 266 ? 28.486 0.952   25.321 1.00 18.88 ? 289 ARG A C   1 
ATOM   2166 O  O   . ARG A 1 266 ? 27.801 1.210   26.318 1.00 12.72 ? 289 ARG A O   1 
ATOM   2167 C  CB  . ARG A 1 266 ? 30.605 2.321   25.424 1.00 15.82 ? 289 ARG A CB  1 
ATOM   2168 C  CG  . ARG A 1 266 ? 31.497 1.079   25.554 1.00 17.02 ? 289 ARG A CG  1 
ATOM   2169 C  CD  . ARG A 1 266 ? 32.867 1.369   26.172 1.00 14.72 ? 289 ARG A CD  1 
ATOM   2170 N  NE  . ARG A 1 266 ? 33.508 0.099   26.537 1.00 17.03 ? 289 ARG A NE  1 
ATOM   2171 C  CZ  . ARG A 1 266 ? 34.595 -0.013  27.288 1.00 21.22 ? 289 ARG A CZ  1 
ATOM   2172 N  NH1 . ARG A 1 266 ? 35.192 1.078   27.763 1.00 18.15 ? 289 ARG A NH1 1 
ATOM   2173 N  NH2 . ARG A 1 266 ? 35.077 -1.223  27.571 1.00 15.23 ? 289 ARG A NH2 1 
ATOM   2174 N  N   . MET A 1 267 ? 28.535 -0.253  24.759 1.00 14.43 ? 290 MET A N   1 
ATOM   2175 C  CA  . MET A 1 267 ? 27.946 -1.431  25.384 1.00 13.48 ? 290 MET A CA  1 
ATOM   2176 C  C   . MET A 1 267 ? 29.082 -2.276  25.934 1.00 17.71 ? 290 MET A C   1 
ATOM   2177 O  O   . MET A 1 267 ? 30.000 -2.645  25.193 1.00 19.75 ? 290 MET A O   1 
ATOM   2178 C  CB  . MET A 1 267 ? 27.090 -2.209  24.385 1.00 17.97 ? 290 MET A CB  1 
ATOM   2179 C  CG  . MET A 1 267 ? 25.895 -1.369  23.923 1.00 22.32 ? 290 MET A CG  1 
ATOM   2180 S  SD  . MET A 1 267 ? 24.606 -2.339  23.128 1.00 33.46 ? 290 MET A SD  1 
ATOM   2181 C  CE  . MET A 1 267 ? 25.434 -2.742  21.601 1.00 42.71 ? 290 MET A CE  1 
ATOM   2182 N  N   . TYR A 1 268 ? 29.031 -2.552  27.234 1.00 14.77 ? 291 TYR A N   1 
ATOM   2183 C  CA  . TYR A 1 268 ? 30.095 -3.263  27.916 1.00 15.71 ? 291 TYR A CA  1 
ATOM   2184 C  C   . TYR A 1 268 ? 29.801 -4.763  27.916 1.00 18.34 ? 291 TYR A C   1 
ATOM   2185 O  O   . TYR A 1 268 ? 28.798 -5.232  27.363 1.00 17.52 ? 291 TYR A O   1 
ATOM   2186 C  CB  . TYR A 1 268 ? 30.274 -2.731  29.337 1.00 12.98 ? 291 TYR A CB  1 
ATOM   2187 C  CG  . TYR A 1 268 ? 30.612 -1.245  29.394 1.00 15.35 ? 291 TYR A CG  1 
ATOM   2188 C  CD1 . TYR A 1 268 ? 29.631 -0.285  29.155 1.00 16.76 ? 291 TYR A CD1 1 
ATOM   2189 C  CD2 . TYR A 1 268 ? 31.905 -0.812  29.690 1.00 14.58 ? 291 TYR A CD2 1 
ATOM   2190 C  CE1 . TYR A 1 268 ? 29.921 1.070   29.195 1.00 14.85 ? 291 TYR A CE1 1 
ATOM   2191 C  CE2 . TYR A 1 268 ? 32.214 0.563   29.741 1.00 14.79 ? 291 TYR A CE2 1 
ATOM   2192 C  CZ  . TYR A 1 268 ? 31.208 1.489   29.494 1.00 14.80 ? 291 TYR A CZ  1 
ATOM   2193 O  OH  . TYR A 1 268 ? 31.453 2.836   29.537 1.00 16.98 ? 291 TYR A OH  1 
ATOM   2194 N  N   . ARG A 1 269 ? 30.688 -5.514  28.568 1.00 16.36 ? 292 ARG A N   1 
ATOM   2195 C  CA  . ARG A 1 269 ? 30.641 -6.972  28.536 1.00 16.04 ? 292 ARG A CA  1 
ATOM   2196 C  C   . ARG A 1 269 ? 29.267 -7.509  28.922 1.00 19.24 ? 292 ARG A C   1 
ATOM   2197 O  O   . ARG A 1 269 ? 28.661 -7.075  29.909 1.00 17.81 ? 292 ARG A O   1 
ATOM   2198 C  CB  . ARG A 1 269 ? 31.709 -7.543  29.470 1.00 16.98 ? 292 ARG A CB  1 
ATOM   2199 C  CG  . ARG A 1 269 ? 31.627 -9.070  29.555 1.00 17.27 ? 292 ARG A CG  1 
ATOM   2200 C  CD  . ARG A 1 269 ? 32.775 -9.685  30.316 1.00 15.64 ? 292 ARG A CD  1 
ATOM   2201 N  NE  . ARG A 1 269 ? 32.560 -11.132 30.391 1.00 19.89 ? 292 ARG A NE  1 
ATOM   2202 C  CZ  . ARG A 1 269 ? 33.309 -11.973 31.089 1.00 24.03 ? 292 ARG A CZ  1 
ATOM   2203 N  NH1 . ARG A 1 269 ? 34.352 -11.526 31.769 1.00 19.77 ? 292 ARG A NH1 1 
ATOM   2204 N  NH2 . ARG A 1 269 ? 33.014 -13.274 31.087 1.00 21.25 ? 292 ARG A NH2 1 
ATOM   2205 N  N   . LYS A 1 270 ? 28.788 -8.473  28.138 1.00 16.45 ? 293 LYS A N   1 
ATOM   2206 C  CA  . LYS A 1 270 ? 27.488 -9.083  28.372 1.00 14.83 ? 293 LYS A CA  1 
ATOM   2207 C  C   . LYS A 1 270 ? 27.476 -9.912  29.655 1.00 17.05 ? 293 LYS A C   1 
ATOM   2208 O  O   . LYS A 1 270 ? 28.489 -10.487 30.072 1.00 18.12 ? 293 LYS A O   1 
ATOM   2209 C  CB  . LYS A 1 270 ? 27.104 -9.963  27.180 1.00 20.70 ? 293 LYS A CB  1 
ATOM   2210 C  CG  . LYS A 1 270 ? 28.018 -11.191 27.022 1.00 23.84 ? 293 LYS A CG  1 
ATOM   2211 C  CD  . LYS A 1 270 ? 27.841 -11.895 25.683 1.00 29.31 ? 293 LYS A CD  1 
ATOM   2212 C  CE  . LYS A 1 270 ? 28.774 -13.109 25.573 1.00 25.61 ? 293 LYS A CE  1 
ATOM   2213 N  NZ  . LYS A 1 270 ? 30.178 -12.808 26.038 1.00 26.55 ? 293 LYS A NZ  1 
ATOM   2214 N  N   . SER A 1 271 ? 26.305 -9.951  30.288 1.00 18.08 ? 294 SER A N   1 
ATOM   2215 C  CA  . SER A 1 271 ? 26.084 -10.800 31.453 1.00 19.32 ? 294 SER A CA  1 
ATOM   2216 C  C   . SER A 1 271 ? 26.258 -12.267 31.083 1.00 16.76 ? 294 SER A C   1 
ATOM   2217 O  O   . SER A 1 271 ? 25.825 -12.700 30.017 1.00 18.88 ? 294 SER A O   1 
ATOM   2218 C  CB  . SER A 1 271 ? 24.669 -10.574 31.989 1.00 18.34 ? 294 SER A CB  1 
ATOM   2219 O  OG  . SER A 1 271 ? 24.221 -11.692 32.746 1.00 24.32 ? 294 SER A OG  1 
ATOM   2220 N  N   . GLN A 1 272 ? 26.892 -13.031 31.976 1.00 17.03 ? 295 GLN A N   1 
ATOM   2221 C  CA  . GLN A 1 272 ? 27.005 -14.474 31.780 1.00 21.64 ? 295 GLN A CA  1 
ATOM   2222 C  C   . GLN A 1 272 ? 25.679 -15.190 31.985 1.00 26.05 ? 295 GLN A C   1 
ATOM   2223 O  O   . GLN A 1 272 ? 25.560 -16.365 31.617 1.00 24.50 ? 295 GLN A O   1 
ATOM   2224 C  CB  . GLN A 1 272 ? 28.052 -15.046 32.730 1.00 21.99 ? 295 GLN A CB  1 
ATOM   2225 C  CG  . GLN A 1 272 ? 29.464 -14.561 32.433 1.00 24.54 ? 295 GLN A CG  1 
ATOM   2226 C  CD  . GLN A 1 272 ? 30.323 -14.466 33.679 1.00 38.03 ? 295 GLN A CD  1 
ATOM   2227 O  OE1 . GLN A 1 272 ? 29.976 -13.768 34.641 1.00 38.96 ? 295 GLN A OE1 1 
ATOM   2228 N  NE2 . GLN A 1 272 ? 31.451 -15.166 33.671 1.00 39.69 ? 295 GLN A NE2 1 
ATOM   2229 N  N   . THR A 1 273 ? 24.684 -14.514 32.554 1.00 19.76 ? 296 THR A N   1 
ATOM   2230 C  CA  . THR A 1 273 ? 23.368 -15.109 32.754 1.00 22.30 ? 296 THR A CA  1 
ATOM   2231 C  C   . THR A 1 273 ? 22.437 -14.859 31.575 1.00 29.00 ? 296 THR A C   1 
ATOM   2232 O  O   . THR A 1 273 ? 21.819 -15.796 31.060 1.00 29.39 ? 296 THR A O   1 
ATOM   2233 C  CB  . THR A 1 273 ? 22.747 -14.566 34.045 1.00 29.23 ? 296 THR A CB  1 
ATOM   2234 O  OG1 . THR A 1 273 ? 23.561 -14.959 35.154 1.00 32.04 ? 296 THR A OG1 1 
ATOM   2235 C  CG2 . THR A 1 273 ? 21.343 -15.109 34.235 1.00 33.49 ? 296 THR A CG2 1 
ATOM   2236 N  N   . THR A 1 274 ? 22.323 -13.604 31.135 1.00 22.19 ? 297 THR A N   1 
ATOM   2237 C  CA  . THR A 1 274 ? 21.347 -13.233 30.120 1.00 21.44 ? 297 THR A CA  1 
ATOM   2238 C  C   . THR A 1 274 ? 21.934 -13.081 28.724 1.00 25.10 ? 297 THR A C   1 
ATOM   2239 O  O   . THR A 1 274 ? 21.173 -13.064 27.746 1.00 24.39 ? 297 THR A O   1 
ATOM   2240 C  CB  . THR A 1 274 ? 20.689 -11.909 30.499 1.00 25.84 ? 297 THR A CB  1 
ATOM   2241 O  OG1 . THR A 1 274 ? 21.697 -10.889 30.473 1.00 24.26 ? 297 THR A OG1 1 
ATOM   2242 C  CG2 . THR A 1 274 ? 20.100 -12.003 31.895 1.00 28.25 ? 297 THR A CG2 1 
ATOM   2243 N  N   . GLY A 1 275 ? 23.249 -12.921 28.607 1.00 22.93 ? 298 GLY A N   1 
ATOM   2244 C  CA  . GLY A 1 275 ? 23.835 -12.590 27.324 1.00 23.29 ? 298 GLY A CA  1 
ATOM   2245 C  C   . GLY A 1 275 ? 23.567 -11.186 26.838 1.00 26.03 ? 298 GLY A C   1 
ATOM   2246 O  O   . GLY A 1 275 ? 23.831 -10.891 25.666 1.00 24.38 ? 298 GLY A O   1 
ATOM   2247 N  N   . PHE A 1 276 ? 23.052 -10.308 27.698 1.00 21.85 ? 299 PHE A N   1 
ATOM   2248 C  CA  . PHE A 1 276 ? 22.783 -8.908  27.378 1.00 23.01 ? 299 PHE A CA  1 
ATOM   2249 C  C   . PHE A 1 276 ? 23.850 -8.011  27.998 1.00 17.01 ? 299 PHE A C   1 
ATOM   2250 O  O   . PHE A 1 276 ? 24.335 -8.305  29.096 1.00 19.13 ? 299 PHE A O   1 
ATOM   2251 C  CB  . PHE A 1 276 ? 21.405 -8.493  27.901 1.00 18.70 ? 299 PHE A CB  1 
ATOM   2252 C  CG  . PHE A 1 276 ? 20.921 -7.172  27.357 1.00 20.05 ? 299 PHE A CG  1 
ATOM   2253 C  CD1 . PHE A 1 276 ? 20.233 -7.114  26.156 1.00 21.16 ? 299 PHE A CD1 1 
ATOM   2254 C  CD2 . PHE A 1 276 ? 21.153 -5.991  28.047 1.00 19.23 ? 299 PHE A CD2 1 
ATOM   2255 C  CE1 . PHE A 1 276 ? 19.786 -5.902  25.650 1.00 25.81 ? 299 PHE A CE1 1 
ATOM   2256 C  CE2 . PHE A 1 276 ? 20.703 -4.778  27.544 1.00 17.43 ? 299 PHE A CE2 1 
ATOM   2257 C  CZ  . PHE A 1 276 ? 20.024 -4.732  26.349 1.00 24.93 ? 299 PHE A CZ  1 
ATOM   2258 N  N   . PRO A 1 277 ? 24.256 -6.927  27.321 1.00 15.59 ? 300 PRO A N   1 
ATOM   2259 C  CA  . PRO A 1 277 ? 25.284 -6.045  27.890 1.00 16.98 ? 300 PRO A CA  1 
ATOM   2260 C  C   . PRO A 1 277 ? 24.941 -5.652  29.322 1.00 15.40 ? 300 PRO A C   1 
ATOM   2261 O  O   . PRO A 1 277 ? 23.827 -5.219  29.610 1.00 17.53 ? 300 PRO A O   1 
ATOM   2262 C  CB  . PRO A 1 277 ? 25.272 -4.838  26.940 1.00 19.54 ? 300 PRO A CB  1 
ATOM   2263 C  CG  . PRO A 1 277 ? 24.923 -5.456  25.602 1.00 20.57 ? 300 PRO A CG  1 
ATOM   2264 C  CD  . PRO A 1 277 ? 23.873 -6.513  25.953 1.00 14.23 ? 300 PRO A CD  1 
ATOM   2265 N  N   . SER A 1 278 ? 25.896 -5.863  30.235 1.00 15.84 ? 301 SER A N   1 
ATOM   2266 C  CA  . SER A 1 278 ? 25.634 -5.619  31.652 1.00 17.62 ? 301 SER A CA  1 
ATOM   2267 C  C   . SER A 1 278 ? 25.539 -4.133  31.964 1.00 19.06 ? 301 SER A C   1 
ATOM   2268 O  O   . SER A 1 278 ? 24.940 -3.755  32.977 1.00 15.64 ? 301 SER A O   1 
ATOM   2269 C  CB  . SER A 1 278 ? 26.728 -6.268  32.508 1.00 17.84 ? 301 SER A CB  1 
ATOM   2270 O  OG  . SER A 1 278 ? 27.994 -5.669  32.275 1.00 16.80 ? 301 SER A OG  1 
ATOM   2271 N  N   . LEU A 1 279 ? 26.083 -3.297  31.089 1.00 13.07 ? 302 LEU A N   1 
ATOM   2272 C  CA  . LEU A 1 279 ? 26.208 -1.868  31.310 1.00 15.43 ? 302 LEU A CA  1 
ATOM   2273 C  C   . LEU A 1 279 ? 26.194 -1.214  29.944 1.00 14.21 ? 302 LEU A C   1 
ATOM   2274 O  O   . LEU A 1 279 ? 26.806 -1.734  29.004 1.00 16.19 ? 302 LEU A O   1 
ATOM   2275 C  CB  . LEU A 1 279 ? 27.516 -1.551  32.042 1.00 18.42 ? 302 LEU A CB  1 
ATOM   2276 C  CG  . LEU A 1 279 ? 27.879 -0.099  32.332 1.00 16.65 ? 302 LEU A CG  1 
ATOM   2277 C  CD1 . LEU A 1 279 ? 26.983 0.437   33.425 1.00 13.98 ? 302 LEU A CD1 1 
ATOM   2278 C  CD2 . LEU A 1 279 ? 29.354 -0.004  32.728 1.00 15.37 ? 302 LEU A CD2 1 
ATOM   2279 N  N   . ILE A 1 280 ? 25.511 -0.074  29.838 1.00 12.91 ? 303 ILE A N   1 
ATOM   2280 C  CA  . ILE A 1 280 ? 25.498 0.728   28.625 1.00 10.05 ? 303 ILE A CA  1 
ATOM   2281 C  C   . ILE A 1 280 ? 25.731 2.177   29.028 1.00 14.82 ? 303 ILE A C   1 
ATOM   2282 O  O   . ILE A 1 280 ? 25.037 2.694   29.908 1.00 15.23 ? 303 ILE A O   1 
ATOM   2283 C  CB  . ILE A 1 280 ? 24.172 0.593   27.853 1.00 13.28 ? 303 ILE A CB  1 
ATOM   2284 C  CG1 . ILE A 1 280 ? 23.918 -0.871  27.446 1.00 14.57 ? 303 ILE A CG1 1 
ATOM   2285 C  CG2 . ILE A 1 280 ? 24.192 1.503   26.622 1.00 13.48 ? 303 ILE A CG2 1 
ATOM   2286 C  CD1 . ILE A 1 280 ? 22.589 -1.083  26.722 1.00 20.22 ? 303 ILE A CD1 1 
ATOM   2287 N  N   . THR A 1 281 ? 26.710 2.824   28.407 1.00 12.22 ? 304 THR A N   1 
ATOM   2288 C  CA  . THR A 1 281 ? 26.907 4.265   28.559 1.00 10.94 ? 304 THR A CA  1 
ATOM   2289 C  C   . THR A 1 281 ? 26.299 4.973   27.351 1.00 12.33 ? 304 THR A C   1 
ATOM   2290 O  O   . THR A 1 281 ? 26.556 4.581   26.210 1.00 14.78 ? 304 THR A O   1 
ATOM   2291 C  CB  . THR A 1 281 ? 28.396 4.621   28.673 1.00 10.31 ? 304 THR A CB  1 
ATOM   2292 O  OG1 . THR A 1 281 ? 28.930 4.075   29.882 1.00 13.72 ? 304 THR A OG1 1 
ATOM   2293 C  CG2 . THR A 1 281 ? 28.589 6.158   28.691 1.00 11.84 ? 304 THR A CG2 1 
ATOM   2294 N  N   . ILE A 1 282 ? 25.494 6.007   27.597 1.00 13.95 ? 305 ILE A N   1 
ATOM   2295 C  CA  . ILE A 1 282 ? 24.932 6.836   26.532 1.00 11.20 ? 305 ILE A CA  1 
ATOM   2296 C  C   . ILE A 1 282 ? 25.353 8.279   26.787 1.00 16.36 ? 305 ILE A C   1 
ATOM   2297 O  O   . ILE A 1 282 ? 25.385 8.728   27.936 1.00 13.48 ? 305 ILE A O   1 
ATOM   2298 C  CB  . ILE A 1 282 ? 23.394 6.670   26.459 1.00 11.09 ? 305 ILE A CB  1 
ATOM   2299 C  CG1 . ILE A 1 282 ? 22.802 7.327   25.203 1.00 14.72 ? 305 ILE A CG1 1 
ATOM   2300 C  CG2 . ILE A 1 282 ? 22.700 7.192   27.741 1.00 14.61 ? 305 ILE A CG2 1 
ATOM   2301 C  CD1 . ILE A 1 282 ? 23.254 6.646   23.884 1.00 16.22 ? 305 ILE A CD1 1 
ATOM   2302 N  N   . PHE A 1 283 ? 25.717 8.998   25.722 1.00 15.27 ? 306 PHE A N   1 
ATOM   2303 C  CA  . PHE A 1 283 ? 26.254 10.351  25.855 1.00 14.67 ? 306 PHE A CA  1 
ATOM   2304 C  C   . PHE A 1 283 ? 25.705 11.189  24.707 1.00 12.97 ? 306 PHE A C   1 
ATOM   2305 O  O   . PHE A 1 283 ? 25.927 10.865  23.538 1.00 15.62 ? 306 PHE A O   1 
ATOM   2306 C  CB  . PHE A 1 283 ? 27.786 10.341  25.856 1.00 14.20 ? 306 PHE A CB  1 
ATOM   2307 C  CG  . PHE A 1 283 ? 28.407 11.578  26.473 1.00 14.94 ? 306 PHE A CG  1 
ATOM   2308 C  CD1 . PHE A 1 283 ? 28.614 12.722  25.706 1.00 15.05 ? 306 PHE A CD1 1 
ATOM   2309 C  CD2 . PHE A 1 283 ? 28.774 11.591  27.820 1.00 12.40 ? 306 PHE A CD2 1 
ATOM   2310 C  CE1 . PHE A 1 283 ? 29.179 13.858  26.272 1.00 18.77 ? 306 PHE A CE1 1 
ATOM   2311 C  CE2 . PHE A 1 283 ? 29.350 12.713  28.388 1.00 13.92 ? 306 PHE A CE2 1 
ATOM   2312 C  CZ  . PHE A 1 283 ? 29.547 13.855  27.612 1.00 18.77 ? 306 PHE A CZ  1 
ATOM   2313 N  N   . SER A 1 284 ? 24.970 12.253  25.030 1.00 14.07 ? 307 SER A N   1 
ATOM   2314 C  CA  . SER A 1 284 ? 23.995 12.778  24.078 1.00 14.23 ? 307 SER A CA  1 
ATOM   2315 C  C   . SER A 1 284 ? 24.317 14.187  23.594 1.00 18.29 ? 307 SER A C   1 
ATOM   2316 O  O   . SER A 1 284 ? 23.423 14.884  23.111 1.00 21.32 ? 307 SER A O   1 
ATOM   2317 C  CB  . SER A 1 284 ? 22.588 12.724  24.676 1.00 13.37 ? 307 SER A CB  1 
ATOM   2318 O  OG  . SER A 1 284 ? 22.184 11.370  24.850 1.00 14.18 ? 307 SER A OG  1 
ATOM   2319 N  N   . ALA A 1 285 ? 25.567 14.609  23.693 1.00 16.55 ? 308 ALA A N   1 
ATOM   2320 C  CA  . ALA A 1 285 ? 25.994 15.873  23.107 1.00 23.87 ? 308 ALA A CA  1 
ATOM   2321 C  C   . ALA A 1 285 ? 27.495 15.794  22.863 1.00 18.00 ? 308 ALA A C   1 
ATOM   2322 O  O   . ALA A 1 285 ? 28.167 14.887  23.367 1.00 21.11 ? 308 ALA A O   1 
ATOM   2323 C  CB  . ALA A 1 285 ? 25.633 17.057  24.016 1.00 20.87 ? 308 ALA A CB  1 
ATOM   2324 N  N   . PRO A 1 286 ? 28.047 16.722  22.075 1.00 21.03 ? 309 PRO A N   1 
ATOM   2325 C  CA  . PRO A 1 286 ? 29.502 16.720  21.820 1.00 21.09 ? 309 PRO A CA  1 
ATOM   2326 C  C   . PRO A 1 286 ? 30.327 16.806  23.094 1.00 24.47 ? 309 PRO A C   1 
ATOM   2327 O  O   . PRO A 1 286 ? 29.852 17.145  24.179 1.00 17.82 ? 309 PRO A O   1 
ATOM   2328 C  CB  . PRO A 1 286 ? 29.720 17.967  20.961 1.00 18.20 ? 309 PRO A CB  1 
ATOM   2329 C  CG  . PRO A 1 286 ? 28.421 18.160  20.233 1.00 23.17 ? 309 PRO A CG  1 
ATOM   2330 C  CD  . PRO A 1 286 ? 27.334 17.677  21.202 1.00 21.22 ? 309 PRO A CD  1 
ATOM   2331 N  N   . ASN A 1 287 ? 31.616 16.517  22.945 1.00 23.30 ? 310 ASN A N   1 
ATOM   2332 C  CA  . ASN A 1 287 ? 32.517 16.634  24.076 1.00 22.74 ? 310 ASN A CA  1 
ATOM   2333 C  C   . ASN A 1 287 ? 33.883 17.079  23.584 1.00 32.23 ? 310 ASN A C   1 
ATOM   2334 O  O   . ASN A 1 287 ? 34.237 16.881  22.416 1.00 29.57 ? 310 ASN A O   1 
ATOM   2335 C  CB  . ASN A 1 287 ? 32.622 15.318  24.854 1.00 23.94 ? 310 ASN A CB  1 
ATOM   2336 C  CG  . ASN A 1 287 ? 33.470 14.288  24.140 1.00 28.41 ? 310 ASN A CG  1 
ATOM   2337 O  OD1 . ASN A 1 287 ? 34.675 14.204  24.377 1.00 29.91 ? 310 ASN A OD1 1 
ATOM   2338 N  ND2 . ASN A 1 287 ? 32.848 13.503  23.251 1.00 27.85 ? 310 ASN A ND2 1 
ATOM   2339 N  N   . TYR A 1 288 ? 34.626 17.715  24.487 1.00 24.19 ? 311 TYR A N   1 
ATOM   2340 C  CA  . TYR A 1 288 ? 36.005 18.150  24.270 1.00 37.72 ? 311 TYR A CA  1 
ATOM   2341 C  C   . TYR A 1 288 ? 36.842 17.461  25.339 1.00 48.64 ? 311 TYR A C   1 
ATOM   2342 O  O   . TYR A 1 288 ? 36.955 17.974  26.456 1.00 70.31 ? 311 TYR A O   1 
ATOM   2343 C  CB  . TYR A 1 288 ? 36.187 19.668  24.404 1.00 48.18 ? 311 TYR A CB  1 
ATOM   2344 C  CG  . TYR A 1 288 ? 35.137 20.598  23.828 1.00 56.25 ? 311 TYR A CG  1 
ATOM   2345 C  CD1 . TYR A 1 288 ? 33.800 20.530  24.226 1.00 58.43 ? 311 TYR A CD1 1 
ATOM   2346 C  CD2 . TYR A 1 288 ? 35.506 21.609  22.947 1.00 51.54 ? 311 TYR A CD2 1 
ATOM   2347 C  CE1 . TYR A 1 288 ? 32.856 21.401  23.714 1.00 51.41 ? 311 TYR A CE1 1 
ATOM   2348 C  CE2 . TYR A 1 288 ? 34.574 22.486  22.436 1.00 54.82 ? 311 TYR A CE2 1 
ATOM   2349 C  CZ  . TYR A 1 288 ? 33.251 22.379  22.820 1.00 51.47 ? 311 TYR A CZ  1 
ATOM   2350 O  OH  . TYR A 1 288 ? 32.328 23.255  22.307 1.00 54.12 ? 311 TYR A OH  1 
ATOM   2351 N  N   . LEU A 1 289 ? 37.429 16.304  25.030 1.00 50.54 ? 312 LEU A N   1 
ATOM   2352 C  CA  . LEU A 1 289 ? 38.373 15.692  25.951 1.00 64.48 ? 312 LEU A CA  1 
ATOM   2353 C  C   . LEU A 1 289 ? 39.759 15.877  25.355 1.00 70.40 ? 312 LEU A C   1 
ATOM   2354 O  O   . LEU A 1 289 ? 40.409 16.912  25.612 1.00 72.86 ? 312 LEU A O   1 
ATOM   2355 C  CB  . LEU A 1 289 ? 37.988 14.237  26.250 1.00 61.85 ? 312 LEU A CB  1 
ATOM   2356 C  CG  . LEU A 1 289 ? 37.414 14.013  27.660 1.00 64.44 ? 312 LEU A CG  1 
ATOM   2357 C  CD1 . LEU A 1 289 ? 36.471 15.141  28.074 1.00 63.34 ? 312 LEU A CD1 1 
ATOM   2358 C  CD2 . LEU A 1 289 ? 36.698 12.671  27.757 1.00 52.43 ? 312 LEU A CD2 1 
ATOM   2359 N  N   . ASP A 1 290 ? 40.262 14.937  24.557 1.00 61.20 ? 313 ASP A N   1 
ATOM   2360 C  CA  . ASP A 1 290 ? 41.514 15.181  23.840 1.00 62.39 ? 313 ASP A CA  1 
ATOM   2361 C  C   . ASP A 1 290 ? 41.268 16.103  22.648 1.00 62.21 ? 313 ASP A C   1 
ATOM   2362 O  O   . ASP A 1 290 ? 41.740 17.244  22.620 1.00 61.78 ? 313 ASP A O   1 
ATOM   2363 C  CB  . ASP A 1 290 ? 42.146 13.855  23.402 1.00 60.19 ? 313 ASP A CB  1 
ATOM   2364 N  N   . VAL A 1 291 ? 40.516 15.622  21.662 1.00 48.87 ? 314 VAL A N   1 
ATOM   2365 C  CA  . VAL A 1 291 ? 40.076 16.433  20.539 1.00 43.59 ? 314 VAL A CA  1 
ATOM   2366 C  C   . VAL A 1 291 ? 38.580 16.704  20.693 1.00 39.36 ? 314 VAL A C   1 
ATOM   2367 O  O   . VAL A 1 291 ? 37.911 16.151  21.566 1.00 34.10 ? 314 VAL A O   1 
ATOM   2368 C  CB  . VAL A 1 291 ? 40.382 15.759  19.186 1.00 45.97 ? 314 VAL A CB  1 
ATOM   2369 N  N   . TYR A 1 292 ? 38.057 17.572  19.833 1.00 30.35 ? 315 TYR A N   1 
ATOM   2370 C  CA  . TYR A 1 292 ? 36.620 17.810  19.796 1.00 30.83 ? 315 TYR A CA  1 
ATOM   2371 C  C   . TYR A 1 292 ? 35.924 16.642  19.113 1.00 31.85 ? 315 TYR A C   1 
ATOM   2372 O  O   . TYR A 1 292 ? 36.403 16.120  18.103 1.00 29.57 ? 315 TYR A O   1 
ATOM   2373 C  CB  . TYR A 1 292 ? 36.290 19.112  19.060 1.00 26.41 ? 315 TYR A CB  1 
ATOM   2374 C  CG  . TYR A 1 292 ? 34.797 19.360  18.961 1.00 24.29 ? 315 TYR A CG  1 
ATOM   2375 C  CD1 . TYR A 1 292 ? 34.045 19.687  20.094 1.00 25.78 ? 315 TYR A CD1 1 
ATOM   2376 C  CD2 . TYR A 1 292 ? 34.133 19.248  17.742 1.00 20.97 ? 315 TYR A CD2 1 
ATOM   2377 C  CE1 . TYR A 1 292 ? 32.663 19.904  20.013 1.00 20.21 ? 315 TYR A CE1 1 
ATOM   2378 C  CE2 . TYR A 1 292 ? 32.754 19.453  17.651 1.00 24.53 ? 315 TYR A CE2 1 
ATOM   2379 C  CZ  . TYR A 1 292 ? 32.029 19.784  18.787 1.00 25.84 ? 315 TYR A CZ  1 
ATOM   2380 O  OH  . TYR A 1 292 ? 30.669 19.985  18.673 1.00 21.87 ? 315 TYR A OH  1 
ATOM   2381 N  N   . ASN A 1 293 ? 34.789 16.223  19.665 1.00 23.74 ? 316 ASN A N   1 
ATOM   2382 C  CA  . ASN A 1 293 ? 34.007 15.137  19.076 1.00 22.74 ? 316 ASN A CA  1 
ATOM   2383 C  C   . ASN A 1 293 ? 32.555 15.582  19.003 1.00 25.26 ? 316 ASN A C   1 
ATOM   2384 O  O   . ASN A 1 293 ? 31.890 15.707  20.035 1.00 20.06 ? 316 ASN A O   1 
ATOM   2385 C  CB  . ASN A 1 293 ? 34.143 13.842  19.884 1.00 20.48 ? 316 ASN A CB  1 
ATOM   2386 C  CG  . ASN A 1 293 ? 33.362 12.680  19.273 1.00 25.89 ? 316 ASN A CG  1 
ATOM   2387 O  OD1 . ASN A 1 293 ? 32.870 12.757  18.139 1.00 26.42 ? 316 ASN A OD1 1 
ATOM   2388 N  ND2 . ASN A 1 293 ? 33.247 11.594  20.028 1.00 26.52 ? 316 ASN A ND2 1 
ATOM   2389 N  N   . ASN A 1 294 ? 32.066 15.811  17.782 1.00 24.45 ? 317 ASN A N   1 
ATOM   2390 C  CA  . ASN A 1 294 ? 30.704 16.288  17.589 1.00 23.46 ? 317 ASN A CA  1 
ATOM   2391 C  C   . ASN A 1 294 ? 29.663 15.196  17.794 1.00 22.65 ? 317 ASN A C   1 
ATOM   2392 O  O   . ASN A 1 294 ? 28.504 15.514  18.079 1.00 22.04 ? 317 ASN A O   1 
ATOM   2393 C  CB  . ASN A 1 294 ? 30.554 16.881  16.184 1.00 21.78 ? 317 ASN A CB  1 
ATOM   2394 C  CG  . ASN A 1 294 ? 29.305 17.737  16.043 1.00 25.98 ? 317 ASN A CG  1 
ATOM   2395 O  OD1 . ASN A 1 294 ? 28.345 17.350  15.379 1.00 35.28 ? 317 ASN A OD1 1 
ATOM   2396 N  ND2 . ASN A 1 294 ? 29.316 18.907  16.674 1.00 21.27 ? 317 ASN A ND2 1 
ATOM   2397 N  N   . LYS A 1 295 ? 30.050 13.925  17.661 1.00 21.84 ? 318 LYS A N   1 
ATOM   2398 C  CA  . LYS A 1 295 ? 29.069 12.845  17.617 1.00 24.35 ? 318 LYS A CA  1 
ATOM   2399 C  C   . LYS A 1 295 ? 28.453 12.600  18.990 1.00 24.79 ? 318 LYS A C   1 
ATOM   2400 O  O   . LYS A 1 295 ? 29.066 12.857  20.032 1.00 25.37 ? 318 LYS A O   1 
ATOM   2401 C  CB  . LYS A 1 295 ? 29.702 11.553  17.104 1.00 24.41 ? 318 LYS A CB  1 
ATOM   2402 C  CG  . LYS A 1 295 ? 30.195 11.636  15.667 1.00 39.77 ? 318 LYS A CG  1 
ATOM   2403 C  CD  . LYS A 1 295 ? 30.673 10.284  15.155 1.00 43.56 ? 318 LYS A CD  1 
ATOM   2404 C  CE  . LYS A 1 295 ? 31.784 9.718   16.019 1.00 37.99 ? 318 LYS A CE  1 
ATOM   2405 N  NZ  . LYS A 1 295 ? 32.926 10.664  16.196 1.00 41.97 ? 318 LYS A NZ  1 
ATOM   2406 N  N   . ALA A 1 296 ? 27.230 12.076  18.973 1.00 22.19 ? 319 ALA A N   1 
ATOM   2407 C  CA  . ALA A 1 296 ? 26.459 11.815  20.181 1.00 17.05 ? 319 ALA A CA  1 
ATOM   2408 C  C   . ALA A 1 296 ? 25.392 10.791  19.826 1.00 19.94 ? 319 ALA A C   1 
ATOM   2409 O  O   . ALA A 1 296 ? 25.122 10.534  18.651 1.00 18.63 ? 319 ALA A O   1 
ATOM   2410 C  CB  . ALA A 1 296 ? 25.830 13.098  20.729 1.00 20.67 ? 319 ALA A CB  1 
ATOM   2411 N  N   . ALA A 1 297 ? 24.763 10.231  20.854 1.00 15.20 ? 320 ALA A N   1 
ATOM   2412 C  CA  . ALA A 1 297 ? 23.734 9.230   20.627 1.00 13.45 ? 320 ALA A CA  1 
ATOM   2413 C  C   . ALA A 1 297 ? 22.655 9.339   21.689 1.00 18.80 ? 320 ALA A C   1 
ATOM   2414 O  O   . ALA A 1 297 ? 22.863 9.906   22.765 1.00 16.85 ? 320 ALA A O   1 
ATOM   2415 C  CB  . ALA A 1 297 ? 24.319 7.810   20.630 1.00 13.69 ? 320 ALA A CB  1 
ATOM   2416 N  N   . VAL A 1 298 ? 21.482 8.792   21.358 1.00 14.13 ? 321 VAL A N   1 
ATOM   2417 C  CA  . VAL A 1 298 ? 20.401 8.574   22.313 1.00 14.64 ? 321 VAL A CA  1 
ATOM   2418 C  C   . VAL A 1 298 ? 19.975 7.113   22.209 1.00 20.24 ? 321 VAL A C   1 
ATOM   2419 O  O   . VAL A 1 298 ? 20.281 6.414   21.241 1.00 19.26 ? 321 VAL A O   1 
ATOM   2420 C  CB  . VAL A 1 298 ? 19.178 9.498   22.085 1.00 17.05 ? 321 VAL A CB  1 
ATOM   2421 C  CG1 . VAL A 1 298 ? 19.574 10.977  22.174 1.00 17.43 ? 321 VAL A CG1 1 
ATOM   2422 C  CG2 . VAL A 1 298 ? 18.484 9.176   20.758 1.00 18.25 ? 321 VAL A CG2 1 
ATOM   2423 N  N   . LEU A 1 299 ? 19.262 6.656   23.228 1.00 14.90 ? 322 LEU A N   1 
ATOM   2424 C  CA  A LEU A 1 299 ? 18.775 5.281   23.323 0.49 15.51 ? 322 LEU A CA  1 
ATOM   2425 C  CA  B LEU A 1 299 ? 18.779 5.289   23.293 0.51 15.47 ? 322 LEU A CA  1 
ATOM   2426 C  C   . LEU A 1 299 ? 17.257 5.311   23.254 1.00 22.44 ? 322 LEU A C   1 
ATOM   2427 O  O   . LEU A 1 299 ? 16.619 5.969   24.078 1.00 24.55 ? 322 LEU A O   1 
ATOM   2428 C  CB  A LEU A 1 299 ? 19.202 4.616   24.635 0.49 16.78 ? 322 LEU A CB  1 
ATOM   2429 C  CB  B LEU A 1 299 ? 19.304 4.628   24.560 0.51 16.78 ? 322 LEU A CB  1 
ATOM   2430 C  CG  A LEU A 1 299 ? 20.655 4.355   25.037 0.49 16.30 ? 322 LEU A CG  1 
ATOM   2431 C  CG  B LEU A 1 299 ? 18.989 3.176   24.837 0.51 22.21 ? 322 LEU A CG  1 
ATOM   2432 C  CD1 A LEU A 1 299 ? 20.735 3.892   26.495 0.49 15.43 ? 322 LEU A CD1 1 
ATOM   2433 C  CD1 B LEU A 1 299 ? 20.079 2.668   25.759 0.51 23.60 ? 322 LEU A CD1 1 
ATOM   2434 C  CD2 A LEU A 1 299 ? 21.272 3.318   24.137 0.49 21.26 ? 322 LEU A CD2 1 
ATOM   2435 C  CD2 B LEU A 1 299 ? 17.622 3.075   25.509 0.51 22.07 ? 322 LEU A CD2 1 
ATOM   2436 N  N   . LYS A 1 300 ? 16.677 4.600   22.292 1.00 20.66 ? 323 LYS A N   1 
ATOM   2437 C  CA  . LYS A 1 300 ? 15.221 4.521   22.174 1.00 18.52 ? 323 LYS A CA  1 
ATOM   2438 C  C   . LYS A 1 300 ? 14.821 3.076   22.438 1.00 20.30 ? 323 LYS A C   1 
ATOM   2439 O  O   . LYS A 1 300 ? 15.187 2.172   21.677 1.00 22.31 ? 323 LYS A O   1 
ATOM   2440 C  CB  . LYS A 1 300 ? 14.741 5.005   20.802 1.00 26.05 ? 323 LYS A CB  1 
ATOM   2441 N  N   . TYR A 1 301 ? 14.116 2.852   23.536 1.00 18.76 ? 324 TYR A N   1 
ATOM   2442 C  CA  . TYR A 1 301 ? 13.658 1.525   23.911 1.00 20.03 ? 324 TYR A CA  1 
ATOM   2443 C  C   . TYR A 1 301 ? 12.183 1.412   23.555 1.00 22.67 ? 324 TYR A C   1 
ATOM   2444 O  O   . TYR A 1 301 ? 11.349 2.122   24.119 1.00 18.60 ? 324 TYR A O   1 
ATOM   2445 C  CB  . TYR A 1 301 ? 13.885 1.264   25.399 1.00 22.98 ? 324 TYR A CB  1 
ATOM   2446 C  CG  . TYR A 1 301 ? 13.645 -0.177  25.761 1.00 20.62 ? 324 TYR A CG  1 
ATOM   2447 C  CD1 . TYR A 1 301 ? 14.287 -1.197  25.071 1.00 26.30 ? 324 TYR A CD1 1 
ATOM   2448 C  CD2 . TYR A 1 301 ? 12.760 -0.524  26.771 1.00 22.31 ? 324 TYR A CD2 1 
ATOM   2449 C  CE1 . TYR A 1 301 ? 14.065 -2.529  25.387 1.00 28.37 ? 324 TYR A CE1 1 
ATOM   2450 C  CE2 . TYR A 1 301 ? 12.529 -1.852  27.092 1.00 28.03 ? 324 TYR A CE2 1 
ATOM   2451 C  CZ  . TYR A 1 301 ? 13.184 -2.849  26.398 1.00 28.26 ? 324 TYR A CZ  1 
ATOM   2452 O  OH  . TYR A 1 301 ? 12.958 -4.168  26.722 1.00 25.99 ? 324 TYR A OH  1 
ATOM   2453 N  N   . GLU A 1 302 ? 11.862 0.519   22.624 1.00 24.43 ? 325 GLU A N   1 
ATOM   2454 C  CA  . GLU A 1 302 ? 10.501 0.457   22.113 1.00 25.85 ? 325 GLU A CA  1 
ATOM   2455 C  C   . GLU A 1 302 ? 10.315 -0.876  21.416 1.00 29.22 ? 325 GLU A C   1 
ATOM   2456 O  O   . GLU A 1 302 ? 11.200 -1.313  20.677 1.00 26.63 ? 325 GLU A O   1 
ATOM   2457 C  CB  . GLU A 1 302 ? 10.225 1.607   21.140 1.00 27.61 ? 325 GLU A CB  1 
ATOM   2458 C  CG  . GLU A 1 302 ? 8.793  1.721   20.663 1.00 37.04 ? 325 GLU A CG  1 
ATOM   2459 C  CD  . GLU A 1 302 ? 8.565  2.984   19.853 1.00 47.20 ? 325 GLU A CD  1 
ATOM   2460 O  OE1 . GLU A 1 302 ? 9.499  3.408   19.133 1.00 52.98 ? 325 GLU A OE1 1 
ATOM   2461 O  OE2 . GLU A 1 302 ? 7.461  3.562   19.946 1.00 44.49 ? 325 GLU A OE2 1 
ATOM   2462 N  N   . ASN A 1 303 ? 9.175  -1.520  21.672 1.00 32.22 ? 326 ASN A N   1 
ATOM   2463 C  CA  . ASN A 1 303 ? 8.827  -2.774  21.004 1.00 30.36 ? 326 ASN A CA  1 
ATOM   2464 C  C   . ASN A 1 303 ? 9.895  -3.838  21.232 1.00 32.58 ? 326 ASN A C   1 
ATOM   2465 O  O   . ASN A 1 303 ? 10.267 -4.578  20.320 1.00 39.72 ? 326 ASN A O   1 
ATOM   2466 C  CB  . ASN A 1 303 ? 8.594  -2.544  19.511 1.00 29.77 ? 326 ASN A CB  1 
ATOM   2467 C  CG  . ASN A 1 303 ? 7.403  -1.646  19.247 1.00 35.40 ? 326 ASN A CG  1 
ATOM   2468 O  OD1 . ASN A 1 303 ? 6.380  -1.737  19.932 1.00 38.30 ? 326 ASN A OD1 1 
ATOM   2469 N  ND2 . ASN A 1 303 ? 7.526  -0.772  18.254 1.00 39.60 ? 326 ASN A ND2 1 
ATOM   2470 N  N   . ASN A 1 304 ? 10.399 -3.901  22.465 1.00 28.81 ? 327 ASN A N   1 
ATOM   2471 C  CA  . ASN A 1 304 ? 11.420 -4.869  22.869 1.00 33.14 ? 327 ASN A CA  1 
ATOM   2472 C  C   . ASN A 1 304 ? 12.690 -4.757  22.020 1.00 29.80 ? 327 ASN A C   1 
ATOM   2473 O  O   . ASN A 1 304 ? 13.420 -5.735  21.844 1.00 28.24 ? 327 ASN A O   1 
ATOM   2474 C  CB  . ASN A 1 304 ? 10.875 -6.300  22.828 1.00 29.55 ? 327 ASN A CB  1 
ATOM   2475 C  CG  . ASN A 1 304 ? 11.593 -7.217  23.788 1.00 39.48 ? 327 ASN A CG  1 
ATOM   2476 O  OD1 . ASN A 1 304 ? 12.011 -6.796  24.869 1.00 39.91 ? 327 ASN A OD1 1 
ATOM   2477 N  ND2 . ASN A 1 304 ? 11.749 -8.479  23.399 1.00 40.18 ? 327 ASN A ND2 1 
ATOM   2478 N  N   . VAL A 1 305 ? 12.966 -3.569  21.491 1.00 27.64 ? 328 VAL A N   1 
ATOM   2479 C  CA  . VAL A 1 305 ? 14.189 -3.296  20.745 1.00 25.34 ? 328 VAL A CA  1 
ATOM   2480 C  C   . VAL A 1 305 ? 14.885 -2.104  21.390 1.00 26.64 ? 328 VAL A C   1 
ATOM   2481 O  O   . VAL A 1 305 ? 14.284 -1.033  21.536 1.00 23.96 ? 328 VAL A O   1 
ATOM   2482 C  CB  . VAL A 1 305 ? 13.914 -3.016  19.260 1.00 30.29 ? 328 VAL A CB  1 
ATOM   2483 C  CG1 . VAL A 1 305 ? 15.183 -2.519  18.582 1.00 29.58 ? 328 VAL A CG1 1 
ATOM   2484 C  CG2 . VAL A 1 305 ? 13.383 -4.275  18.563 1.00 27.19 ? 328 VAL A CG2 1 
ATOM   2485 N  N   . MET A 1 306 ? 16.138 -2.304  21.784 1.00 22.71 ? 329 MET A N   1 
ATOM   2486 C  CA  . MET A 1 306 ? 17.024 -1.255  22.288 1.00 23.61 ? 329 MET A CA  1 
ATOM   2487 C  C   . MET A 1 306 ? 17.724 -0.623  21.089 1.00 26.94 ? 329 MET A C   1 
ATOM   2488 O  O   . MET A 1 306 ? 18.697 -1.176  20.565 1.00 29.61 ? 329 MET A O   1 
ATOM   2489 C  CB  . MET A 1 306 ? 18.023 -1.863  23.262 1.00 24.49 ? 329 MET A CB  1 
ATOM   2490 C  CG  . MET A 1 306 ? 19.040 -0.911  23.820 1.00 40.76 ? 329 MET A CG  1 
ATOM   2491 S  SD  . MET A 1 306 ? 18.301 -0.072  25.216 1.00 55.12 ? 329 MET A SD  1 
ATOM   2492 C  CE  . MET A 1 306 ? 17.683 -1.450  26.139 1.00 35.79 ? 329 MET A CE  1 
ATOM   2493 N  N   . ASN A 1 307 ? 17.227 0.528   20.638 1.00 24.35 ? 330 ASN A N   1 
ATOM   2494 C  CA  . ASN A 1 307 ? 17.720 1.178   19.423 1.00 22.58 ? 330 ASN A CA  1 
ATOM   2495 C  C   . ASN A 1 307 ? 18.632 2.348   19.792 1.00 24.88 ? 330 ASN A C   1 
ATOM   2496 O  O   . ASN A 1 307 ? 18.160 3.406   20.224 1.00 23.47 ? 330 ASN A O   1 
ATOM   2497 C  CB  . ASN A 1 307 ? 16.550 1.640   18.555 1.00 24.32 ? 330 ASN A CB  1 
ATOM   2498 C  CG  . ASN A 1 307 ? 16.997 2.294   17.247 1.00 34.60 ? 330 ASN A CG  1 
ATOM   2499 O  OD1 . ASN A 1 307 ? 16.261 3.094   16.664 1.00 34.82 ? 330 ASN A OD1 1 
ATOM   2500 N  ND2 . ASN A 1 307 ? 18.202 1.956   16.780 1.00 31.03 ? 330 ASN A ND2 1 
ATOM   2501 N  N   . ILE A 1 308 ? 19.933 2.169   19.593 1.00 20.78 ? 331 ILE A N   1 
ATOM   2502 C  CA  . ILE A 1 308 ? 20.911 3.231   19.812 1.00 22.16 ? 331 ILE A CA  1 
ATOM   2503 C  C   . ILE A 1 308 ? 20.987 4.061   18.540 1.00 26.02 ? 331 ILE A C   1 
ATOM   2504 O  O   . ILE A 1 308 ? 21.377 3.550   17.483 1.00 25.96 ? 331 ILE A O   1 
ATOM   2505 C  CB  . ILE A 1 308 ? 22.287 2.657   20.171 1.00 20.39 ? 331 ILE A CB  1 
ATOM   2506 C  CG1 . ILE A 1 308 ? 22.158 1.630   21.297 1.00 30.92 ? 331 ILE A CG1 1 
ATOM   2507 C  CG2 . ILE A 1 308 ? 23.269 3.777   20.526 1.00 19.85 ? 331 ILE A CG2 1 
ATOM   2508 C  CD1 . ILE A 1 308 ? 23.476 1.187   21.888 1.00 33.20 ? 331 ILE A CD1 1 
ATOM   2509 N  N   . ARG A 1 309 ? 20.620 5.335   18.635 1.00 19.30 ? 332 ARG A N   1 
ATOM   2510 C  CA  . ARG A 1 309 ? 20.546 6.218   17.475 1.00 20.71 ? 332 ARG A CA  1 
ATOM   2511 C  C   . ARG A 1 309 ? 21.649 7.259   17.581 1.00 24.39 ? 332 ARG A C   1 
ATOM   2512 O  O   . ARG A 1 309 ? 21.601 8.150   18.438 1.00 18.10 ? 332 ARG A O   1 
ATOM   2513 C  CB  . ARG A 1 309 ? 19.171 6.874   17.359 1.00 22.27 ? 332 ARG A CB  1 
ATOM   2514 C  CG  . ARG A 1 309 ? 18.050 5.863   17.152 1.00 34.92 ? 332 ARG A CG  1 
ATOM   2515 C  CD  . ARG A 1 309 ? 16.714 6.541   16.897 1.00 52.27 ? 332 ARG A CD  1 
ATOM   2516 N  N   . GLN A 1 310 ? 22.646 7.130   16.721 1.00 19.32 ? 333 GLN A N   1 
ATOM   2517 C  CA  . GLN A 1 310 ? 23.709 8.113   16.629 1.00 24.65 ? 333 GLN A CA  1 
ATOM   2518 C  C   . GLN A 1 310 ? 23.246 9.313   15.816 1.00 28.79 ? 333 GLN A C   1 
ATOM   2519 O  O   . GLN A 1 310 ? 22.453 9.181   14.880 1.00 27.98 ? 333 GLN A O   1 
ATOM   2520 C  CB  . GLN A 1 310 ? 24.931 7.479   15.980 1.00 24.01 ? 333 GLN A CB  1 
ATOM   2521 C  CG  . GLN A 1 310 ? 26.215 8.223   16.163 1.00 29.74 ? 333 GLN A CG  1 
ATOM   2522 C  CD  . GLN A 1 310 ? 27.333 7.537   15.420 1.00 36.04 ? 333 GLN A CD  1 
ATOM   2523 O  OE1 . GLN A 1 310 ? 27.268 7.379   14.200 1.00 36.63 ? 333 GLN A OE1 1 
ATOM   2524 N  NE2 . GLN A 1 310 ? 28.350 7.099   16.151 1.00 22.44 ? 333 GLN A NE2 1 
ATOM   2525 N  N   . PHE A 1 311 ? 23.741 10.494  16.183 1.00 27.85 ? 334 PHE A N   1 
ATOM   2526 C  CA  . PHE A 1 311 ? 23.449 11.704  15.427 1.00 28.38 ? 334 PHE A CA  1 
ATOM   2527 C  C   . PHE A 1 311 ? 24.661 12.627  15.500 1.00 33.29 ? 334 PHE A C   1 
ATOM   2528 O  O   . PHE A 1 311 ? 25.692 12.288  16.091 1.00 24.69 ? 334 PHE A O   1 
ATOM   2529 C  CB  . PHE A 1 311 ? 22.159 12.376  15.925 1.00 30.23 ? 334 PHE A CB  1 
ATOM   2530 C  CG  . PHE A 1 311 ? 22.219 12.875  17.350 1.00 35.40 ? 334 PHE A CG  1 
ATOM   2531 C  CD1 . PHE A 1 311 ? 21.963 12.017  18.418 1.00 27.19 ? 334 PHE A CD1 1 
ATOM   2532 C  CD2 . PHE A 1 311 ? 22.487 14.215  17.619 1.00 33.17 ? 334 PHE A CD2 1 
ATOM   2533 C  CE1 . PHE A 1 311 ? 22.006 12.481  19.729 1.00 21.85 ? 334 PHE A CE1 1 
ATOM   2534 C  CE2 . PHE A 1 311 ? 22.530 14.689  18.931 1.00 33.25 ? 334 PHE A CE2 1 
ATOM   2535 C  CZ  . PHE A 1 311 ? 22.289 13.819  19.986 1.00 28.94 ? 334 PHE A CZ  1 
ATOM   2536 N  N   . ASN A 1 312 ? 24.543 13.788  14.846 1.00 38.42 ? 335 ASN A N   1 
ATOM   2537 C  CA  . ASN A 1 312 ? 25.591 14.814  14.836 1.00 38.40 ? 335 ASN A CA  1 
ATOM   2538 C  C   . ASN A 1 312 ? 26.898 14.313  14.216 1.00 43.41 ? 335 ASN A C   1 
ATOM   2539 O  O   . ASN A 1 312 ? 27.985 14.518  14.763 1.00 51.13 ? 335 ASN A O   1 
ATOM   2540 C  CB  . ASN A 1 312 ? 25.844 15.341  16.249 1.00 36.63 ? 335 ASN A CB  1 
ATOM   2541 C  CG  . ASN A 1 312 ? 24.976 16.527  16.597 1.00 34.56 ? 335 ASN A CG  1 
ATOM   2542 O  OD1 . ASN A 1 312 ? 23.952 16.781  15.959 1.00 49.62 ? 335 ASN A OD1 1 
ATOM   2543 N  ND2 . ASN A 1 312 ? 25.385 17.266  17.620 1.00 44.06 ? 335 ASN A ND2 1 
ATOM   2544 N  N   . CYS A 1 313 ? 26.800 13.674  13.055 1.00 46.21 ? 336 CYS A N   1 
ATOM   2545 C  CA  . CYS A 1 313 ? 28.007 13.173  12.393 1.00 60.25 ? 336 CYS A CA  1 
ATOM   2546 C  C   . CYS A 1 313 ? 28.713 14.246  11.562 1.00 69.63 ? 336 CYS A C   1 
ATOM   2547 O  O   . CYS A 1 313 ? 28.719 15.425  11.917 1.00 71.49 ? 336 CYS A O   1 
ATOM   2548 C  CB  . CYS A 1 313 ? 27.679 11.973  11.505 1.00 60.11 ? 336 CYS A CB  1 
ATOM   2549 S  SG  . CYS A 1 313 ? 27.488 10.401  12.383 1.00 60.96 ? 336 CYS A SG  1 
ATOM   2550 N  N   . THR B 2 29  ? 14.322 -11.081 26.503 1.00 42.45 ? 153 THR B N   1 
ATOM   2551 C  CA  . THR B 2 29  ? 15.524 -10.281 26.294 1.00 34.17 ? 153 THR B CA  1 
ATOM   2552 C  C   . THR B 2 29  ? 15.407 -9.478  24.998 1.00 33.20 ? 153 THR B C   1 
ATOM   2553 O  O   . THR B 2 29  ? 15.240 -10.055 23.927 1.00 30.95 ? 153 THR B O   1 
ATOM   2554 C  CB  . THR B 2 29  ? 16.777 -11.162 26.243 1.00 37.89 ? 153 THR B CB  1 
ATOM   2555 O  OG1 . THR B 2 29  ? 16.755 -12.079 27.344 1.00 53.42 ? 153 THR B OG1 1 
ATOM   2556 C  CG2 . THR B 2 29  ? 18.027 -10.319 26.342 1.00 31.96 ? 153 THR B CG2 1 
ATOM   2557 N  N   . PRO B 2 30  ? 15.486 -8.154  25.098 1.00 32.38 ? 154 PRO B N   1 
ATOM   2558 C  CA  . PRO B 2 30  ? 15.361 -7.314  23.902 1.00 28.99 ? 154 PRO B CA  1 
ATOM   2559 C  C   . PRO B 2 30  ? 16.566 -7.440  22.985 1.00 23.71 ? 154 PRO B C   1 
ATOM   2560 O  O   . PRO B 2 30  ? 17.661 -7.850  23.385 1.00 30.45 ? 154 PRO B O   1 
ATOM   2561 C  CB  . PRO B 2 30  ? 15.257 -5.891  24.467 1.00 28.82 ? 154 PRO B CB  1 
ATOM   2562 C  CG  . PRO B 2 30  ? 15.945 -5.966  25.771 1.00 26.69 ? 154 PRO B CG  1 
ATOM   2563 C  CD  . PRO B 2 30  ? 15.648 -7.347  26.317 1.00 29.61 ? 154 PRO B CD  1 
ATOM   2564 N  N   . SER B 2 31  ? 16.344 -7.074  21.731 1.00 27.99 ? 155 SER B N   1 
ATOM   2565 C  CA  . SER B 2 31  ? 17.429 -7.023  20.767 1.00 35.18 ? 155 SER B CA  1 
ATOM   2566 C  C   . SER B 2 31  ? 17.998 -5.610  20.722 1.00 27.59 ? 155 SER B C   1 
ATOM   2567 O  O   . SER B 2 31  ? 17.367 -4.650  21.165 1.00 30.46 ? 155 SER B O   1 
ATOM   2568 C  CB  . SER B 2 31  ? 16.944 -7.451  19.382 1.00 34.63 ? 155 SER B CB  1 
ATOM   2569 O  OG  . SER B 2 31  ? 16.046 -6.495  18.843 1.00 41.20 ? 155 SER B OG  1 
ATOM   2570 N  N   . VAL B 2 32  ? 19.215 -5.493  20.198 1.00 31.52 ? 156 VAL B N   1 
ATOM   2571 C  CA  . VAL B 2 32  ? 19.905 -4.214  20.079 1.00 26.10 ? 156 VAL B CA  1 
ATOM   2572 C  C   . VAL B 2 32  ? 20.052 -3.881  18.604 1.00 35.64 ? 156 VAL B C   1 
ATOM   2573 O  O   . VAL B 2 32  ? 20.528 -4.708  17.816 1.00 30.02 ? 156 VAL B O   1 
ATOM   2574 C  CB  . VAL B 2 32  ? 21.277 -4.245  20.771 1.00 31.53 ? 156 VAL B CB  1 
ATOM   2575 C  CG1 . VAL B 2 32  ? 21.988 -2.911  20.583 1.00 29.95 ? 156 VAL B CG1 1 
ATOM   2576 C  CG2 . VAL B 2 32  ? 21.121 -4.575  22.251 1.00 32.43 ? 156 VAL B CG2 1 
ATOM   2577 N  N   . VAL B 2 33  ? 19.635 -2.676  18.230 1.00 26.08 ? 157 VAL B N   1 
ATOM   2578 C  CA  . VAL B 2 33  ? 19.799 -2.159  16.878 1.00 24.16 ? 157 VAL B CA  1 
ATOM   2579 C  C   . VAL B 2 33  ? 20.567 -0.847  16.980 1.00 29.94 ? 157 VAL B C   1 
ATOM   2580 O  O   . VAL B 2 33  ? 20.102 0.101   17.627 1.00 24.59 ? 157 VAL B O   1 
ATOM   2581 C  CB  . VAL B 2 33  ? 18.452 -1.945  16.173 1.00 27.07 ? 157 VAL B CB  1 
ATOM   2582 C  CG1 . VAL B 2 33  ? 18.671 -1.305  14.809 1.00 28.61 ? 157 VAL B CG1 1 
ATOM   2583 C  CG2 . VAL B 2 33  ? 17.686 -3.259  16.053 1.00 30.82 ? 157 VAL B CG2 1 
ATOM   2584 N  N   . ILE B 2 34  ? 21.738 -0.795  16.352 1.00 25.99 ? 158 ILE B N   1 
ATOM   2585 C  CA  . ILE B 2 34  ? 22.541 0.419   16.274 1.00 23.07 ? 158 ILE B CA  1 
ATOM   2586 C  C   . ILE B 2 34  ? 22.268 1.097   14.942 1.00 29.12 ? 158 ILE B C   1 
ATOM   2587 O  O   . ILE B 2 34  ? 22.426 0.479   13.879 1.00 31.20 ? 158 ILE B O   1 
ATOM   2588 C  CB  . ILE B 2 34  ? 24.042 0.120   16.407 1.00 21.63 ? 158 ILE B CB  1 
ATOM   2589 C  CG1 . ILE B 2 34  ? 24.311 -0.903  17.512 1.00 33.51 ? 158 ILE B CG1 1 
ATOM   2590 C  CG2 . ILE B 2 34  ? 24.820 1.438   16.569 1.00 23.14 ? 158 ILE B CG2 1 
ATOM   2591 C  CD1 . ILE B 2 34  ? 24.429 -0.330  18.880 1.00 29.52 ? 158 ILE B CD1 1 
ATOM   2592 N  N   . THR B 2 35  ? 21.882 2.366   14.996 1.00 21.58 ? 159 THR B N   1 
ATOM   2593 C  CA  . THR B 2 35  ? 21.728 3.210   13.815 1.00 27.14 ? 159 THR B CA  1 
ATOM   2594 C  C   . THR B 2 35  ? 22.832 4.263   13.845 1.00 26.67 ? 159 THR B C   1 
ATOM   2595 O  O   . THR B 2 35  ? 22.829 5.140   14.713 1.00 25.44 ? 159 THR B O   1 
ATOM   2596 C  CB  . THR B 2 35  ? 20.349 3.864   13.795 1.00 25.49 ? 159 THR B CB  1 
ATOM   2597 O  OG1 . THR B 2 35  ? 19.346 2.854   13.957 1.00 33.44 ? 159 THR B OG1 1 
ATOM   2598 C  CG2 . THR B 2 35  ? 20.123 4.595   12.485 1.00 30.67 ? 159 THR B CG2 1 
ATOM   2599 N  N   . VAL B 2 36  ? 23.779 4.175   12.910 1.00 28.74 ? 160 VAL B N   1 
ATOM   2600 C  CA  . VAL B 2 36  ? 24.882 5.128   12.839 1.00 29.19 ? 160 VAL B CA  1 
ATOM   2601 C  C   . VAL B 2 36  ? 24.567 6.157   11.764 1.00 29.72 ? 160 VAL B C   1 
ATOM   2602 O  O   . VAL B 2 36  ? 23.710 5.948   10.903 1.00 31.92 ? 160 VAL B O   1 
ATOM   2603 C  CB  . VAL B 2 36  ? 26.238 4.439   12.562 1.00 43.48 ? 160 VAL B CB  1 
ATOM   2604 C  CG1 . VAL B 2 36  ? 26.588 3.479   13.689 1.00 42.76 ? 160 VAL B CG1 1 
ATOM   2605 C  CG2 . VAL B 2 36  ? 26.212 3.720   11.213 1.00 30.91 ? 160 VAL B CG2 1 
ATOM   2606 N  N   . CYS B 2 37  ? 25.254 7.298   11.822 1.00 28.24 ? 161 CYS B N   1 
ATOM   2607 C  CA  . CYS B 2 37  ? 25.106 8.313   10.776 1.00 39.30 ? 161 CYS B CA  1 
ATOM   2608 C  C   . CYS B 2 37  ? 26.404 8.490   10.001 1.00 43.53 ? 161 CYS B C   1 
ATOM   2609 O  O   . CYS B 2 37  ? 27.111 7.519   9.738  1.00 51.59 ? 161 CYS B O   1 
ATOM   2610 C  CB  . CYS B 2 37  ? 24.644 9.663   11.350 1.00 42.04 ? 161 CYS B CB  1 
ATOM   2611 S  SG  . CYS B 2 37  ? 25.507 10.316  12.825 1.00 44.07 ? 161 CYS B SG  1 
HETATM 2612 P  P   . PO4 C 3 .   ? 31.680 15.258  34.287 0.94 17.38 ? 401 PO4 A P   1 
HETATM 2613 O  O1  . PO4 C 3 .   ? 30.914 15.924  33.182 0.94 18.06 ? 401 PO4 A O1  1 
HETATM 2614 O  O2  . PO4 C 3 .   ? 30.719 14.623  35.263 0.94 13.66 ? 401 PO4 A O2  1 
HETATM 2615 O  O3  . PO4 C 3 .   ? 32.505 16.322  34.994 0.94 19.24 ? 401 PO4 A O3  1 
HETATM 2616 O  O4  . PO4 C 3 .   ? 32.618 14.214  33.690 0.94 18.90 ? 401 PO4 A O4  1 
HETATM 2617 P  P   . PO4 D 3 .   ? 32.089 15.353  30.229 0.83 23.41 ? 402 PO4 A P   1 
HETATM 2618 O  O1  . PO4 D 3 .   ? 32.408 15.192  28.757 0.83 46.87 ? 402 PO4 A O1  1 
HETATM 2619 O  O2  . PO4 D 3 .   ? 30.716 14.809  30.552 0.83 21.68 ? 402 PO4 A O2  1 
HETATM 2620 O  O3  . PO4 D 3 .   ? 33.135 14.647  31.065 0.83 33.06 ? 402 PO4 A O3  1 
HETATM 2621 O  O4  . PO4 D 3 .   ? 32.105 16.839  30.505 0.83 44.21 ? 402 PO4 A O4  1 
HETATM 2622 ZN ZN  . ZN  E 4 .   ? 29.271 15.217  32.132 0.88 20.17 ? 403 ZN  A ZN  1 
HETATM 2623 FE FE  . FE  F 5 .   ? 28.926 13.545  34.950 1.00 13.76 ? 404 FE  A FE  1 
HETATM 2624 O  O   . HOH G 6 .   ? 6.852  -0.464  30.220 1.00 42.83 ? 501 HOH A O   1 
HETATM 2625 O  O   . HOH G 6 .   ? 40.988 -0.934  35.751 1.00 30.18 ? 502 HOH A O   1 
HETATM 2626 O  O   . HOH G 6 .   ? 12.061 -7.590  26.964 1.00 35.84 ? 503 HOH A O   1 
HETATM 2627 O  O   . HOH G 6 .   ? 29.497 -11.319 42.827 1.00 47.83 ? 504 HOH A O   1 
HETATM 2628 O  O   . HOH G 6 .   ? 10.188 2.194   41.409 1.00 40.02 ? 505 HOH A O   1 
HETATM 2629 O  O   . HOH G 6 .   ? 7.546  0.044   33.733 1.00 24.84 ? 506 HOH A O   1 
HETATM 2630 O  O   . HOH G 6 .   ? 24.491 29.759  31.516 1.00 26.17 ? 507 HOH A O   1 
HETATM 2631 O  O   . HOH G 6 .   ? -0.508 34.765  26.287 1.00 44.36 ? 508 HOH A O   1 
HETATM 2632 O  O   . HOH G 6 .   ? 15.335 29.406  45.878 1.00 41.97 ? 509 HOH A O   1 
HETATM 2633 O  O   . HOH G 6 .   ? 13.349 8.372   19.869 1.00 40.47 ? 510 HOH A O   1 
HETATM 2634 O  O   . HOH G 6 .   ? 31.541 -16.625 31.738 1.00 35.87 ? 511 HOH A O   1 
HETATM 2635 O  O   . HOH G 6 .   ? 18.066 33.147  28.910 1.00 28.44 ? 512 HOH A O   1 
HETATM 2636 O  O   . HOH G 6 .   ? 5.725  5.746   32.863 1.00 35.72 ? 513 HOH A O   1 
HETATM 2637 O  O   . HOH G 6 .   ? 29.936 10.594  57.903 1.00 38.14 ? 514 HOH A O   1 
HETATM 2638 O  O   . HOH G 6 .   ? 22.274 14.072  12.574 1.00 46.27 ? 515 HOH A O   1 
HETATM 2639 O  O   . HOH G 6 .   ? 31.367 32.070  44.202 1.00 44.91 ? 516 HOH A O   1 
HETATM 2640 O  O   . HOH G 6 .   ? 6.140  20.476  22.164 1.00 36.91 ? 517 HOH A O   1 
HETATM 2641 O  O   . HOH G 6 .   ? 29.248 6.162   53.461 1.00 42.37 ? 518 HOH A O   1 
HETATM 2642 O  O   . HOH G 6 .   ? 22.355 -2.423  51.112 1.00 37.27 ? 519 HOH A O   1 
HETATM 2643 O  O   . HOH G 6 .   ? 30.321 10.656  23.493 1.00 21.68 ? 520 HOH A O   1 
HETATM 2644 O  O   . HOH G 6 .   ? 15.271 -4.751  44.360 1.00 36.72 ? 521 HOH A O   1 
HETATM 2645 O  O   . HOH G 6 .   ? 36.713 14.059  22.896 1.00 35.22 ? 522 HOH A O   1 
HETATM 2646 O  O   . HOH G 6 .   ? 33.542 16.248  37.305 1.00 36.89 ? 523 HOH A O   1 
HETATM 2647 O  O   . HOH G 6 .   ? 8.559  0.287   37.974 1.00 39.72 ? 524 HOH A O   1 
HETATM 2648 O  O   . HOH G 6 .   ? 27.758 35.194  23.769 1.00 18.48 ? 525 HOH A O   1 
HETATM 2649 O  O   . HOH G 6 .   ? 13.704 0.535   19.610 1.00 38.66 ? 526 HOH A O   1 
HETATM 2650 O  O   . HOH G 6 .   ? -7.442 30.071  28.505 1.00 47.99 ? 527 HOH A O   1 
HETATM 2651 O  O   . HOH G 6 .   ? 4.108  29.623  39.459 1.00 30.17 ? 528 HOH A O   1 
HETATM 2652 O  O   . HOH G 6 .   ? 27.084 27.490  29.995 1.00 26.34 ? 529 HOH A O   1 
HETATM 2653 O  O   . HOH G 6 .   ? 4.602  8.249   32.154 1.00 37.82 ? 530 HOH A O   1 
HETATM 2654 O  O   . HOH G 6 .   ? 16.778 22.466  48.463 1.00 30.45 ? 531 HOH A O   1 
HETATM 2655 O  O   . HOH G 6 .   ? 20.234 33.924  28.197 1.00 38.36 ? 532 HOH A O   1 
HETATM 2656 O  O   . HOH G 6 .   ? 33.665 3.731   30.514 1.00 21.57 ? 533 HOH A O   1 
HETATM 2657 O  O   . HOH G 6 .   ? 41.680 -5.397  37.911 1.00 49.25 ? 534 HOH A O   1 
HETATM 2658 O  O   . HOH G 6 .   ? 23.390 31.692  19.467 1.00 19.55 ? 535 HOH A O   1 
HETATM 2659 O  O   . HOH G 6 .   ? 36.690 7.407   47.155 1.00 28.28 ? 536 HOH A O   1 
HETATM 2660 O  O   . HOH G 6 .   ? 23.856 19.349  16.592 1.00 28.04 ? 537 HOH A O   1 
HETATM 2661 O  O   . HOH G 6 .   ? 41.505 2.648   42.534 1.00 37.21 ? 538 HOH A O   1 
HETATM 2662 O  O   . HOH G 6 .   ? 7.592  14.111  26.481 1.00 23.39 ? 539 HOH A O   1 
HETATM 2663 O  O   . HOH G 6 .   ? 30.750 29.844  38.274 1.00 24.88 ? 540 HOH A O   1 
HETATM 2664 O  O   . HOH G 6 .   ? 9.044  41.280  35.497 1.00 43.20 ? 541 HOH A O   1 
HETATM 2665 O  O   . HOH G 6 .   ? 22.486 2.761   51.556 1.00 40.57 ? 542 HOH A O   1 
HETATM 2666 O  O   . HOH G 6 .   ? 10.295 -10.291 38.883 1.00 54.68 ? 543 HOH A O   1 
HETATM 2667 O  O   . HOH G 6 .   ? 27.224 20.550  17.107 1.00 20.93 ? 544 HOH A O   1 
HETATM 2668 O  O   . HOH G 6 .   ? 10.401 42.680  29.068 1.00 33.84 ? 545 HOH A O   1 
HETATM 2669 O  O   . HOH G 6 .   ? 12.002 13.878  36.461 1.00 14.67 ? 546 HOH A O   1 
HETATM 2670 O  O   . HOH G 6 .   ? 25.190 33.297  21.024 1.00 16.71 ? 547 HOH A O   1 
HETATM 2671 O  O   . HOH G 6 .   ? 29.107 34.941  27.935 1.00 40.06 ? 548 HOH A O   1 
HETATM 2672 O  O   . HOH G 6 .   ? 35.268 26.297  22.547 1.00 38.31 ? 549 HOH A O   1 
HETATM 2673 O  O   . HOH G 6 .   ? 35.109 3.913   26.778 1.00 26.82 ? 550 HOH A O   1 
HETATM 2674 O  O   . HOH G 6 .   ? 5.749  13.798  37.391 1.00 32.53 ? 551 HOH A O   1 
HETATM 2675 O  O   . HOH G 6 .   ? 11.761 7.091   47.562 1.00 33.33 ? 552 HOH A O   1 
HETATM 2676 O  O   . HOH G 6 .   ? 2.275  27.834  34.342 1.00 26.24 ? 553 HOH A O   1 
HETATM 2677 O  O   . HOH G 6 .   ? 32.189 5.978   50.287 1.00 34.62 ? 554 HOH A O   1 
HETATM 2678 O  O   . HOH G 6 .   ? 21.708 -9.234  32.522 1.00 23.45 ? 555 HOH A O   1 
HETATM 2679 O  O   . HOH G 6 .   ? 30.168 23.295  23.820 1.00 33.88 ? 556 HOH A O   1 
HETATM 2680 O  O   . HOH G 6 .   ? 28.979 -5.614  45.158 1.00 31.05 ? 557 HOH A O   1 
HETATM 2681 O  O   . HOH G 6 .   ? 24.891 17.574  51.780 1.00 24.85 ? 558 HOH A O   1 
HETATM 2682 O  O   . HOH G 6 .   ? 31.336 7.742   48.252 1.00 17.80 ? 559 HOH A O   1 
HETATM 2683 O  O   . HOH G 6 .   ? 17.382 17.521  53.111 1.00 32.65 ? 560 HOH A O   1 
HETATM 2684 O  O   . HOH G 6 .   ? 9.672  0.465   35.585 1.00 22.91 ? 561 HOH A O   1 
HETATM 2685 O  O   . HOH G 6 .   ? 20.570 9.768   13.095 1.00 46.59 ? 562 HOH A O   1 
HETATM 2686 O  O   . HOH G 6 .   ? 33.154 24.792  44.430 1.00 30.80 ? 563 HOH A O   1 
HETATM 2687 O  O   . HOH G 6 .   ? 19.417 13.868  55.184 1.00 35.94 ? 564 HOH A O   1 
HETATM 2688 O  O   . HOH G 6 .   ? 35.463 8.420   28.530 1.00 33.53 ? 565 HOH A O   1 
HETATM 2689 O  O   . HOH G 6 .   ? 13.819 -5.478  41.432 1.00 50.00 ? 566 HOH A O   1 
HETATM 2690 O  O   . HOH G 6 .   ? 30.128 13.241  22.608 1.00 21.44 ? 567 HOH A O   1 
HETATM 2691 O  O   . HOH G 6 .   ? 27.726 -12.326 34.650 1.00 27.80 ? 568 HOH A O   1 
HETATM 2692 O  O   . HOH G 6 .   ? 17.364 -12.577 38.609 1.00 44.57 ? 569 HOH A O   1 
HETATM 2693 O  O   . HOH G 6 .   ? 6.252  39.409  32.959 1.00 38.78 ? 570 HOH A O   1 
HETATM 2694 O  O   . HOH G 6 .   ? 29.670 13.391  32.974 1.00 18.13 ? 571 HOH A O   1 
HETATM 2695 O  O   . HOH G 6 .   ? 36.217 4.351   33.289 1.00 21.70 ? 572 HOH A O   1 
HETATM 2696 O  O   . HOH G 6 .   ? 37.490 4.073   30.419 1.00 41.62 ? 573 HOH A O   1 
HETATM 2697 O  O   . HOH G 6 .   ? 1.010  16.372  23.348 1.00 40.21 ? 574 HOH A O   1 
HETATM 2698 O  O   . HOH G 6 .   ? 35.183 -7.609  41.108 1.00 26.61 ? 575 HOH A O   1 
HETATM 2699 O  O   . HOH G 6 .   ? 29.990 31.424  30.205 1.00 46.66 ? 576 HOH A O   1 
HETATM 2700 O  O   . HOH G 6 .   ? 31.555 30.857  40.583 1.00 35.98 ? 577 HOH A O   1 
HETATM 2701 O  O   . HOH G 6 .   ? 18.185 39.891  35.513 1.00 39.81 ? 578 HOH A O   1 
HETATM 2702 O  O   . HOH G 6 .   ? 36.290 27.306  24.683 1.00 54.34 ? 579 HOH A O   1 
HETATM 2703 O  O   . HOH G 6 .   ? 18.327 21.353  14.938 1.00 44.70 ? 580 HOH A O   1 
HETATM 2704 O  O   . HOH G 6 .   ? 2.471  21.173  34.776 1.00 22.02 ? 581 HOH A O   1 
HETATM 2705 O  O   . HOH G 6 .   ? 6.431  37.955  35.437 1.00 39.89 ? 582 HOH A O   1 
HETATM 2706 O  O   . HOH G 6 .   ? 4.553  34.712  22.673 1.00 42.84 ? 583 HOH A O   1 
HETATM 2707 O  O   . HOH G 6 .   ? 4.003  13.933  25.669 1.00 28.99 ? 584 HOH A O   1 
HETATM 2708 O  O   . HOH G 6 .   ? 6.499  26.720  43.018 1.00 27.90 ? 585 HOH A O   1 
HETATM 2709 O  O   . HOH G 6 .   ? 10.572 33.331  19.840 1.00 34.70 ? 586 HOH A O   1 
HETATM 2710 O  O   . HOH G 6 .   ? 29.781 14.793  45.780 1.00 25.73 ? 587 HOH A O   1 
HETATM 2711 O  O   . HOH G 6 .   ? 28.486 18.330  46.143 1.00 23.30 ? 588 HOH A O   1 
HETATM 2712 O  O   . HOH G 6 .   ? 13.993 15.423  52.844 1.00 39.83 ? 589 HOH A O   1 
HETATM 2713 O  O   . HOH G 6 .   ? 18.618 -14.017 28.014 1.00 37.55 ? 590 HOH A O   1 
HETATM 2714 O  O   . HOH G 6 .   ? 37.462 1.350   29.464 1.00 23.91 ? 591 HOH A O   1 
HETATM 2715 O  O   . HOH G 6 .   ? 31.701 25.434  32.622 1.00 23.12 ? 592 HOH A O   1 
HETATM 2716 O  O   . HOH G 6 .   ? 12.227 -3.167  44.779 1.00 43.05 ? 593 HOH A O   1 
HETATM 2717 O  O   . HOH G 6 .   ? 2.455  17.147  39.932 1.00 37.55 ? 594 HOH A O   1 
HETATM 2718 O  O   . HOH G 6 .   ? 29.533 5.012   49.739 1.00 28.30 ? 595 HOH A O   1 
HETATM 2719 O  O   . HOH G 6 .   ? 6.363  28.516  41.095 1.00 29.07 ? 596 HOH A O   1 
HETATM 2720 O  O   . HOH G 6 .   ? 23.654 12.457  31.670 1.00 17.89 ? 597 HOH A O   1 
HETATM 2721 O  O   . HOH G 6 .   ? 37.589 -6.050  40.539 1.00 41.42 ? 598 HOH A O   1 
HETATM 2722 O  O   . HOH G 6 .   ? 18.405 20.707  51.941 1.00 42.76 ? 599 HOH A O   1 
HETATM 2723 O  O   . HOH G 6 .   ? -3.884 33.278  32.760 1.00 56.40 ? 600 HOH A O   1 
HETATM 2724 O  O   . HOH G 6 .   ? 29.531 6.343   13.004 1.00 38.93 ? 601 HOH A O   1 
HETATM 2725 O  O   . HOH G 6 .   ? -0.310 31.842  32.423 1.00 37.43 ? 602 HOH A O   1 
HETATM 2726 O  O   . HOH G 6 .   ? 7.395  13.178  16.992 1.00 42.57 ? 603 HOH A O   1 
HETATM 2727 O  O   . HOH G 6 .   ? 26.127 -2.154  44.141 1.00 24.21 ? 604 HOH A O   1 
HETATM 2728 O  O   . HOH G 6 .   ? 27.046 32.173  27.532 1.00 42.28 ? 605 HOH A O   1 
HETATM 2729 O  O   . HOH G 6 .   ? 10.836 -2.609  42.654 1.00 49.11 ? 606 HOH A O   1 
HETATM 2730 O  O   . HOH G 6 .   ? 20.899 14.623  30.373 1.00 16.09 ? 607 HOH A O   1 
HETATM 2731 O  O   . HOH G 6 .   ? 25.348 -5.502  45.329 1.00 31.22 ? 608 HOH A O   1 
HETATM 2732 O  O   . HOH G 6 .   ? 2.192  25.511  24.682 1.00 42.47 ? 609 HOH A O   1 
HETATM 2733 O  O   . HOH G 6 .   ? 21.672 9.932   38.606 1.00 14.01 ? 610 HOH A O   1 
HETATM 2734 O  O   . HOH G 6 .   ? 14.195 20.639  18.088 1.00 36.09 ? 611 HOH A O   1 
HETATM 2735 O  O   . HOH G 6 .   ? 24.470 31.875  46.167 1.00 42.79 ? 612 HOH A O   1 
HETATM 2736 O  O   . HOH G 6 .   ? 24.467 30.397  29.280 1.00 31.15 ? 613 HOH A O   1 
HETATM 2737 O  O   . HOH G 6 .   ? 27.430 27.690  45.071 1.00 26.72 ? 614 HOH A O   1 
HETATM 2738 O  O   . HOH G 6 .   ? 38.459 -1.087  47.980 1.00 45.72 ? 615 HOH A O   1 
HETATM 2739 O  O   . HOH G 6 .   ? 5.830  -2.353  30.376 1.00 38.98 ? 616 HOH A O   1 
HETATM 2740 O  O   . HOH G 6 .   ? 18.358 15.171  44.275 1.00 15.57 ? 617 HOH A O   1 
HETATM 2741 O  O   . HOH G 6 .   ? 28.998 18.211  49.557 1.00 26.73 ? 618 HOH A O   1 
HETATM 2742 O  O   . HOH G 6 .   ? 20.715 -10.139 35.063 1.00 32.53 ? 619 HOH A O   1 
HETATM 2743 O  O   . HOH G 6 .   ? 39.676 19.057  18.107 1.00 37.79 ? 620 HOH A O   1 
HETATM 2744 O  O   . HOH G 6 .   ? 35.366 1.605   31.451 1.00 30.49 ? 621 HOH A O   1 
HETATM 2745 O  O   . HOH G 6 .   ? 20.773 38.013  21.469 1.00 46.47 ? 622 HOH A O   1 
HETATM 2746 O  O   . HOH G 6 .   ? 1.721  19.570  23.112 1.00 37.41 ? 623 HOH A O   1 
HETATM 2747 O  O   . HOH G 6 .   ? 7.854  9.069   19.310 1.00 38.68 ? 624 HOH A O   1 
HETATM 2748 O  O   . HOH G 6 .   ? 14.173 41.049  34.277 1.00 33.13 ? 625 HOH A O   1 
HETATM 2749 O  O   . HOH G 6 .   ? 19.936 21.968  50.232 1.00 31.62 ? 626 HOH A O   1 
HETATM 2750 O  O   . HOH G 6 .   ? 35.971 9.630   23.586 1.00 36.64 ? 627 HOH A O   1 
HETATM 2751 O  O   . HOH G 6 .   ? 15.601 9.710   14.103 1.00 62.22 ? 628 HOH A O   1 
HETATM 2752 O  O   . HOH G 6 .   ? 5.252  15.478  39.878 1.00 24.54 ? 629 HOH A O   1 
HETATM 2753 O  O   . HOH G 6 .   ? 11.472 20.258  21.456 1.00 40.22 ? 630 HOH A O   1 
HETATM 2754 O  O   . HOH G 6 .   ? 28.558 -6.077  24.677 1.00 32.35 ? 631 HOH A O   1 
HETATM 2755 O  O   . HOH G 6 .   ? 34.430 4.701   23.474 1.00 37.40 ? 632 HOH A O   1 
HETATM 2756 O  O   . HOH G 6 .   ? 23.013 -6.666  45.285 1.00 30.83 ? 633 HOH A O   1 
HETATM 2757 O  O   . HOH G 6 .   ? 33.504 15.144  15.433 1.00 33.02 ? 634 HOH A O   1 
HETATM 2758 O  O   . HOH G 6 .   ? 10.771 27.585  17.311 1.00 34.85 ? 635 HOH A O   1 
HETATM 2759 O  O   . HOH G 6 .   ? 32.645 22.388  50.943 1.00 33.77 ? 636 HOH A O   1 
HETATM 2760 O  O   . HOH G 6 .   ? 18.073 29.058  48.367 1.00 44.79 ? 637 HOH A O   1 
HETATM 2761 O  O   . HOH G 6 .   ? 36.567 15.233  39.471 1.00 33.48 ? 638 HOH A O   1 
HETATM 2762 O  O   . HOH G 6 .   ? 14.304 12.103  48.983 1.00 17.07 ? 639 HOH A O   1 
HETATM 2763 O  O   . HOH G 6 .   ? 31.194 2.202   21.331 1.00 32.89 ? 640 HOH A O   1 
HETATM 2764 O  O   . HOH G 6 .   ? 36.644 -2.213  29.728 1.00 23.85 ? 641 HOH A O   1 
HETATM 2765 O  O   . HOH G 6 .   ? 14.465 22.297  47.133 1.00 42.44 ? 642 HOH A O   1 
HETATM 2766 O  O   . HOH G 6 .   ? 25.247 -12.793 35.914 1.00 32.32 ? 643 HOH A O   1 
HETATM 2767 O  O   . HOH G 6 .   ? 40.923 0.336   40.647 1.00 39.46 ? 644 HOH A O   1 
HETATM 2768 O  O   . HOH G 6 .   ? 30.543 5.515   15.241 1.00 37.20 ? 645 HOH A O   1 
HETATM 2769 O  O   . HOH G 6 .   ? 10.193 -2.104  24.673 1.00 33.04 ? 646 HOH A O   1 
HETATM 2770 O  O   . HOH G 6 .   ? 20.397 22.202  15.928 1.00 29.48 ? 647 HOH A O   1 
HETATM 2771 O  O   . HOH G 6 .   ? 4.007  35.180  36.005 1.00 33.51 ? 648 HOH A O   1 
HETATM 2772 O  O   . HOH G 6 .   ? 33.444 18.292  27.028 1.00 38.30 ? 649 HOH A O   1 
HETATM 2773 O  O   . HOH G 6 .   ? 6.051  20.393  45.235 1.00 27.99 ? 650 HOH A O   1 
HETATM 2774 O  O   . HOH G 6 .   ? 34.520 -3.585  47.101 1.00 30.99 ? 651 HOH A O   1 
HETATM 2775 O  O   . HOH G 6 .   ? 23.822 -10.627 35.381 1.00 29.60 ? 652 HOH A O   1 
HETATM 2776 O  O   . HOH G 6 .   ? 0.556  20.763  30.380 1.00 42.34 ? 653 HOH A O   1 
HETATM 2777 O  O   . HOH G 6 .   ? 27.139 10.543  53.426 1.00 36.13 ? 654 HOH A O   1 
HETATM 2778 O  O   . HOH G 6 .   ? 26.102 10.595  49.568 1.00 20.41 ? 655 HOH A O   1 
HETATM 2779 O  O   . HOH G 6 .   ? 35.614 -10.632 35.707 1.00 36.18 ? 656 HOH A O   1 
HETATM 2780 O  O   . HOH G 6 .   ? 7.787  7.416   23.521 1.00 30.65 ? 657 HOH A O   1 
HETATM 2781 O  O   . HOH G 6 .   ? 0.765  19.158  27.382 1.00 43.45 ? 658 HOH A O   1 
HETATM 2782 O  O   . HOH G 6 .   ? 30.405 -12.340 37.119 1.00 45.47 ? 659 HOH A O   1 
HETATM 2783 O  O   . HOH G 6 .   ? 11.742 40.436  36.432 1.00 36.88 ? 660 HOH A O   1 
HETATM 2784 O  O   . HOH G 6 .   ? 17.094 38.960  24.992 1.00 38.53 ? 661 HOH A O   1 
HETATM 2785 O  O   . HOH G 6 .   ? 40.141 1.210   46.725 1.00 29.57 ? 662 HOH A O   1 
HETATM 2786 O  O   . HOH G 6 .   ? 39.901 2.128   36.428 1.00 27.43 ? 663 HOH A O   1 
HETATM 2787 O  O   . HOH G 6 .   ? 13.525 26.576  42.923 1.00 25.72 ? 664 HOH A O   1 
HETATM 2788 O  O   . HOH G 6 .   ? 27.184 -4.654  43.615 1.00 24.80 ? 665 HOH A O   1 
HETATM 2789 O  O   . HOH G 6 .   ? 36.390 8.242   34.647 1.00 32.98 ? 666 HOH A O   1 
HETATM 2790 O  O   . HOH G 6 .   ? 27.801 16.314  42.756 1.00 20.14 ? 667 HOH A O   1 
HETATM 2791 O  O   . HOH G 6 .   ? 40.307 -4.336  40.144 1.00 46.28 ? 668 HOH A O   1 
HETATM 2792 O  O   . HOH G 6 .   ? 33.449 9.847   47.807 1.00 17.83 ? 669 HOH A O   1 
HETATM 2793 O  O   . HOH G 6 .   ? 10.495 7.226   23.107 1.00 33.14 ? 670 HOH A O   1 
HETATM 2794 O  O   . HOH G 6 .   ? 1.099  34.444  32.687 1.00 40.61 ? 671 HOH A O   1 
HETATM 2795 O  O   . HOH G 6 .   ? 22.815 28.378  46.212 1.00 30.67 ? 672 HOH A O   1 
HETATM 2796 O  O   . HOH G 6 .   ? 30.168 -8.965  25.621 1.00 24.84 ? 673 HOH A O   1 
HETATM 2797 O  O   . HOH G 6 .   ? 10.087 4.117   44.008 1.00 28.43 ? 674 HOH A O   1 
HETATM 2798 O  O   . HOH G 6 .   ? 30.374 -12.483 28.990 1.00 21.10 ? 675 HOH A O   1 
HETATM 2799 O  O   . HOH G 6 .   ? 3.986  41.511  26.890 1.00 43.67 ? 676 HOH A O   1 
HETATM 2800 O  O   . HOH G 6 .   ? 30.505 17.655  26.992 1.00 33.43 ? 677 HOH A O   1 
HETATM 2801 O  O   . HOH G 6 .   ? 33.376 -4.458  29.082 1.00 17.91 ? 678 HOH A O   1 
HETATM 2802 O  O   . HOH G 6 .   ? 7.524  9.604   40.842 1.00 19.37 ? 679 HOH A O   1 
HETATM 2803 O  O   . HOH G 6 .   ? 27.616 34.278  45.852 1.00 47.85 ? 680 HOH A O   1 
HETATM 2804 O  O   . HOH G 6 .   ? 1.529  22.802  31.643 1.00 35.44 ? 681 HOH A O   1 
HETATM 2805 O  O   . HOH G 6 .   ? 22.207 20.980  51.127 1.00 24.43 ? 682 HOH A O   1 
HETATM 2806 O  O   . HOH G 6 .   ? 2.340  14.960  30.718 1.00 21.13 ? 683 HOH A O   1 
HETATM 2807 O  O   . HOH G 6 .   ? 36.473 -1.976  41.437 1.00 24.93 ? 684 HOH A O   1 
HETATM 2808 O  O   . HOH G 6 .   ? 12.616 40.815  38.569 1.00 39.04 ? 685 HOH A O   1 
HETATM 2809 O  O   . HOH G 6 .   ? -3.418 31.871  25.535 1.00 40.70 ? 686 HOH A O   1 
HETATM 2810 O  O   . HOH G 6 .   ? 7.586  7.359   39.264 1.00 25.78 ? 687 HOH A O   1 
HETATM 2811 O  O   . HOH G 6 .   ? 5.663  -0.990  28.094 1.00 47.67 ? 688 HOH A O   1 
HETATM 2812 O  O   . HOH G 6 .   ? 21.449 11.226  51.119 1.00 31.11 ? 689 HOH A O   1 
HETATM 2813 O  O   . HOH G 6 .   ? 34.987 30.092  35.459 1.00 39.20 ? 690 HOH A O   1 
HETATM 2814 O  O   . HOH G 6 .   ? 9.697  25.046  44.120 1.00 38.52 ? 691 HOH A O   1 
HETATM 2815 O  O   . HOH G 6 .   ? 35.013 11.486  22.439 1.00 27.61 ? 692 HOH A O   1 
HETATM 2816 O  O   . HOH G 6 .   ? 14.355 -3.437  46.694 1.00 24.99 ? 693 HOH A O   1 
HETATM 2817 O  O   . HOH G 6 .   ? 4.930  27.634  17.505 1.00 54.77 ? 694 HOH A O   1 
HETATM 2818 O  O   . HOH G 6 .   ? 35.456 -14.991 31.522 1.00 32.18 ? 695 HOH A O   1 
HETATM 2819 O  O   . HOH G 6 .   ? 17.910 33.714  47.002 1.00 51.18 ? 696 HOH A O   1 
HETATM 2820 O  O   . HOH G 6 .   ? 9.212  -6.072  31.861 1.00 41.81 ? 697 HOH A O   1 
HETATM 2821 O  O   . HOH G 6 .   ? 32.301 4.465   21.272 1.00 26.62 ? 698 HOH A O   1 
HETATM 2822 O  O   . HOH G 6 .   ? 42.419 10.259  43.737 1.00 44.43 ? 699 HOH A O   1 
HETATM 2823 O  O   . HOH G 6 .   ? 25.791 36.773  26.744 1.00 42.29 ? 700 HOH A O   1 
HETATM 2824 O  O   . HOH G 6 .   ? 6.392  7.953   36.998 1.00 46.49 ? 701 HOH A O   1 
HETATM 2825 O  O   . HOH G 6 .   ? 32.635 14.171  46.140 1.00 38.27 ? 702 HOH A O   1 
HETATM 2826 O  O   . HOH G 6 .   ? 20.057 9.660   52.869 1.00 27.31 ? 703 HOH A O   1 
HETATM 2827 O  O   . HOH G 6 .   ? 22.141 22.054  43.719 1.00 19.39 ? 704 HOH A O   1 
HETATM 2828 O  O   . HOH G 6 .   ? 35.344 14.466  37.090 1.00 26.52 ? 705 HOH A O   1 
HETATM 2829 O  O   . HOH G 6 .   ? 5.387  28.232  21.158 1.00 37.34 ? 706 HOH A O   1 
HETATM 2830 O  O   . HOH G 6 .   ? 34.500 -6.634  46.987 1.00 34.78 ? 707 HOH A O   1 
HETATM 2831 O  O   . HOH G 6 .   ? 11.913 6.061   45.316 1.00 18.52 ? 708 HOH A O   1 
HETATM 2832 O  O   . HOH G 6 .   ? 10.571 8.117   18.896 1.00 43.01 ? 709 HOH A O   1 
HETATM 2833 O  O   . HOH G 6 .   ? 32.963 25.070  25.350 1.00 50.25 ? 710 HOH A O   1 
HETATM 2834 O  O   . HOH G 6 .   ? 32.243 -11.122 24.481 1.00 11.61 ? 711 HOH A O   1 
HETATM 2835 O  O   . HOH G 6 .   ? 3.156  39.733  31.020 1.00 40.95 ? 712 HOH A O   1 
HETATM 2836 O  O   . HOH G 6 .   ? 35.168 -12.852 34.439 1.00 46.75 ? 713 HOH A O   1 
HETATM 2837 O  O   . HOH G 6 .   ? 24.068 -8.417  46.408 1.00 45.55 ? 714 HOH A O   1 
HETATM 2838 O  O   . HOH G 6 .   ? 8.633  -5.841  28.074 1.00 51.45 ? 715 HOH A O   1 
HETATM 2839 O  O   . HOH G 6 .   ? 15.912 32.043  45.237 1.00 46.28 ? 716 HOH A O   1 
HETATM 2840 O  O   . HOH G 6 .   ? 7.169  -0.379  23.747 1.00 31.32 ? 717 HOH A O   1 
HETATM 2841 O  O   . HOH G 6 .   ? 28.498 -4.284  47.668 1.00 39.01 ? 718 HOH A O   1 
HETATM 2842 O  O   . HOH G 6 .   ? 27.808 25.185  23.543 1.00 17.15 ? 719 HOH A O   1 
HETATM 2843 O  O   . HOH G 6 .   ? 11.042 9.733   47.252 1.00 32.94 ? 720 HOH A O   1 
HETATM 2844 O  O   . HOH G 6 .   ? 14.147 -8.911  31.403 1.00 43.75 ? 721 HOH A O   1 
HETATM 2845 O  O   . HOH G 6 .   ? 11.250 17.541  17.791 1.00 40.35 ? 722 HOH A O   1 
HETATM 2846 O  O   . HOH G 6 .   ? 11.157 15.271  14.903 1.00 46.54 ? 723 HOH A O   1 
HETATM 2847 O  O   . HOH G 6 .   ? 29.529 16.283  52.798 1.00 35.69 ? 724 HOH A O   1 
HETATM 2848 O  O   . HOH G 6 .   ? 2.140  9.349   30.801 1.00 44.18 ? 725 HOH A O   1 
HETATM 2849 O  O   . HOH G 6 .   ? 13.052 21.121  20.137 1.00 38.41 ? 726 HOH A O   1 
HETATM 2850 O  O   . HOH G 6 .   ? 24.597 41.345  29.792 1.00 43.00 ? 727 HOH A O   1 
HETATM 2851 O  O   . HOH G 6 .   ? 8.591  12.918  46.959 1.00 37.52 ? 728 HOH A O   1 
HETATM 2852 O  O   . HOH G 6 .   ? 14.681 -4.806  49.339 1.00 41.79 ? 729 HOH A O   1 
HETATM 2853 O  O   . HOH G 6 .   ? 23.778 9.612   50.729 1.00 21.91 ? 730 HOH A O   1 
HETATM 2854 O  O   . HOH G 6 .   ? 35.121 5.409   29.004 1.00 34.24 ? 731 HOH A O   1 
HETATM 2855 O  O   . HOH G 6 .   ? 44.099 10.052  37.405 1.00 45.22 ? 732 HOH A O   1 
HETATM 2856 O  O   . HOH G 6 .   ? 3.675  18.203  47.827 1.00 38.53 ? 733 HOH A O   1 
HETATM 2857 O  O   . HOH G 6 .   ? 13.936 7.780   16.885 1.00 47.55 ? 734 HOH A O   1 
HETATM 2858 O  O   . HOH G 6 .   ? 31.417 29.000  29.582 1.00 44.03 ? 735 HOH A O   1 
HETATM 2859 O  O   . HOH G 6 .   ? 6.977  -3.788  27.767 1.00 48.23 ? 736 HOH A O   1 
HETATM 2860 O  O   . HOH G 6 .   ? 23.321 -0.696  52.346 1.00 44.25 ? 737 HOH A O   1 
HETATM 2861 O  O   . HOH G 6 .   ? 29.484 26.314  46.191 1.00 37.38 ? 738 HOH A O   1 
HETATM 2862 O  O   . HOH G 6 .   ? 6.785  -2.331  32.671 1.00 40.64 ? 739 HOH A O   1 
HETATM 2863 O  O   . HOH G 6 .   ? 41.675 23.599  40.938 1.00 40.42 ? 740 HOH A O   1 
HETATM 2864 O  O   . HOH G 6 .   ? -0.690 23.945  32.616 1.00 47.54 ? 741 HOH A O   1 
HETATM 2865 O  O   . HOH G 6 .   ? 36.265 10.862  33.422 1.00 35.68 ? 742 HOH A O   1 
HETATM 2866 O  O   . HOH G 6 .   ? 15.507 21.112  50.090 1.00 49.49 ? 743 HOH A O   1 
HETATM 2867 O  O   . HOH G 6 .   ? 24.632 15.548  54.091 1.00 46.51 ? 744 HOH A O   1 
HETATM 2868 O  O   . HOH G 6 .   ? 42.221 -11.886 34.598 1.00 49.27 ? 745 HOH A O   1 
HETATM 2869 O  O   . HOH G 6 .   ? 30.403 21.596  52.045 1.00 43.31 ? 746 HOH A O   1 
HETATM 2870 O  O   . HOH G 6 .   ? 2.839  11.704  24.768 1.00 40.42 ? 747 HOH A O   1 
HETATM 2871 O  O   . HOH G 6 .   ? 43.481 -10.293 33.793 1.00 53.55 ? 748 HOH A O   1 
HETATM 2872 O  O   . HOH G 6 .   ? 36.805 10.793  18.928 1.00 50.52 ? 749 HOH A O   1 
HETATM 2873 O  O   . HOH G 6 .   ? 41.513 11.118  47.292 1.00 34.64 ? 750 HOH A O   1 
HETATM 2874 O  O   . HOH G 6 .   ? 13.810 9.835   53.492 1.00 50.18 ? 751 HOH A O   1 
HETATM 2875 O  O   . HOH G 6 .   ? 19.981 11.355  55.499 1.00 51.74 ? 752 HOH A O   1 
HETATM 2876 O  O   . HOH G 6 .   ? 11.707 11.718  49.094 1.00 43.69 ? 753 HOH A O   1 
HETATM 2877 O  O   . HOH G 6 .   ? 31.977 25.833  46.552 1.00 39.62 ? 754 HOH A O   1 
HETATM 2878 O  O   . HOH G 6 .   ? 28.921 -11.959 38.944 1.00 43.45 ? 755 HOH A O   1 
HETATM 2879 O  O   . HOH G 6 .   ? 38.377 5.726   33.886 1.00 40.42 ? 756 HOH A O   1 
HETATM 2880 O  O   . HOH G 6 .   ? 12.393 -5.085  39.239 1.00 49.61 ? 757 HOH A O   1 
HETATM 2881 O  O   . HOH G 6 .   ? 42.095 1.756   45.700 1.00 47.72 ? 758 HOH A O   1 
HETATM 2882 O  O   . HOH G 6 .   ? 24.184 23.110  50.717 1.00 33.50 ? 759 HOH A O   1 
HETATM 2883 O  O   . HOH G 6 .   ? -1.750 31.831  34.180 1.00 47.15 ? 760 HOH A O   1 
HETATM 2884 O  O   . HOH G 6 .   ? 3.169  42.053  29.382 1.00 48.04 ? 761 HOH A O   1 
HETATM 2885 O  O   . HOH G 6 .   ? 22.844 -7.770  48.834 1.00 45.49 ? 762 HOH A O   1 
HETATM 2886 O  O   . HOH G 6 .   ? -0.097 28.024  35.824 1.00 40.31 ? 763 HOH A O   1 
HETATM 2887 O  O   . HOH G 6 .   ? 10.528 43.451  35.031 1.00 51.30 ? 764 HOH A O   1 
HETATM 2888 O  O   . HOH G 6 .   ? 30.486 33.428  41.863 1.00 44.71 ? 765 HOH A O   1 
HETATM 2889 O  O   . HOH G 6 .   ? 5.888  11.076  15.214 1.00 54.69 ? 766 HOH A O   1 
HETATM 2890 O  O   . HOH G 6 .   ? 36.074 36.365  36.378 1.00 57.15 ? 767 HOH A O   1 
HETATM 2891 O  O   . HOH G 6 .   ? -1.531 25.616  35.966 1.00 51.72 ? 768 HOH A O   1 
HETATM 2892 O  O   . HOH G 6 .   ? 35.220 26.230  43.694 1.00 39.41 ? 769 HOH A O   1 
HETATM 2893 O  O   . HOH G 6 .   ? 1.547  14.570  26.995 1.00 44.94 ? 770 HOH A O   1 
HETATM 2894 O  O   . HOH G 6 .   ? 8.457  20.538  21.513 1.00 43.27 ? 771 HOH A O   1 
HETATM 2895 O  O   . HOH G 6 .   ? 0.065  20.191  33.833 1.00 39.86 ? 772 HOH A O   1 
HETATM 2896 O  O   . HOH G 6 .   ? 5.134  9.699   41.836 1.00 49.08 ? 773 HOH A O   1 
HETATM 2897 O  O   . HOH G 6 .   ? 33.108 28.409  28.267 1.00 44.55 ? 774 HOH A O   1 
HETATM 2898 O  O   . HOH G 6 .   ? 38.202 9.543   17.727 1.00 49.61 ? 775 HOH A O   1 
HETATM 2899 O  O   . HOH G 6 .   ? 27.207 12.455  54.582 1.00 46.21 ? 776 HOH A O   1 
HETATM 2900 O  O   . HOH G 6 .   ? 18.324 8.786   13.716 1.00 50.75 ? 777 HOH A O   1 
HETATM 2901 O  O   . HOH G 6 .   ? 25.520 27.989  47.037 1.00 29.18 ? 778 HOH A O   1 
HETATM 2902 O  O   . HOH G 6 .   ? 27.869 18.650  51.830 1.00 42.78 ? 779 HOH A O   1 
HETATM 2903 O  O   . HOH G 6 .   ? 34.256 25.589  31.901 1.00 33.15 ? 780 HOH A O   1 
HETATM 2904 O  O   . HOH G 6 .   ? 3.512  9.487   25.368 1.00 39.50 ? 781 HOH A O   1 
HETATM 2905 O  O   . HOH G 6 .   ? 26.749 22.949  50.097 1.00 39.78 ? 782 HOH A O   1 
HETATM 2906 O  O   . HOH G 6 .   ? 31.213 33.322  32.844 1.00 38.92 ? 783 HOH A O   1 
HETATM 2907 O  O   . HOH G 6 .   ? 20.478 7.472   53.919 1.00 51.29 ? 784 HOH A O   1 
HETATM 2908 O  O   . HOH G 6 .   ? 23.329 19.295  53.222 1.00 42.32 ? 785 HOH A O   1 
HETATM 2909 O  O   . HOH G 6 .   ? 35.083 18.173  38.386 1.00 41.97 ? 786 HOH A O   1 
HETATM 2910 O  O   . HOH G 6 .   ? 11.037 19.608  19.217 1.00 47.69 ? 787 HOH A O   1 
HETATM 2911 O  O   . HOH G 6 .   ? 25.050 21.116  52.171 1.00 53.52 ? 788 HOH A O   1 
HETATM 2912 O  O   . HOH G 6 .   ? 24.004 8.825   53.206 1.00 38.45 ? 789 HOH A O   1 
HETATM 2913 O  O   . HOH G 6 .   ? 32.248 30.975  28.668 1.00 46.21 ? 790 HOH A O   1 
HETATM 2914 O  O   . HOH G 6 .   ? 41.181 1.133   38.207 1.00 42.79 ? 791 HOH A O   1 
HETATM 2915 O  O   . HOH G 6 .   ? 1.142  23.141  23.975 1.00 47.41 ? 792 HOH A O   1 
HETATM 2916 O  O   . HOH H 6 .   ? 12.439 -10.099 25.664 1.00 46.13 ? 201 HOH B O   1 
HETATM 2917 O  O   . HOH H 6 .   ? 29.213 5.970   10.289 1.00 40.47 ? 202 HOH B O   1 
HETATM 2918 O  O   . HOH H 6 .   ? 22.534 -1.485  11.880 1.00 45.17 ? 203 HOH B O   1 
HETATM 2919 O  O   . HOH H 6 .   ? 15.475 -5.880  16.105 1.00 40.40 ? 204 HOH B O   1 
HETATM 2920 O  O   . HOH H 6 .   ? 21.656 -6.295  15.712 1.00 40.44 ? 205 HOH B O   1 
HETATM 2921 O  O   . HOH H 6 .   ? 22.452 -3.243  14.810 1.00 32.15 ? 206 HOH B O   1 
HETATM 2922 O  O   . HOH H 6 .   ? 20.486 -8.162  19.471 1.00 37.09 ? 207 HOH B O   1 
HETATM 2923 O  O   . HOH H 6 .   ? 22.862 2.320   10.634 1.00 39.64 ? 208 HOH B O   1 
HETATM 2924 O  O   . HOH H 6 .   ? 23.554 -5.381  17.195 1.00 50.38 ? 209 HOH B O   1 
HETATM 2925 O  O   . HOH H 6 .   ? 19.310 0.917   11.383 1.00 49.33 ? 210 HOH B O   1 
HETATM 2926 O  O   . HOH H 6 .   ? 20.199 -9.837  23.105 1.00 45.52 ? 211 HOH B O   1 
HETATM 2927 O  O   . HOH H 6 .   ? 20.925 -0.472  11.021 1.00 43.69 ? 212 HOH B O   1 
HETATM 2928 O  O   . HOH H 6 .   ? 22.625 -7.426  17.442 1.00 44.52 ? 213 HOH B O   1 
HETATM 2929 O  O   . HOH H 6 .   ? 24.950 -1.071  12.030 1.00 45.43 ? 214 HOH B O   1 
HETATM 2930 O  O   . HOH H 6 .   ? 24.572 -2.777  13.312 1.00 55.25 ? 215 HOH B O   1 
HETATM 2931 O  O   . HOH H 6 .   ? 22.595 -3.545  12.674 1.00 46.02 ? 216 HOH B O   1 
HETATM 2932 O  O   . HOH H 6 .   ? 21.424 -5.382  13.759 1.00 35.93 ? 217 HOH B O   1 
HETATM 2933 O  O   . HOH H 6 .   ? 21.048 -8.930  17.591 1.00 44.32 ? 218 HOH B O   1 
HETATM 2934 O  O   . HOH H 6 .   ? 19.863 -10.440 20.312 1.00 44.24 ? 219 HOH B O   1 
HETATM 2935 O  O   . HOH H 6 .   ? 22.707 -7.881  15.113 1.00 51.60 ? 220 HOH B O   1 
HETATM 2936 O  O   . HOH H 6 .   ? 19.234 -10.370 17.938 1.00 41.62 ? 221 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   24  ?   ?   ?   A . n 
A 1 2   GLY 2   25  ?   ?   ?   A . n 
A 1 3   SER 3   26  26  SER SER A . n 
A 1 4   HIS 4   27  27  HIS HIS A . n 
A 1 5   ARG 5   28  28  ARG ARG A . n 
A 1 6   LEU 6   29  29  LEU LEU A . n 
A 1 7   THR 7   30  30  THR THR A . n 
A 1 8   ALA 8   31  31  ALA ALA A . n 
A 1 9   LYS 9   32  32  LYS LYS A . n 
A 1 10  GLU 10  33  33  GLU GLU A . n 
A 1 11  VAL 11  34  34  VAL VAL A . n 
A 1 12  PHE 12  35  35  PHE PHE A . n 
A 1 13  ASP 13  36  36  ASP ASP A . n 
A 1 14  ASN 14  37  37  ASN ASN A . n 
A 1 15  ASP 15  38  38  ASP ASP A . n 
A 1 16  GLY 16  39  39  GLY GLY A . n 
A 1 17  LYS 17  40  40  LYS LYS A . n 
A 1 18  PRO 18  41  41  PRO PRO A . n 
A 1 19  ARG 19  42  42  ARG ARG A . n 
A 1 20  VAL 20  43  43  VAL VAL A . n 
A 1 21  ASP 21  44  44  ASP ASP A . n 
A 1 22  ILE 22  45  45  ILE ILE A . n 
A 1 23  LEU 23  46  46  LEU LEU A . n 
A 1 24  LYS 24  47  47  LYS LYS A . n 
A 1 25  ALA 25  48  48  ALA ALA A . n 
A 1 26  HIS 26  49  49  HIS HIS A . n 
A 1 27  LEU 27  50  50  LEU LEU A . n 
A 1 28  MET 28  51  51  MET MET A . n 
A 1 29  LYS 29  52  52  LYS LYS A . n 
A 1 30  GLU 30  53  53  GLU GLU A . n 
A 1 31  GLY 31  54  54  GLY GLY A . n 
A 1 32  ARG 32  55  55  ARG ARG A . n 
A 1 33  LEU 33  56  56  LEU LEU A . n 
A 1 34  GLU 34  57  57  GLU GLU A . n 
A 1 35  GLU 35  58  58  GLU GLU A . n 
A 1 36  SER 36  59  59  SER SER A . n 
A 1 37  VAL 37  60  60  VAL VAL A . n 
A 1 38  ALA 38  61  61  ALA ALA A . n 
A 1 39  LEU 39  62  62  LEU LEU A . n 
A 1 40  ARG 40  63  63  ARG ARG A . n 
A 1 41  ILE 41  64  64  ILE ILE A . n 
A 1 42  ILE 42  65  65  ILE ILE A . n 
A 1 43  THR 43  66  66  THR THR A . n 
A 1 44  GLU 44  67  67  GLU GLU A . n 
A 1 45  GLY 45  68  68  GLY GLY A . n 
A 1 46  ALA 46  69  69  ALA ALA A . n 
A 1 47  SER 47  70  70  SER SER A . n 
A 1 48  ILE 48  71  71  ILE ILE A . n 
A 1 49  LEU 49  72  72  LEU LEU A . n 
A 1 50  ARG 50  73  73  ARG ARG A . n 
A 1 51  GLN 51  74  74  GLN GLN A . n 
A 1 52  GLU 52  75  75  GLU GLU A . n 
A 1 53  LYS 53  76  76  LYS LYS A . n 
A 1 54  ASN 54  77  77  ASN ASN A . n 
A 1 55  LEU 55  78  78  LEU LEU A . n 
A 1 56  LEU 56  79  79  LEU LEU A . n 
A 1 57  ASP 57  80  80  ASP ASP A . n 
A 1 58  ILE 58  81  81  ILE ILE A . n 
A 1 59  ASP 59  82  82  ASP ASP A . n 
A 1 60  ALA 60  83  83  ALA ALA A . n 
A 1 61  PRO 61  84  84  PRO PRO A . n 
A 1 62  VAL 62  85  85  VAL VAL A . n 
A 1 63  THR 63  86  86  THR THR A . n 
A 1 64  VAL 64  87  87  VAL VAL A . n 
A 1 65  CYS 65  88  88  CYS CYS A . n 
A 1 66  GLY 66  89  89  GLY GLY A . n 
A 1 67  ASP 67  90  90  ASP ASP A . n 
A 1 68  ILE 68  91  91  ILE ILE A . n 
A 1 69  HIS 69  92  92  HIS HIS A . n 
A 1 70  GLY 70  93  93  GLY GLY A . n 
A 1 71  GLN 71  94  94  GLN GLN A . n 
A 1 72  PHE 72  95  95  PHE PHE A . n 
A 1 73  PHE 73  96  96  PHE PHE A . n 
A 1 74  ASP 74  97  97  ASP ASP A . n 
A 1 75  LEU 75  98  98  LEU LEU A . n 
A 1 76  MET 76  99  99  MET MET A . n 
A 1 77  LYS 77  100 100 LYS LYS A . n 
A 1 78  LEU 78  101 101 LEU LEU A . n 
A 1 79  PHE 79  102 102 PHE PHE A . n 
A 1 80  GLU 80  103 103 GLU GLU A . n 
A 1 81  VAL 81  104 104 VAL VAL A . n 
A 1 82  GLY 82  105 105 GLY GLY A . n 
A 1 83  GLY 83  106 106 GLY GLY A . n 
A 1 84  SER 84  107 107 SER SER A . n 
A 1 85  PRO 85  108 108 PRO PRO A . n 
A 1 86  ALA 86  109 109 ALA ALA A . n 
A 1 87  ASN 87  110 110 ASN ASN A . n 
A 1 88  THR 88  111 111 THR THR A . n 
A 1 89  ARG 89  112 112 ARG ARG A . n 
A 1 90  TYR 90  113 113 TYR TYR A . n 
A 1 91  LEU 91  114 114 LEU LEU A . n 
A 1 92  PHE 92  115 115 PHE PHE A . n 
A 1 93  LEU 93  116 116 LEU LEU A . n 
A 1 94  GLY 94  117 117 GLY GLY A . n 
A 1 95  ASP 95  118 118 ASP ASP A . n 
A 1 96  TYR 96  119 119 TYR TYR A . n 
A 1 97  VAL 97  120 120 VAL VAL A . n 
A 1 98  ASP 98  121 121 ASP ASP A . n 
A 1 99  ARG 99  122 122 ARG ARG A . n 
A 1 100 GLY 100 123 123 GLY GLY A . n 
A 1 101 TYR 101 124 124 TYR TYR A . n 
A 1 102 PHE 102 125 125 PHE PHE A . n 
A 1 103 SER 103 126 126 SER SER A . n 
A 1 104 ILE 104 127 127 ILE ILE A . n 
A 1 105 GLU 105 128 128 GLU GLU A . n 
A 1 106 CYS 106 129 129 CYS CYS A . n 
A 1 107 VAL 107 130 130 VAL VAL A . n 
A 1 108 LEU 108 131 131 LEU LEU A . n 
A 1 109 TYR 109 132 132 TYR TYR A . n 
A 1 110 LEU 110 133 133 LEU LEU A . n 
A 1 111 TRP 111 134 134 TRP TRP A . n 
A 1 112 ALA 112 135 135 ALA ALA A . n 
A 1 113 LEU 113 136 136 LEU LEU A . n 
A 1 114 LYS 114 137 137 LYS LYS A . n 
A 1 115 ILE 115 138 138 ILE ILE A . n 
A 1 116 LEU 116 139 139 LEU LEU A . n 
A 1 117 TYR 117 140 140 TYR TYR A . n 
A 1 118 PRO 118 141 141 PRO PRO A . n 
A 1 119 LYS 119 142 142 LYS LYS A . n 
A 1 120 THR 120 143 143 THR THR A . n 
A 1 121 LEU 121 144 144 LEU LEU A . n 
A 1 122 PHE 122 145 145 PHE PHE A . n 
A 1 123 LEU 123 146 146 LEU LEU A . n 
A 1 124 LEU 124 147 147 LEU LEU A . n 
A 1 125 ARG 125 148 148 ARG ARG A . n 
A 1 126 GLY 126 149 149 GLY GLY A . n 
A 1 127 ASN 127 150 150 ASN ASN A . n 
A 1 128 HIS 128 151 151 HIS HIS A . n 
A 1 129 GLU 129 152 152 GLU GLU A . n 
A 1 130 CYS 130 153 153 CYS CYS A . n 
A 1 131 ARG 131 154 154 ARG ARG A . n 
A 1 132 HIS 132 155 155 HIS HIS A . n 
A 1 133 LEU 133 156 156 LEU LEU A . n 
A 1 134 THR 134 157 157 THR THR A . n 
A 1 135 GLU 135 158 158 GLU GLU A . n 
A 1 136 TYR 136 159 159 TYR TYR A . n 
A 1 137 PHE 137 160 160 PHE PHE A . n 
A 1 138 THR 138 161 161 THR THR A . n 
A 1 139 PHE 139 162 162 PHE PHE A . n 
A 1 140 LYS 140 163 163 LYS LYS A . n 
A 1 141 GLN 141 164 164 GLN GLN A . n 
A 1 142 GLU 142 165 165 GLU GLU A . n 
A 1 143 CYS 143 166 166 CYS CYS A . n 
A 1 144 LYS 144 167 167 LYS LYS A . n 
A 1 145 ILE 145 168 168 ILE ILE A . n 
A 1 146 LYS 146 169 169 LYS LYS A . n 
A 1 147 TYR 147 170 170 TYR TYR A . n 
A 1 148 SER 148 171 171 SER SER A . n 
A 1 149 GLU 149 172 172 GLU GLU A . n 
A 1 150 ARG 150 173 173 ARG ARG A . n 
A 1 151 VAL 151 174 174 VAL VAL A . n 
A 1 152 TYR 152 175 175 TYR TYR A . n 
A 1 153 ASP 153 176 176 ASP ASP A . n 
A 1 154 ALA 154 177 177 ALA ALA A . n 
A 1 155 CYS 155 178 178 CYS CYS A . n 
A 1 156 MET 156 179 179 MET MET A . n 
A 1 157 ASP 157 180 180 ASP ASP A . n 
A 1 158 ALA 158 181 181 ALA ALA A . n 
A 1 159 PHE 159 182 182 PHE PHE A . n 
A 1 160 ASP 160 183 183 ASP ASP A . n 
A 1 161 CYS 161 184 184 CYS CYS A . n 
A 1 162 LEU 162 185 185 LEU LEU A . n 
A 1 163 PRO 163 186 186 PRO PRO A . n 
A 1 164 LEU 164 187 187 LEU LEU A . n 
A 1 165 ALA 165 188 188 ALA ALA A . n 
A 1 166 ALA 166 189 189 ALA ALA A . n 
A 1 167 LEU 167 190 190 LEU LEU A . n 
A 1 168 MET 168 191 191 MET MET A . n 
A 1 169 ASN 169 192 192 ASN ASN A . n 
A 1 170 GLN 170 193 193 GLN GLN A . n 
A 1 171 GLN 171 194 194 GLN GLN A . n 
A 1 172 PHE 172 195 195 PHE PHE A . n 
A 1 173 LEU 173 196 196 LEU LEU A . n 
A 1 174 CYS 174 197 197 CYS CYS A . n 
A 1 175 VAL 175 198 198 VAL VAL A . n 
A 1 176 HIS 176 199 199 HIS HIS A . n 
A 1 177 GLY 177 200 200 GLY GLY A . n 
A 1 178 GLY 178 201 201 GLY GLY A . n 
A 1 179 LEU 179 202 202 LEU LEU A . n 
A 1 180 SER 180 203 203 SER SER A . n 
A 1 181 PRO 181 204 204 PRO PRO A . n 
A 1 182 GLU 182 205 205 GLU GLU A . n 
A 1 183 ILE 183 206 206 ILE ILE A . n 
A 1 184 ASN 184 207 207 ASN ASN A . n 
A 1 185 THR 185 208 208 THR THR A . n 
A 1 186 LEU 186 209 209 LEU LEU A . n 
A 1 187 ASP 187 210 210 ASP ASP A . n 
A 1 188 ASP 188 211 211 ASP ASP A . n 
A 1 189 ILE 189 212 212 ILE ILE A . n 
A 1 190 ARG 190 213 213 ARG ARG A . n 
A 1 191 LYS 191 214 214 LYS LYS A . n 
A 1 192 LEU 192 215 215 LEU LEU A . n 
A 1 193 ASP 193 216 216 ASP ASP A . n 
A 1 194 ARG 194 217 217 ARG ARG A . n 
A 1 195 PHE 195 218 218 PHE PHE A . n 
A 1 196 LYS 196 219 219 LYS LYS A . n 
A 1 197 GLU 197 220 220 GLU GLU A . n 
A 1 198 PRO 198 221 221 PRO PRO A . n 
A 1 199 PRO 199 222 222 PRO PRO A . n 
A 1 200 ALA 200 223 223 ALA ALA A . n 
A 1 201 TYR 201 224 224 TYR TYR A . n 
A 1 202 GLY 202 225 225 GLY GLY A . n 
A 1 203 PRO 203 226 226 PRO PRO A . n 
A 1 204 MET 204 227 227 MET MET A . n 
A 1 205 CYS 205 228 228 CYS CYS A . n 
A 1 206 ASP 206 229 229 ASP ASP A . n 
A 1 207 ILE 207 230 230 ILE ILE A . n 
A 1 208 LEU 208 231 231 LEU LEU A . n 
A 1 209 TRP 209 232 232 TRP TRP A . n 
A 1 210 SER 210 233 233 SER SER A . n 
A 1 211 ASP 211 234 234 ASP ASP A . n 
A 1 212 PRO 212 235 235 PRO PRO A . n 
A 1 213 LEU 213 236 236 LEU LEU A . n 
A 1 214 GLU 214 237 237 GLU GLU A . n 
A 1 215 ASP 215 238 238 ASP ASP A . n 
A 1 216 PHE 216 239 239 PHE PHE A . n 
A 1 217 GLY 217 240 240 GLY GLY A . n 
A 1 218 ASN 218 241 241 ASN ASN A . n 
A 1 219 GLU 219 242 242 GLU GLU A . n 
A 1 220 LYS 220 243 243 LYS LYS A . n 
A 1 221 THR 221 244 244 THR THR A . n 
A 1 222 GLN 222 245 245 GLN GLN A . n 
A 1 223 GLU 223 246 246 GLU GLU A . n 
A 1 224 HIS 224 247 247 HIS HIS A . n 
A 1 225 PHE 225 248 248 PHE PHE A . n 
A 1 226 THR 226 249 249 THR THR A . n 
A 1 227 HIS 227 250 250 HIS HIS A . n 
A 1 228 ASN 228 251 251 ASN ASN A . n 
A 1 229 THR 229 252 252 THR THR A . n 
A 1 230 VAL 230 253 253 VAL VAL A . n 
A 1 231 ARG 231 254 254 ARG ARG A . n 
A 1 232 GLY 232 255 255 GLY GLY A . n 
A 1 233 CYS 233 256 256 CYS CYS A . n 
A 1 234 SER 234 257 257 SER SER A . n 
A 1 235 TYR 235 258 258 TYR TYR A . n 
A 1 236 PHE 236 259 259 PHE PHE A . n 
A 1 237 TYR 237 260 260 TYR TYR A . n 
A 1 238 SER 238 261 261 SER SER A . n 
A 1 239 TYR 239 262 262 TYR TYR A . n 
A 1 240 PRO 240 263 263 PRO PRO A . n 
A 1 241 ALA 241 264 264 ALA ALA A . n 
A 1 242 VAL 242 265 265 VAL VAL A . n 
A 1 243 CYS 243 266 266 CYS CYS A . n 
A 1 244 GLU 244 267 267 GLU GLU A . n 
A 1 245 PHE 245 268 268 PHE PHE A . n 
A 1 246 LEU 246 269 269 LEU LEU A . n 
A 1 247 GLN 247 270 270 GLN GLN A . n 
A 1 248 HIS 248 271 271 HIS HIS A . n 
A 1 249 ASN 249 272 272 ASN ASN A . n 
A 1 250 ASN 250 273 273 ASN ASN A . n 
A 1 251 LEU 251 274 274 LEU LEU A . n 
A 1 252 LEU 252 275 275 LEU LEU A . n 
A 1 253 SER 253 276 276 SER SER A . n 
A 1 254 ILE 254 277 277 ILE ILE A . n 
A 1 255 LEU 255 278 278 LEU LEU A . n 
A 1 256 ARG 256 279 279 ARG ARG A . n 
A 1 257 ALA 257 280 280 ALA ALA A . n 
A 1 258 HIS 258 281 281 HIS HIS A . n 
A 1 259 GLU 259 282 282 GLU GLU A . n 
A 1 260 ALA 260 283 283 ALA ALA A . n 
A 1 261 GLN 261 284 284 GLN GLN A . n 
A 1 262 ASP 262 285 285 ASP ASP A . n 
A 1 263 ALA 263 286 286 ALA ALA A . n 
A 1 264 GLY 264 287 287 GLY GLY A . n 
A 1 265 TYR 265 288 288 TYR TYR A . n 
A 1 266 ARG 266 289 289 ARG ARG A . n 
A 1 267 MET 267 290 290 MET MET A . n 
A 1 268 TYR 268 291 291 TYR TYR A . n 
A 1 269 ARG 269 292 292 ARG ARG A . n 
A 1 270 LYS 270 293 293 LYS LYS A . n 
A 1 271 SER 271 294 294 SER SER A . n 
A 1 272 GLN 272 295 295 GLN GLN A . n 
A 1 273 THR 273 296 296 THR THR A . n 
A 1 274 THR 274 297 297 THR THR A . n 
A 1 275 GLY 275 298 298 GLY GLY A . n 
A 1 276 PHE 276 299 299 PHE PHE A . n 
A 1 277 PRO 277 300 300 PRO PRO A . n 
A 1 278 SER 278 301 301 SER SER A . n 
A 1 279 LEU 279 302 302 LEU LEU A . n 
A 1 280 ILE 280 303 303 ILE ILE A . n 
A 1 281 THR 281 304 304 THR THR A . n 
A 1 282 ILE 282 305 305 ILE ILE A . n 
A 1 283 PHE 283 306 306 PHE PHE A . n 
A 1 284 SER 284 307 307 SER SER A . n 
A 1 285 ALA 285 308 308 ALA ALA A . n 
A 1 286 PRO 286 309 309 PRO PRO A . n 
A 1 287 ASN 287 310 310 ASN ASN A . n 
A 1 288 TYR 288 311 311 TYR TYR A . n 
A 1 289 LEU 289 312 312 LEU LEU A . n 
A 1 290 ASP 290 313 313 ASP ALA A . n 
A 1 291 VAL 291 314 314 VAL VAL A . n 
A 1 292 TYR 292 315 315 TYR TYR A . n 
A 1 293 ASN 293 316 316 ASN ASN A . n 
A 1 294 ASN 294 317 317 ASN ASN A . n 
A 1 295 LYS 295 318 318 LYS LYS A . n 
A 1 296 ALA 296 319 319 ALA ALA A . n 
A 1 297 ALA 297 320 320 ALA ALA A . n 
A 1 298 VAL 298 321 321 VAL VAL A . n 
A 1 299 LEU 299 322 322 LEU LEU A . n 
A 1 300 LYS 300 323 323 LYS LYS A . n 
A 1 301 TYR 301 324 324 TYR TYR A . n 
A 1 302 GLU 302 325 325 GLU GLU A . n 
A 1 303 ASN 303 326 326 ASN ASN A . n 
A 1 304 ASN 304 327 327 ASN ASN A . n 
A 1 305 VAL 305 328 328 VAL VAL A . n 
A 1 306 MET 306 329 329 MET MET A . n 
A 1 307 ASN 307 330 330 ASN ASN A . n 
A 1 308 ILE 308 331 331 ILE ILE A . n 
A 1 309 ARG 309 332 332 ARG ARG A . n 
A 1 310 GLN 310 333 333 GLN GLN A . n 
A 1 311 PHE 311 334 334 PHE PHE A . n 
A 1 312 ASN 312 335 335 ASN ASN A . n 
A 1 313 CYS 313 336 336 CYS CYS A . n 
A 1 314 SER 314 337 ?   ?   ?   A . n 
A 1 315 PRO 315 338 ?   ?   ?   A . n 
A 1 316 HIS 316 339 ?   ?   ?   A . n 
B 2 1   GLY 1   125 ?   ?   ?   B . n 
B 2 2   HIS 2   126 ?   ?   ?   B . n 
B 2 3   MET 3   127 ?   ?   ?   B . n 
B 2 4   ASN 4   128 ?   ?   ?   B . n 
B 2 5   TYR 5   129 ?   ?   ?   B . n 
B 2 6   ASP 6   130 ?   ?   ?   B . n 
B 2 7   LEU 7   131 ?   ?   ?   B . n 
B 2 8   LEU 8   132 ?   ?   ?   B . n 
B 2 9   TYR 9   133 ?   ?   ?   B . n 
B 2 10  ALA 10  134 ?   ?   ?   B . n 
B 2 11  ILE 11  135 ?   ?   ?   B . n 
B 2 12  SER 12  136 ?   ?   ?   B . n 
B 2 13  LYS 13  137 ?   ?   ?   B . n 
B 2 14  LEU 14  138 ?   ?   ?   B . n 
B 2 15  GLY 15  139 ?   ?   ?   B . n 
B 2 16  PRO 16  140 ?   ?   ?   B . n 
B 2 17  GLY 17  141 ?   ?   ?   B . n 
B 2 18  GLU 18  142 ?   ?   ?   B . n 
B 2 19  LYS 19  143 ?   ?   ?   B . n 
B 2 20  TYR 20  144 ?   ?   ?   B . n 
B 2 21  GLU 21  145 ?   ?   ?   B . n 
B 2 22  LEU 22  146 ?   ?   ?   B . n 
B 2 23  HIS 23  147 ?   ?   ?   B . n 
B 2 24  ALA 24  148 ?   ?   ?   B . n 
B 2 25  ALA 25  149 ?   ?   ?   B . n 
B 2 26  THR 26  150 ?   ?   ?   B . n 
B 2 27  ASP 27  151 ?   ?   ?   B . n 
B 2 28  THR 28  152 ?   ?   ?   B . n 
B 2 29  THR 29  153 153 THR THR B . n 
B 2 30  PRO 30  154 154 PRO PRO B . n 
B 2 31  SER 31  155 155 SER SER B . n 
B 2 32  VAL 32  156 156 VAL VAL B . n 
B 2 33  VAL 33  157 157 VAL VAL B . n 
B 2 34  ILE 34  158 158 ILE ILE B . n 
B 2 35  THR 35  159 159 THR THR B . n 
B 2 36  VAL 36  160 160 VAL VAL B . n 
B 2 37  CYS 37  161 161 CYS CYS B . n 
B 2 38  GLU 38  162 ?   ?   ?   B . n 
B 2 39  SER 39  163 ?   ?   ?   B . n 
B 2 40  ASP 40  164 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 PO4 1   401 1   PO4 PO4 A . 
D 3 PO4 1   402 2   PO4 PO4 A . 
E 4 ZN  1   403 1   ZN  ZN  A . 
F 5 FE  1   404 1   FE  FE  A . 
G 6 HOH 1   501 234 HOH HOH A . 
G 6 HOH 2   502 308 HOH HOH A . 
G 6 HOH 3   503 122 HOH HOH A . 
G 6 HOH 4   504 150 HOH HOH A . 
G 6 HOH 5   505 155 HOH HOH A . 
G 6 HOH 6   506 91  HOH HOH A . 
G 6 HOH 7   507 97  HOH HOH A . 
G 6 HOH 8   508 235 HOH HOH A . 
G 6 HOH 9   509 293 HOH HOH A . 
G 6 HOH 10  510 226 HOH HOH A . 
G 6 HOH 11  511 118 HOH HOH A . 
G 6 HOH 12  512 10  HOH HOH A . 
G 6 HOH 13  513 309 HOH HOH A . 
G 6 HOH 14  514 139 HOH HOH A . 
G 6 HOH 15  515 206 HOH HOH A . 
G 6 HOH 16  516 50  HOH HOH A . 
G 6 HOH 17  517 159 HOH HOH A . 
G 6 HOH 18  518 241 HOH HOH A . 
G 6 HOH 19  519 127 HOH HOH A . 
G 6 HOH 20  520 17  HOH HOH A . 
G 6 HOH 21  521 53  HOH HOH A . 
G 6 HOH 22  522 113 HOH HOH A . 
G 6 HOH 23  523 290 HOH HOH A . 
G 6 HOH 24  524 265 HOH HOH A . 
G 6 HOH 25  525 15  HOH HOH A . 
G 6 HOH 26  526 167 HOH HOH A . 
G 6 HOH 27  527 277 HOH HOH A . 
G 6 HOH 28  528 108 HOH HOH A . 
G 6 HOH 29  529 85  HOH HOH A . 
G 6 HOH 30  530 128 HOH HOH A . 
G 6 HOH 31  531 136 HOH HOH A . 
G 6 HOH 32  532 34  HOH HOH A . 
G 6 HOH 33  533 22  HOH HOH A . 
G 6 HOH 34  534 172 HOH HOH A . 
G 6 HOH 35  535 9   HOH HOH A . 
G 6 HOH 36  536 41  HOH HOH A . 
G 6 HOH 37  537 61  HOH HOH A . 
G 6 HOH 38  538 209 HOH HOH A . 
G 6 HOH 39  539 1   HOH HOH A . 
G 6 HOH 40  540 23  HOH HOH A . 
G 6 HOH 41  541 65  HOH HOH A . 
G 6 HOH 42  542 45  HOH HOH A . 
G 6 HOH 43  543 214 HOH HOH A . 
G 6 HOH 44  544 81  HOH HOH A . 
G 6 HOH 45  545 47  HOH HOH A . 
G 6 HOH 46  546 2   HOH HOH A . 
G 6 HOH 47  547 73  HOH HOH A . 
G 6 HOH 48  548 195 HOH HOH A . 
G 6 HOH 49  549 176 HOH HOH A . 
G 6 HOH 50  550 36  HOH HOH A . 
G 6 HOH 51  551 148 HOH HOH A . 
G 6 HOH 52  552 166 HOH HOH A . 
G 6 HOH 53  553 82  HOH HOH A . 
G 6 HOH 54  554 153 HOH HOH A . 
G 6 HOH 55  555 187 HOH HOH A . 
G 6 HOH 56  556 134 HOH HOH A . 
G 6 HOH 57  557 55  HOH HOH A . 
G 6 HOH 58  558 88  HOH HOH A . 
G 6 HOH 59  559 20  HOH HOH A . 
G 6 HOH 60  560 135 HOH HOH A . 
G 6 HOH 61  561 78  HOH HOH A . 
G 6 HOH 62  562 219 HOH HOH A . 
G 6 HOH 63  563 140 HOH HOH A . 
G 6 HOH 64  564 49  HOH HOH A . 
G 6 HOH 65  565 38  HOH HOH A . 
G 6 HOH 66  566 285 HOH HOH A . 
G 6 HOH 67  567 68  HOH HOH A . 
G 6 HOH 68  568 30  HOH HOH A . 
G 6 HOH 69  569 196 HOH HOH A . 
G 6 HOH 70  570 27  HOH HOH A . 
G 6 HOH 71  571 71  HOH HOH A . 
G 6 HOH 72  572 8   HOH HOH A . 
G 6 HOH 73  573 238 HOH HOH A . 
G 6 HOH 74  574 117 HOH HOH A . 
G 6 HOH 75  575 7   HOH HOH A . 
G 6 HOH 76  576 303 HOH HOH A . 
G 6 HOH 77  577 62  HOH HOH A . 
G 6 HOH 78  578 98  HOH HOH A . 
G 6 HOH 79  579 327 HOH HOH A . 
G 6 HOH 80  580 225 HOH HOH A . 
G 6 HOH 81  581 83  HOH HOH A . 
G 6 HOH 82  582 66  HOH HOH A . 
G 6 HOH 83  583 210 HOH HOH A . 
G 6 HOH 84  584 105 HOH HOH A . 
G 6 HOH 85  585 89  HOH HOH A . 
G 6 HOH 86  586 35  HOH HOH A . 
G 6 HOH 87  587 95  HOH HOH A . 
G 6 HOH 88  588 87  HOH HOH A . 
G 6 HOH 89  589 202 HOH HOH A . 
G 6 HOH 90  590 192 HOH HOH A . 
G 6 HOH 91  591 28  HOH HOH A . 
G 6 HOH 92  592 12  HOH HOH A . 
G 6 HOH 93  593 64  HOH HOH A . 
G 6 HOH 94  594 197 HOH HOH A . 
G 6 HOH 95  595 31  HOH HOH A . 
G 6 HOH 96  596 102 HOH HOH A . 
G 6 HOH 97  597 3   HOH HOH A . 
G 6 HOH 98  598 144 HOH HOH A . 
G 6 HOH 99  599 218 HOH HOH A . 
G 6 HOH 100 600 253 HOH HOH A . 
G 6 HOH 101 601 152 HOH HOH A . 
G 6 HOH 102 602 124 HOH HOH A . 
G 6 HOH 103 603 200 HOH HOH A . 
G 6 HOH 104 604 43  HOH HOH A . 
G 6 HOH 105 605 181 HOH HOH A . 
G 6 HOH 106 606 185 HOH HOH A . 
G 6 HOH 107 607 11  HOH HOH A . 
G 6 HOH 108 608 106 HOH HOH A . 
G 6 HOH 109 609 272 HOH HOH A . 
G 6 HOH 110 610 5   HOH HOH A . 
G 6 HOH 111 611 56  HOH HOH A . 
G 6 HOH 112 612 183 HOH HOH A . 
G 6 HOH 113 613 306 HOH HOH A . 
G 6 HOH 114 614 84  HOH HOH A . 
G 6 HOH 115 615 212 HOH HOH A . 
G 6 HOH 116 616 138 HOH HOH A . 
G 6 HOH 117 617 6   HOH HOH A . 
G 6 HOH 118 618 99  HOH HOH A . 
G 6 HOH 119 619 104 HOH HOH A . 
G 6 HOH 120 620 147 HOH HOH A . 
G 6 HOH 121 621 54  HOH HOH A . 
G 6 HOH 122 622 204 HOH HOH A . 
G 6 HOH 123 623 137 HOH HOH A . 
G 6 HOH 124 624 63  HOH HOH A . 
G 6 HOH 125 625 19  HOH HOH A . 
G 6 HOH 126 626 141 HOH HOH A . 
G 6 HOH 127 627 133 HOH HOH A . 
G 6 HOH 128 628 257 HOH HOH A . 
G 6 HOH 129 629 94  HOH HOH A . 
G 6 HOH 130 630 247 HOH HOH A . 
G 6 HOH 131 631 164 HOH HOH A . 
G 6 HOH 132 632 244 HOH HOH A . 
G 6 HOH 133 633 190 HOH HOH A . 
G 6 HOH 134 634 115 HOH HOH A . 
G 6 HOH 135 635 130 HOH HOH A . 
G 6 HOH 136 636 146 HOH HOH A . 
G 6 HOH 137 637 170 HOH HOH A . 
G 6 HOH 138 638 52  HOH HOH A . 
G 6 HOH 139 639 74  HOH HOH A . 
G 6 HOH 140 640 307 HOH HOH A . 
G 6 HOH 141 641 32  HOH HOH A . 
G 6 HOH 142 642 236 HOH HOH A . 
G 6 HOH 143 643 112 HOH HOH A . 
G 6 HOH 144 644 57  HOH HOH A . 
G 6 HOH 145 645 116 HOH HOH A . 
G 6 HOH 146 646 114 HOH HOH A . 
G 6 HOH 147 647 67  HOH HOH A . 
G 6 HOH 148 648 245 HOH HOH A . 
G 6 HOH 149 649 230 HOH HOH A . 
G 6 HOH 150 650 107 HOH HOH A . 
G 6 HOH 151 651 42  HOH HOH A . 
G 6 HOH 152 652 286 HOH HOH A . 
G 6 HOH 153 653 193 HOH HOH A . 
G 6 HOH 154 654 256 HOH HOH A . 
G 6 HOH 155 655 76  HOH HOH A . 
G 6 HOH 156 656 33  HOH HOH A . 
G 6 HOH 157 657 263 HOH HOH A . 
G 6 HOH 158 658 223 HOH HOH A . 
G 6 HOH 159 659 149 HOH HOH A . 
G 6 HOH 160 660 29  HOH HOH A . 
G 6 HOH 161 661 46  HOH HOH A . 
G 6 HOH 162 662 242 HOH HOH A . 
G 6 HOH 163 663 25  HOH HOH A . 
G 6 HOH 164 664 125 HOH HOH A . 
G 6 HOH 165 665 79  HOH HOH A . 
G 6 HOH 166 666 58  HOH HOH A . 
G 6 HOH 167 667 16  HOH HOH A . 
G 6 HOH 168 668 269 HOH HOH A . 
G 6 HOH 169 669 21  HOH HOH A . 
G 6 HOH 170 670 51  HOH HOH A . 
G 6 HOH 171 671 132 HOH HOH A . 
G 6 HOH 172 672 119 HOH HOH A . 
G 6 HOH 173 673 14  HOH HOH A . 
G 6 HOH 174 674 126 HOH HOH A . 
G 6 HOH 175 675 13  HOH HOH A . 
G 6 HOH 176 676 131 HOH HOH A . 
G 6 HOH 177 677 151 HOH HOH A . 
G 6 HOH 178 678 4   HOH HOH A . 
G 6 HOH 179 679 80  HOH HOH A . 
G 6 HOH 180 680 239 HOH HOH A . 
G 6 HOH 181 681 158 HOH HOH A . 
G 6 HOH 182 682 77  HOH HOH A . 
G 6 HOH 183 683 90  HOH HOH A . 
G 6 HOH 184 684 26  HOH HOH A . 
G 6 HOH 185 685 59  HOH HOH A . 
G 6 HOH 186 686 255 HOH HOH A . 
G 6 HOH 187 687 93  HOH HOH A . 
G 6 HOH 188 688 254 HOH HOH A . 
G 6 HOH 189 689 109 HOH HOH A . 
G 6 HOH 190 690 48  HOH HOH A . 
G 6 HOH 191 691 208 HOH HOH A . 
G 6 HOH 192 692 69  HOH HOH A . 
G 6 HOH 193 693 44  HOH HOH A . 
G 6 HOH 194 694 216 HOH HOH A . 
G 6 HOH 195 695 110 HOH HOH A . 
G 6 HOH 196 696 304 HOH HOH A . 
G 6 HOH 197 697 215 HOH HOH A . 
G 6 HOH 198 698 24  HOH HOH A . 
G 6 HOH 199 699 291 HOH HOH A . 
G 6 HOH 200 700 165 HOH HOH A . 
G 6 HOH 201 701 267 HOH HOH A . 
G 6 HOH 202 702 203 HOH HOH A . 
G 6 HOH 203 703 101 HOH HOH A . 
G 6 HOH 204 704 75  HOH HOH A . 
G 6 HOH 205 705 18  HOH HOH A . 
G 6 HOH 206 706 233 HOH HOH A . 
G 6 HOH 207 707 40  HOH HOH A . 
G 6 HOH 208 708 86  HOH HOH A . 
G 6 HOH 209 709 168 HOH HOH A . 
G 6 HOH 210 710 224 HOH HOH A . 
G 6 HOH 211 711 70  HOH HOH A . 
G 6 HOH 212 712 237 HOH HOH A . 
G 6 HOH 213 713 296 HOH HOH A . 
G 6 HOH 214 714 276 HOH HOH A . 
G 6 HOH 215 715 305 HOH HOH A . 
G 6 HOH 216 716 288 HOH HOH A . 
G 6 HOH 217 717 96  HOH HOH A . 
G 6 HOH 218 718 129 HOH HOH A . 
G 6 HOH 219 719 72  HOH HOH A . 
G 6 HOH 220 720 157 HOH HOH A . 
G 6 HOH 221 721 260 HOH HOH A . 
G 6 HOH 222 722 252 HOH HOH A . 
G 6 HOH 223 723 302 HOH HOH A . 
G 6 HOH 224 724 103 HOH HOH A . 
G 6 HOH 225 725 222 HOH HOH A . 
G 6 HOH 226 726 232 HOH HOH A . 
G 6 HOH 227 727 271 HOH HOH A . 
G 6 HOH 228 728 323 HOH HOH A . 
G 6 HOH 229 729 174 HOH HOH A . 
G 6 HOH 230 730 92  HOH HOH A . 
G 6 HOH 231 731 37  HOH HOH A . 
G 6 HOH 232 732 229 HOH HOH A . 
G 6 HOH 233 733 261 HOH HOH A . 
G 6 HOH 234 734 325 HOH HOH A . 
G 6 HOH 235 735 282 HOH HOH A . 
G 6 HOH 236 736 246 HOH HOH A . 
G 6 HOH 237 737 274 HOH HOH A . 
G 6 HOH 238 738 311 HOH HOH A . 
G 6 HOH 239 739 207 HOH HOH A . 
G 6 HOH 240 740 188 HOH HOH A . 
G 6 HOH 241 741 297 HOH HOH A . 
G 6 HOH 242 742 123 HOH HOH A . 
G 6 HOH 243 743 258 HOH HOH A . 
G 6 HOH 244 744 240 HOH HOH A . 
G 6 HOH 245 745 221 HOH HOH A . 
G 6 HOH 246 746 312 HOH HOH A . 
G 6 HOH 247 747 220 HOH HOH A . 
G 6 HOH 248 748 248 HOH HOH A . 
G 6 HOH 249 749 275 HOH HOH A . 
G 6 HOH 250 750 310 HOH HOH A . 
G 6 HOH 251 751 289 HOH HOH A . 
G 6 HOH 252 752 280 HOH HOH A . 
G 6 HOH 253 753 179 HOH HOH A . 
G 6 HOH 254 754 180 HOH HOH A . 
G 6 HOH 255 755 299 HOH HOH A . 
G 6 HOH 256 756 250 HOH HOH A . 
G 6 HOH 257 757 300 HOH HOH A . 
G 6 HOH 258 758 259 HOH HOH A . 
G 6 HOH 259 759 111 HOH HOH A . 
G 6 HOH 260 760 201 HOH HOH A . 
G 6 HOH 261 761 173 HOH HOH A . 
G 6 HOH 262 762 264 HOH HOH A . 
G 6 HOH 263 763 205 HOH HOH A . 
G 6 HOH 264 764 217 HOH HOH A . 
G 6 HOH 265 765 60  HOH HOH A . 
G 6 HOH 266 766 301 HOH HOH A . 
G 6 HOH 267 767 315 HOH HOH A . 
G 6 HOH 268 768 213 HOH HOH A . 
G 6 HOH 269 769 198 HOH HOH A . 
G 6 HOH 270 770 182 HOH HOH A . 
G 6 HOH 271 771 175 HOH HOH A . 
G 6 HOH 272 772 145 HOH HOH A . 
G 6 HOH 273 773 294 HOH HOH A . 
G 6 HOH 274 774 266 HOH HOH A . 
G 6 HOH 275 775 281 HOH HOH A . 
G 6 HOH 276 776 178 HOH HOH A . 
G 6 HOH 277 777 251 HOH HOH A . 
G 6 HOH 278 778 143 HOH HOH A . 
G 6 HOH 279 779 169 HOH HOH A . 
G 6 HOH 280 780 120 HOH HOH A . 
G 6 HOH 281 781 211 HOH HOH A . 
G 6 HOH 282 782 161 HOH HOH A . 
G 6 HOH 283 783 317 HOH HOH A . 
G 6 HOH 284 784 163 HOH HOH A . 
G 6 HOH 285 785 177 HOH HOH A . 
G 6 HOH 286 786 287 HOH HOH A . 
G 6 HOH 287 787 270 HOH HOH A . 
G 6 HOH 288 788 273 HOH HOH A . 
G 6 HOH 289 789 160 HOH HOH A . 
G 6 HOH 290 790 278 HOH HOH A . 
G 6 HOH 291 791 39  HOH HOH A . 
G 6 HOH 292 792 199 HOH HOH A . 
H 6 HOH 1   201 268 HOH HOH B . 
H 6 HOH 2   202 156 HOH HOH B . 
H 6 HOH 3   203 292 HOH HOH B . 
H 6 HOH 4   204 171 HOH HOH B . 
H 6 HOH 5   205 100 HOH HOH B . 
H 6 HOH 6   206 316 HOH HOH B . 
H 6 HOH 7   207 243 HOH HOH B . 
H 6 HOH 8   208 142 HOH HOH B . 
H 6 HOH 9   209 324 HOH HOH B . 
H 6 HOH 10  210 279 HOH HOH B . 
H 6 HOH 11  211 184 HOH HOH B . 
H 6 HOH 12  212 262 HOH HOH B . 
H 6 HOH 13  213 313 HOH HOH B . 
H 6 HOH 14  214 319 HOH HOH B . 
H 6 HOH 15  215 326 HOH HOH B . 
H 6 HOH 16  216 318 HOH HOH B . 
H 6 HOH 17  217 189 HOH HOH B . 
H 6 HOH 18  218 249 HOH HOH B . 
H 6 HOH 19  219 154 HOH HOH B . 
H 6 HOH 20  220 320 HOH HOH B . 
H 6 HOH 21  221 162 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1850  ? 
1 MORE         -83   ? 
1 'SSA (A^2)'  13100 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 67  ? A ASP 90  ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 NE2 ? A HIS 69  ? A HIS 92  ? 1_555 100.6 ? 
2  OD2 ? A ASP 67  ? A ASP 90  ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 OD2 ? A ASP 95  ? A ASP 118 ? 1_555 94.0  ? 
3  NE2 ? A HIS 69  ? A HIS 92  ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 OD2 ? A ASP 95  ? A ASP 118 ? 1_555 95.5  ? 
4  OD2 ? A ASP 67  ? A ASP 90  ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O1  ? C PO4 .   ? A PO4 401 ? 1_555 164.9 ? 
5  NE2 ? A HIS 69  ? A HIS 92  ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O1  ? C PO4 .   ? A PO4 401 ? 1_555 91.8  ? 
6  OD2 ? A ASP 95  ? A ASP 118 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O1  ? C PO4 .   ? A PO4 401 ? 1_555 93.3  ? 
7  OD2 ? A ASP 67  ? A ASP 90  ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O2  ? D PO4 .   ? A PO4 402 ? 1_555 85.9  ? 
8  NE2 ? A HIS 69  ? A HIS 92  ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O2  ? D PO4 .   ? A PO4 402 ? 1_555 94.9  ? 
9  OD2 ? A ASP 95  ? A ASP 118 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O2  ? D PO4 .   ? A PO4 402 ? 1_555 169.4 ? 
10 O1  ? C PO4 .   ? A PO4 401 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O2  ? D PO4 .   ? A PO4 402 ? 1_555 84.6  ? 
11 OD2 ? A ASP 67  ? A ASP 90  ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 81.7  ? 
12 NE2 ? A HIS 69  ? A HIS 92  ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 174.6 ? 
13 OD2 ? A ASP 95  ? A ASP 118 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 79.4  ? 
14 O1  ? C PO4 .   ? A PO4 401 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 86.6  ? 
15 O2  ? D PO4 .   ? A PO4 402 ? 1_555 ZN ? E ZN . ? A ZN 403 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 90.1  ? 
16 OD2 ? A ASP 95  ? A ASP 118 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 OD1 ? A ASN 127 ? A ASN 150 ? 1_555 96.8  ? 
17 OD2 ? A ASP 95  ? A ASP 118 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 NE2 ? A HIS 176 ? A HIS 199 ? 1_555 87.2  ? 
18 OD1 ? A ASN 127 ? A ASN 150 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 NE2 ? A HIS 176 ? A HIS 199 ? 1_555 87.2  ? 
19 OD2 ? A ASP 95  ? A ASP 118 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 ND1 ? A HIS 258 ? A HIS 281 ? 1_555 163.4 ? 
20 OD1 ? A ASN 127 ? A ASN 150 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 ND1 ? A HIS 258 ? A HIS 281 ? 1_555 98.7  ? 
21 NE2 ? A HIS 176 ? A HIS 199 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 ND1 ? A HIS 258 ? A HIS 281 ? 1_555 87.7  ? 
22 OD2 ? A ASP 95  ? A ASP 118 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 O2  ? C PO4 .   ? A PO4 401 ? 1_555 91.8  ? 
23 OD1 ? A ASN 127 ? A ASN 150 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 O2  ? C PO4 .   ? A PO4 401 ? 1_555 84.0  ? 
24 NE2 ? A HIS 176 ? A HIS 199 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 O2  ? C PO4 .   ? A PO4 401 ? 1_555 171.0 ? 
25 ND1 ? A HIS 258 ? A HIS 281 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 O2  ? C PO4 .   ? A PO4 401 ? 1_555 95.6  ? 
26 OD2 ? A ASP 95  ? A ASP 118 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 75.5  ? 
27 OD1 ? A ASN 127 ? A ASN 150 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 164.6 ? 
28 NE2 ? A HIS 176 ? A HIS 199 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 105.4 ? 
29 ND1 ? A HIS 258 ? A HIS 281 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 90.6  ? 
30 O2  ? C PO4 .   ? A PO4 401 ? 1_555 FE ? F FE . ? A FE 404 ? 1_555 O   ? G HOH .   ? A HOH 571 ? 1_555 83.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-09-09 
2 'Structure model' 1 1 2020-09-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
2 2 'Structure model' '_citation.title'                   
3 2 'Structure model' '_citation_author.name'             
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .         1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.13_2998 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25      3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .         4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .         5 
# 
_pdbx_entry_details.entry_id                 6UUQ 
_pdbx_entry_details.has_ligand_of_interest   N 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   B HOH 205 ? ? O  B HOH 220 ? ? 1.99 
2  1 O   B HOH 203 ? ? O  B HOH 212 ? ? 2.09 
3  1 O   B HOH 207 ? ? O  B HOH 218 ? ? 2.11 
4  1 NH1 A ARG 122 ? ? O4 A PO4 402 ? ? 2.11 
5  1 OD1 A ASN 192 ? ? O  A HOH 501 ? ? 2.11 
6  1 OD1 A ASP 238 ? A O  A HOH 502 ? ? 2.12 
7  1 O   A HOH 501 ? ? O  A HOH 616 ? ? 2.15 
8  1 O   B HOH 210 ? ? O  B HOH 212 ? ? 2.16 
9  1 O   B HOH 206 ? ? O  B HOH 216 ? ? 2.16 
10 1 O   B HOH 214 ? ? O  B HOH 215 ? ? 2.17 
11 1 O   B HOH 205 ? ? O  B HOH 217 ? ? 2.17 
12 1 O   B HOH 213 ? ? O  B HOH 218 ? ? 2.18 
13 1 O   A HOH 745 ? ? O  A HOH 748 ? ? 2.18 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 767 ? ? 1_555 O B HOH 212 ? ? 3_655 2.04 
2 1 O A HOH 783 ? ? 1_555 O B HOH 215 ? ? 3_655 2.12 
3 1 O A HOH 767 ? ? 1_555 O B HOH 208 ? ? 3_655 2.13 
4 1 O A HOH 774 ? ? 1_555 O B HOH 213 ? ? 3_655 2.15 
5 1 O A HOH 579 ? ? 1_555 O B HOH 207 ? ? 3_655 2.16 
6 1 O A HOH 790 ? ? 1_555 O B HOH 209 ? ? 3_655 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 110 ? ? -141.20 17.54   
2  1 ASP A 121 ? ? 78.46   159.31  
3  1 ARG A 122 ? ? 74.79   -58.31  
4  1 PHE A 160 ? ? -84.97  -148.75 
5  1 TYR A 170 ? ? -133.50 -97.43  
6  1 GLN A 193 ? ? 56.31   19.50   
7  1 ASN A 241 ? ? -141.99 57.90   
8  1 SER A 257 ? ? 59.67   -149.47 
9  1 ALA A 280 ? ? -127.17 -127.10 
10 1 HIS A 281 ? ? 79.56   -26.47  
11 1 LEU A 312 ? ? -106.83 -91.27  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 32  ? CG  ? A LYS 9   CG  
2  1 Y 1 A LYS 32  ? CD  ? A LYS 9   CD  
3  1 Y 1 A LYS 32  ? CE  ? A LYS 9   CE  
4  1 Y 1 A LYS 32  ? NZ  ? A LYS 9   NZ  
5  1 Y 1 A ARG 173 ? CG  ? A ARG 150 CG  
6  1 Y 1 A ARG 173 ? CD  ? A ARG 150 CD  
7  1 Y 1 A ARG 173 ? NE  ? A ARG 150 NE  
8  1 Y 1 A ARG 173 ? CZ  ? A ARG 150 CZ  
9  1 Y 1 A ARG 173 ? NH1 ? A ARG 150 NH1 
10 1 Y 1 A ARG 173 ? NH2 ? A ARG 150 NH2 
11 1 Y 1 A LYS 243 ? CG  ? A LYS 220 CG  
12 1 Y 1 A LYS 243 ? CD  ? A LYS 220 CD  
13 1 Y 1 A LYS 243 ? CE  ? A LYS 220 CE  
14 1 Y 1 A LYS 243 ? NZ  ? A LYS 220 NZ  
15 1 Y 1 A GLN 245 ? CG  ? A GLN 222 CG  
16 1 Y 1 A GLN 245 ? CD  ? A GLN 222 CD  
17 1 Y 1 A GLN 245 ? OE1 ? A GLN 222 OE1 
18 1 Y 1 A GLN 245 ? NE2 ? A GLN 222 NE2 
19 1 Y 1 A GLN 270 ? CG  ? A GLN 247 CG  
20 1 Y 1 A GLN 270 ? CD  ? A GLN 247 CD  
21 1 Y 1 A GLN 270 ? OE1 ? A GLN 247 OE1 
22 1 Y 1 A GLN 270 ? NE2 ? A GLN 247 NE2 
23 1 Y 1 A ASP 313 ? CG  ? A ASP 290 CG  
24 1 Y 1 A ASP 313 ? OD1 ? A ASP 290 OD1 
25 1 Y 1 A ASP 313 ? OD2 ? A ASP 290 OD2 
26 1 Y 1 A VAL 314 ? CG1 ? A VAL 291 CG1 
27 1 Y 1 A VAL 314 ? CG2 ? A VAL 291 CG2 
28 1 Y 1 A LYS 323 ? CG  ? A LYS 300 CG  
29 1 Y 1 A LYS 323 ? CD  ? A LYS 300 CD  
30 1 Y 1 A LYS 323 ? CE  ? A LYS 300 CE  
31 1 Y 1 A LYS 323 ? NZ  ? A LYS 300 NZ  
32 1 Y 1 A ARG 332 ? NE  ? A ARG 309 NE  
33 1 Y 1 A ARG 332 ? CZ  ? A ARG 309 CZ  
34 1 Y 1 A ARG 332 ? NH1 ? A ARG 309 NH1 
35 1 Y 1 A ARG 332 ? NH2 ? A ARG 309 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 24  ? A MET 1   
2  1 Y 1 A GLY 25  ? A GLY 2   
3  1 Y 1 A SER 337 ? A SER 314 
4  1 Y 1 A PRO 338 ? A PRO 315 
5  1 Y 1 A HIS 339 ? A HIS 316 
6  1 Y 1 B GLY 125 ? B GLY 1   
7  1 Y 1 B HIS 126 ? B HIS 2   
8  1 Y 1 B MET 127 ? B MET 3   
9  1 Y 1 B ASN 128 ? B ASN 4   
10 1 Y 1 B TYR 129 ? B TYR 5   
11 1 Y 1 B ASP 130 ? B ASP 6   
12 1 Y 1 B LEU 131 ? B LEU 7   
13 1 Y 1 B LEU 132 ? B LEU 8   
14 1 Y 1 B TYR 133 ? B TYR 9   
15 1 Y 1 B ALA 134 ? B ALA 10  
16 1 Y 1 B ILE 135 ? B ILE 11  
17 1 Y 1 B SER 136 ? B SER 12  
18 1 Y 1 B LYS 137 ? B LYS 13  
19 1 Y 1 B LEU 138 ? B LEU 14  
20 1 Y 1 B GLY 139 ? B GLY 15  
21 1 Y 1 B PRO 140 ? B PRO 16  
22 1 Y 1 B GLY 141 ? B GLY 17  
23 1 Y 1 B GLU 142 ? B GLU 18  
24 1 Y 1 B LYS 143 ? B LYS 19  
25 1 Y 1 B TYR 144 ? B TYR 20  
26 1 Y 1 B GLU 145 ? B GLU 21  
27 1 Y 1 B LEU 146 ? B LEU 22  
28 1 Y 1 B HIS 147 ? B HIS 23  
29 1 Y 1 B ALA 148 ? B ALA 24  
30 1 Y 1 B ALA 149 ? B ALA 25  
31 1 Y 1 B THR 150 ? B THR 26  
32 1 Y 1 B ASP 151 ? B ASP 27  
33 1 Y 1 B THR 152 ? B THR 28  
34 1 Y 1 B GLU 162 ? B GLU 38  
35 1 Y 1 B SER 163 ? B SER 39  
36 1 Y 1 B ASP 164 ? B ASP 40  
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' R01NS091336 1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)'          'United States' R01GM098482 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'PHOSPHATE ION' PO4 
4 'ZINC ION'      ZN  
5 'FE (III) ION'  FE  
6 water           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#