data_6WCW
# 
_entry.id   6WCW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.331 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6WCW         
WWPDB D_1000247762 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6WCW 
_pdbx_database_status.recvd_initial_deposition_date   2020-03-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bhargava, H.K.'  1 0000-0003-4675-9293 
'Byck, J.M.'      2 0000-0003-3703-0986 
'Farrell, D.P.'   3 0000-0001-7024-7998 
'Anishchenko, I.' 4 0000-0003-3645-2044 
'DiMaio, F.'      5 0000-0002-7524-8938 
'Im, Y.J.'        6 0000-0002-3644-3028 
'Hurley, J.H.'    7 0000-0001-5054-5445 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            117 
_citation.language                  ? 
_citation.page_first                17003 
_citation.page_last                 17010 
_citation.title                     'Structural basis for autophagy inhibition by the human Rubicon-Rab7 complex.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.2008030117 
_citation.pdbx_database_id_PubMed   32632011 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bhargava, H.K.'  1  0000-0003-4675-9293 
primary 'Tabata, K.'      2  0000-0001-6776-1689 
primary 'Byck, J.M.'      3  0000-0003-3703-0986 
primary 'Hamasaki, M.'    4  ?                   
primary 'Farrell, D.P.'   5  0000-0001-7024-7998 
primary 'Anishchenko, I.' 6  0000-0003-3645-2044 
primary 'DiMaio, F.'      7  ?                   
primary 'Im, Y.J.'        8  ?                   
primary 'Yoshimori, T.'   9  ?                   
primary 'Hurley, J.H.'    10 0000-0001-5054-5445 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   98.507 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6WCW 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     60.040 
_cell.length_a_esd                 ? 
_cell.length_b                     45.330 
_cell.length_b_esd                 ? 
_cell.length_c                     186.277 
_cell.length_c_esd                 ? 
_cell.volume                       501396.243 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6WCW 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            'C 2y (x,y,-x+z)' 
_symmetry.space_group_name_H-M             'I 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ras-related protein Rab-7a'                                                  20840.699 1 ? Q67L ?           ? 
2 polymer     man 'Run domain Beclin-1-interacting and cysteine-rich domain-containing protein' 29541.436 1 ? ?    'RH domain' ? 
3 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE"                                                   523.180   1 ? ?    ?           ? 
4 non-polymer syn 'MAGNESIUM ION'                                                               24.305    1 ? ?    ?           ? 
5 non-polymer syn 'ZINC ION'                                                                    65.409    4 ? ?    ?           ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Rubicon, Beclin-1 associated RUN domain containing protein,Baron' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SNATSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGLERFQSLGVAFY
RGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKE
AINVEQAFQTIARNALKQETEVEL
;
;SNATSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGLERFQSLGVAFY
RGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKE
AINVEQAFQTIARNALKQETEVEL
;
B ? 
2 'polypeptide(L)' no no 
;SNAQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSKYYVSN
FSKDLLIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVPGHLTEDLHLYSLNDL
TATRKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCEECKACYHKACFKSGSCPRCERL
QARREALARQSLES
;
;SNAQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSKYYVSN
FSKDLLIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVPGHLTEDLHLYSLNDL
TATRKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCEECKACYHKACFKSGSCPRCERL
QARREALARQSLES
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   THR n 
1 5   SER n 
1 6   ARG n 
1 7   LYS n 
1 8   LYS n 
1 9   VAL n 
1 10  LEU n 
1 11  LEU n 
1 12  LYS n 
1 13  VAL n 
1 14  ILE n 
1 15  ILE n 
1 16  LEU n 
1 17  GLY n 
1 18  ASP n 
1 19  SER n 
1 20  GLY n 
1 21  VAL n 
1 22  GLY n 
1 23  LYS n 
1 24  THR n 
1 25  SER n 
1 26  LEU n 
1 27  MET n 
1 28  ASN n 
1 29  GLN n 
1 30  TYR n 
1 31  VAL n 
1 32  ASN n 
1 33  LYS n 
1 34  LYS n 
1 35  PHE n 
1 36  SER n 
1 37  ASN n 
1 38  GLN n 
1 39  TYR n 
1 40  LYS n 
1 41  ALA n 
1 42  THR n 
1 43  ILE n 
1 44  GLY n 
1 45  ALA n 
1 46  ASP n 
1 47  PHE n 
1 48  LEU n 
1 49  THR n 
1 50  LYS n 
1 51  GLU n 
1 52  VAL n 
1 53  MET n 
1 54  VAL n 
1 55  ASP n 
1 56  ASP n 
1 57  ARG n 
1 58  LEU n 
1 59  VAL n 
1 60  THR n 
1 61  MET n 
1 62  GLN n 
1 63  ILE n 
1 64  TRP n 
1 65  ASP n 
1 66  THR n 
1 67  ALA n 
1 68  GLY n 
1 69  LEU n 
1 70  GLU n 
1 71  ARG n 
1 72  PHE n 
1 73  GLN n 
1 74  SER n 
1 75  LEU n 
1 76  GLY n 
1 77  VAL n 
1 78  ALA n 
1 79  PHE n 
1 80  TYR n 
1 81  ARG n 
1 82  GLY n 
1 83  ALA n 
1 84  ASP n 
1 85  CYS n 
1 86  CYS n 
1 87  VAL n 
1 88  LEU n 
1 89  VAL n 
1 90  PHE n 
1 91  ASP n 
1 92  VAL n 
1 93  THR n 
1 94  ALA n 
1 95  PRO n 
1 96  ASN n 
1 97  THR n 
1 98  PHE n 
1 99  LYS n 
1 100 THR n 
1 101 LEU n 
1 102 ASP n 
1 103 SER n 
1 104 TRP n 
1 105 ARG n 
1 106 ASP n 
1 107 GLU n 
1 108 PHE n 
1 109 LEU n 
1 110 ILE n 
1 111 GLN n 
1 112 ALA n 
1 113 SER n 
1 114 PRO n 
1 115 ARG n 
1 116 ASP n 
1 117 PRO n 
1 118 GLU n 
1 119 ASN n 
1 120 PHE n 
1 121 PRO n 
1 122 PHE n 
1 123 VAL n 
1 124 VAL n 
1 125 LEU n 
1 126 GLY n 
1 127 ASN n 
1 128 LYS n 
1 129 ILE n 
1 130 ASP n 
1 131 LEU n 
1 132 GLU n 
1 133 ASN n 
1 134 ARG n 
1 135 GLN n 
1 136 VAL n 
1 137 ALA n 
1 138 THR n 
1 139 LYS n 
1 140 ARG n 
1 141 ALA n 
1 142 GLN n 
1 143 ALA n 
1 144 TRP n 
1 145 CYS n 
1 146 TYR n 
1 147 SER n 
1 148 LYS n 
1 149 ASN n 
1 150 ASN n 
1 151 ILE n 
1 152 PRO n 
1 153 TYR n 
1 154 PHE n 
1 155 GLU n 
1 156 THR n 
1 157 SER n 
1 158 ALA n 
1 159 LYS n 
1 160 GLU n 
1 161 ALA n 
1 162 ILE n 
1 163 ASN n 
1 164 VAL n 
1 165 GLU n 
1 166 GLN n 
1 167 ALA n 
1 168 PHE n 
1 169 GLN n 
1 170 THR n 
1 171 ILE n 
1 172 ALA n 
1 173 ARG n 
1 174 ASN n 
1 175 ALA n 
1 176 LEU n 
1 177 LYS n 
1 178 GLN n 
1 179 GLU n 
1 180 THR n 
1 181 GLU n 
1 182 VAL n 
1 183 GLU n 
1 184 LEU n 
2 1   SER n 
2 2   ASN n 
2 3   ALA n 
2 4   GLN n 
2 5   ILE n 
2 6   ILE n 
2 7   PHE n 
2 8   ASN n 
2 9   VAL n 
2 10  HIS n 
2 11  PRO n 
2 12  ALA n 
2 13  PRO n 
2 14  THR n 
2 15  ARG n 
2 16  LYS n 
2 17  ILE n 
2 18  ALA n 
2 19  VAL n 
2 20  ALA n 
2 21  LYS n 
2 22  GLN n 
2 23  ASN n 
2 24  TYR n 
2 25  ARG n 
2 26  CYS n 
2 27  ALA n 
2 28  GLY n 
2 29  CYS n 
2 30  GLY n 
2 31  ILE n 
2 32  ARG n 
2 33  THR n 
2 34  ASP n 
2 35  PRO n 
2 36  ASP n 
2 37  TYR n 
2 38  ILE n 
2 39  LYS n 
2 40  ARG n 
2 41  LEU n 
2 42  ARG n 
2 43  TYR n 
2 44  CYS n 
2 45  GLU n 
2 46  TYR n 
2 47  LEU n 
2 48  GLY n 
2 49  LYS n 
2 50  TYR n 
2 51  PHE n 
2 52  CYS n 
2 53  GLN n 
2 54  CYS n 
2 55  CYS n 
2 56  HIS n 
2 57  GLU n 
2 58  ASN n 
2 59  ALA n 
2 60  GLN n 
2 61  MET n 
2 62  ALA n 
2 63  ILE n 
2 64  PRO n 
2 65  SER n 
2 66  ARG n 
2 67  VAL n 
2 68  LEU n 
2 69  ARG n 
2 70  LYS n 
2 71  TRP n 
2 72  ASP n 
2 73  PHE n 
2 74  SER n 
2 75  LYS n 
2 76  TYR n 
2 77  TYR n 
2 78  VAL n 
2 79  SER n 
2 80  ASN n 
2 81  PHE n 
2 82  SER n 
2 83  LYS n 
2 84  ASP n 
2 85  LEU n 
2 86  LEU n 
2 87  ILE n 
2 88  LYS n 
2 89  ILE n 
2 90  TRP n 
2 91  ASN n 
2 92  ASP n 
2 93  PRO n 
2 94  LEU n 
2 95  PHE n 
2 96  ASN n 
2 97  VAL n 
2 98  GLN n 
2 99  ASP n 
2 100 ILE n 
2 101 ASN n 
2 102 SER n 
2 103 ALA n 
2 104 LEU n 
2 105 TYR n 
2 106 ARG n 
2 107 LYS n 
2 108 VAL n 
2 109 LYS n 
2 110 LEU n 
2 111 LEU n 
2 112 ASN n 
2 113 GLN n 
2 114 VAL n 
2 115 ARG n 
2 116 LEU n 
2 117 LEU n 
2 118 ARG n 
2 119 VAL n 
2 120 GLN n 
2 121 LEU n 
2 122 CYS n 
2 123 HIS n 
2 124 MET n 
2 125 LYS n 
2 126 ASN n 
2 127 MET n 
2 128 PHE n 
2 129 LYS n 
2 130 THR n 
2 131 CYS n 
2 132 ARG n 
2 133 LEU n 
2 134 ALA n 
2 135 LYS n 
2 136 GLU n 
2 137 LEU n 
2 138 LEU n 
2 139 ASP n 
2 140 SER n 
2 141 PHE n 
2 142 ASP n 
2 143 THR n 
2 144 VAL n 
2 145 PRO n 
2 146 GLY n 
2 147 HIS n 
2 148 LEU n 
2 149 THR n 
2 150 GLU n 
2 151 ASP n 
2 152 LEU n 
2 153 HIS n 
2 154 LEU n 
2 155 TYR n 
2 156 SER n 
2 157 LEU n 
2 158 ASN n 
2 159 ASP n 
2 160 LEU n 
2 161 THR n 
2 162 ALA n 
2 163 THR n 
2 164 ARG n 
2 165 LYS n 
2 166 GLY n 
2 167 GLU n 
2 168 LEU n 
2 169 GLY n 
2 170 PRO n 
2 171 ARG n 
2 172 LEU n 
2 173 ALA n 
2 174 GLU n 
2 175 LEU n 
2 176 THR n 
2 177 ARG n 
2 178 ALA n 
2 179 GLY n 
2 180 ALA n 
2 181 THR n 
2 182 HIS n 
2 183 VAL n 
2 184 GLU n 
2 185 ARG n 
2 186 CYS n 
2 187 MET n 
2 188 LEU n 
2 189 CYS n 
2 190 GLN n 
2 191 ALA n 
2 192 LYS n 
2 193 GLY n 
2 194 PHE n 
2 195 ILE n 
2 196 CYS n 
2 197 GLU n 
2 198 PHE n 
2 199 CYS n 
2 200 GLN n 
2 201 ASN n 
2 202 GLU n 
2 203 ASP n 
2 204 ASP n 
2 205 ILE n 
2 206 ILE n 
2 207 PHE n 
2 208 PRO n 
2 209 PHE n 
2 210 GLU n 
2 211 LEU n 
2 212 HIS n 
2 213 LYS n 
2 214 CYS n 
2 215 ARG n 
2 216 THR n 
2 217 CYS n 
2 218 GLU n 
2 219 GLU n 
2 220 CYS n 
2 221 LYS n 
2 222 ALA n 
2 223 CYS n 
2 224 TYR n 
2 225 HIS n 
2 226 LYS n 
2 227 ALA n 
2 228 CYS n 
2 229 PHE n 
2 230 LYS n 
2 231 SER n 
2 232 GLY n 
2 233 SER n 
2 234 CYS n 
2 235 PRO n 
2 236 ARG n 
2 237 CYS n 
2 238 GLU n 
2 239 ARG n 
2 240 LEU n 
2 241 GLN n 
2 242 ALA n 
2 243 ARG n 
2 244 ARG n 
2 245 GLU n 
2 246 ALA n 
2 247 LEU n 
2 248 ALA n 
2 249 ARG n 
2 250 GLN n 
2 251 SER n 
2 252 LEU n 
2 253 GLU n 
2 254 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 184 Human ? 'RAB7A, RAB7'     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21' 511693 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 254 Human ? 'RUBCN, KIAA0226' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21' 511693 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RAB7A_HUMAN P51149 ? 1 
;TSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQERFQSLGVAFYRGA
DCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAIN
VEQAFQTIARNALKQETEVEL
;
2   
2 UNP RUBIC_HUMAN Q92622 ? 2 
;QIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSKYYVSNFSK
DLLIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVPGHLTEDLHLYSLNDLTAT
RKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCEECKACYHKACFKSGSCPRCERLQAR
REALARQSLES
;
699 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6WCW B 4 ? 184 ? P51149 2   ? 182 ? 2   182 
2 2 6WCW A 4 ? 254 ? Q92622 699 ? 949 ? 699 949 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6WCW SER B 1  ? UNP P51149 ?   ?  'expression tag'      -1  1 
1 6WCW ASN B 2  ? UNP P51149 ?   ?  'expression tag'      0   2 
1 6WCW ALA B 3  ? UNP P51149 ?   ?  'expression tag'      1   3 
1 6WCW LEU B 69 ? UNP P51149 GLN 67 'engineered mutation' 67  4 
2 6WCW SER A 1  ? UNP Q92622 ?   ?  'expression tag'      696 5 
2 6WCW ASN A 2  ? UNP Q92622 ?   ?  'expression tag'      697 6 
2 6WCW ALA A 3  ? UNP Q92622 ?   ?  'expression tag'      698 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                  ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6WCW 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.54 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.51 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;6% (w/v) PEG 8000,
100mM Tris-HCl pH 7.4,
15mM TCEP
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-04-25 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.283 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.283 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            50.62 
_reflns.entry_id                         6WCW 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.80 
_reflns.d_resolution_low                 92.11 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       12498 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.986 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1234 
_reflns_shell.percent_possible_all        98.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.715 
_reflns_shell.pdbx_CC_star                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               58.14 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6WCW 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.80 
_refine.ls_d_res_low                             54.22 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12395 
_refine.ls_number_reflns_R_free                  591 
_refine.ls_number_reflns_R_work                  11804 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.91 
_refine.ls_percent_reflns_R_free                 4.77 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2024 
_refine.ls_R_factor_R_free                       0.2584 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1995 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1YHN 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.1988 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3844 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        54.22 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3447 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        3447 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0090  ? 3512 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.0541  ? 4748 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0560  ? 521  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0055  ? 607  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 24.5853 ? 1320 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.80 3.08  . . 130 2923 98.74 . . . 0.3922 . 0.2824 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.08 3.53  . . 169 2898 98.55 . . . 0.3102 . 0.2443 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.53 4.44  . . 137 2958 99.36 . . . 0.2124 . 0.1749 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.44 54.22 . . 155 3025 98.97 . . . 0.2353 . 0.1735 . . . . . . . . . . . 
# 
_struct.entry_id                     6WCW 
_struct.title                        'Structure of human Rubicon RH domain in complex with GTP-bound Rab7' 
_struct.pdbx_descriptor              
'Ras-related protein Rab-7a, Run domain Beclin-1-interacting and cysteine-rich domain-containing protein' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6WCW 
_struct_keywords.text            'autophagy, rab, gtpase, aging, zinc finger, g protein, METAL BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 22  ? LYS A 33  ? GLY B 20  LYS B 31  1 ? 12 
HELX_P HELX_P2  AA2 VAL A 77  ? ARG A 81  ? VAL B 75  ARG B 79  5 ? 5  
HELX_P HELX_P3  AA3 ALA A 94  ? THR A 100 ? ALA B 92  THR B 98  1 ? 7  
HELX_P HELX_P4  AA4 THR A 100 ? SER A 113 ? THR B 98  SER B 111 1 ? 14 
HELX_P HELX_P5  AA5 ASP A 116 ? PHE A 120 ? ASP B 114 PHE B 118 5 ? 5  
HELX_P HELX_P6  AA6 ALA A 137 ? LYS A 148 ? ALA B 135 LYS B 146 1 ? 12 
HELX_P HELX_P7  AA7 ASN A 163 ? THR A 180 ? ASN B 161 THR B 178 1 ? 18 
HELX_P HELX_P8  AA8 ALA B 12  ? GLN B 22  ? ALA A 707 GLN A 717 1 ? 11 
HELX_P HELX_P9  AA9 ASP B 34  ? LEU B 41  ? ASP A 729 LEU A 736 5 ? 8  
HELX_P HELX_P10 AB1 ILE B 63  ? ARG B 69  ? ILE A 758 ARG A 764 1 ? 7  
HELX_P HELX_P11 AB2 SER B 79  ? ILE B 89  ? SER A 774 ILE A 784 1 ? 11 
HELX_P HELX_P12 AB3 VAL B 97  ? ASN B 101 ? VAL A 792 ASN A 796 1 ? 5  
HELX_P HELX_P13 AB4 ALA B 103 ? VAL B 108 ? ALA A 798 VAL A 803 1 ? 6  
HELX_P HELX_P14 AB5 VAL B 108 ? LYS B 129 ? VAL A 803 LYS A 824 1 ? 22 
HELX_P HELX_P15 AB6 ALA B 134 ? PHE B 141 ? ALA A 829 PHE A 836 1 ? 8  
HELX_P HELX_P16 AB7 PRO B 145 ? ASP B 151 ? PRO A 840 ASP A 846 1 ? 7  
HELX_P HELX_P17 AB8 SER B 156 ? LYS B 165 ? SER A 851 LYS A 860 1 ? 10 
HELX_P HELX_P18 AB9 GLU B 167 ? CYS B 186 ? GLU A 862 CYS A 881 1 ? 20 
HELX_P HELX_P19 AC1 CYS B 189 ? GLY B 193 ? CYS A 884 GLY A 888 5 ? 5  
HELX_P HELX_P20 AC2 CYS B 234 ? ALA B 248 ? CYS A 929 ALA A 943 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A THR 24  OG1 ? ? ? 1_555 D MG . MG ? ? B THR 22   B MG 1402 1_555 ? ? ? ? ? ? ? 1.836 ? ? 
metalc2  metalc ? ? A THR 42  OG1 ? ? ? 1_555 D MG . MG ? ? B THR 40   B MG 1402 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
metalc3  metalc ? ? C GTP .   O1G ? ? ? 1_555 D MG . MG ? ? B GTP 1401 B MG 1402 1_555 ? ? ? ? ? ? ? 1.859 ? ? 
metalc4  metalc ? ? C GTP .   O2B ? ? ? 1_555 D MG . MG ? ? B GTP 1401 B MG 1402 1_555 ? ? ? ? ? ? ? 2.257 ? ? 
metalc5  metalc ? ? B CYS 26  SG  ? ? ? 1_555 E ZN . ZN ? ? A CYS 721  A ZN 1001 1_555 ? ? ? ? ? ? ? 1.984 ? ? 
metalc6  metalc ? ? B CYS 29  SG  ? ? ? 1_555 E ZN . ZN ? ? A CYS 724  A ZN 1001 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
metalc7  metalc ? ? B CYS 52  SG  ? ? ? 1_555 E ZN . ZN ? ? A CYS 747  A ZN 1001 1_555 ? ? ? ? ? ? ? 2.011 ? ? 
metalc8  metalc ? ? B CYS 55  SG  ? ? ? 1_555 E ZN . ZN ? ? A CYS 750  A ZN 1001 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc9  metalc ? ? B CYS 131 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 826  A ZN 1002 1_555 ? ? ? ? ? ? ? 2.116 ? ? 
metalc10 metalc ? ? B HIS 182 NE2 ? ? ? 1_555 F ZN . ZN ? ? A HIS 877  A ZN 1002 1_555 ? ? ? ? ? ? ? 1.832 ? ? 
metalc11 metalc ? ? B CYS 186 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 881  A ZN 1002 1_555 ? ? ? ? ? ? ? 2.279 ? ? 
metalc12 metalc ? ? B CYS 189 SG  ? ? ? 1_555 F ZN . ZN ? ? A CYS 884  A ZN 1002 1_555 ? ? ? ? ? ? ? 2.146 ? ? 
metalc13 metalc ? ? B CYS 196 SG  ? ? ? 1_555 G ZN . ZN ? ? A CYS 891  A ZN 1003 1_555 ? ? ? ? ? ? ? 2.113 ? ? 
metalc14 metalc ? ? B CYS 199 SG  ? ? ? 1_555 G ZN . ZN ? ? A CYS 894  A ZN 1003 1_555 ? ? ? ? ? ? ? 2.228 ? ? 
metalc15 metalc ? ? B CYS 217 SG  ? ? ? 1_555 H ZN . ZN ? ? A CYS 912  A ZN 1004 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc16 metalc ? ? B CYS 220 SG  ? ? ? 1_555 H ZN . ZN ? ? A CYS 915  A ZN 1004 1_555 ? ? ? ? ? ? ? 2.341 ? ? 
metalc17 metalc ? ? B HIS 225 ND1 ? ? ? 1_555 G ZN . ZN ? ? A HIS 920  A ZN 1003 1_555 ? ? ? ? ? ? ? 1.853 ? ? 
metalc18 metalc ? ? B CYS 228 SG  ? ? ? 1_555 G ZN . ZN ? ? A CYS 923  A ZN 1003 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
metalc19 metalc ? ? B CYS 234 SG  ? ? ? 1_555 H ZN . ZN ? ? A CYS 929  A ZN 1004 1_555 ? ? ? ? ? ? ? 2.436 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASP A 46  ? VAL A 54  ? ASP B 44  VAL B 52  
AA1 2 ARG A 57  ? ASP A 65  ? ARG B 55  ASP B 63  
AA1 3 LEU A 10  ? LEU A 16  ? LEU B 8   LEU B 14  
AA1 4 CYS A 85  ? ASP A 91  ? CYS B 83  ASP B 89  
AA1 5 PHE A 122 ? ASN A 127 ? PHE B 120 ASN B 125 
AA1 6 TYR A 153 ? THR A 156 ? TYR B 151 THR B 154 
AA2 1 ARG B 42  ? TYR B 43  ? ARG A 737 TYR A 738 
AA2 2 TYR B 50  ? PHE B 51  ? TYR A 745 PHE A 746 
AA3 1 ALA B 59  ? MET B 61  ? ALA A 754 MET A 756 
AA3 2 TYR B 76  ? VAL B 78  ? TYR A 771 VAL A 773 
AA4 1 PHE B 95  ? ASN B 96  ? PHE A 790 ASN A 791 
AA4 2 LEU B 154 ? TYR B 155 ? LEU A 849 TYR A 850 
AA5 1 CYS B 214 ? THR B 216 ? CYS A 909 THR A 911 
AA5 2 CYS B 223 ? HIS B 225 ? CYS A 918 HIS A 920 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 50  ? N LYS B 48  O MET A 61  ? O MET B 59  
AA1 2 3 O TRP A 64  ? O TRP B 62  N ILE A 15  ? N ILE B 13  
AA1 3 4 N LEU A 16  ? N LEU B 14  O VAL A 87  ? O VAL B 85  
AA1 4 5 N PHE A 90  ? N PHE B 88  O ASN A 127 ? O ASN B 125 
AA1 5 6 N GLY A 126 ? N GLY B 124 O PHE A 154 ? O PHE B 152 
AA2 1 2 N ARG B 42  ? N ARG A 737 O PHE B 51  ? O PHE A 746 
AA3 1 2 N ALA B 59  ? N ALA A 754 O VAL B 78  ? O VAL A 773 
AA4 1 2 N PHE B 95  ? N PHE A 790 O TYR B 155 ? O TYR A 850 
AA5 1 2 N ARG B 215 ? N ARG A 910 O TYR B 224 ? O TYR A 919 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software B GTP 1401 ? 22 'binding site for residue GTP B 1401' 
AC2 Software B MG  1402 ? 6  'binding site for residue MG B 1402'  
AC3 Software A ZN  1001 ? 4  'binding site for residue ZN A 1001'  
AC4 Software A ZN  1002 ? 4  'binding site for residue ZN A 1002'  
AC5 Software A ZN  1003 ? 4  'binding site for residue ZN A 1003'  
AC6 Software A ZN  1004 ? 4  'binding site for residue ZN A 1004'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 SER A 19  ? SER B 17   . ? 1_555 ? 
2  AC1 22 GLY A 20  ? GLY B 18   . ? 1_555 ? 
3  AC1 22 VAL A 21  ? VAL B 19   . ? 1_555 ? 
4  AC1 22 GLY A 22  ? GLY B 20   . ? 1_555 ? 
5  AC1 22 LYS A 23  ? LYS B 21   . ? 1_555 ? 
6  AC1 22 THR A 24  ? THR B 22   . ? 1_555 ? 
7  AC1 22 SER A 25  ? SER B 23   . ? 1_555 ? 
8  AC1 22 PHE A 35  ? PHE B 33   . ? 1_555 ? 
9  AC1 22 SER A 36  ? SER B 34   . ? 1_555 ? 
10 AC1 22 ASN A 37  ? ASN B 35   . ? 1_555 ? 
11 AC1 22 TYR A 39  ? TYR B 37   . ? 1_555 ? 
12 AC1 22 THR A 42  ? THR B 40   . ? 1_555 ? 
13 AC1 22 THR A 66  ? THR B 64   . ? 1_555 ? 
14 AC1 22 GLY A 68  ? GLY B 66   . ? 1_555 ? 
15 AC1 22 ASN A 127 ? ASN B 125  . ? 1_555 ? 
16 AC1 22 LYS A 128 ? LYS B 126  . ? 1_555 ? 
17 AC1 22 ASP A 130 ? ASP B 128  . ? 1_555 ? 
18 AC1 22 LEU A 131 ? LEU B 129  . ? 1_555 ? 
19 AC1 22 SER A 157 ? SER B 155  . ? 1_555 ? 
20 AC1 22 ALA A 158 ? ALA B 156  . ? 1_555 ? 
21 AC1 22 LYS A 159 ? LYS B 157  . ? 1_555 ? 
22 AC1 22 MG  D .   ? MG  B 1402 . ? 1_555 ? 
23 AC2 6  LYS A 23  ? LYS B 21   . ? 1_555 ? 
24 AC2 6  THR A 24  ? THR B 22   . ? 1_555 ? 
25 AC2 6  THR A 42  ? THR B 40   . ? 1_555 ? 
26 AC2 6  ASP A 65  ? ASP B 63   . ? 1_555 ? 
27 AC2 6  THR A 66  ? THR B 64   . ? 1_555 ? 
28 AC2 6  GTP C .   ? GTP B 1401 . ? 1_555 ? 
29 AC3 4  CYS B 26  ? CYS A 721  . ? 1_555 ? 
30 AC3 4  CYS B 29  ? CYS A 724  . ? 1_555 ? 
31 AC3 4  CYS B 52  ? CYS A 747  . ? 1_555 ? 
32 AC3 4  CYS B 55  ? CYS A 750  . ? 1_555 ? 
33 AC4 4  CYS B 131 ? CYS A 826  . ? 1_555 ? 
34 AC4 4  HIS B 182 ? HIS A 877  . ? 1_555 ? 
35 AC4 4  CYS B 186 ? CYS A 881  . ? 1_555 ? 
36 AC4 4  CYS B 189 ? CYS A 884  . ? 1_555 ? 
37 AC5 4  CYS B 196 ? CYS A 891  . ? 1_555 ? 
38 AC5 4  CYS B 199 ? CYS A 894  . ? 1_555 ? 
39 AC5 4  HIS B 225 ? HIS A 920  . ? 1_555 ? 
40 AC5 4  CYS B 228 ? CYS A 923  . ? 1_555 ? 
41 AC6 4  CYS B 217 ? CYS A 912  . ? 1_555 ? 
42 AC6 4  CYS B 220 ? CYS A 915  . ? 1_555 ? 
43 AC6 4  CYS B 234 ? CYS A 929  . ? 1_555 ? 
44 AC6 4  CYS B 237 ? CYS A 932  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6WCW 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.016656 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002491 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022060 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005428 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C  ? ? 3.54356  2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
MG ? ? 9.41153  2.53737 ? ? 2.59044  63.03566 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N  ? ? 4.01032  2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O  ? ? 7.96527  ?       ? ? 9.05267  ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
P  ? ? 9.51135  5.44231 ? ? 1.42069  35.72801 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S  ? ? 9.55732  6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
ZN ? ? 24.64596 5.25405 ? ? 2.14387  29.76375 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . VAL A 1 9   ? 4.22800   44.97600 9.06800   1.000 60.60414  ? 7    VAL B N     1 
ATOM   2    C  CA    . VAL A 1 9   ? 4.01300   43.52500 9.05800   1.000 60.37987  ? 7    VAL B CA    1 
ATOM   3    C  C     . VAL A 1 9   ? 4.59600   42.82500 10.30400  1.000 61.81998  ? 7    VAL B C     1 
ATOM   4    O  O     . VAL A 1 9   ? 5.77300   42.99800 10.62700  1.000 60.74740  ? 7    VAL B O     1 
ATOM   5    C  CB    . VAL A 1 9   ? 4.60900   42.90500 7.78500   1.000 55.60331  ? 7    VAL B CB    1 
ATOM   6    C  CG1   . VAL A 1 9   ? 4.01000   41.52300 7.53000   1.000 46.63575  ? 7    VAL B CG1   1 
ATOM   7    C  CG2   . VAL A 1 9   ? 4.43800   43.85100 6.58900   1.000 58.80389  ? 7    VAL B CG2   1 
ATOM   8    N  N     . LEU A 1 10  ? 3.78300   42.00800 10.98100  1.000 66.73697  ? 8    LEU B N     1 
ATOM   9    C  CA    . LEU A 1 10  ? 4.20000   41.29700 12.19200  1.000 65.34967  ? 8    LEU B CA    1 
ATOM   10   C  C     . LEU A 1 10  ? 3.78100   39.83100 12.12400  1.000 60.43394  ? 8    LEU B C     1 
ATOM   11   O  O     . LEU A 1 10  ? 2.59100   39.52900 11.99100  1.000 55.39396  ? 8    LEU B O     1 
ATOM   12   C  CB    . LEU A 1 10  ? 3.60800   41.95300 13.44500  1.000 66.65316  ? 8    LEU B CB    1 
ATOM   13   C  CG    . LEU A 1 10  ? 3.91400   41.28800 14.79800  1.000 64.05937  ? 8    LEU B CG    1 
ATOM   14   C  CD1   . LEU A 1 10  ? 4.22800   42.34300 15.84300  1.000 66.59283  ? 8    LEU B CD1   1 
ATOM   15   C  CD2   . LEU A 1 10  ? 2.77600   40.38900 15.28000  1.000 58.16489  ? 8    LEU B CD2   1 
ATOM   16   N  N     . LEU A 1 11  ? 4.75000   38.92600 12.26900  1.000 54.32966  ? 9    LEU B N     1 
ATOM   17   C  CA    . LEU A 1 11  ? 4.51000   37.48800 12.24100  1.000 49.30329  ? 9    LEU B CA    1 
ATOM   18   C  C     . LEU A 1 11  ? 4.48700   36.90800 13.64500  1.000 45.07430  ? 9    LEU B C     1 
ATOM   19   O  O     . LEU A 1 11  ? 5.31600   37.26700 14.48400  1.000 50.26472  ? 9    LEU B O     1 
ATOM   20   C  CB    . LEU A 1 11  ? 5.59000   36.77400 11.43500  1.000 42.44539  ? 9    LEU B CB    1 
ATOM   21   C  CG    . LEU A 1 11  ? 5.79200   37.40700 10.08200  1.000 39.11813  ? 9    LEU B CG    1 
ATOM   22   C  CD1   . LEU A 1 11  ? 6.77000   36.56600 9.28900   1.000 40.75556  ? 9    LEU B CD1   1 
ATOM   23   C  CD2   . LEU A 1 11  ? 4.44400   37.50900 9.39700   1.000 42.62770  ? 9    LEU B CD2   1 
ATOM   24   N  N     . LYS A 1 12  ? 3.56200   35.98300 13.88900  1.000 38.69657  ? 10   LYS B N     1 
ATOM   25   C  CA    . LYS A 1 12  ? 3.50600   35.24800 15.14800  1.000 39.32009  ? 10   LYS B CA    1 
ATOM   26   C  C     . LYS A 1 12  ? 3.92400   33.80500 14.88900  1.000 41.10165  ? 10   LYS B C     1 
ATOM   27   O  O     . LYS A 1 12  ? 3.29600   33.10700 14.08200  1.000 40.15742  ? 10   LYS B O     1 
ATOM   28   C  CB    . LYS A 1 12  ? 2.11100   35.31400 15.77600  1.000 38.48868  ? 10   LYS B CB    1 
ATOM   29   C  CG    . LYS A 1 12  ? 1.96400   34.53900 17.09500  1.000 36.87225  ? 10   LYS B CG    1 
ATOM   30   C  CD    . LYS A 1 12  ? 0.51500   34.47600 17.56500  1.000 35.11113  ? 10   LYS B CD    1 
ATOM   31   C  CE    . LYS A 1 12  ? 0.14600   35.68200 18.42200  1.000 38.76142  ? 10   LYS B CE    1 
ATOM   32   N  NZ    . LYS A 1 12  ? -1.27800  35.67100 18.92400  1.000 40.46210  ? 10   LYS B NZ    1 
ATOM   33   N  N     . VAL A 1 13  ? 4.98400   33.36800 15.57700  1.000 30.03251  ? 11   VAL B N     1 
ATOM   34   C  CA    . VAL A 1 13  ? 5.51800   32.01300 15.47900  1.000 26.79986  ? 11   VAL B CA    1 
ATOM   35   C  C     . VAL A 1 13  ? 5.38200   31.33100 16.84200  1.000 27.05617  ? 11   VAL B C     1 
ATOM   36   O  O     . VAL A 1 13  ? 5.63600   31.94900 17.88300  1.000 23.53652  ? 11   VAL B O     1 
ATOM   37   C  CB    . VAL A 1 13  ? 6.99600   32.03800 15.02300  1.000 26.46381  ? 11   VAL B CB    1 
ATOM   38   C  CG1   . VAL A 1 13  ? 7.56000   30.62300 14.91900  1.000 22.53943  ? 11   VAL B CG1   1 
ATOM   39   C  CG2   . VAL A 1 13  ? 7.13800   32.84200 13.73300  1.000 23.78578  ? 11   VAL B CG2   1 
ATOM   40   N  N     . ILE A 1 14  ? 5.01100   30.05000 16.83500  1.000 32.97320  ? 12   ILE B N     1 
ATOM   41   C  CA    . ILE A 1 14  ? 4.76300   29.28300 18.05200  1.000 32.37157  ? 12   ILE B CA    1 
ATOM   42   C  C     . ILE A 1 14  ? 5.60300   28.01000 18.03800  1.000 35.10682  ? 12   ILE B C     1 
ATOM   43   O  O     . ILE A 1 14  ? 5.47500   27.18800 17.12100  1.000 39.20902  ? 12   ILE B O     1 
ATOM   44   C  CB    . ILE A 1 14  ? 3.27500   28.93200 18.19200  1.000 34.79344  ? 12   ILE B CB    1 
ATOM   45   C  CG1   . ILE A 1 14  ? 2.50300   30.18000 18.56800  1.000 35.36297  ? 12   ILE B CG1   1 
ATOM   46   C  CG2   . ILE A 1 14  ? 3.07900   27.86600 19.23700  1.000 34.18230  ? 12   ILE B CG2   1 
ATOM   47   C  CD1   . ILE A 1 14  ? 1.13200   30.06200 18.23000  1.000 39.66687  ? 12   ILE B CD1   1 
ATOM   48   N  N     . ILE A 1 15  ? 6.41600   27.82100 19.08100  1.000 39.78418  ? 13   ILE B N     1 
ATOM   49   C  CA    . ILE A 1 15  ? 7.34400   26.69600 19.19400  1.000 41.71890  ? 13   ILE B CA    1 
ATOM   50   C  C     . ILE A 1 15  ? 6.77200   25.67500 20.16900  1.000 40.20029  ? 13   ILE B C     1 
ATOM   51   O  O     . ILE A 1 15  ? 6.59900   25.97100 21.35400  1.000 39.53521  ? 13   ILE B O     1 
ATOM   52   C  CB    . ILE A 1 15  ? 8.73500   27.15800 19.65900  1.000 41.98406  ? 13   ILE B CB    1 
ATOM   53   C  CG1   . ILE A 1 15  ? 9.18000   28.36600 18.85100  1.000 40.24537  ? 13   ILE B CG1   1 
ATOM   54   C  CG2   . ILE A 1 15  ? 9.76300   26.00800 19.54800  1.000 38.76394  ? 13   ILE B CG2   1 
ATOM   55   C  CD1   . ILE A 1 15  ? 10.61200  28.58100 18.92800  1.000 45.90331  ? 13   ILE B CD1   1 
ATOM   56   N  N     . LEU A 1 16  ? 6.53400   24.46300 19.68100  1.000 34.57555  ? 14   LEU B N     1 
ATOM   57   C  CA    . LEU A 1 16  ? 5.96600   23.35900 20.43700  1.000 37.85213  ? 14   LEU B CA    1 
ATOM   58   C  C     . LEU A 1 16  ? 6.96300   22.21000 20.47600  1.000 43.64080  ? 14   LEU B C     1 
ATOM   59   O  O     . LEU A 1 16  ? 7.95500   22.19000 19.74500  1.000 45.39805  ? 14   LEU B O     1 
ATOM   60   C  CB    . LEU A 1 16  ? 4.64600   22.87500 19.81300  1.000 43.37772  ? 14   LEU B CB    1 
ATOM   61   C  CG    . LEU A 1 16  ? 3.47900   23.85900 19.64500  1.000 40.39808  ? 14   LEU B CG    1 
ATOM   62   C  CD1   . LEU A 1 16  ? 2.38700   23.26200 18.77700  1.000 40.85605  ? 14   LEU B CD1   1 
ATOM   63   C  CD2   . LEU A 1 16  ? 2.91400   24.27200 20.98400  1.000 26.96079  ? 14   LEU B CD2   1 
ATOM   64   N  N     . GLY A 1 17  ? 6.69000   21.23500 21.33000  1.000 52.29070  ? 15   GLY B N     1 
ATOM   65   C  CA    . GLY A 1 17  ? 7.48400   20.02900 21.41700  1.000 52.08969  ? 15   GLY B CA    1 
ATOM   66   C  C     . GLY A 1 17  ? 7.77200   19.64100 22.85700  1.000 52.29900  ? 15   GLY B C     1 
ATOM   67   O  O     . GLY A 1 17  ? 7.70200   20.46000 23.78200  1.000 48.87505  ? 15   GLY B O     1 
ATOM   68   N  N     . ASP A 1 18  ? 8.13600   18.37200 23.04300  1.000 58.85662  ? 16   ASP B N     1 
ATOM   69   C  CA    . ASP A 1 18  ? 8.27900   17.77100 24.36500  1.000 60.86461  ? 16   ASP B CA    1 
ATOM   70   C  C     . ASP A 1 18  ? 9.31800   18.51900 25.20400  1.000 54.92614  ? 16   ASP B C     1 
ATOM   71   O  O     . ASP A 1 18  ? 10.16100  19.25700 24.69200  1.000 53.06436  ? 16   ASP B O     1 
ATOM   72   C  CB    . ASP A 1 18  ? 8.66100   16.29200 24.23300  1.000 66.18115  ? 16   ASP B CB    1 
ATOM   73   C  CG    . ASP A 1 18  ? 7.44200   15.37100 24.07400  1.000 70.39395  ? 16   ASP B CG    1 
ATOM   74   O  OD1   . ASP A 1 18  ? 6.28600   15.84400 24.22400  1.000 69.88325  ? 16   ASP B OD1   1 
ATOM   75   O  OD2   . ASP A 1 18  ? 7.65100   14.16400 23.80100  1.000 70.73328  ? 16   ASP B OD2   1 
ATOM   76   N  N     . SER A 1 19  ? 9.24900   18.32500 26.51700  1.000 47.83211  ? 17   SER B N     1 
ATOM   77   C  CA    . SER A 1 19  ? 10.13000  19.07400 27.39700  1.000 51.16109  ? 17   SER B CA    1 
ATOM   78   C  C     . SER A 1 19  ? 11.57100  18.62800 27.19000  1.000 55.57756  ? 17   SER B C     1 
ATOM   79   O  O     . SER A 1 19  ? 11.84900  17.44300 26.97800  1.000 55.07627  ? 17   SER B O     1 
ATOM   80   C  CB    . SER A 1 19  ? 9.72300   18.89800 28.86000  1.000 47.73919  ? 17   SER B CB    1 
ATOM   81   O  OG    . SER A 1 19  ? 10.83400  19.03300 29.72900  1.000 46.54011  ? 17   SER B OG    1 
ATOM   82   N  N     . GLY A 1 20  ? 12.48200  19.59500 27.22000  1.000 69.02795  ? 18   GLY B N     1 
ATOM   83   C  CA    . GLY A 1 20  ? 13.89300  19.30600 27.12400  1.000 70.84141  ? 18   GLY B CA    1 
ATOM   84   C  C     . GLY A 1 20  ? 14.41000  18.98300 25.74200  1.000 69.66587  ? 18   GLY B C     1 
ATOM   85   O  O     . GLY A 1 20  ? 15.55900  18.53900 25.61900  1.000 70.74328  ? 18   GLY B O     1 
ATOM   86   N  N     . VAL A 1 21  ? 13.61200  19.19900 24.69200  1.000 49.01114  ? 19   VAL B N     1 
ATOM   87   C  CA    . VAL A 1 21  ? 14.11800  18.98000 23.33900  1.000 46.17945  ? 19   VAL B CA    1 
ATOM   88   C  C     . VAL A 1 21  ? 14.94900  20.15300 22.81800  1.000 43.17229  ? 19   VAL B C     1 
ATOM   89   O  O     . VAL A 1 21  ? 15.67200  19.99200 21.82300  1.000 37.54707  ? 19   VAL B O     1 
ATOM   90   C  CB    . VAL A 1 21  ? 12.96800  18.65700 22.35600  1.000 41.75638  ? 19   VAL B CB    1 
ATOM   91   C  CG1   . VAL A 1 21  ? 12.16600  17.48400 22.85300  1.000 42.06599  ? 19   VAL B CG1   1 
ATOM   92   C  CG2   . VAL A 1 21  ? 12.05900  19.86600 22.12800  1.000 34.74683  ? 19   VAL B CG2   1 
ATOM   93   N  N     . GLY A 1 22  ? 14.87800  21.31900 23.44600  1.000 40.29563  ? 20   GLY B N     1 
ATOM   94   C  CA    . GLY A 1 22  ? 15.63300  22.46700 23.00500  1.000 34.30078  ? 20   GLY B CA    1 
ATOM   95   C  C     . GLY A 1 22  ? 14.84600  23.66500 22.45600  1.000 37.65959  ? 20   GLY B C     1 
ATOM   96   O  O     . GLY A 1 22  ? 15.41100  24.44000 21.66600  1.000 35.79245  ? 20   GLY B O     1 
ATOM   97   N  N     . LYS A 1 23  ? 13.58500  23.85100 22.85800  1.000 39.02183  ? 21   LYS B N     1 
ATOM   98   C  CA    . LYS A 1 23  ? 12.81100  24.96800 22.33000  1.000 39.29832  ? 21   LYS B CA    1 
ATOM   99   C  C     . LYS A 1 23  ? 13.39000  26.30200 22.79900  1.000 42.11721  ? 21   LYS B C     1 
ATOM   100  O  O     . LYS A 1 23  ? 13.70500  27.18500 21.98500  1.000 35.55626  ? 21   LYS B O     1 
ATOM   101  C  CB    . LYS A 1 23  ? 11.35000  24.81700 22.74500  1.000 37.42623  ? 21   LYS B CB    1 
ATOM   102  C  CG    . LYS A 1 23  ? 10.68400  23.55500 22.21200  1.000 37.16976  ? 21   LYS B CG    1 
ATOM   103  C  CD    . LYS A 1 23  ? 9.35500   23.36800 22.91800  1.000 40.57850  ? 21   LYS B CD    1 
ATOM   104  C  CE    . LYS A 1 23  ? 9.58000   22.80900 24.30800  1.000 41.40151  ? 21   LYS B CE    1 
ATOM   105  N  NZ    . LYS A 1 23  ? 9.53500   23.87700 25.32700  1.000 45.52604  ? 21   LYS B NZ    1 
ATOM   106  N  N     . THR A 1 24  ? 13.56500  26.44900 24.12100  1.000 43.03084  ? 22   THR B N     1 
ATOM   107  C  CA    . THR A 1 24  ? 14.10100  27.68200 24.69100  1.000 34.54395  ? 22   THR B CA    1 
ATOM   108  C  C     . THR A 1 24  ? 15.52300  27.96100 24.19000  1.000 41.62112  ? 22   THR B C     1 
ATOM   109  O  O     . THR A 1 24  ? 15.90700  29.12400 24.00900  1.000 40.21122  ? 22   THR B O     1 
ATOM   110  C  CB    . THR A 1 24  ? 14.04800  27.59900 26.22500  1.000 32.46400  ? 22   THR B CB    1 
ATOM   111  O  OG1   . THR A 1 24  ? 12.77700  27.04700 26.67500  1.000 39.67558  ? 22   THR B OG1   1 
ATOM   112  C  CG2   . THR A 1 24  ? 14.24500  28.96700 26.82600  1.000 24.03372  ? 22   THR B CG2   1 
ATOM   113  N  N     . SER A 1 25  ? 16.29900  26.90800 23.90700  1.000 50.30581  ? 23   SER B N     1 
ATOM   114  C  CA    . SER A 1 25  ? 17.67400  27.06800 23.43600  1.000 47.27055  ? 23   SER B CA    1 
ATOM   115  C  C     . SER A 1 25  ? 17.75500  27.41400 21.94700  1.000 42.40807  ? 23   SER B C     1 
ATOM   116  O  O     . SER A 1 25  ? 18.58300  28.24400 21.54600  1.000 43.17816  ? 23   SER B O     1 
ATOM   117  C  CB    . SER A 1 25  ? 18.47900  25.79700 23.72000  1.000 45.40001  ? 23   SER B CB    1 
ATOM   118  O  OG    . SER A 1 25  ? 18.35300  25.39600 25.06800  1.000 42.28223  ? 23   SER B OG    1 
ATOM   119  N  N     . LEU A 1 26  ? 16.93700  26.77000 21.10600  1.000 34.99815  ? 24   LEU B N     1 
ATOM   120  C  CA    . LEU A 1 26  ? 16.92400  27.14000 19.69200  1.000 28.24366  ? 24   LEU B CA    1 
ATOM   121  C  C     . LEU A 1 26  ? 16.50700  28.58200 19.50900  1.000 29.53890  ? 24   LEU B C     1 
ATOM   122  O  O     . LEU A 1 26  ? 17.00900  29.26900 18.61000  1.000 33.45567  ? 24   LEU B O     1 
ATOM   123  C  CB    . LEU A 1 26  ? 15.98500  26.24000 18.90700  1.000 22.49735  ? 24   LEU B CB    1 
ATOM   124  C  CG    . LEU A 1 26  ? 16.57900  24.86700 18.66000  1.000 29.62757  ? 24   LEU B CG    1 
ATOM   125  C  CD1   . LEU A 1 26  ? 15.49600  23.97000 18.09100  1.000 27.23105  ? 24   LEU B CD1   1 
ATOM   126  C  CD2   . LEU A 1 26  ? 17.79700  24.97000 17.74000  1.000 29.33498  ? 24   LEU B CD2   1 
ATOM   127  N  N     . MET A 1 27  ? 15.59900  29.05700 20.35600  1.000 30.76897  ? 25   MET B N     1 
ATOM   128  C  CA    . MET A 1 27  ? 15.12500  30.42800 20.25300  1.000 33.78257  ? 25   MET B CA    1 
ATOM   129  C  C     . MET A 1 27  ? 16.12300  31.41800 20.85600  1.000 37.83809  ? 25   MET B C     1 
ATOM   130  O  O     . MET A 1 27  ? 16.30000  32.52400 20.32800  1.000 31.06700  ? 25   MET B O     1 
ATOM   131  C  CB    . MET A 1 27  ? 13.75800  30.50400 20.91000  1.000 37.01600  ? 25   MET B CB    1 
ATOM   132  C  CG    . MET A 1 27  ? 13.28700  31.87400 21.24500  1.000 43.50652  ? 25   MET B CG    1 
ATOM   133  S  SD    . MET A 1 27  ? 11.85900  31.62800 22.29100  1.000 44.14627  ? 25   MET B SD    1 
ATOM   134  C  CE    . MET A 1 27  ? 10.69200  31.10300 21.09000  1.000 44.60846  ? 25   MET B CE    1 
ATOM   135  N  N     . ASN A 1 28  ? 16.80400  31.03200 21.94500  1.000 43.88619  ? 26   ASN B N     1 
ATOM   136  C  CA    . ASN A 1 28  ? 17.89500  31.84600 22.48200  1.000 36.27399  ? 26   ASN B CA    1 
ATOM   137  C  C     . ASN A 1 28  ? 19.05800  31.92100 21.49000  1.000 38.79131  ? 26   ASN B C     1 
ATOM   138  O  O     . ASN A 1 28  ? 19.59400  33.00400 21.21200  1.000 33.53379  ? 26   ASN B O     1 
ATOM   139  C  CB    . ASN A 1 28  ? 18.34800  31.26300 23.81700  1.000 34.22613  ? 26   ASN B CB    1 
ATOM   140  C  CG    . ASN A 1 28  ? 19.26000  32.19500 24.59400  1.000 46.06137  ? 26   ASN B CG    1 
ATOM   141  O  OD1   . ASN A 1 28  ? 19.16600  33.42100 24.47300  1.000 49.54510  ? 26   ASN B OD1   1 
ATOM   142  N  ND2   . ASN A 1 28  ? 20.15800  31.61400 25.40100  1.000 45.93018  ? 26   ASN B ND2   1 
ATOM   143  N  N     . GLN A 1 29  ? 19.45200  30.77400 20.93200  1.000 30.74205  ? 27   GLN B N     1 
ATOM   144  C  CA    . GLN A 1 29  ? 20.48000  30.75200 19.89700  1.000 29.40509  ? 27   GLN B CA    1 
ATOM   145  C  C     . GLN A 1 29  ? 20.11100  31.62300 18.68900  1.000 32.73834  ? 27   GLN B C     1 
ATOM   146  O  O     . GLN A 1 29  ? 20.95500  32.35900 18.16800  1.000 36.45916  ? 27   GLN B O     1 
ATOM   147  C  CB    . GLN A 1 29  ? 20.73500  29.31600 19.45000  1.000 36.06637  ? 27   GLN B CB    1 
ATOM   148  C  CG    . GLN A 1 29  ? 21.66000  29.23900 18.24500  1.000 41.78990  ? 27   GLN B CG    1 
ATOM   149  C  CD    . GLN A 1 29  ? 23.04000  29.78000 18.55500  1.000 38.64006  ? 27   GLN B CD    1 
ATOM   150  O  OE1   . GLN A 1 29  ? 23.59800  29.48400 19.61200  1.000 38.66392  ? 27   GLN B OE1   1 
ATOM   151  N  NE2   . GLN A 1 29  ? 23.58300  30.60600 17.65600  1.000 34.80861  ? 27   GLN B NE2   1 
ATOM   152  N  N     . TYR A 1 30  ? 18.86000  31.54900 18.21200  1.000 33.55065  ? 28   TYR B N     1 
ATOM   153  C  CA    . TYR A 1 30  ? 18.49800  32.32600 17.02400  1.000 30.17044  ? 28   TYR B CA    1 
ATOM   154  C  C     . TYR A 1 30  ? 18.41100  33.81600 17.33600  1.000 34.65595  ? 28   TYR B C     1 
ATOM   155  O  O     . TYR A 1 30  ? 18.94400  34.64900 16.59700  1.000 39.85310  ? 28   TYR B O     1 
ATOM   156  C  CB    . TYR A 1 30  ? 17.17700  31.83800 16.42200  1.000 27.54902  ? 28   TYR B CB    1 
ATOM   157  C  CG    . TYR A 1 30  ? 16.72000  32.70100 15.26800  1.000 36.64467  ? 28   TYR B CG    1 
ATOM   158  C  CD1   . TYR A 1 30  ? 17.51600  32.84500 14.12100  1.000 37.56054  ? 28   TYR B CD1   1 
ATOM   159  C  CD2   . TYR A 1 30  ? 15.50500  33.37700 15.31200  1.000 43.53267  ? 28   TYR B CD2   1 
ATOM   160  C  CE1   . TYR A 1 30  ? 17.11100  33.63700 13.05500  1.000 38.73148  ? 28   TYR B CE1   1 
ATOM   161  C  CE2   . TYR A 1 30  ? 15.08900  34.17900 14.23500  1.000 49.20978  ? 28   TYR B CE2   1 
ATOM   162  C  CZ    . TYR A 1 30  ? 15.89900  34.30200 13.11200  1.000 46.92014  ? 28   TYR B CZ    1 
ATOM   163  O  OH    . TYR A 1 30  ? 15.50400  35.08800 12.04800  1.000 51.38409  ? 28   TYR B OH    1 
ATOM   164  N  N     . VAL A 1 31  ? 17.74100  34.17900 18.42100  1.000 32.94767  ? 29   VAL B N     1 
ATOM   165  C  CA    . VAL A 1 31  ? 17.53000  35.60300 18.65100  1.000 36.63676  ? 29   VAL B CA    1 
ATOM   166  C  C     . VAL A 1 31  ? 18.80600  36.26900 19.16000  1.000 34.56474  ? 29   VAL B C     1 
ATOM   167  O  O     . VAL A 1 31  ? 19.09300  37.41900 18.81100  1.000 32.89674  ? 29   VAL B O     1 
ATOM   168  C  CB    . VAL A 1 31  ? 16.33400  35.81900 19.60500  1.000 29.98083  ? 29   VAL B CB    1 
ATOM   169  C  CG1   . VAL A 1 31  ? 16.20000  37.27100 19.96400  1.000 27.45546  ? 29   VAL B CG1   1 
ATOM   170  C  CG2   . VAL A 1 31  ? 15.06300  35.38200 18.93700  1.000 24.20331  ? 29   VAL B CG2   1 
ATOM   171  N  N     . ASN A 1 32  ? 19.59300  35.56400 19.97800  1.000 33.78649  ? 30   ASN B N     1 
ATOM   172  C  CA    . ASN A 1 32  ? 20.69400  36.18500 20.70200  1.000 37.28390  ? 30   ASN B CA    1 
ATOM   173  C  C     . ASN A 1 32  ? 22.04700  35.54800 20.43600  1.000 39.42965  ? 30   ASN B C     1 
ATOM   174  O  O     . ASN A 1 32  ? 23.03500  35.97900 21.04000  1.000 37.67962  ? 30   ASN B O     1 
ATOM   175  C  CB    . ASN A 1 32  ? 20.41200  36.17300 22.21500  1.000 34.59726  ? 30   ASN B CB    1 
ATOM   176  C  CG    . ASN A 1 32  ? 19.19200  37.01000 22.58400  1.000 35.48587  ? 30   ASN B CG    1 
ATOM   177  O  OD1   . ASN A 1 32  ? 19.16000  38.23600 22.36200  1.000 33.35987  ? 30   ASN B OD1   1 
ATOM   178  N  ND2   . ASN A 1 32  ? 18.18800  36.35900 23.16200  1.000 39.41289  ? 30   ASN B ND2   1 
ATOM   179  N  N     . LYS A 1 33  ? 22.12200  34.55000 19.55000  1.000 39.43412  ? 31   LYS B N     1 
ATOM   180  C  CA    . LYS A 1 33  ? 23.37500  33.86600 19.21800  1.000 34.51234  ? 31   LYS B CA    1 
ATOM   181  C  C     . LYS A 1 33  ? 24.10900  33.41100 20.48200  1.000 37.58823  ? 31   LYS B C     1 
ATOM   182  O  O     . LYS A 1 33  ? 25.33800  33.40600 20.54800  1.000 40.45496  ? 31   LYS B O     1 
ATOM   183  C  CB    . LYS A 1 33  ? 24.24600  34.75500 18.33200  1.000 26.85241  ? 31   LYS B CB    1 
ATOM   184  C  CG    . LYS A 1 33  ? 23.56300  35.08000 17.00700  1.000 26.09445  ? 31   LYS B CG    1 
ATOM   185  C  CD    . LYS A 1 33  ? 24.48100  35.78100 16.01700  1.000 31.69122  ? 31   LYS B CD    1 
ATOM   186  C  CE    . LYS A 1 33  ? 23.73000  36.20100 14.76700  1.000 30.95897  ? 31   LYS B CE    1 
ATOM   187  N  NZ    . LYS A 1 33  ? 23.30100  35.03500 13.94600  1.000 33.66952  ? 31   LYS B NZ    1 
ATOM   188  N  N     . LYS A 1 34  ? 23.32400  33.02100 21.49200  1.000 44.84980  ? 32   LYS B N     1 
ATOM   189  C  CA    . LYS A 1 34  ? 23.76200  32.60000 22.81700  1.000 43.64737  ? 32   LYS B CA    1 
ATOM   190  C  C     . LYS A 1 34  ? 23.32400  31.16500 23.07900  1.000 37.52811  ? 32   LYS B C     1 
ATOM   191  O  O     . LYS A 1 34  ? 22.37600  30.65700 22.47700  1.000 43.97638  ? 32   LYS B O     1 
ATOM   192  C  CB    . LYS A 1 34  ? 23.17900  33.50000 23.91900  1.000 48.51925  ? 32   LYS B CB    1 
ATOM   193  C  CG    . LYS A 1 34  ? 23.83200  34.88000 24.10500  1.000 52.41759  ? 32   LYS B CG    1 
ATOM   194  C  CD    . LYS A 1 34  ? 23.05100  35.68000 25.17200  1.000 56.68358  ? 32   LYS B CD    1 
ATOM   195  C  CE    . LYS A 1 34  ? 23.78100  36.93900 25.63500  1.000 64.14304  ? 32   LYS B CE    1 
ATOM   196  N  NZ    . LYS A 1 34  ? 22.92200  37.79300 26.53000  1.000 64.86856  ? 32   LYS B NZ    1 
ATOM   197  N  N     . PHE A 1 35  ? 24.03100  30.50400 23.98800  1.000 32.47084  ? 33   PHE B N     1 
ATOM   198  C  CA    . PHE A 1 35  ? 23.66400  29.14000 24.36200  1.000 38.44407  ? 33   PHE B CA    1 
ATOM   199  C  C     . PHE A 1 35  ? 24.28200  28.83400 25.71100  1.000 41.88144  ? 33   PHE B C     1 
ATOM   200  O  O     . PHE A 1 35  ? 25.49900  28.94000 25.85600  1.000 50.85987  ? 33   PHE B O     1 
ATOM   201  C  CB    . PHE A 1 35  ? 24.12400  28.09500 23.32700  1.000 35.51580  ? 33   PHE B CB    1 
ATOM   202  C  CG    . PHE A 1 35  ? 23.90400  26.67100 23.79600  1.000 42.28535  ? 33   PHE B CG    1 
ATOM   203  C  CD1   . PHE A 1 35  ? 22.71300  26.00300 23.50700  1.000 46.82276  ? 33   PHE B CD1   1 
ATOM   204  C  CD2   . PHE A 1 35  ? 24.84700  26.03100 24.59400  1.000 36.37790  ? 33   PHE B CD2   1 
ATOM   205  C  CE1   . PHE A 1 35  ? 22.49200  24.71700 23.96500  1.000 46.09708  ? 33   PHE B CE1   1 
ATOM   206  C  CE2   . PHE A 1 35  ? 24.62400  24.74700 25.06300  1.000 41.79813  ? 33   PHE B CE2   1 
ATOM   207  C  CZ    . PHE A 1 35  ? 23.45000  24.08800 24.74500  1.000 44.25505  ? 33   PHE B CZ    1 
ATOM   208  N  N     . SER A 1 36  ? 23.46700  28.42800 26.68100  1.000 48.07500  ? 34   SER B N     1 
ATOM   209  C  CA    . SER A 1 36  ? 23.97600  27.93900 27.95100  1.000 53.72316  ? 34   SER B CA    1 
ATOM   210  C  C     . SER A 1 36  ? 23.45700  26.53000 28.18700  1.000 56.89631  ? 34   SER B C     1 
ATOM   211  O  O     . SER A 1 36  ? 22.29400  26.22500 27.89500  1.000 56.33171  ? 34   SER B O     1 
ATOM   212  C  CB    . SER A 1 36  ? 23.58500  28.85300 29.11600  1.000 58.16768  ? 34   SER B CB    1 
ATOM   213  O  OG    . SER A 1 36  ? 23.48900  28.09900 30.31100  1.000 67.19492  ? 34   SER B OG    1 
ATOM   214  N  N     . ASN A 1 37  ? 24.34300  25.67500 28.70200  1.000 74.71513  ? 35   ASN B N     1 
ATOM   215  C  CA    . ASN A 1 37  ? 24.06400  24.25500 28.86600  1.000 76.77541  ? 35   ASN B CA    1 
ATOM   216  C  C     . ASN A 1 37  ? 23.24300  23.97400 30.11300  1.000 80.03792  ? 35   ASN B C     1 
ATOM   217  O  O     . ASN A 1 37  ? 22.73300  22.85700 30.27200  1.000 80.28591  ? 35   ASN B O     1 
ATOM   218  C  CB    . ASN A 1 37  ? 25.37700  23.45000 28.90900  1.000 79.45073  ? 35   ASN B CB    1 
ATOM   219  C  CG    . ASN A 1 37  ? 25.14800  21.94300 28.84500  1.000 85.75280  ? 35   ASN B CG    1 
ATOM   220  O  OD1   . ASN A 1 37  ? 24.48300  21.44000 27.92900  1.000 91.74254  ? 35   ASN B OD1   1 
ATOM   221  N  ND2   . ASN A 1 37  ? 25.69900  21.21700 29.81400  1.000 84.32147  ? 35   ASN B ND2   1 
ATOM   222  N  N     . GLN A 1 38  ? 23.09200  24.96500 30.98600  1.000 76.66791  ? 36   GLN B N     1 
ATOM   223  C  CA    . GLN A 1 38  ? 22.25700  24.82600 32.16900  1.000 73.68525  ? 36   GLN B CA    1 
ATOM   224  C  C     . GLN A 1 38  ? 20.78700  24.79400 31.75800  1.000 69.67972  ? 36   GLN B C     1 
ATOM   225  O  O     . GLN A 1 38  ? 20.29500  25.73200 31.12300  1.000 71.21047  ? 36   GLN B O     1 
ATOM   226  C  CB    . GLN A 1 38  ? 22.54300  25.98100 33.12400  1.000 75.79663  ? 36   GLN B CB    1 
ATOM   227  C  CG    . GLN A 1 38  ? 23.71500  25.71200 34.05000  1.000 81.57867  ? 36   GLN B CG    1 
ATOM   228  C  CD    . GLN A 1 38  ? 23.33500  24.79200 35.21000  1.000 86.15365  ? 36   GLN B CD    1 
ATOM   229  O  OE1   . GLN A 1 38  ? 22.18700  24.80700 35.68400  1.000 84.76848  ? 36   GLN B OE1   1 
ATOM   230  N  NE2   . GLN A 1 38  ? 24.29600  23.98400 35.67100  1.000 84.31477  ? 36   GLN B NE2   1 
ATOM   231  N  N     . TYR A 1 39  ? 20.08700  23.71700 32.11500  1.000 70.13996  ? 37   TYR B N     1 
ATOM   232  C  CA    . TYR A 1 39  ? 18.68000  23.56700 31.75200  1.000 71.57830  ? 37   TYR B CA    1 
ATOM   233  C  C     . TYR A 1 39  ? 17.78500  24.31300 32.72800  1.000 69.92067  ? 37   TYR B C     1 
ATOM   234  O  O     . TYR A 1 39  ? 17.91400  24.15000 33.94200  1.000 71.78788  ? 37   TYR B O     1 
ATOM   235  C  CB    . TYR A 1 39  ? 18.27900  22.09400 31.72800  1.000 73.16609  ? 37   TYR B CB    1 
ATOM   236  C  CG    . TYR A 1 39  ? 16.78500  21.87500 31.66300  1.000 70.46466  ? 37   TYR B CG    1 
ATOM   237  C  CD1   . TYR A 1 39  ? 16.07400  22.14300 30.49600  1.000 68.54576  ? 37   TYR B CD1   1 
ATOM   238  C  CD2   . TYR A 1 39  ? 16.08300  21.41100 32.77200  1.000 72.72398  ? 37   TYR B CD2   1 
ATOM   239  C  CE1   . TYR A 1 39  ? 14.69700  21.94400 30.42900  1.000 70.05181  ? 37   TYR B CE1   1 
ATOM   240  C  CE2   . TYR A 1 39  ? 14.70300  21.21100 32.71600  1.000 75.32067  ? 37   TYR B CE2   1 
ATOM   241  C  CZ    . TYR A 1 39  ? 14.01800  21.47800 31.54000  1.000 72.13401  ? 37   TYR B CZ    1 
ATOM   242  O  OH    . TYR A 1 39  ? 12.66000  21.27000 31.48400  1.000 68.90939  ? 37   TYR B OH    1 
ATOM   243  N  N     . LYS A 1 40  ? 16.85100  25.09600 32.19100  1.000 68.09821  ? 38   LYS B N     1 
ATOM   244  C  CA    . LYS A 1 40  ? 15.91600  25.90400 32.97700  1.000 63.97649  ? 38   LYS B CA    1 
ATOM   245  C  C     . LYS A 1 40  ? 14.52000  25.70100 32.39300  1.000 62.01815  ? 38   LYS B C     1 
ATOM   246  O  O     . LYS A 1 40  ? 14.16300  26.35400 31.40500  1.000 71.04851  ? 38   LYS B O     1 
ATOM   247  C  CB    . LYS A 1 40  ? 16.32800  27.37200 32.94200  1.000 67.76119  ? 38   LYS B CB    1 
ATOM   248  C  CG    . LYS A 1 40  ? 15.45600  28.30600 33.74300  1.000 71.83120  ? 38   LYS B CG    1 
ATOM   249  C  CD    . LYS A 1 40  ? 15.50800  27.97600 35.21800  1.000 72.83335  ? 38   LYS B CD    1 
ATOM   250  C  CE    . LYS A 1 40  ? 14.34800  28.62100 35.95900  1.000 71.43573  ? 38   LYS B CE    1 
ATOM   251  N  NZ    . LYS A 1 40  ? 14.35800  28.23100 37.39000  1.000 70.58226  ? 38   LYS B NZ    1 
ATOM   252  N  N     . ALA A 1 41  ? 13.73600  24.79600 32.98500  1.000 47.34628  ? 39   ALA B N     1 
ATOM   253  C  CA    . ALA A 1 41  ? 12.41300  24.47500 32.44300  1.000 43.59847  ? 39   ALA B CA    1 
ATOM   254  C  C     . ALA A 1 41  ? 11.53700  25.72300 32.36000  1.000 47.86996  ? 39   ALA B C     1 
ATOM   255  O  O     . ALA A 1 41  ? 11.36800  26.44200 33.34700  1.000 47.56201  ? 39   ALA B O     1 
ATOM   256  C  CB    . ALA A 1 41  ? 11.72000  23.41900 33.29900  1.000 29.62256  ? 39   ALA B CB    1 
ATOM   257  N  N     . THR A 1 42  ? 10.99400  25.99100 31.17300  1.000 44.13069  ? 40   THR B N     1 
ATOM   258  C  CA    . THR A 1 42  ? 10.11200  27.13700 31.01300  1.000 45.31799  ? 40   THR B CA    1 
ATOM   259  C  C     . THR A 1 42  ? 8.73700   26.75800 31.56000  1.000 40.73022  ? 40   THR B C     1 
ATOM   260  O  O     . THR A 1 42  ? 8.23400   25.65600 31.30400  1.000 35.17655  ? 40   THR B O     1 
ATOM   261  C  CB    . THR A 1 42  ? 10.06200  27.60000 29.54200  1.000 44.51422  ? 40   THR B CB    1 
ATOM   262  O  OG1   . THR A 1 42  ? 9.85000   26.48800 28.66400  1.000 48.97308  ? 40   THR B OG1   1 
ATOM   263  C  CG2   . THR A 1 42  ? 11.38300  28.33600 29.12600  1.000 32.20496  ? 40   THR B CG2   1 
ATOM   264  N  N     . ILE A 1 43  ? 8.16300   27.64100 32.37400  1.000 49.11565  ? 41   ILE B N     1 
ATOM   265  C  CA    . ILE A 1 43  ? 6.95200   27.30400 33.12500  1.000 55.66061  ? 41   ILE B CA    1 
ATOM   266  C  C     . ILE A 1 43  ? 5.73000   27.94200 32.48300  1.000 57.01252  ? 41   ILE B C     1 
ATOM   267  O  O     . ILE A 1 43  ? 4.62600   27.38900 32.53600  1.000 58.25187  ? 41   ILE B O     1 
ATOM   268  C  CB    . ILE A 1 43  ? 7.06700   27.72500 34.60500  1.000 53.40624  ? 41   ILE B CB    1 
ATOM   269  C  CG1   . ILE A 1 43  ? 7.21100   29.24000 34.72400  1.000 51.41807  ? 41   ILE B CG1   1 
ATOM   270  C  CG2   . ILE A 1 43  ? 8.26600   27.05000 35.26000  1.000 48.37684  ? 41   ILE B CG2   1 
ATOM   271  C  CD1   . ILE A 1 43  ? 5.97500   30.01100 34.40600  1.000 56.03987  ? 41   ILE B CD1   1 
ATOM   272  N  N     . GLY A 1 44  ? 5.92100   29.10900 31.88600  1.000 62.10397  ? 42   GLY B N     1 
ATOM   273  C  CA    . GLY A 1 44  ? 4.84800   29.79900 31.20100  1.000 63.78156  ? 42   GLY B CA    1 
ATOM   274  C  C     . GLY A 1 44  ? 5.29600   30.25700 29.83000  1.000 60.40825  ? 42   GLY B C     1 
ATOM   275  O  O     . GLY A 1 44  ? 6.47600   30.49800 29.58700  1.000 65.12406  ? 42   GLY B O     1 
ATOM   276  N  N     . ALA A 1 45  ? 4.32500   30.37000 28.92700  1.000 47.66420  ? 43   ALA B N     1 
ATOM   277  C  CA    . ALA A 1 45  ? 4.59600   30.82100 27.57000  1.000 39.35426  ? 43   ALA B CA    1 
ATOM   278  C  C     . ALA A 1 45  ? 4.93700   32.30500 27.55400  1.000 37.96753  ? 43   ALA B C     1 
ATOM   279  O  O     . ALA A 1 45  ? 4.27300   33.12100 28.19500  1.000 44.25292  ? 43   ALA B O     1 
ATOM   280  C  CB    . ALA A 1 45  ? 3.39500   30.54200 26.67200  1.000 41.33638  ? 43   ALA B CB    1 
ATOM   281  N  N     . ASP A 1 46  ? 5.99600   32.64200 26.83300  1.000 43.51535  ? 44   ASP B N     1 
ATOM   282  C  CA    . ASP A 1 46  ? 6.47300   34.00800 26.68500  1.000 46.40411  ? 44   ASP B CA    1 
ATOM   283  C  C     . ASP A 1 46  ? 7.08600   34.10900 25.29300  1.000 43.88030  ? 44   ASP B C     1 
ATOM   284  O  O     . ASP A 1 46  ? 7.17700   33.11600 24.56300  1.000 41.21688  ? 44   ASP B O     1 
ATOM   285  C  CB    . ASP A 1 46  ? 7.47500   34.36600 27.79100  1.000 49.79441  ? 44   ASP B CB    1 
ATOM   286  C  CG    . ASP A 1 46  ? 7.51800   35.85700 28.10300  1.000 53.40201  ? 44   ASP B CG    1 
ATOM   287  O  OD1   . ASP A 1 46  ? 6.87700   36.66100 27.39800  1.000 52.24275  ? 44   ASP B OD1   1 
ATOM   288  O  OD2   . ASP A 1 46  ? 8.22100   36.21900 29.06900  1.000 57.45099  ? 44   ASP B OD2   1 
ATOM   289  N  N     . PHE A 1 47  ? 7.52800   35.30900 24.92600  1.000 32.85130  ? 45   PHE B N     1 
ATOM   290  C  CA    . PHE A 1 47  ? 7.98900   35.52100 23.56900  1.000 35.54543  ? 45   PHE B CA    1 
ATOM   291  C  C     . PHE A 1 47  ? 9.22100   36.41800 23.51900  1.000 40.80410  ? 45   PHE B C     1 
ATOM   292  O  O     . PHE A 1 47  ? 9.49800   37.19200 24.43800  1.000 45.89713  ? 45   PHE B O     1 
ATOM   293  C  CB    . PHE A 1 47  ? 6.86600   36.10800 22.72800  1.000 30.90685  ? 45   PHE B CB    1 
ATOM   294  C  CG    . PHE A 1 47  ? 6.52000   37.51600 23.07800  1.000 28.71082  ? 45   PHE B CG    1 
ATOM   295  C  CD1   . PHE A 1 47  ? 5.55100   37.78200 24.04100  1.000 33.63040  ? 45   PHE B CD1   1 
ATOM   296  C  CD2   . PHE A 1 47  ? 7.13400   38.57900 22.42600  1.000 26.05648  ? 45   PHE B CD2   1 
ATOM   297  C  CE1   . PHE A 1 47  ? 5.20100   39.08400 24.36400  1.000 32.61544  ? 45   PHE B CE1   1 
ATOM   298  C  CE2   . PHE A 1 47  ? 6.79000   39.88800 22.73300  1.000 37.05787  ? 45   PHE B CE2   1 
ATOM   299  C  CZ    . PHE A 1 47  ? 5.81500   40.14100 23.71400  1.000 39.58807  ? 45   PHE B CZ    1 
ATOM   300  N  N     . LEU A 1 48  ? 9.96300   36.28600 22.42000  1.000 46.81568  ? 46   LEU B N     1 
ATOM   301  C  CA    . LEU A 1 48  ? 10.98400  37.23000 21.98200  1.000 45.50086  ? 46   LEU B CA    1 
ATOM   302  C  C     . LEU A 1 48  ? 10.60200  37.78000 20.61400  1.000 48.25131  ? 46   LEU B C     1 
ATOM   303  O  O     . LEU A 1 48  ? 9.73600   37.23100 19.92200  1.000 49.75272  ? 46   LEU B O     1 
ATOM   304  C  CB    . LEU A 1 48  ? 12.36100  36.57200 21.90400  1.000 33.94819  ? 46   LEU B CB    1 
ATOM   305  C  CG    . LEU A 1 48  ? 12.97900  36.26100 23.24000  1.000 33.52966  ? 46   LEU B CG    1 
ATOM   306  C  CD1   . LEU A 1 48  ? 14.26300  35.51700 23.01100  1.000 34.00807  ? 46   LEU B CD1   1 
ATOM   307  C  CD2   . LEU A 1 48  ? 13.19200  37.57500 23.99700  1.000 42.87029  ? 46   LEU B CD2   1 
ATOM   308  N  N     . THR A 1 49  ? 11.26500  38.87400 20.22400  1.000 52.38123  ? 47   THR B N     1 
ATOM   309  C  CA    . THR A 1 49  ? 11.05600  39.49300 18.91900  1.000 50.70339  ? 47   THR B CA    1 
ATOM   310  C  C     . THR A 1 49  ? 12.39000  39.64300 18.19500  1.000 45.72379  ? 47   THR B C     1 
ATOM   311  O  O     . THR A 1 49  ? 13.37500  40.10100 18.78100  1.000 44.56742  ? 47   THR B O     1 
ATOM   312  C  CB    . THR A 1 49  ? 10.35100  40.86000 19.05000  1.000 54.80169  ? 47   THR B CB    1 
ATOM   313  O  OG1   . THR A 1 49  ? 11.25800  41.84300 19.56300  1.000 62.46191  ? 47   THR B OG1   1 
ATOM   314  C  CG2   . THR A 1 49  ? 9.16900   40.76500 19.99000  1.000 51.57122  ? 47   THR B CG2   1 
ATOM   315  N  N     . LYS A 1 50  ? 12.42400  39.23400 16.93100  1.000 46.37084  ? 48   LYS B N     1 
ATOM   316  C  CA    . LYS A 1 50  ? 13.53100  39.54200 16.03500  1.000 47.60208  ? 48   LYS B CA    1 
ATOM   317  C  C     . LYS A 1 50  ? 12.96300  40.28500 14.84400  1.000 47.59977  ? 48   LYS B C     1 
ATOM   318  O  O     . LYS A 1 50  ? 11.92800  39.88500 14.30700  1.000 41.21289  ? 48   LYS B O     1 
ATOM   319  C  CB    . LYS A 1 50  ? 14.27200  38.28300 15.56000  1.000 47.03301  ? 48   LYS B CB    1 
ATOM   320  C  CG    . LYS A 1 50  ? 15.61600  38.56400 14.87400  1.000 44.21442  ? 48   LYS B CG    1 
ATOM   321  C  CD    . LYS A 1 50  ? 16.52200  37.33000 14.91300  1.000 44.22157  ? 48   LYS B CD    1 
ATOM   322  C  CE    . LYS A 1 50  ? 17.88500  37.58000 14.25700  1.000 48.31476  ? 48   LYS B CE    1 
ATOM   323  N  NZ    . LYS A 1 50  ? 18.88700  38.25600 15.14600  1.000 45.53398  ? 48   LYS B NZ    1 
ATOM   324  N  N     . GLU A 1 51  ? 13.61400  41.37600 14.45200  1.000 73.56396  ? 49   GLU B N     1 
ATOM   325  C  CA    . GLU A 1 51  ? 13.32600  42.00000 13.17000  1.000 74.99921  ? 49   GLU B CA    1 
ATOM   326  C  C     . GLU A 1 51  ? 14.24400  41.39900 12.11200  1.000 69.94203  ? 49   GLU B C     1 
ATOM   327  O  O     . GLU A 1 51  ? 15.45100  41.23200 12.33400  1.000 67.39874  ? 49   GLU B O     1 
ATOM   328  C  CB    . GLU A 1 51  ? 13.48400  43.52200 13.22900  1.000 80.54085  ? 49   GLU B CB    1 
ATOM   329  C  CG    . GLU A 1 51  ? 12.50400  44.22000 14.15900  1.000 87.92249  ? 49   GLU B CG    1 
ATOM   330  C  CD    . GLU A 1 51  ? 13.16100  45.33200 14.96800  1.000 98.12522  ? 49   GLU B CD    1 
ATOM   331  O  OE1   . GLU A 1 51  ? 14.41300  45.37000 15.03000  1.000 100.42146 ? 49   GLU B OE1   1 
ATOM   332  O  OE2   . GLU A 1 51  ? 12.42600  46.16300 15.55000  1.000 103.46627 ? 49   GLU B OE2   1 
ATOM   333  N  N     . VAL A 1 52  ? 13.64800  41.02500 10.98600  1.000 59.56934  ? 50   VAL B N     1 
ATOM   334  C  CA    . VAL A 1 52  ? 14.37100  40.62800 9.79400   1.000 56.59035  ? 50   VAL B CA    1 
ATOM   335  C  C     . VAL A 1 52  ? 13.79600  41.41700 8.62200   1.000 55.90623  ? 50   VAL B C     1 
ATOM   336  O  O     . VAL A 1 52  ? 12.79500  42.12300 8.75000   1.000 56.79088  ? 50   VAL B O     1 
ATOM   337  C  CB    . VAL A 1 52  ? 14.29900  39.10200 9.54300   1.000 55.13278  ? 50   VAL B CB    1 
ATOM   338  C  CG1   . VAL A 1 52  ? 14.89900  38.34300 10.71900  1.000 57.38983  ? 50   VAL B CG1   1 
ATOM   339  C  CG2   . VAL A 1 52  ? 12.87300  38.64400 9.29900   1.000 53.01968  ? 50   VAL B CG2   1 
ATOM   340  N  N     . MET A 1 53  ? 14.45200  41.31300 7.47000   1.000 62.61283  ? 51   MET B N     1 
ATOM   341  C  CA    . MET A 1 53  ? 13.93900  41.94100 6.25800   1.000 66.08274  ? 51   MET B CA    1 
ATOM   342  C  C     . MET A 1 53  ? 13.86800  40.94200 5.11300   1.000 61.55512  ? 51   MET B C     1 
ATOM   343  O  O     . MET A 1 53  ? 14.81400  40.17200 4.89600   1.000 52.86029  ? 51   MET B O     1 
ATOM   344  C  CB    . MET A 1 53  ? 14.76900  43.16600 5.87500   1.000 72.00434  ? 51   MET B CB    1 
ATOM   345  C  CG    . MET A 1 53  ? 14.65000  44.24600 6.93400   1.000 83.43216  ? 51   MET B CG    1 
ATOM   346  S  SD    . MET A 1 53  ? 14.63500  45.92200 6.26800   1.000 92.46546  ? 51   MET B SD    1 
ATOM   347  C  CE    . MET A 1 53  ? 16.37600  46.25600 6.00200   1.000 89.79294  ? 51   MET B CE    1 
ATOM   348  N  N     . VAL A 1 54  ? 12.71600  40.94800 4.42200   1.000 63.05910  ? 52   VAL B N     1 
ATOM   349  C  CA    . VAL A 1 54  ? 12.46300  40.20000 3.18800   1.000 69.08959  ? 52   VAL B CA    1 
ATOM   350  C  C     . VAL A 1 54  ? 12.09200  41.21000 2.10600   1.000 83.11437  ? 52   VAL B C     1 
ATOM   351  O  O     . VAL A 1 54  ? 11.02300  41.83500 2.17700   1.000 86.66389  ? 52   VAL B O     1 
ATOM   352  C  CB    . VAL A 1 54  ? 11.33500  39.16600 3.34400   1.000 62.82249  ? 52   VAL B CB    1 
ATOM   353  C  CG1   . VAL A 1 54  ? 11.27000  38.23700 2.10400   1.000 60.10087  ? 52   VAL B CG1   1 
ATOM   354  C  CG2   . VAL A 1 54  ? 11.43100  38.39400 4.66700   1.000 57.47675  ? 52   VAL B CG2   1 
ATOM   355  N  N     . ASP A 1 55  ? 12.96200  41.36000 1.10000   1.000 109.98570 ? 53   ASP B N     1 
ATOM   356  C  CA    . ASP A 1 55  ? 12.67200  42.12200 -0.12700  1.000 119.28277 ? 53   ASP B CA    1 
ATOM   357  C  C     . ASP A 1 55  ? 12.33600  43.58200 0.18100   1.000 120.14163 ? 53   ASP B C     1 
ATOM   358  O  O     . ASP A 1 55  ? 11.21100  44.04800 -0.06500  1.000 126.68203 ? 53   ASP B O     1 
ATOM   359  C  CB    . ASP A 1 55  ? 11.50100  41.51300 -0.92400  1.000 124.65118 ? 53   ASP B CB    1 
ATOM   360  C  CG    . ASP A 1 55  ? 11.51200  39.99600 -0.96500  1.000 127.12242 ? 53   ASP B CG    1 
ATOM   361  O  OD1   . ASP A 1 55  ? 10.43400  39.40700 -0.75400  1.000 127.84715 ? 53   ASP B OD1   1 
ATOM   362  O  OD2   . ASP A 1 55  ? 12.57600  39.39700 -1.23000  1.000 127.57702 ? 53   ASP B OD2   1 
ATOM   363  N  N     . ASP A 1 56  ? 13.31700  44.30200 0.75200   1.000 114.31136 ? 54   ASP B N     1 
ATOM   364  C  CA    . ASP A 1 56  ? 13.17200  45.73600 1.04500   1.000 112.44593 ? 54   ASP B CA    1 
ATOM   365  C  C     . ASP A 1 56  ? 12.15800  45.98000 2.17500   1.000 106.97405 ? 54   ASP B C     1 
ATOM   366  O  O     . ASP A 1 56  ? 12.14600  47.05100 2.79900   1.000 104.35895 ? 54   ASP B O     1 
ATOM   367  C  CB    . ASP A 1 56  ? 12.79300  46.49600 -0.25300  1.000 115.86191 ? 54   ASP B CB    1 
ATOM   368  C  CG    . ASP A 1 56  ? 12.69300  48.01900 -0.08000  1.000 117.96345 ? 54   ASP B CG    1 
ATOM   369  O  OD1   . ASP A 1 56  ? 11.66900  48.58600 -0.51400  1.000 118.69158 ? 54   ASP B OD1   1 
ATOM   370  O  OD2   . ASP A 1 56  ? 13.64700  48.64700 0.44200   1.000 117.95069 ? 54   ASP B OD2   1 
ATOM   371  N  N     . ARG A 1 57  ? 11.33800  44.96700 2.47200   1.000 86.37805  ? 55   ARG B N     1 
ATOM   372  C  CA    . ARG A 1 57  ? 10.21800  45.05900 3.40200   1.000 75.34901  ? 55   ARG B CA    1 
ATOM   373  C  C     . ARG A 1 57  ? 10.62900  44.66500 4.81800   1.000 77.25367  ? 55   ARG B C     1 
ATOM   374  O  O     . ARG A 1 57  ? 11.14900  43.56400 5.04200   1.000 72.97870  ? 55   ARG B O     1 
ATOM   375  C  CB    . ARG A 1 57  ? 9.09400   44.14200 2.93100   1.000 69.86158  ? 55   ARG B CB    1 
ATOM   376  C  CG    . ARG A 1 57  ? 7.83800   44.14300 3.80700   1.000 76.37095  ? 55   ARG B CG    1 
ATOM   377  C  CD    . ARG A 1 57  ? 6.55600   43.94800 2.99700   1.000 74.90911  ? 55   ARG B CD    1 
ATOM   378  N  NE    . ARG A 1 57  ? 6.33400   42.54100 2.65700   1.000 78.18476  ? 55   ARG B NE    1 
ATOM   379  C  CZ    . ARG A 1 57  ? 6.89300   41.90000 1.62700   1.000 86.16862  ? 55   ARG B CZ    1 
ATOM   380  N  NH1   . ARG A 1 57  ? 7.71500   42.52200 0.78600   1.000 90.37763  ? 55   ARG B NH1   1 
ATOM   381  N  NH2   . ARG A 1 57  ? 6.61800   40.62100 1.42100   1.000 86.48914  ? 55   ARG B NH2   1 
ATOM   382  N  N     . LEU A 1 58  ? 10.37300  45.55300 5.77600   1.000 88.44871  ? 56   LEU B N     1 
ATOM   383  C  CA    . LEU A 1 58  ? 10.67500  45.26600 7.17300   1.000 85.44121  ? 56   LEU B CA    1 
ATOM   384  C  C     . LEU A 1 58  ? 9.57400   44.40500 7.77300   1.000 85.43925  ? 56   LEU B C     1 
ATOM   385  O  O     . LEU A 1 58  ? 8.38800   44.70800 7.62000   1.000 93.24636  ? 56   LEU B O     1 
ATOM   386  C  CB    . LEU A 1 58  ? 10.83800  46.56800 7.96100   1.000 81.59073  ? 56   LEU B CB    1 
ATOM   387  C  CG    . LEU A 1 58  ? 11.37200  46.47000 9.38600   1.000 82.68322  ? 56   LEU B CG    1 
ATOM   388  C  CD1   . LEU A 1 58  ? 10.27300  46.12100 10.41600  1.000 89.40672  ? 56   LEU B CD1   1 
ATOM   389  C  CD2   . LEU A 1 58  ? 12.52400  45.46500 9.46100   1.000 81.08409  ? 56   LEU B CD2   1 
ATOM   390  N  N     . VAL A 1 59  ? 9.96600   43.32900 8.45800   1.000 62.13857  ? 57   VAL B N     1 
ATOM   391  C  CA    . VAL A 1 59  ? 9.01900   42.41500 9.08700   1.000 59.46622  ? 57   VAL B CA    1 
ATOM   392  C  C     . VAL A 1 59  ? 9.55600   42.00800 10.45400  1.000 53.95083  ? 57   VAL B C     1 
ATOM   393  O  O     . VAL A 1 59  ? 10.76800  41.90800 10.66300  1.000 51.59504  ? 57   VAL B O     1 
ATOM   394  C  CB    . VAL A 1 59  ? 8.75600   41.16900 8.20700   1.000 62.62931  ? 57   VAL B CB    1 
ATOM   395  C  CG1   . VAL A 1 59  ? 8.29000   41.57200 6.78700   1.000 64.36964  ? 57   VAL B CG1   1 
ATOM   396  C  CG2   . VAL A 1 59  ? 9.99000   40.27400 8.15000   1.000 61.50003  ? 57   VAL B CG2   1 
ATOM   397  N  N     . THR A 1 60  ? 8.63900   41.76300 11.39100  1.000 47.50938  ? 58   THR B N     1 
ATOM   398  C  CA    . THR A 1 60  ? 8.97000   41.50500 12.79300  1.000 45.26567  ? 58   THR B CA    1 
ATOM   399  C  C     . THR A 1 60  ? 8.36000   40.17900 13.23600  1.000 41.27609  ? 58   THR B C     1 
ATOM   400  O  O     . THR A 1 60  ? 7.14100   40.00900 13.20700  1.000 43.83761  ? 58   THR B O     1 
ATOM   401  C  CB    . THR A 1 60  ? 8.47100   42.64600 13.68100  1.000 48.93879  ? 58   THR B CB    1 
ATOM   402  O  OG1   . THR A 1 60  ? 8.63700   43.88900 12.98300  1.000 61.27898  ? 58   THR B OG1   1 
ATOM   403  C  CG2   . THR A 1 60  ? 9.21100   42.68300 15.00400  1.000 46.67226  ? 58   THR B CG2   1 
ATOM   404  N  N     . MET A 1 61  ? 9.20100   39.24500 13.64900  1.000 41.31785  ? 59   MET B N     1 
ATOM   405  C  CA    . MET A 1 61  ? 8.72400   37.95700 14.12300  1.000 42.63158  ? 59   MET B CA    1 
ATOM   406  C  C     . MET A 1 61  ? 8.50100   38.01600 15.62500  1.000 42.60927  ? 59   MET B C     1 
ATOM   407  O  O     . MET A 1 61  ? 9.28800   38.61400 16.36600  1.000 41.28481  ? 59   MET B O     1 
ATOM   408  C  CB    . MET A 1 61  ? 9.71800   36.83500 13.81500  1.000 44.37095  ? 59   MET B CB    1 
ATOM   409  C  CG    . MET A 1 61  ? 10.04100  36.58200 12.36800  1.000 43.57288  ? 59   MET B CG    1 
ATOM   410  S  SD    . MET A 1 61  ? 11.18300  35.19200 12.23700  1.000 55.57589  ? 59   MET B SD    1 
ATOM   411  C  CE    . MET A 1 61  ? 10.05000  33.81600 12.28800  1.000 55.71396  ? 59   MET B CE    1 
ATOM   412  N  N     . GLN A 1 62  ? 7.43700   37.36800 16.07400  1.000 48.07399  ? 60   GLN B N     1 
ATOM   413  C  CA    . GLN A 1 62  ? 7.14900   37.23300 17.49600  1.000 46.72663  ? 60   GLN B CA    1 
ATOM   414  C  C     . GLN A 1 62  ? 7.10000   35.73800 17.77400  1.000 48.00087  ? 60   GLN B C     1 
ATOM   415  O  O     . GLN A 1 62  ? 6.17100   35.05200 17.32300  1.000 42.40200  ? 60   GLN B O     1 
ATOM   416  C  CB    . GLN A 1 62  ? 5.84700   37.94000 17.85300  1.000 44.28495  ? 60   GLN B CB    1 
ATOM   417  C  CG    . GLN A 1 62  ? 5.49800   37.94800 19.31000  1.000 47.74806  ? 60   GLN B CG    1 
ATOM   418  C  CD    . GLN A 1 62  ? 4.20300   38.71700 19.58500  1.000 49.31326  ? 60   GLN B CD    1 
ATOM   419  O  OE1   . GLN A 1 62  ? 3.10000   38.14300 19.59100  1.000 44.99855  ? 60   GLN B OE1   1 
ATOM   420  N  NE2   . GLN A 1 62  ? 4.33700   40.01400 19.85000  1.000 52.61945  ? 60   GLN B NE2   1 
ATOM   421  N  N     . ILE A 1 63  ? 8.13100   35.23300 18.46500  1.000 47.57199  ? 61   ILE B N     1 
ATOM   422  C  CA    . ILE A 1 63  ? 8.39400   33.80000 18.58900  1.000 45.48196  ? 61   ILE B CA    1 
ATOM   423  C  C     . ILE A 1 63  ? 8.04000   33.37400 20.01300  1.000 49.16761  ? 61   ILE B C     1 
ATOM   424  O  O     . ILE A 1 63  ? 8.66100   33.83100 20.98000  1.000 50.07271  ? 61   ILE B O     1 
ATOM   425  C  CB    . ILE A 1 63  ? 9.85300   33.45800 18.25800  1.000 46.09173  ? 61   ILE B CB    1 
ATOM   426  C  CG1   . ILE A 1 63  ? 10.21600  33.99500 16.86600  1.000 49.98630  ? 61   ILE B CG1   1 
ATOM   427  C  CG2   . ILE A 1 63  ? 10.04000  31.95600 18.26300  1.000 46.36196  ? 61   ILE B CG2   1 
ATOM   428  C  CD1   . ILE A 1 63  ? 11.60400  33.61900 16.36900  1.000 44.44813  ? 61   ILE B CD1   1 
ATOM   429  N  N     . TRP A 1 64  ? 7.05300   32.48800 20.14300  1.000 41.64342  ? 62   TRP B N     1 
ATOM   430  C  CA    . TRP A 1 64  ? 6.56500   32.00800 21.43100  1.000 40.42390  ? 62   TRP B CA    1 
ATOM   431  C  C     . TRP A 1 64  ? 7.15200   30.62800 21.70400  1.000 41.03069  ? 62   TRP B C     1 
ATOM   432  O  O     . TRP A 1 64  ? 6.96100   29.70700 20.90300  1.000 43.73432  ? 62   TRP B O     1 
ATOM   433  C  CB    . TRP A 1 64  ? 5.03100   31.93400 21.43300  1.000 44.56137  ? 62   TRP B CB    1 
ATOM   434  C  CG    . TRP A 1 64  ? 4.31200   33.27800 21.37700  1.000 44.36352  ? 62   TRP B CG    1 
ATOM   435  C  CD1   . TRP A 1 64  ? 4.06300   34.03700 20.26400  1.000 39.53498  ? 62   TRP B CD1   1 
ATOM   436  C  CD2   . TRP A 1 64  ? 3.75700   34.00300 22.48900  1.000 43.66119  ? 62   TRP B CD2   1 
ATOM   437  N  NE1   . TRP A 1 64  ? 3.40200   35.19400 20.62000  1.000 40.02967  ? 62   TRP B NE1   1 
ATOM   438  C  CE2   . TRP A 1 64  ? 3.20200   35.19500 21.97600  1.000 41.76203  ? 62   TRP B CE2   1 
ATOM   439  C  CE3   . TRP A 1 64  ? 3.68200   33.76000 23.87000  1.000 39.60701  ? 62   TRP B CE3   1 
ATOM   440  C  CZ2   . TRP A 1 64  ? 2.58600   36.14000 22.79300  1.000 43.48796  ? 62   TRP B CZ2   1 
ATOM   441  C  CZ3   . TRP A 1 64  ? 3.07400   34.70000 24.68000  1.000 36.18112  ? 62   TRP B CZ3   1 
ATOM   442  C  CH2   . TRP A 1 64  ? 2.53100   35.87300 24.14200  1.000 41.88086  ? 62   TRP B CH2   1 
ATOM   443  N  N     . ASP A 1 65  ? 7.86000   30.46900 22.82100  1.000 53.42225  ? 63   ASP B N     1 
ATOM   444  C  CA    . ASP A 1 65  ? 8.15200   29.11200 23.26100  1.000 55.97710  ? 63   ASP B CA    1 
ATOM   445  C  C     . ASP A 1 65  ? 7.26800   28.74700 24.44400  1.000 54.42696  ? 63   ASP B C     1 
ATOM   446  O  O     . ASP A 1 65  ? 6.75200   29.60100 25.17000  1.000 50.38387  ? 63   ASP B O     1 
ATOM   447  C  CB    . ASP A 1 65  ? 9.62900   28.86600 23.60000  1.000 49.12857  ? 63   ASP B CB    1 
ATOM   448  C  CG    . ASP A 1 65  ? 10.07600  29.59000 24.80300  1.000 49.23753  ? 63   ASP B CG    1 
ATOM   449  O  OD1   . ASP A 1 65  ? 9.57400   30.71800 24.97700  1.000 54.34748  ? 63   ASP B OD1   1 
ATOM   450  O  OD2   . ASP A 1 65  ? 10.95000  29.05600 25.53700  1.000 50.00324  ? 63   ASP B OD2   1 
ATOM   451  N  N     . THR A 1 66  ? 7.08200   27.45200 24.59400  1.000 37.42677  ? 64   THR B N     1 
ATOM   452  C  CA    . THR A 1 66  ? 6.03800   26.87800 25.39400  1.000 32.90287  ? 64   THR B CA    1 
ATOM   453  C  C     . THR A 1 66  ? 6.65500   26.06700 26.52300  1.000 43.43358  ? 64   THR B C     1 
ATOM   454  O  O     . THR A 1 66  ? 7.88000   25.89900 26.60300  1.000 45.73982  ? 64   THR B O     1 
ATOM   455  C  CB    . THR A 1 66  ? 5.12700   26.02600 24.49900  1.000 38.15506  ? 64   THR B CB    1 
ATOM   456  O  OG1   . THR A 1 66  ? 5.87600   24.94800 23.91900  1.000 41.29570  ? 64   THR B OG1   1 
ATOM   457  C  CG2   . THR A 1 66  ? 4.52100   26.90000 23.39200  1.000 36.27510  ? 64   THR B CG2   1 
ATOM   458  N  N     . ALA A 1 67  ? 5.78900   25.58500 27.42000  1.000 49.91625  ? 65   ALA B N     1 
ATOM   459  C  CA    . ALA A 1 67  ? 6.20900   24.75500 28.54800  1.000 48.70795  ? 65   ALA B CA    1 
ATOM   460  C  C     . ALA A 1 67  ? 5.90200   23.30800 28.19300  1.000 55.11439  ? 65   ALA B C     1 
ATOM   461  O  O     . ALA A 1 67  ? 4.79100   22.83200 28.39700  1.000 61.65534  ? 65   ALA B O     1 
ATOM   462  C  CB    . ALA A 1 67  ? 5.50800   25.18100 29.82800  1.000 45.62504  ? 65   ALA B CB    1 
ATOM   463  N  N     . GLY A 1 68  ? 6.90000   22.60300 27.65600  1.000 63.87162  ? 66   GLY B N     1 
ATOM   464  C  CA    . GLY A 1 68  ? 6.68400   21.24600 27.17800  1.000 67.51190  ? 66   GLY B CA    1 
ATOM   465  C  C     . GLY A 1 68  ? 6.55000   20.20300 28.26600  1.000 72.23157  ? 66   GLY B C     1 
ATOM   466  O  O     . GLY A 1 68  ? 6.16100   19.06900 27.96100  1.000 72.84037  ? 66   GLY B O     1 
ATOM   467  N  N     . LEU A 1 69  ? 6.86400   20.56200 29.51800  1.000 80.40804  ? 67   LEU B N     1 
ATOM   468  C  CA    . LEU A 1 69  ? 6.81300   19.66100 30.66600  1.000 80.27562  ? 67   LEU B CA    1 
ATOM   469  C  C     . LEU A 1 69  ? 5.38300   19.21200 30.96000  1.000 80.87792  ? 67   LEU B C     1 
ATOM   470  O  O     . LEU A 1 69  ? 4.87700   18.30100 30.30200  1.000 85.83931  ? 67   LEU B O     1 
ATOM   471  C  CB    . LEU A 1 69  ? 7.44200   20.35000 31.87800  1.000 77.60884  ? 67   LEU B CB    1 
ATOM   472  C  CG    . LEU A 1 69  ? 8.03800   19.52200 33.01500  1.000 68.87320  ? 67   LEU B CG    1 
ATOM   473  C  CD1   . LEU A 1 69  ? 8.92400   18.38700 32.49600  1.000 66.45141  ? 67   LEU B CD1   1 
ATOM   474  C  CD2   . LEU A 1 69  ? 8.81700   20.45300 33.94500  1.000 58.74120  ? 67   LEU B CD2   1 
ATOM   475  N  N     . GLU A 1 70  ? 4.72400   19.82400 31.94400  1.000 77.51869  ? 68   GLU B N     1 
ATOM   476  C  CA    . GLU A 1 70  ? 3.30600   19.55100 32.15800  1.000 80.82317  ? 68   GLU B CA    1 
ATOM   477  C  C     . GLU A 1 70  ? 2.67000   20.66100 32.97700  1.000 79.11652  ? 68   GLU B C     1 
ATOM   478  O  O     . GLU A 1 70  ? 1.89800   20.40800 33.90900  1.000 69.67682  ? 68   GLU B O     1 
ATOM   479  C  CB    . GLU A 1 70  ? 3.08700   18.18800 32.82100  1.000 86.45215  ? 68   GLU B CB    1 
ATOM   480  C  CG    . GLU A 1 70  ? 1.79100   17.50800 32.36700  1.000 94.42424  ? 68   GLU B CG    1 
ATOM   481  C  CD    . GLU A 1 70  ? 1.92500   16.78300 31.02300  1.000 99.94553  ? 68   GLU B CD    1 
ATOM   482  O  OE1   . GLU A 1 70  ? 0.89000   16.59100 30.33500  1.000 104.78106 ? 68   GLU B OE1   1 
ATOM   483  O  OE2   . GLU A 1 70  ? 3.05800   16.40300 30.65600  1.000 97.05505  ? 68   GLU B OE2   1 
ATOM   484  N  N     . ARG A 1 71  ? 3.00200   21.89700 32.61600  1.000 101.14809 ? 69   ARG B N     1 
ATOM   485  C  CA    . ARG A 1 71  ? 2.31900   23.08700 33.10800  1.000 102.60258 ? 69   ARG B CA    1 
ATOM   486  C  C     . ARG A 1 71  ? 1.29400   23.58000 32.09700  1.000 100.66375 ? 69   ARG B C     1 
ATOM   487  O  O     . ARG A 1 71  ? 1.18700   24.78100 31.83200  1.000 100.16403 ? 69   ARG B O     1 
ATOM   488  C  CB    . ARG A 1 71  ? 3.33900   24.16800 33.44700  1.000 103.08004 ? 69   ARG B CB    1 
ATOM   489  C  CG    . ARG A 1 71  ? 4.55300   23.60700 34.19600  1.000 104.01923 ? 69   ARG B CG    1 
ATOM   490  C  CD    . ARG A 1 71  ? 4.25400   23.37200 35.67700  1.000 108.55522 ? 69   ARG B CD    1 
ATOM   491  N  NE    . ARG A 1 71  ? 3.27000   22.30700 35.91300  1.000 112.55778 ? 69   ARG B NE    1 
ATOM   492  C  CZ    . ARG A 1 71  ? 3.56600   21.02400 36.10600  1.000 112.66557 ? 69   ARG B CZ    1 
ATOM   493  N  NH1   . ARG A 1 71  ? 4.82900   20.61600 36.09200  1.000 113.79235 ? 69   ARG B NH1   1 
ATOM   494  N  NH2   . ARG A 1 71  ? 2.58900   20.14600 36.30600  1.000 110.60397 ? 69   ARG B NH2   1 
ATOM   495  N  N     . PHE A 1 72  ? 0.54300   22.64100 31.50600  1.000 88.27071  ? 70   PHE B N     1 
ATOM   496  C  CA    . PHE A 1 72  ? -0.56900  22.96300 30.61400  1.000 92.63524  ? 70   PHE B CA    1 
ATOM   497  C  C     . PHE A 1 72  ? -1.83800  23.25700 31.40400  1.000 99.42535  ? 70   PHE B C     1 
ATOM   498  O  O     . PHE A 1 72  ? -2.45000  24.32200 31.25900  1.000 98.16434  ? 70   PHE B O     1 
ATOM   499  C  CB    . PHE A 1 72  ? -0.87600  21.80100 29.65900  1.000 90.20617  ? 70   PHE B CB    1 
ATOM   500  C  CG    . PHE A 1 72  ? 0.32200   21.05600 29.13200  1.000 88.60473  ? 70   PHE B CG    1 
ATOM   501  C  CD1   . PHE A 1 72  ? 0.19600   19.70800 28.81100  1.000 89.46274  ? 70   PHE B CD1   1 
ATOM   502  C  CD2   . PHE A 1 72  ? 1.53200   21.68000 28.88900  1.000 88.75197  ? 70   PHE B CD2   1 
ATOM   503  C  CE1   . PHE A 1 72  ? 1.27100   18.98800 28.29700  1.000 91.40192  ? 70   PHE B CE1   1 
ATOM   504  C  CE2   . PHE A 1 72  ? 2.61200   20.95900 28.37900  1.000 90.69161  ? 70   PHE B CE2   1 
ATOM   505  C  CZ    . PHE A 1 72  ? 2.48000   19.61400 28.08100  1.000 91.64050  ? 70   PHE B CZ    1 
ATOM   506  N  N     . GLN A 1 73  ? -2.23800  22.29800 32.23900  1.000 112.62160 ? 71   GLN B N     1 
ATOM   507  C  CA    . GLN A 1 73  ? -3.60700  22.18800 32.72100  1.000 112.67717 ? 71   GLN B CA    1 
ATOM   508  C  C     . GLN A 1 73  ? -4.01800  23.42900 33.50500  1.000 113.78462 ? 71   GLN B C     1 
ATOM   509  O  O     . GLN A 1 73  ? -3.18800  24.10100 34.12500  1.000 112.85285 ? 71   GLN B O     1 
ATOM   510  C  CB    . GLN A 1 73  ? -3.74800  20.93000 33.58000  1.000 111.68881 ? 71   GLN B CB    1 
ATOM   511  C  CG    . GLN A 1 73  ? -3.79500  19.64100 32.75500  1.000 113.79350 ? 71   GLN B CG    1 
ATOM   512  C  CD    . GLN A 1 73  ? -2.46200  18.90500 32.72800  1.000 114.80938 ? 71   GLN B CD    1 
ATOM   513  O  OE1   . GLN A 1 73  ? -1.68300  18.97000 33.67900  1.000 117.79013 ? 71   GLN B OE1   1 
ATOM   514  N  NE2   . GLN A 1 73  ? -2.18900  18.21500 31.62500  1.000 114.07209 ? 71   GLN B NE2   1 
ATOM   515  N  N     . SER A 1 74  ? -5.31900  23.74400 33.42900  1.000 127.82607 ? 72   SER B N     1 
ATOM   516  C  CA    . SER A 1 74  ? -5.94700  24.92600 34.02300  1.000 126.67405 ? 72   SER B CA    1 
ATOM   517  C  C     . SER A 1 74  ? -5.52600  26.19600 33.29300  1.000 121.91685 ? 72   SER B C     1 
ATOM   518  O  O     . SER A 1 74  ? -6.18100  27.23700 33.42500  1.000 127.44340 ? 72   SER B O     1 
ATOM   519  C  CB    . SER A 1 74  ? -5.62900  25.04700 35.52100  1.000 126.44065 ? 72   SER B CB    1 
ATOM   520  O  OG    . SER A 1 74  ? -6.22600  26.20200 36.09300  1.000 125.53566 ? 72   SER B OG    1 
ATOM   521  N  N     . LEU A 1 75  ? -4.44600  26.12700 32.51700  1.000 68.36782  ? 73   LEU B N     1 
ATOM   522  C  CA    . LEU A 1 75  ? -3.91800  27.29200 31.82500  1.000 58.03093  ? 73   LEU B CA    1 
ATOM   523  C  C     . LEU A 1 75  ? -4.16600  27.17700 30.32600  1.000 50.49671  ? 73   LEU B C     1 
ATOM   524  O  O     . LEU A 1 75  ? -3.85000  26.15100 29.70200  1.000 45.69208  ? 73   LEU B O     1 
ATOM   525  C  CB    . LEU A 1 75  ? -2.42900  27.48700 32.12200  1.000 54.94682  ? 73   LEU B CB    1 
ATOM   526  C  CG    . LEU A 1 75  ? -2.12700  28.01100 33.52500  1.000 48.91947  ? 73   LEU B CG    1 
ATOM   527  C  CD1   . LEU A 1 75  ? -0.82700  28.81100 33.54800  1.000 52.08583  ? 73   LEU B CD1   1 
ATOM   528  C  CD2   . LEU A 1 75  ? -3.28400  28.84700 34.01000  1.000 43.14743  ? 73   LEU B CD2   1 
ATOM   529  N  N     . GLY A 1 76  ? -4.71000  28.24500 29.75300  1.000 48.90784  ? 74   GLY B N     1 
ATOM   530  C  CA    . GLY A 1 76  ? -5.14400  28.22400 28.37900  1.000 53.30849  ? 74   GLY B CA    1 
ATOM   531  C  C     . GLY A 1 76  ? -4.03500  28.54500 27.39700  1.000 56.14689  ? 74   GLY B C     1 
ATOM   532  O  O     . GLY A 1 76  ? -2.85700  28.65500 27.73300  1.000 59.31511  ? 74   GLY B O     1 
ATOM   533  N  N     . VAL A 1 77  ? -4.44900  28.72200 26.14700  1.000 52.70370  ? 75   VAL B N     1 
ATOM   534  C  CA    . VAL A 1 77  ? -3.52100  28.71700 25.03000  1.000 46.71679  ? 75   VAL B CA    1 
ATOM   535  C  C     . VAL A 1 77  ? -4.07500  29.64400 23.94900  1.000 50.43926  ? 75   VAL B C     1 
ATOM   536  O  O     . VAL A 1 77  ? -3.75100  29.52200 22.76400  1.000 46.81157  ? 75   VAL B O     1 
ATOM   537  C  CB    . VAL A 1 77  ? -3.30400  27.26200 24.56000  1.000 41.80698  ? 75   VAL B CB    1 
ATOM   538  C  CG1   . VAL A 1 77  ? -4.37000  26.75200 23.53600  1.000 41.86366  ? 75   VAL B CG1   1 
ATOM   539  C  CG2   . VAL A 1 77  ? -1.87100  27.03100 24.14600  1.000 42.36189  ? 75   VAL B CG2   1 
ATOM   540  N  N     . ALA A 1 78  ? -4.89600  30.61200 24.36700  1.000 46.09919  ? 76   ALA B N     1 
ATOM   541  C  CA    . ALA A 1 78  ? -5.45700  31.58000 23.43400  1.000 38.03667  ? 76   ALA B CA    1 
ATOM   542  C  C     . ALA A 1 78  ? -4.40400  32.20700 22.52700  1.000 41.48487  ? 76   ALA B C     1 
ATOM   543  O  O     . ALA A 1 78  ? -4.74900  32.67600 21.43900  1.000 47.86666  ? 76   ALA B O     1 
ATOM   544  C  CB    . ALA A 1 78  ? -6.19800  32.68000 24.20000  1.000 31.21859  ? 76   ALA B CB    1 
ATOM   545  N  N     . PHE A 1 79  ? -3.12500  32.21000 22.92900  1.000 48.87179  ? 77   PHE B N     1 
ATOM   546  C  CA    . PHE A 1 79  ? -2.10500  32.87000 22.11200  1.000 49.65618  ? 77   PHE B CA    1 
ATOM   547  C  C     . PHE A 1 79  ? -1.77900  32.11600 20.82500  1.000 45.15704  ? 77   PHE B C     1 
ATOM   548  O  O     . PHE A 1 79  ? -1.04100  32.66100 20.00400  1.000 46.42304  ? 77   PHE B O     1 
ATOM   549  C  CB    . PHE A 1 79  ? -0.81600  33.11900 22.91800  1.000 48.04375  ? 77   PHE B CB    1 
ATOM   550  C  CG    . PHE A 1 79  ? -0.04000  31.87300 23.24400  1.000 50.81511  ? 77   PHE B CG    1 
ATOM   551  C  CD1   . PHE A 1 79  ? -0.35400  31.11100 24.35800  1.000 50.64684  ? 77   PHE B CD1   1 
ATOM   552  C  CD2   . PHE A 1 79  ? 1.00400   31.46000 22.43600  1.000 51.86882  ? 77   PHE B CD2   1 
ATOM   553  C  CE1   . PHE A 1 79  ? 0.36200   29.96400 24.66100  1.000 46.87840  ? 77   PHE B CE1   1 
ATOM   554  C  CE2   . PHE A 1 79  ? 1.71900   30.30800 22.73100  1.000 48.93062  ? 77   PHE B CE2   1 
ATOM   555  C  CZ    . PHE A 1 79  ? 1.40000   29.56500 23.84200  1.000 48.37075  ? 77   PHE B CZ    1 
ATOM   556  N  N     . TYR A 1 80  ? -2.31600  30.91000 20.61000  1.000 34.33421  ? 78   TYR B N     1 
ATOM   557  C  CA    . TYR A 1 80  ? -2.15200  30.25000 19.31800  1.000 30.17054  ? 78   TYR B CA    1 
ATOM   558  C  C     . TYR A 1 80  ? -2.85300  31.00500 18.20200  1.000 40.92966  ? 78   TYR B C     1 
ATOM   559  O  O     . TYR A 1 80  ? -2.42200  30.92900 17.04900  1.000 44.34736  ? 78   TYR B O     1 
ATOM   560  C  CB    . TYR A 1 80  ? -2.69400  28.82100 19.34400  1.000 30.72858  ? 78   TYR B CB    1 
ATOM   561  C  CG    . TYR A 1 80  ? -1.86900  27.84600 20.14200  1.000 34.44864  ? 78   TYR B CG    1 
ATOM   562  C  CD1   . TYR A 1 80  ? -0.74100  28.27400 20.84100  1.000 33.29405  ? 78   TYR B CD1   1 
ATOM   563  C  CD2   . TYR A 1 80  ? -2.22600  26.49600 20.21700  1.000 33.00042  ? 78   TYR B CD2   1 
ATOM   564  C  CE1   . TYR A 1 80  ? 0.00900   27.39600 21.59800  1.000 29.43469  ? 78   TYR B CE1   1 
ATOM   565  C  CE2   . TYR A 1 80  ? -1.47400  25.60800 20.96400  1.000 31.84334  ? 78   TYR B CE2   1 
ATOM   566  C  CZ    . TYR A 1 80  ? -0.35700  26.06700 21.65200  1.000 32.73854  ? 78   TYR B CZ    1 
ATOM   567  O  OH    . TYR A 1 80  ? 0.38500   25.20400 22.42200  1.000 33.03823  ? 78   TYR B OH    1 
ATOM   568  N  N     . ARG A 1 81  ? -3.94800  31.69900 18.51000  1.000 60.54555  ? 79   ARG B N     1 
ATOM   569  C  CA    . ARG A 1 81  ? -4.73300  32.35600 17.47200  1.000 59.66132  ? 79   ARG B CA    1 
ATOM   570  C  C     . ARG A 1 81  ? -3.90700  33.40200 16.73900  1.000 56.26090  ? 79   ARG B C     1 
ATOM   571  O  O     . ARG A 1 81  ? -3.16200  34.18100 17.34900  1.000 59.66212  ? 79   ARG B O     1 
ATOM   572  C  CB    . ARG A 1 81  ? -5.96900  33.01200 18.07200  1.000 57.51409  ? 79   ARG B CB    1 
ATOM   573  C  CG    . ARG A 1 81  ? -6.90100  32.03500 18.68600  1.000 65.45352  ? 79   ARG B CG    1 
ATOM   574  C  CD    . ARG A 1 81  ? -7.77400  31.38800 17.64700  1.000 74.91896  ? 79   ARG B CD    1 
ATOM   575  N  NE    . ARG A 1 81  ? -8.39600  30.18000 18.17600  1.000 79.16962  ? 79   ARG B NE    1 
ATOM   576  C  CZ    . ARG A 1 81  ? -9.46500  29.59200 17.65000  1.000 77.08366  ? 79   ARG B CZ    1 
ATOM   577  N  NH1   . ARG A 1 81  ? -10.06000 30.10300 16.58200  1.000 74.29727  ? 79   ARG B NH1   1 
ATOM   578  N  NH2   . ARG A 1 81  ? -9.93800  28.48900 18.20000  1.000 78.16299  ? 79   ARG B NH2   1 
ATOM   579  N  N     . GLY A 1 82  ? -4.06600  33.42200 15.41900  1.000 37.70222  ? 80   GLY B N     1 
ATOM   580  C  CA    . GLY A 1 82  ? -3.28900  34.28800 14.56700  1.000 42.86008  ? 80   GLY B CA    1 
ATOM   581  C  C     . GLY A 1 82  ? -1.89600  33.78300 14.29700  1.000 39.08099  ? 80   GLY B C     1 
ATOM   582  O  O     . GLY A 1 82  ? -1.08400  34.52500 13.72800  1.000 36.47439  ? 80   GLY B O     1 
ATOM   583  N  N     . ALA A 1 83  ? -1.59300  32.55200 14.71200  1.000 40.89538  ? 81   ALA B N     1 
ATOM   584  C  CA    . ALA A 1 83  ? -0.30300  31.95400 14.42100  1.000 39.84500  ? 81   ALA B CA    1 
ATOM   585  C  C     . ALA A 1 83  ? -0.12900  31.86600 12.92300  1.000 43.56311  ? 81   ALA B C     1 
ATOM   586  O  O     . ALA A 1 83  ? -0.95500  31.27700 12.21700  1.000 43.23042  ? 81   ALA B O     1 
ATOM   587  C  CB    . ALA A 1 83  ? -0.18600  30.57000 15.04200  1.000 35.77396  ? 81   ALA B CB    1 
ATOM   588  N  N     . ASP A 1 84  ? 0.93400   32.48400 12.44600  1.000 44.41283  ? 82   ASP B N     1 
ATOM   589  C  CA    . ASP A 1 84  ? 1.24500   32.45100 11.03800  1.000 39.99926  ? 82   ASP B CA    1 
ATOM   590  C  C     . ASP A 1 84  ? 2.14000   31.26800 10.68300  1.000 40.92265  ? 82   ASP B C     1 
ATOM   591  O  O     . ASP A 1 84  ? 2.12600   30.83200 9.53100   1.000 40.63112  ? 82   ASP B O     1 
ATOM   592  C  CB    . ASP A 1 84  ? 1.83800   33.80500 10.64600  1.000 35.39564  ? 82   ASP B CB    1 
ATOM   593  C  CG    . ASP A 1 84  ? 0.94300   34.98500 11.09900  1.000 44.65941  ? 82   ASP B CG    1 
ATOM   594  O  OD1   . ASP A 1 84  ? -0.26000  34.97500 10.76200  1.000 50.29149  ? 82   ASP B OD1   1 
ATOM   595  O  OD2   . ASP A 1 84  ? 1.41600   35.91500 11.79700  1.000 46.36096  ? 82   ASP B OD2   1 
ATOM   596  N  N     . CYS A 1 85  ? 2.83500   30.68200 11.66300  1.000 41.39003  ? 83   CYS B N     1 
ATOM   597  C  CA    . CYS A 1 85  ? 3.63600   29.47700 11.46900  1.000 36.31232  ? 83   CYS B CA    1 
ATOM   598  C  C     . CYS A 1 85  ? 3.80100   28.77000 12.81400  1.000 33.67937  ? 83   CYS B C     1 
ATOM   599  O  O     . CYS A 1 85  ? 3.86200   29.41700 13.86300  1.000 34.43887  ? 83   CYS B O     1 
ATOM   600  C  CB    . CYS A 1 85  ? 5.01700   29.79600 10.87000  1.000 38.37671  ? 83   CYS B CB    1 
ATOM   601  S  SG    . CYS A 1 85  ? 6.02600   28.30600 10.54200  1.000 41.22883  ? 83   CYS B SG    1 
ATOM   602  N  N     . CYS A 1 86  ? 3.92000   27.44200 12.76400  1.000 33.13514  ? 84   CYS B N     1 
ATOM   603  C  CA    . CYS A 1 86  ? 4.05700   26.59000 13.94500  1.000 37.34523  ? 84   CYS B CA    1 
ATOM   604  C  C     . CYS A 1 86  ? 5.28900   25.69400 13.80800  1.000 37.50079  ? 84   CYS B C     1 
ATOM   605  O  O     . CYS A 1 86  ? 5.46200   25.02100 12.78300  1.000 38.93623  ? 84   CYS B O     1 
ATOM   606  C  CB    . CYS A 1 86  ? 2.78800   25.73300 14.13200  1.000 44.47932  ? 84   CYS B CB    1 
ATOM   607  S  SG    . CYS A 1 86  ? 2.94500   24.32900 15.26200  1.000 44.56478  ? 84   CYS B SG    1 
ATOM   608  N  N     . VAL A 1 87  ? 6.13100   25.67700 14.84000  1.000 29.12879  ? 85   VAL B N     1 
ATOM   609  C  CA    . VAL A 1 87  ? 7.40800   24.96800 14.82200  1.000 28.44948  ? 85   VAL B CA    1 
ATOM   610  C  C     . VAL A 1 87  ? 7.33800   23.78300 15.77200  1.000 32.25818  ? 85   VAL B C     1 
ATOM   611  O  O     . VAL A 1 87  ? 6.99800   23.94100 16.94700  1.000 31.05563  ? 85   VAL B O     1 
ATOM   612  C  CB    . VAL A 1 87  ? 8.57000   25.89500 15.21000  1.000 27.21002  ? 85   VAL B CB    1 
ATOM   613  C  CG1   . VAL A 1 87  ? 9.89000   25.29000 14.78300  1.000 29.51235  ? 85   VAL B CG1   1 
ATOM   614  C  CG2   . VAL A 1 87  ? 8.38200   27.26100 14.58500  1.000 28.66484  ? 85   VAL B CG2   1 
ATOM   615  N  N     . LEU A 1 88  ? 7.68600   22.60700 15.27500  1.000 43.27083  ? 86   LEU B N     1 
ATOM   616  C  CA    . LEU A 1 88  ? 7.69400   21.38700 16.07000  1.000 42.74837  ? 86   LEU B CA    1 
ATOM   617  C  C     . LEU A 1 88  ? 9.13800   20.92500 16.25600  1.000 42.49263  ? 86   LEU B C     1 
ATOM   618  O  O     . LEU A 1 88  ? 9.83700   20.64300 15.27600  1.000 52.37265  ? 86   LEU B O     1 
ATOM   619  C  CB    . LEU A 1 88  ? 6.85300   20.30300 15.39500  1.000 42.22086  ? 86   LEU B CB    1 
ATOM   620  C  CG    . LEU A 1 88  ? 5.41500   20.64900 14.98300  1.000 37.34106  ? 86   LEU B CG    1 
ATOM   621  C  CD1   . LEU A 1 88  ? 4.79100   19.41200 14.36300  1.000 37.05398  ? 86   LEU B CD1   1 
ATOM   622  C  CD2   . LEU A 1 88  ? 4.56300   21.15900 16.13900  1.000 35.06455  ? 86   LEU B CD2   1 
ATOM   623  N  N     . VAL A 1 89  ? 9.58600   20.85100 17.50500  1.000 31.56658  ? 87   VAL B N     1 
ATOM   624  C  CA    . VAL A 1 89  ? 10.96200  20.49900 17.83000  1.000 36.80296  ? 87   VAL B CA    1 
ATOM   625  C  C     . VAL A 1 89  ? 10.98500  19.11800 18.46100  1.000 41.92513  ? 87   VAL B C     1 
ATOM   626  O  O     . VAL A 1 89  ? 10.30100  18.88000 19.46400  1.000 43.34609  ? 87   VAL B O     1 
ATOM   627  C  CB    . VAL A 1 89  ? 11.59200  21.52700 18.78300  1.000 39.67397  ? 87   VAL B CB    1 
ATOM   628  C  CG1   . VAL A 1 89  ? 13.10100  21.28900 18.90100  1.000 37.51046  ? 87   VAL B CG1   1 
ATOM   629  C  CG2   . VAL A 1 89  ? 11.28400  22.94100 18.31500  1.000 36.13960  ? 87   VAL B CG2   1 
ATOM   630  N  N     . PHE A 1 90  ? 11.79300  18.22000 17.90100  1.000 48.96678  ? 88   PHE B N     1 
ATOM   631  C  CA    . PHE A 1 90  ? 12.08900  16.95900 18.56500  1.000 52.70228  ? 88   PHE B CA    1 
ATOM   632  C  C     . PHE A 1 90  ? 13.59600  16.80000 18.79200  1.000 54.53286  ? 88   PHE B C     1 
ATOM   633  O  O     . PHE A 1 90  ? 14.42500  17.53200 18.24400  1.000 56.73208  ? 88   PHE B O     1 
ATOM   634  C  CB    . PHE A 1 90  ? 11.48200  15.75600 17.79500  1.000 51.19203  ? 88   PHE B CB    1 
ATOM   635  C  CG    . PHE A 1 90  ? 12.18600  15.39400 16.51400  1.000 53.90226  ? 88   PHE B CG    1 
ATOM   636  C  CD1   . PHE A 1 90  ? 11.92400  16.08200 15.33700  1.000 55.24427  ? 88   PHE B CD1   1 
ATOM   637  C  CD2   . PHE A 1 90  ? 13.06600  14.32300 16.47400  1.000 55.62797  ? 88   PHE B CD2   1 
ATOM   638  C  CE1   . PHE A 1 90  ? 12.56000  15.73500 14.15400  1.000 56.61533  ? 88   PHE B CE1   1 
ATOM   639  C  CE2   . PHE A 1 90  ? 13.70600  13.97100 15.29300  1.000 56.41424  ? 88   PHE B CE2   1 
ATOM   640  C  CZ    . PHE A 1 90  ? 13.45100  14.67800 14.13200  1.000 57.63739  ? 88   PHE B CZ    1 
ATOM   641  N  N     . ASP A 1 91  ? 13.92800  15.86100 19.67100  1.000 53.41962  ? 89   ASP B N     1 
ATOM   642  C  CA    . ASP A 1 91  ? 15.30200  15.49300 19.99100  1.000 53.60146  ? 89   ASP B CA    1 
ATOM   643  C  C     . ASP A 1 91  ? 15.70200  14.27500 19.16100  1.000 53.73773  ? 89   ASP B C     1 
ATOM   644  O  O     . ASP A 1 91  ? 15.04900  13.23100 19.24400  1.000 53.83712  ? 89   ASP B O     1 
ATOM   645  C  CB    . ASP A 1 91  ? 15.39200  15.19200 21.49000  1.000 56.98524  ? 89   ASP B CB    1 
ATOM   646  C  CG    . ASP A 1 91  ? 16.80800  15.05900 21.99000  1.000 61.65409  ? 89   ASP B CG    1 
ATOM   647  O  OD1   . ASP A 1 91  ? 17.67000  14.51000 21.26400  1.000 66.61306  ? 89   ASP B OD1   1 
ATOM   648  O  OD2   . ASP A 1 91  ? 17.04900  15.50800 23.13000  1.000 62.11305  ? 89   ASP B OD2   1 
ATOM   649  N  N     . VAL A 1 92  ? 16.77900  14.38800 18.37400  1.000 53.57400  ? 90   VAL B N     1 
ATOM   650  C  CA    . VAL A 1 92  ? 17.15100  13.25400 17.52300  1.000 52.49453  ? 90   VAL B CA    1 
ATOM   651  C  C     . VAL A 1 92  ? 17.69300  12.09200 18.34800  1.000 53.66825  ? 90   VAL B C     1 
ATOM   652  O  O     . VAL A 1 92  ? 17.75600  10.96000 17.85000  1.000 56.76733  ? 90   VAL B O     1 
ATOM   653  C  CB    . VAL A 1 92  ? 18.16300  13.65600 16.43200  1.000 52.67449  ? 90   VAL B CB    1 
ATOM   654  C  CG1   . VAL A 1 92  ? 17.48600  14.47000 15.34400  1.000 53.12473  ? 90   VAL B CG1   1 
ATOM   655  C  CG2   . VAL A 1 92  ? 19.34500  14.39900 17.02100  1.000 56.88508  ? 90   VAL B CG2   1 
ATOM   656  N  N     . THR A 1 93  ? 18.05100  12.34100 19.61100  1.000 50.49418  ? 91   THR B N     1 
ATOM   657  C  CA    . THR A 1 93  ? 18.60500  11.32700 20.49700  1.000 54.37873  ? 91   THR B CA    1 
ATOM   658  C  C     . THR A 1 93  ? 17.55900  10.65300 21.38600  1.000 63.47746  ? 91   THR B C     1 
ATOM   659  O  O     . THR A 1 93  ? 17.81700  9.55900  21.90600  1.000 68.71056  ? 91   THR B O     1 
ATOM   660  C  CB    . THR A 1 93  ? 19.68100  11.95900 21.37600  1.000 55.98786  ? 91   THR B CB    1 
ATOM   661  O  OG1   . THR A 1 93  ? 19.06300  12.59600 22.49900  1.000 58.78811  ? 91   THR B OG1   1 
ATOM   662  C  CG2   . THR A 1 93  ? 20.44700  13.01300 20.58000  1.000 52.95784  ? 91   THR B CG2   1 
ATOM   663  N  N     . ALA A 1 94  ? 16.39600  11.27800 21.58400  1.000 68.43314  ? 92   ALA B N     1 
ATOM   664  C  CA    . ALA A 1 94  ? 15.29200  10.67800 22.32600  1.000 66.41484  ? 92   ALA B CA    1 
ATOM   665  C  C     . ALA A 1 94  ? 14.17300  10.31200 21.35700  1.000 67.61233  ? 92   ALA B C     1 
ATOM   666  O  O     . ALA A 1 94  ? 13.34400  11.16800 21.01500  1.000 69.50546  ? 92   ALA B O     1 
ATOM   667  C  CB    . ALA A 1 94  ? 14.77900  11.64400 23.39900  1.000 63.61890  ? 92   ALA B CB    1 
ATOM   668  N  N     . PRO A 1 95  ? 14.07800  9.05100  20.91300  1.000 68.80663  ? 93   PRO B N     1 
ATOM   669  C  CA    . PRO A 1 95  ? 13.13900  8.72300  19.82500  1.000 68.63760  ? 93   PRO B CA    1 
ATOM   670  C  C     . PRO A 1 95  ? 11.67100  8.85400  20.20400  1.000 64.94105  ? 93   PRO B C     1 
ATOM   671  O  O     . PRO A 1 95  ? 10.82000  8.83800  19.31300  1.000 62.56666  ? 93   PRO B O     1 
ATOM   672  C  CB    . PRO A 1 95  ? 13.49400  7.27100  19.49000  1.000 69.15291  ? 93   PRO B CB    1 
ATOM   673  C  CG    . PRO A 1 95  ? 13.93200  6.72100  20.80100  1.000 71.03202  ? 93   PRO B CG    1 
ATOM   674  C  CD    . PRO A 1 95  ? 14.69800  7.84200  21.47800  1.000 70.12880  ? 93   PRO B CD    1 
ATOM   675  N  N     . ASN A 1 96  ? 11.34500  8.98400  21.48700  1.000 77.61888  ? 94   ASN B N     1 
ATOM   676  C  CA    . ASN A 1 96  ? 9.94800   9.13900  21.88000  1.000 81.09376  ? 94   ASN B CA    1 
ATOM   677  C  C     . ASN A 1 96  ? 9.40200   10.50300 21.46900  1.000 76.68954  ? 94   ASN B C     1 
ATOM   678  O  O     . ASN A 1 96  ? 8.24400   10.61000 21.05500  1.000 79.05347  ? 94   ASN B O     1 
ATOM   679  C  CB    . ASN A 1 96  ? 9.79300   8.91500  23.39200  1.000 84.66296  ? 94   ASN B CB    1 
ATOM   680  C  CG    . ASN A 1 96  ? 10.89300  9.59600  24.21500  1.000 90.22784  ? 94   ASN B CG    1 
ATOM   681  O  OD1   . ASN A 1 96  ? 12.09400  9.41400  23.96900  1.000 91.50567  ? 94   ASN B OD1   1 
ATOM   682  N  ND2   . ASN A 1 96  ? 10.47800  10.38100 25.20700  1.000 91.08942  ? 94   ASN B ND2   1 
ATOM   683  N  N     . THR A 1 97  ? 10.21700  11.55600 21.55900  1.000 58.73480  ? 95   THR B N     1 
ATOM   684  C  CA    . THR A 1 97  ? 9.71100   12.88200 21.22700  1.000 53.31872  ? 95   THR B CA    1 
ATOM   685  C  C     . THR A 1 97  ? 9.44200   13.01700 19.73100  1.000 53.09871  ? 95   THR B C     1 
ATOM   686  O  O     . THR A 1 97  ? 8.55600   13.77800 19.33700  1.000 50.31627  ? 95   THR B O     1 
ATOM   687  C  CB    . THR A 1 97  ? 10.69400  13.97000 21.69200  1.000 49.93127  ? 95   THR B CB    1 
ATOM   688  O  OG1   . THR A 1 97  ? 11.91200  13.87200 20.94900  1.000 45.88064  ? 95   THR B OG1   1 
ATOM   689  C  CG2   . THR A 1 97  ? 11.02800  13.81800 23.17700  1.000 44.68385  ? 95   THR B CG2   1 
ATOM   690  N  N     . PHE A 1 98  ? 10.17700  12.28700 18.88200  1.000 51.52797  ? 96   PHE B N     1 
ATOM   691  C  CA    . PHE A 1 98  ? 9.78400   12.22000 17.47900  1.000 46.77925  ? 96   PHE B CA    1 
ATOM   692  C  C     . PHE A 1 98  ? 8.44500   11.50600 17.31700  1.000 48.99568  ? 96   PHE B C     1 
ATOM   693  O  O     . PHE A 1 98  ? 7.70300   11.79800 16.37100  1.000 44.57377  ? 96   PHE B O     1 
ATOM   694  C  CB    . PHE A 1 98  ? 10.86500  11.53000 16.64400  1.000 44.41025  ? 96   PHE B CB    1 
ATOM   695  C  CG    . PHE A 1 98  ? 10.44100  11.23000 15.22200  1.000 45.36002  ? 96   PHE B CG    1 
ATOM   696  C  CD1   . PHE A 1 98  ? 10.32700  12.24900 14.27700  1.000 45.26956  ? 96   PHE B CD1   1 
ATOM   697  C  CD2   . PHE A 1 98  ? 10.16200  9.92400  14.82400  1.000 49.95283  ? 96   PHE B CD2   1 
ATOM   698  C  CE1   . PHE A 1 98  ? 9.94800   11.96700 12.94900  1.000 47.93976  ? 96   PHE B CE1   1 
ATOM   699  C  CE2   . PHE A 1 98  ? 9.78200   9.63200  13.50000  1.000 49.34678  ? 96   PHE B CE2   1 
ATOM   700  C  CZ    . PHE A 1 98  ? 9.67200   10.65700 12.56300  1.000 44.57417  ? 96   PHE B CZ    1 
ATOM   701  N  N     . LYS A 1 99  ? 8.12000   10.57700 18.23200  1.000 59.13180  ? 97   LYS B N     1 
ATOM   702  C  CA    . LYS A 1 99  ? 6.84500   9.86100  18.16100  1.000 57.69082  ? 97   LYS B CA    1 
ATOM   703  C  C     . LYS A 1 99  ? 5.67800   10.78200 18.50600  1.000 54.88797  ? 97   LYS B C     1 
ATOM   704  O  O     . LYS A 1 99  ? 4.62600   10.73900 17.85500  1.000 61.82199  ? 97   LYS B O     1 
ATOM   705  C  CB    . LYS A 1 99  ? 6.86000   8.63700  19.08900  1.000 57.59795  ? 97   LYS B CB    1 
ATOM   706  C  CG    . LYS A 1 99  ? 7.99200   7.63700  18.80100  1.000 59.67478  ? 97   LYS B CG    1 
ATOM   707  C  CD    . LYS A 1 99  ? 7.51000   6.19600  18.71700  1.000 62.64379  ? 97   LYS B CD    1 
ATOM   708  C  CE    . LYS A 1 99  ? 8.05500   5.32000  19.84800  1.000 64.71967  ? 97   LYS B CE    1 
ATOM   709  N  NZ    . LYS A 1 99  ? 7.11100   4.18600  20.19000  1.000 63.40896  ? 97   LYS B NZ    1 
ATOM   710  N  N     . THR A 1 100 ? 5.85100   11.63900 19.49900  1.000 44.65730  ? 98   THR B N     1 
ATOM   711  C  CA    . THR A 1 100 ? 4.79800   12.55500 19.90200  1.000 48.44325  ? 98   THR B CA    1 
ATOM   712  C  C     . THR A 1 100 ? 4.65900   13.75400 18.95800  1.000 50.12129  ? 98   THR B C     1 
ATOM   713  O  O     . THR A 1 100 ? 4.03000   14.75700 19.31300  1.000 51.85873  ? 98   THR B O     1 
ATOM   714  C  CB    . THR A 1 100 ? 5.03800   13.01100 21.34300  1.000 42.68560  ? 98   THR B CB    1 
ATOM   715  O  OG1   . THR A 1 100 ? 5.97100   14.09300 21.36000  1.000 36.64418  ? 98   THR B OG1   1 
ATOM   716  C  CG2   . THR A 1 100 ? 5.60700   11.86600 22.14500  1.000 46.31057  ? 98   THR B CG2   1 
ATOM   717  N  N     . LEU A 1 101 ? 5.21800   13.66900 17.75300  1.000 54.39196  ? 99   LEU B N     1 
ATOM   718  C  CA    . LEU A 1 101 ? 5.07900   14.76900 16.80400  1.000 55.63486  ? 99   LEU B CA    1 
ATOM   719  C  C     . LEU A 1 101 ? 3.63700   14.90500 16.34100  1.000 54.92378  ? 99   LEU B C     1 
ATOM   720  O  O     . LEU A 1 101 ? 3.06800   16.00100 16.39500  1.000 49.06320  ? 99   LEU B O     1 
ATOM   721  C  CB    . LEU A 1 101 ? 6.01300   14.57000 15.60600  1.000 53.21711  ? 99   LEU B CB    1 
ATOM   722  C  CG    . LEU A 1 101 ? 7.42300   15.12800 15.76000  1.000 43.82457  ? 99   LEU B CG    1 
ATOM   723  C  CD1   . LEU A 1 101 ? 8.11400   15.20200 14.39500  1.000 40.69329  ? 99   LEU B CD1   1 
ATOM   724  C  CD2   . LEU A 1 101 ? 7.38300   16.49000 16.45100  1.000 35.06774  ? 99   LEU B CD2   1 
ATOM   725  N  N     . ASP A 1 102 ? 3.04100   13.79700 15.86900  1.000 75.24525  ? 100  ASP B N     1 
ATOM   726  C  CA    . ASP A 1 102 ? 1.62300   13.76800 15.50800  1.000 76.14606  ? 100  ASP B CA    1 
ATOM   727  C  C     . ASP A 1 102 ? 0.75700   14.41400 16.59100  1.000 69.71745  ? 100  ASP B C     1 
ATOM   728  O  O     . ASP A 1 102 ? -0.12500  15.22900 16.28600  1.000 68.47813  ? 100  ASP B O     1 
ATOM   729  C  CB    . ASP A 1 102 ? 1.16800   12.31700 15.27000  1.000 83.34640  ? 100  ASP B CB    1 
ATOM   730  C  CG    . ASP A 1 102 ? 1.66100   11.73000 13.93900  1.000 85.46566  ? 100  ASP B CG    1 
ATOM   731  O  OD1   . ASP A 1 102 ? 1.27300   12.24800 12.86700  1.000 84.63415  ? 100  ASP B OD1   1 
ATOM   732  O  OD2   . ASP A 1 102 ? 2.41900   10.72800 13.97300  1.000 85.25799  ? 100  ASP B OD2   1 
ATOM   733  N  N     . SER A 1 103 ? 1.01200   14.07700 17.86600  1.000 54.62201  ? 101  SER B N     1 
ATOM   734  C  CA    . SER A 1 103 ? 0.19600   14.59400 18.95600  1.000 56.47717  ? 101  SER B CA    1 
ATOM   735  C  C     . SER A 1 103 ? 0.22600   16.12000 19.01800  1.000 56.93463  ? 101  SER B C     1 
ATOM   736  O  O     . SER A 1 103 ? -0.77100  16.74700 19.39600  1.000 56.54448  ? 101  SER B O     1 
ATOM   737  C  CB    . SER A 1 103 ? 0.67300   13.96600 20.28100  1.000 60.36595  ? 101  SER B CB    1 
ATOM   738  O  OG    . SER A 1 103 ? 0.52000   14.86400 21.37100  1.000 63.38708  ? 101  SER B OG    1 
ATOM   739  N  N     . TRP A 1 104 ? 1.35100   16.73400 18.65400  1.000 56.91439  ? 102  TRP B N     1 
ATOM   740  C  CA    . TRP A 1 104 ? 1.49600   18.18100 18.81000  1.000 55.71469  ? 102  TRP B CA    1 
ATOM   741  C  C     . TRP A 1 104 ? 0.83400   18.94600 17.66100  1.000 52.11635  ? 102  TRP B C     1 
ATOM   742  O  O     . TRP A 1 104 ? 0.09300   19.91200 17.89100  1.000 53.52180  ? 102  TRP B O     1 
ATOM   743  C  CB    . TRP A 1 104 ? 2.98100   18.55200 18.92700  1.000 53.07491  ? 102  TRP B CB    1 
ATOM   744  C  CG    . TRP A 1 104 ? 3.60500   18.28200 20.28300  1.000 47.52382  ? 102  TRP B CG    1 
ATOM   745  C  CD1   . TRP A 1 104 ? 4.50400   17.29900 20.59000  1.000 43.25580  ? 102  TRP B CD1   1 
ATOM   746  C  CD2   . TRP A 1 104 ? 3.39300   19.01900 21.49700  1.000 50.09228  ? 102  TRP B CD2   1 
ATOM   747  N  NE1   . TRP A 1 104 ? 4.86000   17.37100 21.91600  1.000 40.89388  ? 102  TRP B NE1   1 
ATOM   748  C  CE2   . TRP A 1 104 ? 4.20000   18.42000 22.49600  1.000 46.94338  ? 102  TRP B CE2   1 
ATOM   749  C  CE3   . TRP A 1 104 ? 2.60200   20.12300 21.84100  1.000 52.09807  ? 102  TRP B CE3   1 
ATOM   750  C  CZ2   . TRP A 1 104 ? 4.23500   18.88600 23.81200  1.000 51.98187  ? 102  TRP B CZ2   1 
ATOM   751  C  CZ3   . TRP A 1 104 ? 2.64600   20.59200 23.15700  1.000 52.23004  ? 102  TRP B CZ3   1 
ATOM   752  C  CH2   . TRP A 1 104 ? 3.45500   19.97000 24.12300  1.000 52.64599  ? 102  TRP B CH2   1 
ATOM   753  N  N     . ARG A 1 105 ? 1.11300   18.54400 16.41800  1.000 38.90181  ? 103  ARG B N     1 
ATOM   754  C  CA    . ARG A 1 105 ? 0.38500   19.07800 15.27300  1.000 42.18380  ? 103  ARG B CA    1 
ATOM   755  C  C     . ARG A 1 105 ? -1.12400  18.95700 15.47700  1.000 45.59717  ? 103  ARG B C     1 
ATOM   756  O  O     . ARG A 1 105 ? -1.84400  19.96100 15.46000  1.000 47.40656  ? 103  ARG B O     1 
ATOM   757  C  CB    . ARG A 1 105 ? 0.82900   18.35000 13.99700  1.000 41.23482  ? 103  ARG B CB    1 
ATOM   758  C  CG    . ARG A 1 105 ? 0.28400   18.89900 12.67400  1.000 43.83865  ? 103  ARG B CG    1 
ATOM   759  C  CD    . ARG A 1 105 ? 0.80100   18.04900 11.51400  1.000 47.90566  ? 103  ARG B CD    1 
ATOM   760  N  NE    . ARG A 1 105 ? 0.19900   18.40800 10.23500  1.000 51.20165  ? 103  ARG B NE    1 
ATOM   761  C  CZ    . ARG A 1 105 ? -0.89900  17.84800 9.74600   1.000 51.69757  ? 103  ARG B CZ    1 
ATOM   762  N  NH1   . ARG A 1 105 ? -1.52200  16.89600 10.43200  1.000 49.82051  ? 103  ARG B NH1   1 
ATOM   763  N  NH2   . ARG A 1 105 ? -1.36700  18.24000 8.57000   1.000 55.50097  ? 103  ARG B NH2   1 
ATOM   764  N  N     . ASP A 1 106 ? -1.61200  17.72900 15.69800  1.000 47.50551  ? 104  ASP B N     1 
ATOM   765  C  CA    . ASP A 1 106 ? -3.05400  17.49600 15.80100  1.000 44.29836  ? 104  ASP B CA    1 
ATOM   766  C  C     . ASP A 1 106 ? -3.69900  18.41500 16.83400  1.000 44.24474  ? 104  ASP B C     1 
ATOM   767  O  O     . ASP A 1 106 ? -4.77000  18.98800 16.58600  1.000 40.87291  ? 104  ASP B O     1 
ATOM   768  C  CB    . ASP A 1 106 ? -3.33900  16.02700 16.13300  1.000 44.76213  ? 104  ASP B CB    1 
ATOM   769  C  CG    . ASP A 1 106 ? -3.35000  15.13700 14.88900  1.000 53.55131  ? 104  ASP B CG    1 
ATOM   770  O  OD1   . ASP A 1 106 ? -3.34000  15.70200 13.77200  1.000 63.36860  ? 104  ASP B OD1   1 
ATOM   771  O  OD2   . ASP A 1 106 ? -3.38200  13.88900 15.02400  1.000 51.26354  ? 104  ASP B OD2   1 
ATOM   772  N  N     . GLU A 1 107 ? -3.05900  18.59600 17.98700  1.000 52.78310  ? 105  GLU B N     1 
ATOM   773  C  CA    . GLU A 1 107 ? -3.66300  19.47000 18.98800  1.000 51.81056  ? 105  GLU B CA    1 
ATOM   774  C  C     . GLU A 1 107 ? -3.58400  20.93600 18.59800  1.000 47.40074  ? 105  GLU B C     1 
ATOM   775  O  O     . GLU A 1 107 ? -4.46200  21.72300 18.97100  1.000 41.72465  ? 105  GLU B O     1 
ATOM   776  C  CB    . GLU A 1 107 ? -3.00800  19.26500 20.35300  1.000 49.86486  ? 105  GLU B CB    1 
ATOM   777  C  CG    . GLU A 1 107 ? -3.81600  19.89100 21.48100  1.000 56.00180  ? 105  GLU B CG    1 
ATOM   778  C  CD    . GLU A 1 107 ? -5.11500  19.12300 21.77900  1.000 63.22533  ? 105  GLU B CD    1 
ATOM   779  O  OE1   . GLU A 1 107 ? -5.30400  17.99800 21.24900  1.000 63.74439  ? 105  GLU B OE1   1 
ATOM   780  O  OE2   . GLU A 1 107 ? -5.96500  19.66800 22.52000  1.000 63.61540  ? 105  GLU B OE2   1 
ATOM   781  N  N     . PHE A 1 108 ? -2.53600  21.32500 17.87400  1.000 44.53274  ? 106  PHE B N     1 
ATOM   782  C  CA    . PHE A 1 108 ? -2.36100  22.72900 17.52700  1.000 42.93641  ? 106  PHE B CA    1 
ATOM   783  C  C     . PHE A 1 108 ? -3.40600  23.16500 16.50900  1.000 41.29535  ? 106  PHE B C     1 
ATOM   784  O  O     . PHE A 1 108 ? -4.01200  24.23800 16.63800  1.000 36.87970  ? 106  PHE B O     1 
ATOM   785  C  CB    . PHE A 1 108 ? -0.94600  22.96300 16.99200  1.000 38.29066  ? 106  PHE B CB    1 
ATOM   786  C  CG    . PHE A 1 108 ? -0.76700  24.30300 16.33700  1.000 32.79342  ? 106  PHE B CG    1 
ATOM   787  C  CD1   . PHE A 1 108 ? -0.55800  25.44000 17.10400  1.000 28.48298  ? 106  PHE B CD1   1 
ATOM   788  C  CD2   . PHE A 1 108 ? -0.83600  24.42900 14.96700  1.000 31.67168  ? 106  PHE B CD2   1 
ATOM   789  C  CE1   . PHE A 1 108 ? -0.41100  26.67800 16.51400  1.000 25.48474  ? 106  PHE B CE1   1 
ATOM   790  C  CE2   . PHE A 1 108 ? -0.69700  25.66000 14.38000  1.000 36.35386  ? 106  PHE B CE2   1 
ATOM   791  C  CZ    . PHE A 1 108 ? -0.47200  26.78700 15.15400  1.000 30.70387  ? 106  PHE B CZ    1 
ATOM   792  N  N     . LEU A 1 109 ? -3.61600  22.34200 15.47900  1.000 38.10678  ? 107  LEU B N     1 
ATOM   793  C  CA    . LEU A 1 109 ? -4.69100  22.57700 14.52800  1.000 37.38428  ? 107  LEU B CA    1 
ATOM   794  C  C     . LEU A 1 109 ? -6.05600  22.66200 15.20900  1.000 41.99278  ? 107  LEU B C     1 
ATOM   795  O  O     . LEU A 1 109 ? -6.96600  23.30700 14.68000  1.000 43.16837  ? 107  LEU B O     1 
ATOM   796  C  CB    . LEU A 1 109 ? -4.68700  21.47100 13.47800  1.000 36.45651  ? 107  LEU B CB    1 
ATOM   797  C  CG    . LEU A 1 109 ? -3.45000  21.37400 12.59700  1.000 43.02579  ? 107  LEU B CG    1 
ATOM   798  C  CD1   . LEU A 1 109 ? -3.49400  20.07000 11.84700  1.000 51.00041  ? 107  LEU B CD1   1 
ATOM   799  C  CD2   . LEU A 1 109 ? -3.36000  22.54500 11.63300  1.000 42.63794  ? 107  LEU B CD2   1 
ATOM   800  N  N     . ILE A 1 110 ? -6.21400  22.05600 16.38100  1.000 50.58999  ? 108  ILE B N     1 
ATOM   801  C  CA    . ILE A 1 110 ? -7.48500  22.13800 17.08400  1.000 50.21719  ? 108  ILE B CA    1 
ATOM   802  C  C     . ILE A 1 110 ? -7.58200  23.38600 17.96600  1.000 51.41035  ? 108  ILE B C     1 
ATOM   803  O  O     . ILE A 1 110 ? -8.68700  23.88800 18.20400  1.000 57.78283  ? 108  ILE B O     1 
ATOM   804  C  CB    . ILE A 1 110 ? -7.71100  20.84300 17.88500  1.000 49.64436  ? 108  ILE B CB    1 
ATOM   805  C  CG1   . ILE A 1 110 ? -7.87900  19.67300 16.91700  1.000 57.48428  ? 108  ILE B CG1   1 
ATOM   806  C  CG2   . ILE A 1 110 ? -8.92200  20.94200 18.83100  1.000 43.60103  ? 108  ILE B CG2   1 
ATOM   807  C  CD1   . ILE A 1 110 ? -8.01900  18.34300 17.59200  1.000 62.20492  ? 108  ILE B CD1   1 
ATOM   808  N  N     . GLN A 1 111 ? -6.46200  23.93300 18.43700  1.000 38.94083  ? 109  GLN B N     1 
ATOM   809  C  CA    . GLN A 1 111 ? -6.57700  25.08600 19.32400  1.000 41.32043  ? 109  GLN B CA    1 
ATOM   810  C  C     . GLN A 1 111 ? -6.41300  26.42100 18.60600  1.000 44.94757  ? 109  GLN B C     1 
ATOM   811  O  O     . GLN A 1 111 ? -7.00400  27.41800 19.04300  1.000 48.33092  ? 109  GLN B O     1 
ATOM   812  C  CB    . GLN A 1 111 ? -5.56000  24.98400 20.46400  1.000 48.06846  ? 109  GLN B CB    1 
ATOM   813  C  CG    . GLN A 1 111 ? -5.60300  23.67400 21.22100  1.000 51.89777  ? 109  GLN B CG    1 
ATOM   814  C  CD    . GLN A 1 111 ? -6.93700  23.43200 21.91600  1.000 54.01313  ? 109  GLN B CD    1 
ATOM   815  O  OE1   . GLN A 1 111 ? -7.39100  24.25300 22.71900  1.000 56.89775  ? 109  GLN B OE1   1 
ATOM   816  N  NE2   . GLN A 1 111 ? -7.56100  22.29200 21.62400  1.000 49.42939  ? 109  GLN B NE2   1 
ATOM   817  N  N     . ALA A 1 112 ? -5.63000  26.46900 17.52000  1.000 42.89850  ? 110  ALA B N     1 
ATOM   818  C  CA    . ALA A 1 112 ? -5.44400  27.68500 16.72900  1.000 42.21023  ? 110  ALA B CA    1 
ATOM   819  C  C     . ALA A 1 112 ? -6.47300  27.81700 15.61000  1.000 48.78958  ? 110  ALA B C     1 
ATOM   820  O  O     . ALA A 1 112 ? -6.86600  28.93600 15.25000  1.000 49.30309  ? 110  ALA B O     1 
ATOM   821  C  CB    . ALA A 1 112 ? -4.03700  27.71400 16.13200  1.000 47.04599  ? 110  ALA B CB    1 
ATOM   822  N  N     . SER A 1 113 ? -6.89100  26.68600 15.03000  1.000 54.23720  ? 111  SER B N     1 
ATOM   823  C  CA    . SER A 1 113 ? -8.06200  26.58500 14.15600  1.000 56.89460  ? 111  SER B CA    1 
ATOM   824  C  C     . SER A 1 113 ? -7.99300  27.42700 12.88200  1.000 56.11849  ? 111  SER B C     1 
ATOM   825  O  O     . SER A 1 113 ? -8.89100  28.24500 12.64900  1.000 56.09570  ? 111  SER B O     1 
ATOM   826  C  CB    . SER A 1 113 ? -9.30500  26.99000 14.94700  1.000 61.52038  ? 111  SER B CB    1 
ATOM   827  O  OG    . SER A 1 113 ? -10.46700 26.34800 14.45000  1.000 69.55005  ? 111  SER B OG    1 
ATOM   828  N  N     . PRO A 1 114 ? -6.97600  27.28300 12.03600  1.000 51.60028  ? 112  PRO B N     1 
ATOM   829  C  CA    . PRO A 1 114 ? -6.92500  28.09800 10.82000  1.000 49.81833  ? 112  PRO B CA    1 
ATOM   830  C  C     . PRO A 1 114 ? -7.80200  27.52100 9.71500   1.000 53.74094  ? 112  PRO B C     1 
ATOM   831  O  O     . PRO A 1 114 ? -8.04300  26.31000 9.64800   1.000 59.92318  ? 112  PRO B O     1 
ATOM   832  C  CB    . PRO A 1 114 ? -5.44100  28.04400 10.43800  1.000 47.83384  ? 112  PRO B CB    1 
ATOM   833  C  CG    . PRO A 1 114 ? -4.98200  26.70600 10.91700  1.000 42.36351  ? 112  PRO B CG    1 
ATOM   834  C  CD    . PRO A 1 114 ? -5.80400  26.39100 12.14800  1.000 44.59585  ? 112  PRO B CD    1 
ATOM   835  N  N     . ARG A 1 115 ? -8.28700  28.41000 8.84000   1.000 51.49615  ? 113  ARG B N     1 
ATOM   836  C  CA    . ARG A 1 115 ? -8.87100  27.94500 7.58600   1.000 48.73213  ? 113  ARG B CA    1 
ATOM   837  C  C     . ARG A 1 115 ? -7.83400  27.12500 6.83300   1.000 60.22839  ? 113  ARG B C     1 
ATOM   838  O  O     . ARG A 1 115 ? -6.65300  27.49700 6.76100   1.000 66.57777  ? 113  ARG B O     1 
ATOM   839  C  CB    . ARG A 1 115 ? -9.32000  29.10800 6.69400   1.000 50.29729  ? 113  ARG B CB    1 
ATOM   840  C  CG    . ARG A 1 115 ? -9.75400  30.35800 7.40300   1.000 54.82029  ? 113  ARG B CG    1 
ATOM   841  C  CD    . ARG A 1 115 ? -9.93900  31.48800 6.40700   1.000 51.27309  ? 113  ARG B CD    1 
ATOM   842  N  NE    . ARG A 1 115 ? -10.80600 31.10900 5.29500   1.000 59.15100  ? 113  ARG B NE    1 
ATOM   843  C  CZ    . ARG A 1 115 ? -11.83700 31.84200 4.86500   1.000 70.46061  ? 113  ARG B CZ    1 
ATOM   844  N  NH1   . ARG A 1 115 ? -12.14300 32.99300 5.45600   1.000 61.40757  ? 113  ARG B NH1   1 
ATOM   845  N  NH2   . ARG A 1 115 ? -12.57600 31.42400 3.84400   1.000 78.78381  ? 113  ARG B NH2   1 
ATOM   846  N  N     . ASP A 1 116 ? -8.28200  26.00200 6.28100   1.000 61.83013  ? 114  ASP B N     1 
ATOM   847  C  CA    . ASP A 1 116 ? -7.43100  25.09400 5.52200   1.000 63.72722  ? 114  ASP B CA    1 
ATOM   848  C  C     . ASP A 1 116 ? -6.27000  24.61200 6.38800   1.000 64.08105  ? 114  ASP B C     1 
ATOM   849  O  O     . ASP A 1 116 ? -5.12200  25.02100 6.18500   1.000 63.52114  ? 114  ASP B O     1 
ATOM   850  C  CB    . ASP A 1 116 ? -6.93000  25.78300 4.25200   1.000 61.91755  ? 114  ASP B CB    1 
ATOM   851  C  CG    . ASP A 1 116 ? -6.47700  24.80000 3.21200   1.000 67.60327  ? 114  ASP B CG    1 
ATOM   852  O  OD1   . ASP A 1 116 ? -6.74500  23.58900 3.41500   1.000 70.92361  ? 114  ASP B OD1   1 
ATOM   853  O  OD2   . ASP A 1 116 ? -5.86600  25.23700 2.20500   1.000 67.51185  ? 114  ASP B OD2   1 
ATOM   854  N  N     . PRO A 1 117 ? -6.52600  23.75200 7.37300   1.000 59.52586  ? 115  PRO B N     1 
ATOM   855  C  CA    . PRO A 1 117 ? -5.46300  23.40900 8.31700   1.000 60.53107  ? 115  PRO B CA    1 
ATOM   856  C  C     . PRO A 1 117 ? -4.37600  22.53800 7.72100   1.000 62.15993  ? 115  PRO B C     1 
ATOM   857  O  O     . PRO A 1 117 ? -3.28000  22.47000 8.29700   1.000 64.29809  ? 115  PRO B O     1 
ATOM   858  C  CB    . PRO A 1 117 ? -6.22000  22.68000 9.43200   1.000 62.87880  ? 115  PRO B CB    1 
ATOM   859  C  CG    . PRO A 1 117 ? -7.34500  22.02800 8.72000   1.000 61.70090  ? 115  PRO B CG    1 
ATOM   860  C  CD    . PRO A 1 117 ? -7.76300  23.00500 7.65400   1.000 60.31596  ? 115  PRO B CD    1 
ATOM   861  N  N     . GLU A 1 118 ? -4.62700  21.86700 6.59700   1.000 71.40393  ? 116  GLU B N     1 
ATOM   862  C  CA    . GLU A 1 118 ? -3.62700  20.97000 6.03300   1.000 73.60294  ? 116  GLU B CA    1 
ATOM   863  C  C     . GLU A 1 118 ? -2.80000  21.64100 4.94000   1.000 75.29001  ? 116  GLU B C     1 
ATOM   864  O  O     . GLU A 1 118 ? -1.93800  20.99500 4.33300   1.000 80.26412  ? 116  GLU B O     1 
ATOM   865  C  CB    . GLU A 1 118 ? -4.29100  19.67900 5.53800   1.000 75.14678  ? 116  GLU B CB    1 
ATOM   866  C  CG    . GLU A 1 118 ? -5.25200  19.03000 6.56600   1.000 83.69145  ? 116  GLU B CG    1 
ATOM   867  C  CD    . GLU A 1 118 ? -4.54800  18.39700 7.78700   1.000 84.37049  ? 116  GLU B CD    1 
ATOM   868  O  OE1   . GLU A 1 118 ? -4.59200  17.15500 7.94600   1.000 82.38774  ? 116  GLU B OE1   1 
ATOM   869  O  OE2   . GLU A 1 118 ? -3.96400  19.14400 8.60200   1.000 84.45263  ? 116  GLU B OE2   1 
ATOM   870  N  N     . ASN A 1 119 ? -3.03900  22.92900 4.68600   1.000 73.20719  ? 117  ASN B N     1 
ATOM   871  C  CA    . ASN A 1 119 ? -2.12800  23.78200 3.93500   1.000 71.10184  ? 117  ASN B CA    1 
ATOM   872  C  C     . ASN A 1 119 ? -1.53300  24.86900 4.82700   1.000 65.21629  ? 117  ASN B C     1 
ATOM   873  O  O     . ASN A 1 119 ? -1.10900  25.91700 4.33400   1.000 69.81687  ? 117  ASN B O     1 
ATOM   874  C  CB    . ASN A 1 119 ? -2.82900  24.40300 2.71900   1.000 76.69936  ? 117  ASN B CB    1 
ATOM   875  C  CG    . ASN A 1 119 ? -2.91200  23.44700 1.50900   1.000 82.63986  ? 117  ASN B CG    1 
ATOM   876  O  OD1   . ASN A 1 119 ? -2.71800  22.23200 1.63400   1.000 85.74021  ? 117  ASN B OD1   1 
ATOM   877  N  ND2   . ASN A 1 119 ? -3.19200  24.00900 0.33100   1.000 82.40861  ? 117  ASN B ND2   1 
ATOM   878  N  N     . PHE A 1 120 ? -1.50200  24.64000 6.13200   1.000 48.18342  ? 118  PHE B N     1 
ATOM   879  C  CA    . PHE A 1 120 ? -0.95500  25.50700 7.17100   1.000 41.60822  ? 118  PHE B CA    1 
ATOM   880  C  C     . PHE A 1 120 ? 0.51700   25.17800 7.40200   1.000 42.48821  ? 118  PHE B C     1 
ATOM   881  O  O     . PHE A 1 120 ? 0.88500   24.00000 7.51700   1.000 39.60027  ? 118  PHE B O     1 
ATOM   882  C  CB    . PHE A 1 120 ? -1.72000  25.34600 8.48300   1.000 37.17209  ? 118  PHE B CB    1 
ATOM   883  C  CG    . PHE A 1 120 ? -1.23400  26.25000 9.58300   1.000 39.61514  ? 118  PHE B CG    1 
ATOM   884  C  CD1   . PHE A 1 120 ? -1.74700  27.53300 9.72500   1.000 42.17563  ? 118  PHE B CD1   1 
ATOM   885  C  CD2   . PHE A 1 120 ? -0.26600  25.82000 10.47800  1.000 38.81799  ? 118  PHE B CD2   1 
ATOM   886  C  CE1   . PHE A 1 120 ? -1.30000  28.37400 10.73700  1.000 40.49056  ? 118  PHE B CE1   1 
ATOM   887  C  CE2   . PHE A 1 120 ? 0.18700   26.64800 11.48000  1.000 38.62050  ? 118  PHE B CE2   1 
ATOM   888  C  CZ    . PHE A 1 120 ? -0.33300  27.92600 11.62400  1.000 37.66426  ? 118  PHE B CZ    1 
ATOM   889  N  N     . PRO A 1 121 ? 1.35700   26.21300 7.49400   1.000 38.12921  ? 119  PRO B N     1 
ATOM   890  C  CA    . PRO A 1 121 ? 2.80900   26.00300 7.53700   1.000 37.98558  ? 119  PRO B CA    1 
ATOM   891  C  C     . PRO A 1 121 ? 3.24900   25.35900 8.85100   1.000 44.58375  ? 119  PRO B C     1 
ATOM   892  O  O     . PRO A 1 121 ? 2.96700   25.86400 9.93900   1.000 49.05018  ? 119  PRO B O     1 
ATOM   893  C  CB    . PRO A 1 121 ? 3.38500   27.41500 7.38000   1.000 33.67189  ? 119  PRO B CB    1 
ATOM   894  C  CG    . PRO A 1 121 ? 2.28100   28.31800 7.79300   1.000 33.28110  ? 119  PRO B CG    1 
ATOM   895  C  CD    . PRO A 1 121 ? 1.00600   27.64100 7.42600   1.000 37.26488  ? 119  PRO B CD    1 
ATOM   896  N  N     . PHE A 1 122 ? 3.94000   24.23900 8.72100   1.000 40.75001  ? 120  PHE B N     1 
ATOM   897  C  CA    . PHE A 1 122 ? 4.68200   23.65000 9.81600   1.000 35.19267  ? 120  PHE B CA    1 
ATOM   898  C  C     . PHE A 1 122 ? 6.14500   23.56700 9.40900   1.000 39.10181  ? 120  PHE B C     1 
ATOM   899  O  O     . PHE A 1 122 ? 6.47800   23.51000 8.21800   1.000 36.18402  ? 120  PHE B O     1 
ATOM   900  C  CB    . PHE A 1 122 ? 4.12900   22.27700 10.16900  1.000 38.14533  ? 120  PHE B CB    1 
ATOM   901  C  CG    . PHE A 1 122 ? 2.81900   22.33100 10.90200  1.000 44.67423  ? 120  PHE B CG    1 
ATOM   902  C  CD1   . PHE A 1 122 ? 2.78700   22.52800 12.27100  1.000 43.64344  ? 120  PHE B CD1   1 
ATOM   903  C  CD2   . PHE A 1 122 ? 1.61700   22.20300 10.22000  1.000 47.54957  ? 120  PHE B CD2   1 
ATOM   904  C  CE1   . PHE A 1 122 ? 1.59200   22.58300 12.94200  1.000 45.23417  ? 120  PHE B CE1   1 
ATOM   905  C  CE2   . PHE A 1 122 ? 0.40800   22.25700 10.89100  1.000 48.70359  ? 120  PHE B CE2   1 
ATOM   906  C  CZ    . PHE A 1 122 ? 0.39500   22.44700 12.25200  1.000 48.91180  ? 120  PHE B CZ    1 
ATOM   907  N  N     . VAL A 1 123 ? 7.01400   23.63500 10.41000  1.000 40.61676  ? 121  VAL B N     1 
ATOM   908  C  CA    . VAL A 1 123 ? 8.45300   23.50200 10.24000  1.000 37.34215  ? 121  VAL B CA    1 
ATOM   909  C  C     . VAL A 1 123 ? 8.95600   22.60400 11.35000  1.000 43.27826  ? 121  VAL B C     1 
ATOM   910  O  O     . VAL A 1 123 ? 8.73600   22.88900 12.53300  1.000 41.51384  ? 121  VAL B O     1 
ATOM   911  C  CB    . VAL A 1 123 ? 9.17400   24.85800 10.29200  1.000 31.78677  ? 121  VAL B CB    1 
ATOM   912  C  CG1   . VAL A 1 123 ? 10.70300  24.64800 10.41000  1.000 26.45830  ? 121  VAL B CG1   1 
ATOM   913  C  CG2   . VAL A 1 123 ? 8.80000   25.70600 9.08600   1.000 26.08736  ? 121  VAL B CG2   1 
ATOM   914  N  N     . VAL A 1 124 ? 9.62600   21.52400 10.97600  1.000 62.56774  ? 122  VAL B N     1 
ATOM   915  C  CA    . VAL A 1 124 ? 10.04100  20.49400 11.91500  1.000 65.73648  ? 122  VAL B CA    1 
ATOM   916  C  C     . VAL A 1 124 ? 11.54400  20.61700 12.14100  1.000 58.31363  ? 122  VAL B C     1 
ATOM   917  O  O     . VAL A 1 124 ? 12.32300  20.67700 11.18000  1.000 61.66606  ? 122  VAL B O     1 
ATOM   918  C  CB    . VAL A 1 124 ? 9.65300   19.09900 11.39500  1.000 68.75650  ? 122  VAL B CB    1 
ATOM   919  C  CG1   . VAL A 1 124 ? 9.96600   18.03700 12.42700  1.000 69.93444  ? 122  VAL B CG1   1 
ATOM   920  C  CG2   . VAL A 1 124 ? 8.18400   19.07700 11.01300  1.000 67.74335  ? 122  VAL B CG2   1 
ATOM   921  N  N     . LEU A 1 125 ? 11.94900  20.66900 13.40700  1.000 30.14677  ? 123  LEU B N     1 
ATOM   922  C  CA    . LEU A 1 125 ? 13.35400  20.78900 13.77900  1.000 28.30331  ? 123  LEU B CA    1 
ATOM   923  C  C     . LEU A 1 125 ? 13.78300  19.54000 14.53500  1.000 35.84876  ? 123  LEU B C     1 
ATOM   924  O  O     . LEU A 1 125 ? 13.26900  19.26800 15.62900  1.000 27.89594  ? 123  LEU B O     1 
ATOM   925  C  CB    . LEU A 1 125 ? 13.61200  22.02500 14.65200  1.000 22.30583  ? 123  LEU B CB    1 
ATOM   926  C  CG    . LEU A 1 125 ? 13.35400  23.42400 14.09600  1.000 21.86181  ? 123  LEU B CG    1 
ATOM   927  C  CD1   . LEU A 1 125 ? 14.09800  24.42600 14.92300  1.000 21.79826  ? 123  LEU B CD1   1 
ATOM   928  C  CD2   . LEU A 1 125 ? 13.73800  23.52800 12.62500  1.000 21.61755  ? 123  LEU B CD2   1 
ATOM   929  N  N     . GLY A 1 126 ? 14.73400  18.79600 13.96200  1.000 51.94656  ? 124  GLY B N     1 
ATOM   930  C  CA    . GLY A 1 126 ? 15.41400  17.75400 14.70600  1.000 52.16972  ? 124  GLY B CA    1 
ATOM   931  C  C     . GLY A 1 126 ? 16.63900  18.28100 15.43400  1.000 52.43662  ? 124  GLY B C     1 
ATOM   932  O  O     . GLY A 1 126 ? 17.71000  18.43400 14.84000  1.000 57.07598  ? 124  GLY B O     1 
ATOM   933  N  N     . ASN A 1 127 ? 16.49600  18.55500 16.72100  1.000 41.60956  ? 125  ASN B N     1 
ATOM   934  C  CA    . ASN A 1 127 ? 17.54200  19.20000 17.49700  1.000 42.17115  ? 125  ASN B CA    1 
ATOM   935  C  C     . ASN A 1 127 ? 18.52800  18.19400 18.07100  1.000 49.54399  ? 125  ASN B C     1 
ATOM   936  O  O     . ASN A 1 127 ? 18.21000  17.01900 18.27600  1.000 46.94691  ? 125  ASN B O     1 
ATOM   937  C  CB    . ASN A 1 127 ? 16.95400  20.00200 18.64900  1.000 37.31132  ? 125  ASN B CB    1 
ATOM   938  C  CG    . ASN A 1 127 ? 17.83600  21.14100 19.05500  1.000 36.41915  ? 125  ASN B CG    1 
ATOM   939  O  OD1   . ASN A 1 127 ? 18.40800  21.81100 18.20600  1.000 43.78299  ? 125  ASN B OD1   1 
ATOM   940  N  ND2   . ASN A 1 127 ? 17.95700  21.37400 20.35200  1.000 37.03212  ? 125  ASN B ND2   1 
ATOM   941  N  N     . LYS A 1 128 ? 19.73600  18.70400 18.35100  1.000 56.95694  ? 126  LYS B N     1 
ATOM   942  C  CA    . LYS A 1 128 ? 20.84100  18.04800 19.05400  1.000 51.17380  ? 126  LYS B CA    1 
ATOM   943  C  C     . LYS A 1 128 ? 21.65000  17.12100 18.15200  1.000 51.06159  ? 126  LYS B C     1 
ATOM   944  O  O     . LYS A 1 128 ? 22.14200  16.09400 18.62000  1.000 49.52208  ? 126  LYS B O     1 
ATOM   945  C  CB    . LYS A 1 128 ? 20.33000  17.28700 20.29000  1.000 46.36264  ? 126  LYS B CB    1 
ATOM   946  C  CG    . LYS A 1 128 ? 19.72200  18.20100 21.35200  1.000 48.00782  ? 126  LYS B CG    1 
ATOM   947  C  CD    . LYS A 1 128 ? 19.44500  17.50500 22.68000  1.000 46.39640  ? 126  LYS B CD    1 
ATOM   948  C  CE    . LYS A 1 128 ? 18.74000  18.45800 23.67500  1.000 47.99581  ? 126  LYS B CE    1 
ATOM   949  N  NZ    . LYS A 1 128 ? 18.02600  17.78100 24.81400  1.000 44.53661  ? 126  LYS B NZ    1 
ATOM   950  N  N     . ILE A 1 129 ? 21.81200  17.47200 16.86900  1.000 48.84108  ? 127  ILE B N     1 
ATOM   951  C  CA    . ILE A 1 129 ? 22.61100  16.64900 15.96200  1.000 47.20309  ? 127  ILE B CA    1 
ATOM   952  C  C     . ILE A 1 129 ? 24.09400  16.64000 16.30700  1.000 49.51545  ? 127  ILE B C     1 
ATOM   953  O  O     . ILE A 1 129 ? 24.85600  15.89500 15.67800  1.000 50.20486  ? 127  ILE B O     1 
ATOM   954  C  CB    . ILE A 1 129 ? 22.48900  17.07800 14.48200  1.000 41.30321  ? 127  ILE B CB    1 
ATOM   955  C  CG1   . ILE A 1 129 ? 22.64600  18.58500 14.32700  1.000 38.17217  ? 127  ILE B CG1   1 
ATOM   956  C  CG2   . ILE A 1 129 ? 21.20200  16.58500 13.85400  1.000 39.54025  ? 127  ILE B CG2   1 
ATOM   957  C  CD1   . ILE A 1 129 ? 22.79700  19.00800 12.88800  1.000 32.47952  ? 127  ILE B CD1   1 
ATOM   958  N  N     . ASP A 1 130 ? 24.53200  17.45500 17.27500  1.000 53.32744  ? 128  ASP B N     1 
ATOM   959  C  CA    . ASP A 1 130 ? 25.93900  17.48000 17.67800  1.000 54.56061  ? 128  ASP B CA    1 
ATOM   960  C  C     . ASP A 1 130 ? 26.31000  16.35000 18.63300  1.000 54.76137  ? 128  ASP B C     1 
ATOM   961  O  O     . ASP A 1 130 ? 27.50100  16.04900 18.77800  1.000 54.89831  ? 128  ASP B O     1 
ATOM   962  C  CB    . ASP A 1 130 ? 26.29300  18.81700 18.33400  1.000 54.06916  ? 128  ASP B CB    1 
ATOM   963  C  CG    . ASP A 1 130 ? 25.46200  19.10500 19.58000  1.000 53.90033  ? 128  ASP B CG    1 
ATOM   964  O  OD1   . ASP A 1 130 ? 24.31600  19.59800 19.43500  1.000 50.13547  ? 128  ASP B OD1   1 
ATOM   965  O  OD2   . ASP A 1 130 ? 25.95100  18.81300 20.70100  1.000 51.43970  ? 128  ASP B OD2   1 
ATOM   966  N  N     . LEU A 1 131 ? 25.32900  15.73600 19.29100  1.000 57.39467  ? 129  LEU B N     1 
ATOM   967  C  CA    . LEU A 1 131 ? 25.55900  14.58500 20.15000  1.000 59.31957  ? 129  LEU B CA    1 
ATOM   968  C  C     . LEU A 1 131 ? 25.68600  13.31900 19.30400  1.000 66.06260  ? 129  LEU B C     1 
ATOM   969  O  O     . LEU A 1 131 ? 25.35000  13.30300 18.11700  1.000 69.49587  ? 129  LEU B O     1 
ATOM   970  C  CB    . LEU A 1 131 ? 24.43200  14.44900 21.17400  1.000 49.38228  ? 129  LEU B CB    1 
ATOM   971  C  CG    . LEU A 1 131 ? 24.17700  15.71400 22.00300  1.000 53.74670  ? 129  LEU B CG    1 
ATOM   972  C  CD1   . LEU A 1 131 ? 23.11700  15.50300 23.10300  1.000 52.57382  ? 129  LEU B CD1   1 
ATOM   973  C  CD2   . LEU A 1 131 ? 25.47600  16.23000 22.59800  1.000 57.93016  ? 129  LEU B CD2   1 
ATOM   974  N  N     . GLU A 1 132 ? 26.19200  12.25100 19.92900  1.000 80.97884  ? 130  GLU B N     1 
ATOM   975  C  CA    . GLU A 1 132 ? 26.54900  11.04800 19.18300  1.000 87.10997  ? 130  GLU B CA    1 
ATOM   976  C  C     . GLU A 1 132 ? 25.58200  9.88100  19.38000  1.000 81.93760  ? 130  GLU B C     1 
ATOM   977  O  O     . GLU A 1 132 ? 25.63200  8.92200  18.58300  1.000 83.05904  ? 130  GLU B O     1 
ATOM   978  C  CB    . GLU A 1 132 ? 27.98100  10.61800 19.52500  1.000 96.11871  ? 130  GLU B CB    1 
ATOM   979  C  CG    . GLU A 1 132 ? 29.08400  11.16000 18.58100  1.000 100.30765 ? 130  GLU B CG    1 
ATOM   980  C  CD    . GLU A 1 132 ? 29.75400  12.44200 19.07400  1.000 101.87979 ? 130  GLU B CD    1 
ATOM   981  O  OE1   . GLU A 1 132 ? 29.43600  12.87800 20.20300  1.000 105.22235 ? 130  GLU B OE1   1 
ATOM   982  O  OE2   . GLU A 1 132 ? 30.58000  13.01900 18.32100  1.000 98.58980  ? 130  GLU B OE2   1 
ATOM   983  N  N     . ASN A 1 133 ? 24.68700  9.94400  20.37100  1.000 61.34893  ? 131  ASN B N     1 
ATOM   984  C  CA    . ASN A 1 133 ? 23.65200  8.91200  20.46600  1.000 63.57036  ? 131  ASN B CA    1 
ATOM   985  C  C     . ASN A 1 133 ? 22.39100  9.28700  19.67500  1.000 60.79207  ? 131  ASN B C     1 
ATOM   986  O  O     . ASN A 1 133 ? 21.27400  9.28000  20.18200  1.000 58.79039  ? 131  ASN B O     1 
ATOM   987  C  CB    . ASN A 1 133 ? 23.34300  8.60500  21.92700  1.000 66.68919  ? 131  ASN B CB    1 
ATOM   988  C  CG    . ASN A 1 133 ? 22.99800  9.84000  22.74400  1.000 69.15791  ? 131  ASN B CG    1 
ATOM   989  O  OD1   . ASN A 1 133 ? 23.35600  10.95900 22.39200  1.000 70.94029  ? 131  ASN B OD1   1 
ATOM   990  N  ND2   . ASN A 1 133 ? 22.31100  9.62600  23.87100  1.000 69.20502  ? 131  ASN B ND2   1 
ATOM   991  N  N     . ARG A 1 134 ? 22.57600  9.58600  18.39100  1.000 71.89805  ? 132  ARG B N     1 
ATOM   992  C  CA    . ARG A 1 134 ? 21.45600  9.92400  17.52700  1.000 68.64952  ? 132  ARG B CA    1 
ATOM   993  C  C     . ARG A 1 134 ? 20.69600  8.66500  17.11400  1.000 69.06583  ? 132  ARG B C     1 
ATOM   994  O  O     . ARG A 1 134 ? 21.27100  7.74700  16.52300  1.000 68.44878  ? 132  ARG B O     1 
ATOM   995  C  CB    . ARG A 1 134 ? 21.95900  10.66900 16.30200  1.000 65.66630  ? 132  ARG B CB    1 
ATOM   996  C  CG    . ARG A 1 134 ? 20.86000  10.96700 15.32900  1.000 64.37801  ? 132  ARG B CG    1 
ATOM   997  C  CD    . ARG A 1 134 ? 21.36400  10.94500 13.91700  1.000 67.32792  ? 132  ARG B CD    1 
ATOM   998  N  NE    . ARG A 1 134 ? 20.25600  11.23300 13.03100  1.000 72.86586  ? 132  ARG B NE    1 
ATOM   999  C  CZ    . ARG A 1 134 ? 20.03700  12.40800 12.45900  1.000 72.92076  ? 132  ARG B CZ    1 
ATOM   1000 N  NH1   . ARG A 1 134 ? 20.87300  13.42300 12.65100  1.000 68.00138  ? 132  ARG B NH1   1 
ATOM   1001 N  NH2   . ARG A 1 134 ? 18.97700  12.55300 11.68300  1.000 77.78015  ? 132  ARG B NH2   1 
ATOM   1002 N  N     . GLN A 1 135 ? 19.39500  8.63200  17.40300  1.000 66.73374  ? 133  GLN B N     1 
ATOM   1003 C  CA    . GLN A 1 135 ? 18.56200  7.45500  17.17600  1.000 67.67149  ? 133  GLN B CA    1 
ATOM   1004 C  C     . GLN A 1 135 ? 17.66800  7.58800  15.95100  1.000 67.80847  ? 133  GLN B C     1 
ATOM   1005 O  O     . GLN A 1 135 ? 17.56900  6.64900  15.15500  1.000 73.61910  ? 133  GLN B O     1 
ATOM   1006 C  CB    . GLN A 1 135 ? 17.68600  7.17500  18.40200  1.000 64.83063  ? 133  GLN B CB    1 
ATOM   1007 C  CG    . GLN A 1 135 ? 18.42400  7.04100  19.73300  1.000 62.79005  ? 133  GLN B CG    1 
ATOM   1008 C  CD    . GLN A 1 135 ? 17.77500  6.00400  20.63000  1.000 65.53739  ? 133  GLN B CD    1 
ATOM   1009 O  OE1   . GLN A 1 135 ? 17.34500  4.94900  20.15900  1.000 63.82211  ? 133  GLN B OE1   1 
ATOM   1010 N  NE2   . GLN A 1 135 ? 17.68000  6.30400  21.92500  1.000 69.93531  ? 133  GLN B NE2   1 
ATOM   1011 N  N     . VAL A 1 136 ? 17.00300  8.72800  15.78600  1.000 54.46931  ? 134  VAL B N     1 
ATOM   1012 C  CA    . VAL A 1 136 ? 16.05100  8.89900  14.69100  1.000 55.13549  ? 134  VAL B CA    1 
ATOM   1013 C  C     . VAL A 1 136 ? 16.80300  9.20700  13.40500  1.000 52.28478  ? 134  VAL B C     1 
ATOM   1014 O  O     . VAL A 1 136 ? 17.61100  10.14200 13.35100  1.000 48.48469  ? 134  VAL B O     1 
ATOM   1015 C  CB    . VAL A 1 136 ? 15.03900  10.01000 15.00700  1.000 55.03838  ? 134  VAL B CB    1 
ATOM   1016 C  CG1   . VAL A 1 136 ? 13.81400  9.87600  14.08400  1.000 54.36861  ? 134  VAL B CG1   1 
ATOM   1017 C  CG2   . VAL A 1 136 ? 14.64400  9.98700  16.47700  1.000 53.17765  ? 134  VAL B CG2   1 
ATOM   1018 N  N     . ALA A 1 137 ? 16.51800  8.44100  12.35700  1.000 59.26150  ? 135  ALA B N     1 
ATOM   1019 C  CA    . ALA A 1 137 ? 17.25900  8.59500  11.11300  1.000 64.46777  ? 135  ALA B CA    1 
ATOM   1020 C  C     . ALA A 1 137 ? 16.72900  9.77900  10.31900  1.000 57.89860  ? 135  ALA B C     1 
ATOM   1021 O  O     . ALA A 1 137 ? 15.53600  10.09200 10.35000  1.000 55.83419  ? 135  ALA B O     1 
ATOM   1022 C  CB    . ALA A 1 137 ? 17.18600  7.31700  10.26800  1.000 72.51910  ? 135  ALA B CB    1 
ATOM   1023 N  N     . THR A 1 138 ? 17.63600  10.43800 9.59800   1.000 55.90124  ? 136  THR B N     1 
ATOM   1024 C  CA    . THR A 1 138 ? 17.23900  11.59700 8.80800   1.000 53.60885  ? 136  THR B CA    1 
ATOM   1025 C  C     . THR A 1 138 ? 16.23800  11.22000 7.72400   1.000 59.15682  ? 136  THR B C     1 
ATOM   1026 O  O     . THR A 1 138 ? 15.24400  11.92900 7.52800   1.000 58.24757  ? 136  THR B O     1 
ATOM   1027 C  CB    . THR A 1 138 ? 18.46300  12.26400 8.19400   1.000 49.02794  ? 136  THR B CB    1 
ATOM   1028 O  OG1   . THR A 1 138 ? 19.41000  12.53300 9.22600   1.000 57.40074  ? 136  THR B OG1   1 
ATOM   1029 C  CG2   . THR A 1 138 ? 18.08200  13.57700 7.54200   1.000 45.93979  ? 136  THR B CG2   1 
ATOM   1030 N  N     . LYS A 1 139 ? 16.47400  10.10900 7.01100   1.000 76.20949  ? 137  LYS B N     1 
ATOM   1031 C  CA    . LYS A 1 139 ? 15.53200  9.69000  5.98100   1.000 76.91346  ? 137  LYS B CA    1 
ATOM   1032 C  C     . LYS A 1 139 ? 14.21800  9.17200  6.57500   1.000 76.50156  ? 137  LYS B C     1 
ATOM   1033 O  O     . LYS A 1 139 ? 13.22100  9.06300  5.84700   1.000 75.35331  ? 137  LYS B O     1 
ATOM   1034 C  CB    . LYS A 1 139 ? 16.18500  8.64300  5.05600   1.000 80.48383  ? 137  LYS B CB    1 
ATOM   1035 C  CG    . LYS A 1 139 ? 15.63800  8.65700  3.59700   1.000 87.65593  ? 137  LYS B CG    1 
ATOM   1036 C  CD    . LYS A 1 139 ? 16.35000  7.67400  2.64200   1.000 86.50115  ? 137  LYS B CD    1 
ATOM   1037 C  CE    . LYS A 1 139 ? 15.79100  7.70400  1.20000   1.000 83.40921  ? 137  LYS B CE    1 
ATOM   1038 N  NZ    . LYS A 1 139 ? 14.51800  8.47100  1.01900   1.000 82.80914  ? 137  LYS B NZ    1 
ATOM   1039 N  N     . ARG A 1 140 ? 14.17000  8.89700  7.88300   1.000 62.04699  ? 138  ARG B N     1 
ATOM   1040 C  CA    . ARG A 1 140 ? 12.89600  8.55900  8.50500   1.000 59.98739  ? 138  ARG B CA    1 
ATOM   1041 C  C     . ARG A 1 140 ? 12.08800  9.80700  8.82100   1.000 58.20011  ? 138  ARG B C     1 
ATOM   1042 O  O     . ARG A 1 140 ? 10.88100  9.85700  8.56400   1.000 62.59945  ? 138  ARG B O     1 
ATOM   1043 C  CB    . ARG A 1 140 ? 13.11200  7.75200  9.77900   1.000 60.80953  ? 138  ARG B CB    1 
ATOM   1044 C  CG    . ARG A 1 140 ? 11.80600  7.42800  10.48800  1.000 57.74230  ? 138  ARG B CG    1 
ATOM   1045 C  CD    . ARG A 1 140 ? 11.75700  5.98200  10.93900  1.000 66.44984  ? 138  ARG B CD    1 
ATOM   1046 N  NE    . ARG A 1 140 ? 12.58900  5.75500  12.12200  1.000 72.50446  ? 138  ARG B NE    1 
ATOM   1047 C  CZ    . ARG A 1 140 ? 12.14300  5.81400  13.37600  1.000 70.48670  ? 138  ARG B CZ    1 
ATOM   1048 N  NH1   . ARG A 1 140 ? 10.86700  6.09800  13.61800  1.000 68.00533  ? 138  ARG B NH1   1 
ATOM   1049 N  NH2   . ARG A 1 140 ? 12.97400  5.59300  14.38800  1.000 69.40442  ? 138  ARG B NH2   1 
ATOM   1050 N  N     . ALA A 1 141 ? 12.73100  10.82000 9.39400   1.000 52.59739  ? 139  ALA B N     1 
ATOM   1051 C  CA    . ALA A 1 141 ? 12.01800  12.05700 9.68500   1.000 49.06563  ? 139  ALA B CA    1 
ATOM   1052 C  C     . ALA A 1 141 ? 11.69600  12.83200 8.40600   1.000 47.23647  ? 139  ALA B C     1 
ATOM   1053 O  O     . ALA A 1 141 ? 10.63600  13.45600 8.30900   1.000 47.13474  ? 139  ALA B O     1 
ATOM   1054 C  CB    . ALA A 1 141 ? 12.82700  12.90600 10.66400  1.000 44.72390  ? 139  ALA B CB    1 
ATOM   1055 N  N     . GLN A 1 142 ? 12.58800  12.80400 7.41100   1.000 63.48209  ? 140  GLN B N     1 
ATOM   1056 C  CA    . GLN A 1 142 ? 12.27200  13.43600 6.13100   1.000 65.08781  ? 140  GLN B CA    1 
ATOM   1057 C  C     . GLN A 1 142 ? 10.99800  12.84800 5.54200   1.000 69.20493  ? 140  GLN B C     1 
ATOM   1058 O  O     . GLN A 1 142 ? 10.17400  13.57400 4.97200   1.000 68.88215  ? 140  GLN B O     1 
ATOM   1059 C  CB    . GLN A 1 142 ? 13.43700  13.28500 5.14600   1.000 65.98336  ? 140  GLN B CB    1 
ATOM   1060 C  CG    . GLN A 1 142 ? 14.43700  14.44400 5.16600   1.000 71.39763  ? 140  GLN B CG    1 
ATOM   1061 C  CD    . GLN A 1 142 ? 15.56800  14.30500 4.14200   1.000 73.51986  ? 140  GLN B CD    1 
ATOM   1062 O  OE1   . GLN A 1 142 ? 15.62500  13.33100 3.38600   1.000 80.14201  ? 140  GLN B OE1   1 
ATOM   1063 N  NE2   . GLN A 1 142 ? 16.47700  15.28300 4.12600   1.000 67.44473  ? 140  GLN B NE2   1 
ATOM   1064 N  N     . ALA A 1 143 ? 10.80800  11.53400 5.68900   1.000 66.60030  ? 141  ALA B N     1 
ATOM   1065 C  CA    . ALA A 1 143 ? 9.61700   10.89500 5.14300   1.000 69.25423  ? 141  ALA B CA    1 
ATOM   1066 C  C     . ALA A 1 143 ? 8.36100   11.32800 5.89200   1.000 74.15528  ? 141  ALA B C     1 
ATOM   1067 O  O     . ALA A 1 143 ? 7.33600   11.63400 5.26900   1.000 77.07305  ? 141  ALA B O     1 
ATOM   1068 C  CB    . ALA A 1 143 ? 9.78200   9.37500  5.17600   1.000 67.46410  ? 141  ALA B CB    1 
ATOM   1069 N  N     . TRP A 1 144 ? 8.42300   11.37700 7.22600   1.000 75.00655  ? 142  TRP B N     1 
ATOM   1070 C  CA    . TRP A 1 144 ? 7.25800   11.78600 8.00700   1.000 71.61971  ? 142  TRP B CA    1 
ATOM   1071 C  C     . TRP A 1 144 ? 6.76700   13.17600 7.61500   1.000 72.08363  ? 142  TRP B C     1 
ATOM   1072 O  O     . TRP A 1 144 ? 5.55600   13.42000 7.55100   1.000 79.86213  ? 142  TRP B O     1 
ATOM   1073 C  CB    . TRP A 1 144 ? 7.57800   11.75500 9.49700   1.000 68.60092  ? 142  TRP B CB    1 
ATOM   1074 C  CG    . TRP A 1 144 ? 6.38900   12.13300 10.30700  1.000 72.09716  ? 142  TRP B CG    1 
ATOM   1075 C  CD1   . TRP A 1 144 ? 5.37800   11.30500 10.70800  1.000 78.59935  ? 142  TRP B CD1   1 
ATOM   1076 C  CD2   . TRP A 1 144 ? 6.05700   13.43500 10.79900  1.000 72.84721  ? 142  TRP B CD2   1 
ATOM   1077 N  NE1   . TRP A 1 144 ? 4.44100   12.00700 11.42800  1.000 78.64797  ? 142  TRP B NE1   1 
ATOM   1078 C  CE2   . TRP A 1 144 ? 4.83100   13.31800 11.50000  1.000 75.60987  ? 142  TRP B CE2   1 
ATOM   1079 C  CE3   . TRP A 1 144 ? 6.67200   14.68700 10.72100  1.000 69.05411  ? 142  TRP B CE3   1 
ATOM   1080 C  CZ2   . TRP A 1 144 ? 4.21200   14.40600 12.12000  1.000 71.02886  ? 142  TRP B CZ2   1 
ATOM   1081 C  CZ3   . TRP A 1 144 ? 6.05700   15.76800 11.33500  1.000 68.82614  ? 142  TRP B CZ3   1 
ATOM   1082 C  CH2   . TRP A 1 144 ? 4.83700   15.61900 12.02600  1.000 69.91304  ? 142  TRP B CH2   1 
ATOM   1083 N  N     . CYS A 1 145 ? 7.69000   14.10700 7.37600   1.000 58.73994  ? 143  CYS B N     1 
ATOM   1084 C  CA    . CYS A 1 145 ? 7.30000   15.45300 6.96900   1.000 59.41712  ? 143  CYS B CA    1 
ATOM   1085 C  C     . CYS A 1 145 ? 6.78300   15.48400 5.53500   1.000 63.19404  ? 143  CYS B C     1 
ATOM   1086 O  O     . CYS A 1 145 ? 5.90800   16.29900 5.20500   1.000 66.01238  ? 143  CYS B O     1 
ATOM   1087 C  CB    . CYS A 1 145 ? 8.47300   16.41800 7.13200   1.000 54.96813  ? 143  CYS B CB    1 
ATOM   1088 S  SG    . CYS A 1 145 ? 9.25800   16.36500 8.76600   1.000 49.18187  ? 143  CYS B SG    1 
ATOM   1089 N  N     . TYR A 1 146 ? 7.32200   14.62500 4.66900   1.000 73.32370  ? 144  TYR B N     1 
ATOM   1090 C  CA    . TYR A 1 146 ? 6.75400   14.46400 3.34100   1.000 72.68016  ? 144  TYR B CA    1 
ATOM   1091 C  C     . TYR A 1 146 ? 5.32100   13.96400 3.42500   1.000 77.13749  ? 144  TYR B C     1 
ATOM   1092 O  O     . TYR A 1 146 ? 4.48700   14.34200 2.59000   1.000 82.47279  ? 144  TYR B O     1 
ATOM   1093 C  CB    . TYR A 1 146 ? 7.63200   13.51400 2.52600   1.000 72.39942  ? 144  TYR B CB    1 
ATOM   1094 C  CG    . TYR A 1 146 ? 7.30100   13.42100 1.05200   1.000 77.97163  ? 144  TYR B CG    1 
ATOM   1095 C  CD1   . TYR A 1 146 ? 7.77900   14.36200 0.14800   1.000 79.60144  ? 144  TYR B CD1   1 
ATOM   1096 C  CD2   . TYR A 1 146 ? 6.52400   12.37200 0.55600   1.000 80.19644  ? 144  TYR B CD2   1 
ATOM   1097 C  CE1   . TYR A 1 146 ? 7.48500   14.26800 -1.20800  1.000 82.07356  ? 144  TYR B CE1   1 
ATOM   1098 C  CE2   . TYR A 1 146 ? 6.22600   12.26800 -0.79500  1.000 80.48882  ? 144  TYR B CE2   1 
ATOM   1099 C  CZ    . TYR A 1 146 ? 6.70900   13.21800 -1.67400  1.000 83.54202  ? 144  TYR B CZ    1 
ATOM   1100 O  OH    . TYR A 1 146 ? 6.40700   13.11100 -3.01900  1.000 86.97087  ? 144  TYR B OH    1 
ATOM   1101 N  N     . SER A 1 147 ? 5.00600   13.14700 4.44300   1.000 69.18397  ? 145  SER B N     1 
ATOM   1102 C  CA    . SER A 1 147 ? 3.63700   12.66400 4.58900   1.000 69.49979  ? 145  SER B CA    1 
ATOM   1103 C  C     . SER A 1 147 ? 2.66700   13.82100 4.81900   1.000 70.41077  ? 145  SER B C     1 
ATOM   1104 O  O     . SER A 1 147 ? 1.56500   13.81800 4.26800   1.000 75.17739  ? 145  SER B O     1 
ATOM   1105 C  CB    . SER A 1 147 ? 3.54200   11.61700 5.72100   1.000 68.54871  ? 145  SER B CB    1 
ATOM   1106 O  OG    . SER A 1 147 ? 3.66400   12.20100 7.02600   1.000 66.77966  ? 145  SER B OG    1 
ATOM   1107 N  N     . LYS A 1 148 ? 3.04600   14.81300 5.62500   1.000 67.60336  ? 146  LYS B N     1 
ATOM   1108 C  CA    . LYS A 1 148 ? 2.09500   15.84400 6.05800   1.000 61.62871  ? 146  LYS B CA    1 
ATOM   1109 C  C     . LYS A 1 148 ? 2.16800   17.09500 5.17900   1.000 60.68173  ? 146  LYS B C     1 
ATOM   1110 O  O     . LYS A 1 148 ? 2.48300   18.18700 5.63600   1.000 57.07777  ? 146  LYS B O     1 
ATOM   1111 C  CB    . LYS A 1 148 ? 2.31700   16.19400 7.52900   1.000 58.20789  ? 146  LYS B CB    1 
ATOM   1112 C  CG    . LYS A 1 148 ? 2.60100   14.96900 8.38900   1.000 55.77320  ? 146  LYS B CG    1 
ATOM   1113 C  CD    . LYS A 1 148 ? 1.39200   14.64000 9.26700   1.000 59.91524  ? 146  LYS B CD    1 
ATOM   1114 C  CE    . LYS A 1 148 ? 1.58400   13.31100 9.96900   1.000 60.53541  ? 146  LYS B CE    1 
ATOM   1115 N  NZ    . LYS A 1 148 ? 0.92300   12.20000 9.22400   1.000 63.71162  ? 146  LYS B NZ    1 
ATOM   1116 N  N     . ASN A 1 149 ? 1.79600   16.93700 3.90600   1.000 86.94553  ? 147  ASN B N     1 
ATOM   1117 C  CA    . ASN A 1 149 ? 1.69700   18.06400 2.97300   1.000 92.15127  ? 147  ASN B CA    1 
ATOM   1118 C  C     . ASN A 1 149 ? 3.04100   18.77300 2.85400   1.000 89.09262  ? 147  ASN B C     1 
ATOM   1119 O  O     . ASN A 1 149 ? 3.11900   20.00600 2.82800   1.000 88.10797  ? 147  ASN B O     1 
ATOM   1120 C  CB    . ASN A 1 149 ? 0.58500   19.04200 3.37800   1.000 97.46266  ? 147  ASN B CB    1 
ATOM   1121 C  CG    . ASN A 1 149 ? -0.73700  18.34100 3.68000   1.000 96.97098  ? 147  ASN B CG    1 
ATOM   1122 O  OD1   . ASN A 1 149 ? -1.05600  18.06400 4.84300   1.000 93.48410  ? 147  ASN B OD1   1 
ATOM   1123 N  ND2   . ASN A 1 149 ? -1.51700  18.06800 2.63600   1.000 99.18765  ? 147  ASN B ND2   1 
ATOM   1124 N  N     . ASN A 1 150 ? 4.10900   17.97300 2.84500   1.000 82.83190  ? 148  ASN B N     1 
ATOM   1125 C  CA    . ASN A 1 150 ? 5.41400   18.40400 2.36200   1.000 78.31263  ? 148  ASN B CA    1 
ATOM   1126 C  C     . ASN A 1 150 ? 5.97800   19.53500 3.22700   1.000 73.33981  ? 148  ASN B C     1 
ATOM   1127 O  O     . ASN A 1 150 ? 6.21400   20.64600 2.75800   1.000 77.68260  ? 148  ASN B O     1 
ATOM   1128 C  CB    . ASN A 1 150 ? 5.29300   18.82800 0.89000   1.000 81.30904  ? 148  ASN B CB    1 
ATOM   1129 C  CG    . ASN A 1 150 ? 6.60000   18.73800 0.13300   1.000 84.98607  ? 148  ASN B CG    1 
ATOM   1130 O  OD1   . ASN A 1 150 ? 7.24700   17.68900 0.10700   1.000 89.18331  ? 148  ASN B OD1   1 
ATOM   1131 N  ND2   . ASN A 1 150 ? 6.98400   19.83800 -0.51700  1.000 81.97815  ? 148  ASN B ND2   1 
ATOM   1132 N  N     . ILE A 1 151 ? 6.19300   19.24900 4.50700   1.000 56.20320  ? 149  ILE B N     1 
ATOM   1133 C  CA    . ILE A 1 151 ? 6.59300   20.33800 5.40200   1.000 55.67779  ? 149  ILE B CA    1 
ATOM   1134 C  C     . ILE A 1 151 ? 8.09300   20.30300 5.68200   1.000 53.20706  ? 149  ILE B C     1 
ATOM   1135 O  O     . ILE A 1 151 ? 8.68200   19.22000 5.78300   1.000 58.85832  ? 149  ILE B O     1 
ATOM   1136 C  CB    . ILE A 1 151 ? 5.77700   20.33100 6.70300   1.000 59.18819  ? 149  ILE B CB    1 
ATOM   1137 C  CG1   . ILE A 1 151 ? 5.90100   19.00200 7.44500   1.000 53.37360  ? 149  ILE B CG1   1 
ATOM   1138 C  CG2   . ILE A 1 151 ? 4.31100   20.67400 6.39800   1.000 65.95598  ? 149  ILE B CG2   1 
ATOM   1139 C  CD1   . ILE A 1 151 ? 4.89900   18.87600 8.59000   1.000 50.89004  ? 149  ILE B CD1   1 
ATOM   1140 N  N     . PRO A 1 152 ? 8.73600   21.47000 5.80100   1.000 44.08051  ? 150  PRO B N     1 
ATOM   1141 C  CA    . PRO A 1 152 ? 10.20500  21.52600 5.86300   1.000 38.81766  ? 150  PRO B CA    1 
ATOM   1142 C  C     . PRO A 1 152 ? 10.80700  20.85000 7.08700   1.000 41.72678  ? 150  PRO B C     1 
ATOM   1143 O  O     . PRO A 1 152 ? 10.25600  20.88100 8.19100   1.000 50.62184  ? 150  PRO B O     1 
ATOM   1144 C  CB    . PRO A 1 152 ? 10.48700  23.02900 5.88100   1.000 39.88655  ? 150  PRO B CB    1 
ATOM   1145 C  CG    . PRO A 1 152 ? 9.33200   23.62000 5.16800   1.000 46.52119  ? 150  PRO B CG    1 
ATOM   1146 C  CD    . PRO A 1 152 ? 8.15200   22.80200 5.57800   1.000 49.51901  ? 150  PRO B CD    1 
ATOM   1147 N  N     . TYR A 1 153 ? 11.97500  20.25200 6.88200   1.000 39.66459  ? 151  TYR B N     1 
ATOM   1148 C  CA    . TYR A 1 153 ? 12.65600  19.51300 7.93200   1.000 46.57083  ? 151  TYR B CA    1 
ATOM   1149 C  C     . TYR A 1 153 ? 14.08500  20.01100 8.06100   1.000 48.55573  ? 151  TYR B C     1 
ATOM   1150 O  O     . TYR A 1 153 ? 14.80900  20.10100 7.06200   1.000 51.49810  ? 151  TYR B O     1 
ATOM   1151 C  CB    . TYR A 1 153 ? 12.65100  18.01400 7.64700   1.000 45.07738  ? 151  TYR B CB    1 
ATOM   1152 C  CG    . TYR A 1 153 ? 13.48700  17.24600 8.62200   1.000 43.14608  ? 151  TYR B CG    1 
ATOM   1153 C  CD1   . TYR A 1 153 ? 13.12900  17.18100 9.95500   1.000 46.57801  ? 151  TYR B CD1   1 
ATOM   1154 C  CD2   . TYR A 1 153 ? 14.65100  16.60300 8.21900   1.000 47.25469  ? 151  TYR B CD2   1 
ATOM   1155 C  CE1   . TYR A 1 153 ? 13.90000  16.48300 10.87100  1.000 53.09482  ? 151  TYR B CE1   1 
ATOM   1156 C  CE2   . TYR A 1 153 ? 15.43200  15.90300 9.11800   1.000 50.65104  ? 151  TYR B CE2   1 
ATOM   1157 C  CZ    . TYR A 1 153 ? 15.04900  15.84400 10.44900  1.000 55.79729  ? 151  TYR B CZ    1 
ATOM   1158 O  OH    . TYR A 1 153 ? 15.80700  15.15100 11.36600  1.000 59.88486  ? 151  TYR B OH    1 
ATOM   1159 N  N     . PHE A 1 154 ? 14.49200  20.32500 9.29000   1.000 35.45129  ? 152  PHE B N     1 
ATOM   1160 C  CA    . PHE A 1 154 ? 15.83800  20.80200 9.55900   1.000 32.86565  ? 152  PHE B CA    1 
ATOM   1161 C  C     . PHE A 1 154 ? 16.42300  20.03400 10.73300  1.000 44.15967  ? 152  PHE B C     1 
ATOM   1162 O  O     . PHE A 1 154 ? 15.80300  19.94500 11.80200  1.000 40.59443  ? 152  PHE B O     1 
ATOM   1163 C  CB    . PHE A 1 154 ? 15.86300  22.30300 9.85700   1.000 24.62226  ? 152  PHE B CB    1 
ATOM   1164 C  CG    . PHE A 1 154 ? 15.44800  23.15700 8.70200   1.000 27.10135  ? 152  PHE B CG    1 
ATOM   1165 C  CD1   . PHE A 1 154 ? 14.10000  23.38900 8.43500   1.000 32.68441  ? 152  PHE B CD1   1 
ATOM   1166 C  CD2   . PHE A 1 154 ? 16.39200  23.74700 7.89200   1.000 30.08898  ? 152  PHE B CD2   1 
ATOM   1167 C  CE1   . PHE A 1 154 ? 13.71500  24.18900 7.38500   1.000 35.64695  ? 152  PHE B CE1   1 
ATOM   1168 C  CE2   . PHE A 1 154 ? 16.01600  24.53200 6.81800   1.000 35.25800  ? 152  PHE B CE2   1 
ATOM   1169 C  CZ    . PHE A 1 154 ? 14.68300  24.75300 6.56000   1.000 39.15462  ? 152  PHE B CZ    1 
ATOM   1170 N  N     . GLU A 1 155 ? 17.61600  19.47700 10.52100  1.000 57.76139  ? 153  GLU B N     1 
ATOM   1171 C  CA    . GLU A 1 155 ? 18.42000  18.91400 11.59800  1.000 51.94997  ? 153  GLU B CA    1 
ATOM   1172 C  C     . GLU A 1 155 ? 19.31300  20.01400 12.14900  1.000 46.92719  ? 153  GLU B C     1 
ATOM   1173 O  O     . GLU A 1 155 ? 20.14800  20.56200 11.42200  1.000 45.78232  ? 153  GLU B O     1 
ATOM   1174 C  CB    . GLU A 1 155 ? 19.24500  17.74200 11.09400  1.000 51.55807  ? 153  GLU B CB    1 
ATOM   1175 C  CG    . GLU A 1 155 ? 18.40800  16.55800 10.79900  1.000 58.00295  ? 153  GLU B CG    1 
ATOM   1176 C  CD    . GLU A 1 155 ? 19.22200  15.35900 10.41000  1.000 70.50109  ? 153  GLU B CD    1 
ATOM   1177 O  OE1   . GLU A 1 155 ? 20.40300  15.51400 9.99400   1.000 74.70744  ? 153  GLU B OE1   1 
ATOM   1178 O  OE2   . GLU A 1 155 ? 18.65700  14.25600 10.51600  1.000 73.63290  ? 153  GLU B OE2   1 
ATOM   1179 N  N     . THR A 1 156 ? 19.12600  20.34400 13.42300  1.000 41.24657  ? 154  THR B N     1 
ATOM   1180 C  CA    . THR A 1 156 ? 19.70900  21.53800 14.01200  1.000 39.72432  ? 154  THR B CA    1 
ATOM   1181 C  C     . THR A 1 156 ? 20.44800  21.21700 15.30900  1.000 37.23177  ? 154  THR B C     1 
ATOM   1182 O  O     . THR A 1 156 ? 20.28100  20.16000 15.93100  1.000 34.41430  ? 154  THR B O     1 
ATOM   1183 C  CB    . THR A 1 156 ? 18.63400  22.60700 14.30300  1.000 44.91747  ? 154  THR B CB    1 
ATOM   1184 O  OG1   . THR A 1 156 ? 17.62500  22.08100 15.18100  1.000 45.42079  ? 154  THR B OG1   1 
ATOM   1185 C  CG2   . THR A 1 156 ? 17.98000  23.07500 13.01000  1.000 43.81785  ? 154  THR B CG2   1 
ATOM   1186 N  N     . SER A 1 157 ? 21.26800  22.17600 15.72000  1.000 28.90061  ? 155  SER B N     1 
ATOM   1187 C  CA    . SER A 1 157 ? 21.93100  22.13700 17.01200  1.000 32.46909  ? 155  SER B CA    1 
ATOM   1188 C  C     . SER A 1 157 ? 21.90000  23.54900 17.57100  1.000 31.87145  ? 155  SER B C     1 
ATOM   1189 O  O     . SER A 1 157 ? 22.51000  24.45500 16.99600  1.000 29.93886  ? 155  SER B O     1 
ATOM   1190 C  CB    . SER A 1 157 ? 23.37400  21.63000 16.89200  1.000 33.54742  ? 155  SER B CB    1 
ATOM   1191 O  OG    . SER A 1 157 ? 23.97600  21.59000 18.17800  1.000 30.90932  ? 155  SER B OG    1 
ATOM   1192 N  N     . ALA A 1 158 ? 21.17300  23.75400 18.67100  1.000 35.60623  ? 156  ALA B N     1 
ATOM   1193 C  CA    . ALA A 1 158 ? 21.27600  25.05000 19.33200  1.000 39.29926  ? 156  ALA B CA    1 
ATOM   1194 C  C     . ALA A 1 158 ? 22.67700  25.26400 19.86800  1.000 44.12902  ? 156  ALA B C     1 
ATOM   1195 O  O     . ALA A 1 158 ? 23.16300  26.40200 19.88500  1.000 42.12959  ? 156  ALA B O     1 
ATOM   1196 C  CB    . ALA A 1 158 ? 20.25400  25.17500 20.45800  1.000 42.11713  ? 156  ALA B CB    1 
ATOM   1197 N  N     . LYS A 1 159 ? 23.33000  24.16900 20.28300  1.000 54.50481  ? 157  LYS B N     1 
ATOM   1198 C  CA    . LYS A 1 159 ? 24.68700  24.21200 20.81800  1.000 52.59796  ? 157  LYS B CA    1 
ATOM   1199 C  C     . LYS A 1 159 ? 25.66600  24.82300 19.83000  1.000 56.08176  ? 157  LYS B C     1 
ATOM   1200 O  O     . LYS A 1 159 ? 26.38000  25.77800 20.15700  1.000 55.01549  ? 157  LYS B O     1 
ATOM   1201 C  CB    . LYS A 1 159 ? 25.12400  22.79900 21.19200  1.000 53.18970  ? 157  LYS B CB    1 
ATOM   1202 C  CG    . LYS A 1 159 ? 26.08300  22.73300 22.36800  1.000 56.66219  ? 157  LYS B CG    1 
ATOM   1203 C  CD    . LYS A 1 159 ? 26.75600  21.37300 22.42700  1.000 61.43752  ? 157  LYS B CD    1 
ATOM   1204 C  CE    . LYS A 1 159 ? 28.14100  21.45400 23.06800  1.000 66.69545  ? 157  LYS B CE    1 
ATOM   1205 N  NZ    . LYS A 1 159 ? 29.25300  21.57000 22.03700  1.000 67.45638  ? 157  LYS B NZ    1 
ATOM   1206 N  N     . GLU A 1 160 ? 25.71400  24.28300 18.61300  1.000 76.84253  ? 158  GLU B N     1 
ATOM   1207 C  CA    . GLU A 1 160 ? 26.76700  24.59600 17.65400  1.000 73.21669  ? 158  GLU B CA    1 
ATOM   1208 C  C     . GLU A 1 160 ? 26.30800  25.51800 16.52900  1.000 72.59154  ? 158  GLU B C     1 
ATOM   1209 O  O     . GLU A 1 160 ? 27.05900  25.72400 15.56600  1.000 78.11717  ? 158  GLU B O     1 
ATOM   1210 C  CB    . GLU A 1 160 ? 27.33400  23.29800 17.07700  1.000 70.70854  ? 158  GLU B CB    1 
ATOM   1211 C  CG    . GLU A 1 160 ? 27.93000  22.39100 18.13700  1.000 77.57002  ? 158  GLU B CG    1 
ATOM   1212 C  CD    . GLU A 1 160 ? 29.19700  22.97500 18.76400  1.000 91.15042  ? 158  GLU B CD    1 
ATOM   1213 O  OE1   . GLU A 1 160 ? 29.77100  23.94000 18.19500  1.000 93.14319  ? 158  GLU B OE1   1 
ATOM   1214 O  OE2   . GLU A 1 160 ? 29.61500  22.46700 19.83400  1.000 97.33944  ? 158  GLU B OE2   1 
ATOM   1215 N  N     . ALA A 1 161 ? 25.10800  26.08900 16.63800  1.000 52.79633  ? 159  ALA B N     1 
ATOM   1216 C  CA    . ALA A 1 161 ? 24.50000  26.93400 15.60200  1.000 45.93134  ? 159  ALA B CA    1 
ATOM   1217 C  C     . ALA A 1 161 ? 24.50600  26.23600 14.24300  1.000 47.12856  ? 159  ALA B C     1 
ATOM   1218 O  O     . ALA A 1 161 ? 25.00100  26.75700 13.24100  1.000 55.98302  ? 159  ALA B O     1 
ATOM   1219 C  CB    . ALA A 1 161 ? 25.18900  28.29900 15.52600  1.000 40.73909  ? 159  ALA B CB    1 
ATOM   1220 N  N     . ILE A 1 162 ? 23.93600  25.03700 14.22000  1.000 30.62795  ? 160  ILE B N     1 
ATOM   1221 C  CA    . ILE A 1 162 ? 23.85900  24.23700 13.01000  1.000 37.10980  ? 160  ILE B CA    1 
ATOM   1222 C  C     . ILE A 1 162 ? 22.43200  24.32500 12.48200  1.000 35.71199  ? 160  ILE B C     1 
ATOM   1223 O  O     . ILE A 1 162 ? 21.50000  23.79800 13.10300  1.000 27.18688  ? 160  ILE B O     1 
ATOM   1224 C  CB    . ILE A 1 162 ? 24.28400  22.78700 13.26200  1.000 41.21065  ? 160  ILE B CB    1 
ATOM   1225 C  CG1   . ILE A 1 162 ? 25.68000  22.78200 13.89800  1.000 40.42555  ? 160  ILE B CG1   1 
ATOM   1226 C  CG2   . ILE A 1 162 ? 24.25300  22.01100 11.95200  1.000 41.41289  ? 160  ILE B CG2   1 
ATOM   1227 C  CD1   . ILE A 1 162 ? 26.42200  21.47000 13.83200  1.000 37.74718  ? 160  ILE B CD1   1 
ATOM   1228 N  N     . ASN A 1 163 ? 22.26600  24.99100 11.32800  1.000 44.20079  ? 161  ASN B N     1 
ATOM   1229 C  CA    . ASN A 1 163 ? 20.98900  25.12000 10.62300  1.000 45.76812  ? 161  ASN B CA    1 
ATOM   1230 C  C     . ASN A 1 163 ? 19.95900  25.89500 11.41400  1.000 47.89242  ? 161  ASN B C     1 
ATOM   1231 O  O     . ASN A 1 163 ? 18.76000  25.80400 11.11800  1.000 47.21990  ? 161  ASN B O     1 
ATOM   1232 C  CB    . ASN A 1 163 ? 20.38200  23.76400 10.25500  1.000 42.35335  ? 161  ASN B CB    1 
ATOM   1233 C  CG    . ASN A 1 163 ? 20.99800  23.17200 9.04400   1.000 44.22741  ? 161  ASN B CG    1 
ATOM   1234 O  OD1   . ASN A 1 163 ? 21.62200  23.87500 8.24900   1.000 48.67613  ? 161  ASN B OD1   1 
ATOM   1235 N  ND2   . ASN A 1 163 ? 20.81000  21.86700 8.86600   1.000 43.45030  ? 161  ASN B ND2   1 
ATOM   1236 N  N     . VAL A 1 164 ? 20.38700  26.63400 12.43600  1.000 42.07607  ? 162  VAL B N     1 
ATOM   1237 C  CA    . VAL A 1 164 ? 19.43000  27.43500 13.18400  1.000 38.59546  ? 162  VAL B CA    1 
ATOM   1238 C  C     . VAL A 1 164 ? 19.00300  28.64300 12.36500  1.000 40.76925  ? 162  VAL B C     1 
ATOM   1239 O  O     . VAL A 1 164 ? 17.80800  28.89400 12.17200  1.000 45.39692  ? 162  VAL B O     1 
ATOM   1240 C  CB    . VAL A 1 164 ? 20.01100  27.84700 14.54200  1.000 35.45332  ? 162  VAL B CB    1 
ATOM   1241 C  CG1   . VAL A 1 164 ? 19.12500  28.88600 15.17500  1.000 36.42978  ? 162  VAL B CG1   1 
ATOM   1242 C  CG2   . VAL A 1 164 ? 20.12000  26.64300 15.43300  1.000 36.20000  ? 162  VAL B CG2   1 
ATOM   1243 N  N     . GLU A 1 165 ? 19.96900  29.40500 11.85900  1.000 43.13071  ? 163  GLU B N     1 
ATOM   1244 C  CA    . GLU A 1 165 ? 19.59200  30.54700 11.04300  1.000 42.51242  ? 163  GLU B CA    1 
ATOM   1245 C  C     . GLU A 1 165 ? 18.84400  30.10100 9.79600   1.000 44.49636  ? 163  GLU B C     1 
ATOM   1246 O  O     . GLU A 1 165 ? 17.94900  30.80900 9.32200   1.000 40.32914  ? 163  GLU B O     1 
ATOM   1247 C  CB    . GLU A 1 165 ? 20.82500  31.37300 10.68600  1.000 38.45561  ? 163  GLU B CB    1 
ATOM   1248 C  CG    . GLU A 1 165 ? 20.46300  32.77600 10.23800  1.000 51.20315  ? 163  GLU B CG    1 
ATOM   1249 C  CD    . GLU A 1 165 ? 20.04600  33.68200 11.38000  1.000 60.67941  ? 163  GLU B CD    1 
ATOM   1250 O  OE1   . GLU A 1 165 ? 19.20800  34.59200 11.14900  1.000 60.44763  ? 163  GLU B OE1   1 
ATOM   1251 O  OE2   . GLU A 1 165 ? 20.56900  33.48800 12.50100  1.000 64.20963  ? 163  GLU B OE2   1 
ATOM   1252 N  N     . GLN A 1 166 ? 19.16900  28.91500 9.27500   1.000 52.90890  ? 164  GLN B N     1 
ATOM   1253 C  CA    . GLN A 1 166 ? 18.45700  28.38700 8.11500   1.000 50.35967  ? 164  GLN B CA    1 
ATOM   1254 C  C     . GLN A 1 166 ? 16.99100  28.16800 8.44100   1.000 42.96142  ? 164  GLN B C     1 
ATOM   1255 O  O     . GLN A 1 166 ? 16.10400  28.61700 7.70500   1.000 45.77518  ? 164  GLN B O     1 
ATOM   1256 C  CB    . GLN A 1 166 ? 19.09500  27.07500 7.65700   1.000 54.10661  ? 164  GLN B CB    1 
ATOM   1257 C  CG    . GLN A 1 166 ? 20.35500  27.21400 6.81500   1.000 53.22466  ? 164  GLN B CG    1 
ATOM   1258 C  CD    . GLN A 1 166 ? 21.62200  27.38300 7.61700   1.000 57.90572  ? 164  GLN B CD    1 
ATOM   1259 O  OE1   . GLN A 1 166 ? 21.65000  28.06100 8.64400   1.000 60.68408  ? 164  GLN B OE1   1 
ATOM   1260 N  NE2   . GLN A 1 166 ? 22.68600  26.74400 7.15500   1.000 62.41836  ? 164  GLN B NE2   1 
ATOM   1261 N  N     . ALA A 1 167 ? 16.72800  27.50300 9.56900   1.000 36.71412  ? 165  ALA B N     1 
ATOM   1262 C  CA    . ALA A 1 167 ? 15.36900  27.11600 9.94900   1.000 32.30819  ? 165  ALA B CA    1 
ATOM   1263 C  C     . ALA A 1 167 ? 14.48400  28.32700 10.20000  1.000 30.26290  ? 165  ALA B C     1 
ATOM   1264 O  O     . ALA A 1 167 ? 13.37600  28.42500 9.65800   1.000 30.74129  ? 165  ALA B O     1 
ATOM   1265 C  CB    . ALA A 1 167 ? 15.41100  26.23100 11.18900  1.000 21.26962  ? 165  ALA B CB    1 
ATOM   1266 N  N     . PHE A 1 168 ? 14.95600  29.26800 11.01500  1.000 34.11419  ? 166  PHE B N     1 
ATOM   1267 C  CA    . PHE A 1 168 ? 14.11400  30.41200 11.32800  1.000 34.45025  ? 166  PHE B CA    1 
ATOM   1268 C  C     . PHE A 1 168 ? 13.96500  31.38800 10.17300  1.000 32.75743  ? 166  PHE B C     1 
ATOM   1269 O  O     . PHE A 1 168 ? 13.11200  32.27200 10.25900  1.000 36.20604  ? 166  PHE B O     1 
ATOM   1270 C  CB    . PHE A 1 168 ? 14.64800  31.12700 12.55400  1.000 29.92435  ? 166  PHE B CB    1 
ATOM   1271 C  CG    . PHE A 1 168 ? 14.20600  30.50000 13.83900  1.000 34.36580  ? 166  PHE B CG    1 
ATOM   1272 C  CD1   . PHE A 1 168 ? 14.94900  29.47700 14.41800  1.000 34.08408  ? 166  PHE B CD1   1 
ATOM   1273 C  CD2   . PHE A 1 168 ? 13.03900  30.91900 14.46600  1.000 38.32807  ? 166  PHE B CD2   1 
ATOM   1274 C  CE1   . PHE A 1 168 ? 14.55400  28.88600 15.60400  1.000 31.04938  ? 166  PHE B CE1   1 
ATOM   1275 C  CE2   . PHE A 1 168 ? 12.62800  30.33400 15.66500  1.000 35.35978  ? 166  PHE B CE2   1 
ATOM   1276 C  CZ    . PHE A 1 168 ? 13.39600  29.30900 16.23800  1.000 30.09176  ? 166  PHE B CZ    1 
ATOM   1277 N  N     . GLN A 1 169 ? 14.77300  31.26700 9.11500   1.000 32.42279  ? 167  GLN B N     1 
ATOM   1278 C  CA    . GLN A 1 169 ? 14.53600  32.04300 7.89800   1.000 28.04177  ? 167  GLN B CA    1 
ATOM   1279 C  C     . GLN A 1 169 ? 13.45100  31.39000 7.05300   1.000 30.11234  ? 167  GLN B C     1 
ATOM   1280 O  O     . GLN A 1 169 ? 12.61800  32.07600 6.45000   1.000 30.30270  ? 167  GLN B O     1 
ATOM   1281 C  CB    . GLN A 1 169 ? 15.82700  32.18100 7.09200   1.000 32.69157  ? 167  GLN B CB    1 
ATOM   1282 C  CG    . GLN A 1 169 ? 16.83800  33.10700 7.73200   1.000 39.90782  ? 167  GLN B CG    1 
ATOM   1283 C  CD    . GLN A 1 169 ? 18.09000  33.30100 6.90300   1.000 39.64629  ? 167  GLN B CD    1 
ATOM   1284 O  OE1   . GLN A 1 169 ? 19.13900  33.64700 7.43200   1.000 37.51597  ? 167  GLN B OE1   1 
ATOM   1285 N  NE2   . GLN A 1 169 ? 17.97900  33.09900 5.60000   1.000 39.20236  ? 167  GLN B NE2   1 
ATOM   1286 N  N     . THR A 1 170 ? 13.44800  30.06200 7.01100   1.000 33.20433  ? 168  THR B N     1 
ATOM   1287 C  CA    . THR A 1 170 ? 12.33300  29.33900 6.42000   1.000 37.35410  ? 168  THR B CA    1 
ATOM   1288 C  C     . THR A 1 170 ? 11.02700  29.60700 7.16900   1.000 43.71246  ? 168  THR B C     1 
ATOM   1289 O  O     . THR A 1 170 ? 9.97900   29.79900 6.54200   1.000 43.97118  ? 168  THR B O     1 
ATOM   1290 C  CB    . THR A 1 170 ? 12.66400  27.85300 6.39900   1.000 38.09757  ? 168  THR B CB    1 
ATOM   1291 O  OG1   . THR A 1 170 ? 13.80100  27.65300 5.55300   1.000 43.18484  ? 168  THR B OG1   1 
ATOM   1292 C  CG2   . THR A 1 170 ? 11.49300  27.04000 5.88600   1.000 37.16708  ? 168  THR B CG2   1 
ATOM   1293 N  N     . ILE A 1 171 ? 11.07200  29.63200 8.51000   1.000 37.13694  ? 169  ILE B N     1 
ATOM   1294 C  CA    . ILE A 1 171 ? 9.88100   29.93800 9.30900   1.000 30.39830  ? 169  ILE B CA    1 
ATOM   1295 C  C     . ILE A 1 171 ? 9.37100   31.33800 8.97900   1.000 31.11634  ? 169  ILE B C     1 
ATOM   1296 O  O     . ILE A 1 171 ? 8.17700   31.54700 8.74500   1.000 37.53487  ? 169  ILE B O     1 
ATOM   1297 C  CB    . ILE A 1 171 ? 10.19200  29.78400 10.81200  1.000 25.29716  ? 169  ILE B CB    1 
ATOM   1298 C  CG1   . ILE A 1 171 ? 10.35200  28.31500 11.17700  1.000 24.87377  ? 169  ILE B CG1   1 
ATOM   1299 C  CG2   . ILE A 1 171 ? 9.11900   30.42700 11.66800  1.000 22.08145  ? 169  ILE B CG2   1 
ATOM   1300 C  CD1   . ILE A 1 171 ? 11.29500  28.09500 12.29000  1.000 24.73560  ? 169  ILE B CD1   1 
ATOM   1301 N  N     . ALA A 1 172 ? 10.27700  32.31000 8.92500   1.000 30.49854  ? 170  ALA B N     1 
ATOM   1302 C  CA    . ALA A 1 172 ? 9.90700   33.66800 8.53600   1.000 29.47546  ? 170  ALA B CA    1 
ATOM   1303 C  C     . ALA A 1 172 ? 9.28800   33.69200 7.14500   1.000 34.48235  ? 170  ALA B C     1 
ATOM   1304 O  O     . ALA A 1 172 ? 8.19700   34.24300 6.94600   1.000 35.96396  ? 170  ALA B O     1 
ATOM   1305 C  CB    . ALA A 1 172 ? 11.14300  34.57000 8.59000   1.000 27.33320  ? 170  ALA B CB    1 
ATOM   1306 N  N     . ARG A 1 173 ? 9.98000   33.09900 6.16800   1.000 40.35058  ? 171  ARG B N     1 
ATOM   1307 C  CA    . ARG A 1 173 ? 9.46900   33.05200 4.80100   1.000 37.76498  ? 171  ARG B CA    1 
ATOM   1308 C  C     . ARG A 1 173 ? 8.06400   32.45500 4.75000   1.000 39.89559  ? 171  ARG B C     1 
ATOM   1309 O  O     . ARG A 1 173 ? 7.15700   33.03000 4.13900   1.000 36.85549  ? 171  ARG B O     1 
ATOM   1310 C  CB    . ARG A 1 173 ? 10.43000  32.24500 3.93700   1.000 35.45871  ? 171  ARG B CB    1 
ATOM   1311 C  CG    . ARG A 1 173 ? 10.39900  32.54900 2.48100   1.000 36.87349  ? 171  ARG B CG    1 
ATOM   1312 C  CD    . ARG A 1 173 ? 11.80800  32.47600 1.87600   1.000 40.16957  ? 171  ARG B CD    1 
ATOM   1313 N  NE    . ARG A 1 173 ? 12.21400  33.80400 1.42200   1.000 43.92853  ? 171  ARG B NE    1 
ATOM   1314 C  CZ    . ARG A 1 173 ? 13.46800  34.17500 1.24000   1.000 43.98168  ? 171  ARG B CZ    1 
ATOM   1315 N  NH1   . ARG A 1 173 ? 14.44000  33.30600 1.45300   1.000 48.55805  ? 171  ARG B NH1   1 
ATOM   1316 N  NH2   . ARG A 1 173 ? 13.74100  35.40900 0.84200   1.000 49.31146  ? 171  ARG B NH2   1 
ATOM   1317 N  N     . ASN A 1 174 ? 7.86800   31.30400 5.40600   1.000 45.88218  ? 172  ASN B N     1 
ATOM   1318 C  CA    . ASN A 1 174 ? 6.59400   30.58800 5.34500   1.000 46.27527  ? 172  ASN B CA    1 
ATOM   1319 C  C     . ASN A 1 174 ? 5.49700   31.31600 6.10900   1.000 52.96410  ? 172  ASN B C     1 
ATOM   1320 O  O     . ASN A 1 174 ? 4.35000   31.38400 5.64600   1.000 57.50011  ? 172  ASN B O     1 
ATOM   1321 C  CB    . ASN A 1 174 ? 6.76300   29.18200 5.90100   1.000 45.29497  ? 172  ASN B CB    1 
ATOM   1322 C  CG    . ASN A 1 174 ? 7.55100   28.28100 4.98000   1.000 51.33973  ? 172  ASN B CG    1 
ATOM   1323 O  OD1   . ASN A 1 174 ? 8.24100   28.74600 4.06300   1.000 56.49196  ? 172  ASN B OD1   1 
ATOM   1324 N  ND2   . ASN A 1 174 ? 7.47000   26.97400 5.23100   1.000 54.54853  ? 172  ASN B ND2   1 
ATOM   1325 N  N     . ALA A 1 175 ? 5.82100   31.83100 7.29800   1.000 38.24451  ? 173  ALA B N     1 
ATOM   1326 C  CA    . ALA A 1 175 ? 4.88900   32.69400 8.01700   1.000 34.47457  ? 173  ALA B CA    1 
ATOM   1327 C  C     . ALA A 1 175 ? 4.46000   33.87900 7.15600   1.000 37.37664  ? 173  ALA B C     1 
ATOM   1328 O  O     . ALA A 1 175 ? 3.26600   34.12300 6.97500   1.000 38.67513  ? 173  ALA B O     1 
ATOM   1329 C  CB    . ALA A 1 175 ? 5.52200   33.17800 9.32600   1.000 30.49141  ? 173  ALA B CB    1 
ATOM   1330 N  N     . LEU A 1 176 ? 5.43000   34.61800 6.60500   1.000 41.65216  ? 174  LEU B N     1 
ATOM   1331 C  CA    . LEU A 1 176 ? 5.12900   35.75400 5.73400   1.000 39.16508  ? 174  LEU B CA    1 
ATOM   1332 C  C     . LEU A 1 176 ? 4.10600   35.39500 4.66200   1.000 43.39798  ? 174  LEU B C     1 
ATOM   1333 O  O     . LEU A 1 176 ? 3.12700   36.12100 4.44700   1.000 44.67376  ? 174  LEU B O     1 
ATOM   1334 C  CB    . LEU A 1 176 ? 6.40900   36.26200 5.07800   1.000 34.53580  ? 174  LEU B CB    1 
ATOM   1335 C  CG    . LEU A 1 176 ? 6.17000   37.59000 4.37500   1.000 35.53101  ? 174  LEU B CG    1 
ATOM   1336 C  CD1   . LEU A 1 176 ? 5.66600   38.58700 5.38400   1.000 41.04203  ? 174  LEU B CD1   1 
ATOM   1337 C  CD2   . LEU A 1 176 ? 7.42000   38.09300 3.74100   1.000 37.87981  ? 174  LEU B CD2   1 
ATOM   1338 N  N     . LYS A 1 177 ? 4.32900   34.28300 3.96100   1.000 49.86675  ? 175  LYS B N     1 
ATOM   1339 C  CA    . LYS A 1 177 ? 3.31100   33.80700 3.03700   1.000 45.43776  ? 175  LYS B CA    1 
ATOM   1340 C  C     . LYS A 1 177 ? 1.97300   33.62500 3.75500   1.000 52.82722  ? 175  LYS B C     1 
ATOM   1341 O  O     . LYS A 1 177 ? 0.97900   34.23900 3.36200   1.000 54.42895  ? 175  LYS B O     1 
ATOM   1342 C  CB    . LYS A 1 177 ? 3.78600   32.52600 2.33700   1.000 45.18332  ? 175  LYS B CB    1 
ATOM   1343 C  CG    . LYS A 1 177 ? 5.23700   32.67400 1.81400   1.000 58.05084  ? 175  LYS B CG    1 
ATOM   1344 C  CD    . LYS A 1 177 ? 5.56400   31.88600 0.52800   1.000 63.35908  ? 175  LYS B CD    1 
ATOM   1345 C  CE    . LYS A 1 177 ? 6.97000   31.28700 0.57500   1.000 60.38597  ? 175  LYS B CE    1 
ATOM   1346 N  NZ    . LYS A 1 177 ? 6.95800   29.96800 1.28100   1.000 60.25850  ? 175  LYS B NZ    1 
ATOM   1347 N  N     . GLN A 1 178 ? 1.95000   32.88200 4.87600   1.000 47.33931  ? 176  GLN B N     1 
ATOM   1348 C  CA    . GLN A 1 178 ? 0.67700   32.58500 5.54700   1.000 40.28842  ? 176  GLN B CA    1 
ATOM   1349 C  C     . GLN A 1 178 ? -0.05900  33.85400 5.98700   1.000 41.17898  ? 176  GLN B C     1 
ATOM   1350 O  O     . GLN A 1 178 ? -1.27200  33.97300 5.77800   1.000 46.17707  ? 176  GLN B O     1 
ATOM   1351 C  CB    . GLN A 1 178 ? 0.89700   31.66800 6.74000   1.000 38.28711  ? 176  GLN B CB    1 
ATOM   1352 C  CG    . GLN A 1 178 ? -0.28700  31.66900 7.65800   1.000 38.61965  ? 176  GLN B CG    1 
ATOM   1353 C  CD    . GLN A 1 178 ? -1.37900  30.77400 7.13200   1.000 42.18198  ? 176  GLN B CD    1 
ATOM   1354 O  OE1   . GLN A 1 178 ? -1.17400  30.03800 6.15800   1.000 38.26799  ? 176  GLN B OE1   1 
ATOM   1355 N  NE2   . GLN A 1 178 ? -2.54900  30.82800 7.76600   1.000 45.13542  ? 176  GLN B NE2   1 
ATOM   1356 N  N     . GLU A 1 179 ? 0.67000   34.83200 6.53800   1.000 51.56103  ? 177  GLU B N     1 
ATOM   1357 C  CA    . GLU A 1 179 ? 0.07100   36.08500 7.00500   1.000 54.56915  ? 177  GLU B CA    1 
ATOM   1358 C  C     . GLU A 1 179 ? -0.60900  36.85700 5.88400   1.000 68.39720  ? 177  GLU B C     1 
ATOM   1359 O  O     . GLU A 1 179 ? -1.69400  37.41400 6.08300   1.000 80.19709  ? 177  GLU B O     1 
ATOM   1360 C  CB    . GLU A 1 179 ? 1.13500   36.97200 7.65600   1.000 52.06190  ? 177  GLU B CB    1 
ATOM   1361 C  CG    . GLU A 1 179 ? 0.59600   38.23600 8.32800   1.000 60.09033  ? 177  GLU B CG    1 
ATOM   1362 C  CD    . GLU A 1 179 ? 0.77000   39.49600 7.48600   1.000 72.79391  ? 177  GLU B CD    1 
ATOM   1363 O  OE1   . GLU A 1 179 ? 0.16700   40.53700 7.84400   1.000 77.19571  ? 177  GLU B OE1   1 
ATOM   1364 O  OE2   . GLU A 1 179 ? 1.49700   39.44500 6.46600   1.000 77.94541  ? 177  GLU B OE2   1 
ATOM   1365 N  N     . THR A 1 180 ? 0.01500   36.93100 4.71000   1.000 82.11835  ? 178  THR B N     1 
ATOM   1366 C  CA    . THR A 1 180 ? -0.58200  37.73500 3.65100   1.000 89.32677  ? 178  THR B CA    1 
ATOM   1367 C  C     . THR A 1 180 ? -1.85500  37.12700 3.04600   1.000 97.64336  ? 178  THR B C     1 
ATOM   1368 O  O     . THR A 1 180 ? -2.44400  37.76700 2.17200   1.000 99.15337  ? 178  THR B O     1 
ATOM   1369 C  CB    . THR A 1 180 ? 0.44700   38.01100 2.53500   1.000 91.66833  ? 178  THR B CB    1 
ATOM   1370 O  OG1   . THR A 1 180 ? 0.79600   36.78900 1.87600   1.000 91.42637  ? 178  THR B OG1   1 
ATOM   1371 C  CG2   . THR A 1 180 ? 1.72400   38.67700 3.08500   1.000 92.02372  ? 178  THR B CG2   1 
ATOM   1372 N  N     . GLU A 1 181 ? -2.33900  35.96100 3.50000   1.000 125.34079 ? 179  GLU B N     1 
ATOM   1373 C  CA    . GLU A 1 181 ? -3.48300  35.30000 2.85100   1.000 128.77084 ? 179  GLU B CA    1 
ATOM   1374 C  C     . GLU A 1 181 ? -4.79200  35.44100 3.60600   1.000 128.03932 ? 179  GLU B C     1 
ATOM   1375 O  O     . GLU A 1 181 ? -5.82500  35.78400 3.01900   1.000 131.80404 ? 179  GLU B O     1 
ATOM   1376 C  CB    . GLU A 1 181 ? -3.19800  33.80400 2.63200   1.000 131.17725 ? 179  GLU B CB    1 
ATOM   1377 C  CG    . GLU A 1 181 ? -1.73300  33.45300 2.34400   1.000 132.95798 ? 179  GLU B CG    1 
ATOM   1378 C  CD    . GLU A 1 181 ? -1.21000  34.22900 1.26600   1.000 137.45266 ? 179  GLU B CD    1 
ATOM   1379 O  OE1   . GLU A 1 181 ? -2.00500  34.93800 0.56700   1.000 142.04146 ? 179  GLU B OE1   1 
ATOM   1380 O  OE2   . GLU A 1 181 ? 0.05100   34.21000 1.13200   1.000 138.76958 ? 179  GLU B OE2   1 
ATOM   1381 N  N     . VAL A 1 182 ? -4.78100  35.21800 4.91800   1.000 129.87059 ? 180  VAL B N     1 
ATOM   1382 C  CA    . VAL A 1 182 ? -6.04400  35.33000 5.63300   1.000 130.13341 ? 180  VAL B CA    1 
ATOM   1383 C  C     . VAL A 1 182 ? -6.38300  36.79700 5.84700   1.000 131.22773 ? 180  VAL B C     1 
ATOM   1384 O  O     . VAL A 1 182 ? -7.37600  37.12100 6.52300   1.000 135.12601 ? 180  VAL B O     1 
ATOM   1385 C  CB    . VAL A 1 182 ? -5.95500  34.44800 6.89300   1.000 124.85630 ? 180  VAL B CB    1 
ATOM   1386 C  CG1   . VAL A 1 182 ? -6.26200  32.97500 6.53500   1.000 122.21886 ? 180  VAL B CG1   1 
ATOM   1387 C  CG2   . VAL A 1 182 ? -4.55700  34.54300 7.50200   1.000 120.83496 ? 180  VAL B CG2   1 
ATOM   1388 N  N     . GLU A 1 183 ? -5.60900  37.69800 5.21400   1.000 111.41900 ? 181  GLU B N     1 
ATOM   1389 C  CA    . GLU A 1 183 ? -6.05900  39.02600 4.83000   1.000 111.41467 ? 181  GLU B CA    1 
ATOM   1390 C  C     . GLU A 1 183 ? -6.82300  39.02100 3.51400   1.000 116.11024 ? 181  GLU B C     1 
ATOM   1391 O  O     . GLU A 1 183 ? -7.48400  40.01600 3.21200   1.000 120.42305 ? 181  GLU B O     1 
ATOM   1392 C  CB    . GLU A 1 183 ? -4.87500  39.99200 4.70800   1.000 108.76661 ? 181  GLU B CB    1 
ATOM   1393 C  CG    . GLU A 1 183 ? -3.72300  39.79300 5.68700   1.000 110.51776 ? 181  GLU B CG    1 
ATOM   1394 C  CD    . GLU A 1 183 ? -4.15800  39.78000 7.15300   1.000 112.83001 ? 181  GLU B CD    1 
ATOM   1395 O  OE1   . GLU A 1 183 ? -5.06700  40.56500 7.52700   1.000 117.75415 ? 181  GLU B OE1   1 
ATOM   1396 O  OE2   . GLU A 1 183 ? -3.57500  38.98900 7.93300   1.000 106.87763 ? 181  GLU B OE2   1 
ATOM   1397 N  N     . LEU A 1 184 ? -6.72900  37.94600 2.72200   1.000 106.84680 ? 182  LEU B N     1 
ATOM   1398 C  CA    . LEU A 1 184 ? -7.48400  37.80900 1.47500   1.000 101.98549 ? 182  LEU B CA    1 
ATOM   1399 C  C     . LEU A 1 184 ? -8.82500  37.12300 1.75000   1.000 106.83819 ? 182  LEU B C     1 
ATOM   1400 O  O     . LEU A 1 184 ? -9.51000  36.72000 0.80800   1.000 110.74052 ? 182  LEU B O     1 
ATOM   1401 C  CB    . LEU A 1 184 ? -6.69700  37.00400 0.43200   1.000 94.52901  ? 182  LEU B CB    1 
ATOM   1402 C  CG    . LEU A 1 184 ? -5.19300  37.22600 0.18700   1.000 88.43442  ? 182  LEU B CG    1 
ATOM   1403 C  CD1   . LEU A 1 184 ? -4.77900  36.57800 -1.12400  1.000 82.38631  ? 182  LEU B CD1   1 
ATOM   1404 C  CD2   . LEU A 1 184 ? -4.79300  38.70200 0.20400   1.000 87.80637  ? 182  LEU B CD2   1 
ATOM   1405 O  OXT   . LEU A 1 184 ? -9.25500  36.92800 2.89500   1.000 107.59671 ? 182  LEU B OXT   1 
ATOM   1406 N  N     . ASN B 2 2   ? -25.71400 20.69800 104.61900 1.000 95.46690  ? 697  ASN A N     1 
ATOM   1407 C  CA    . ASN B 2 2   ? -26.28900 20.81700 103.27600 1.000 97.49874  ? 697  ASN A CA    1 
ATOM   1408 C  C     . ASN B 2 2   ? -25.55000 19.97000 102.23000 1.000 96.89230  ? 697  ASN A C     1 
ATOM   1409 O  O     . ASN B 2 2   ? -25.11100 20.48900 101.20300 1.000 97.46199  ? 697  ASN A O     1 
ATOM   1410 C  CB    . ASN B 2 2   ? -26.30500 22.28400 102.83100 1.000 99.84151  ? 697  ASN A CB    1 
ATOM   1411 C  CG    . ASN B 2 2   ? -25.04700 23.03900 103.23800 1.000 103.44886 ? 697  ASN A CG    1 
ATOM   1412 O  OD1   . ASN B 2 2   ? -23.92600 22.58000 103.01100 1.000 105.38170 ? 697  ASN A OD1   1 
ATOM   1413 N  ND2   . ASN B 2 2   ? -25.23200 24.21600 103.82900 1.000 103.39191 ? 697  ASN A ND2   1 
ATOM   1414 N  N     . ALA B 2 3   ? -25.43400 18.66900 102.49500 1.000 94.68696  ? 698  ALA A N     1 
ATOM   1415 C  CA    . ALA B 2 3   ? -24.80200 17.74600 101.55800 1.000 90.39641  ? 698  ALA A CA    1 
ATOM   1416 C  C     . ALA B 2 3   ? -25.61000 17.63900 100.26500 1.000 92.58920  ? 698  ALA A C     1 
ATOM   1417 O  O     . ALA B 2 3   ? -26.84000 17.69700 100.27800 1.000 95.04369  ? 698  ALA A O     1 
ATOM   1418 C  CB    . ALA B 2 3   ? -24.66200 16.36400 102.20400 1.000 83.18096  ? 698  ALA A CB    1 
ATOM   1419 N  N     . GLN B 2 4   ? -24.91800 17.48900 99.13700  1.000 83.26059  ? 699  GLN A N     1 
ATOM   1420 C  CA    . GLN B 2 4   ? -25.60800 17.15900 97.89400  1.000 80.92886  ? 699  GLN A CA    1 
ATOM   1421 C  C     . GLN B 2 4   ? -26.03400 15.68600 97.89300  1.000 78.42540  ? 699  GLN A C     1 
ATOM   1422 O  O     . GLN B 2 4   ? -25.52700 14.85800 98.66100  1.000 83.72439  ? 699  GLN A O     1 
ATOM   1423 C  CB    . GLN B 2 4   ? -24.71900 17.46200 96.68400  1.000 80.21534  ? 699  GLN A CB    1 
ATOM   1424 C  CG    . GLN B 2 4   ? -25.41000 17.38400 95.31700  1.000 81.83191  ? 699  GLN A CG    1 
ATOM   1425 C  CD    . GLN B 2 4   ? -26.09600 18.67700 94.89600  1.000 82.50117  ? 699  GLN A CD    1 
ATOM   1426 O  OE1   . GLN B 2 4   ? -25.84100 19.74400 95.46000  1.000 86.45915  ? 699  GLN A OE1   1 
ATOM   1427 N  NE2   . GLN B 2 4   ? -26.97600 18.58400 93.89400  1.000 77.18037  ? 699  GLN A NE2   1 
ATOM   1428 N  N     . ILE B 2 5   ? -26.99800 15.36700 97.03100  1.000 53.08479  ? 700  ILE A N     1 
ATOM   1429 C  CA    . ILE B 2 5   ? -27.48700 14.00300 96.84800  1.000 50.22698  ? 700  ILE A CA    1 
ATOM   1430 C  C     . ILE B 2 5   ? -27.01100 13.54500 95.47200  1.000 45.99128  ? 700  ILE A C     1 
ATOM   1431 O  O     . ILE B 2 5   ? -27.40300 14.11800 94.44300  1.000 49.24611  ? 700  ILE A O     1 
ATOM   1432 C  CB    . ILE B 2 5   ? -29.02000 13.93100 97.00000  1.000 54.40726  ? 700  ILE A CB    1 
ATOM   1433 C  CG1   . ILE B 2 5   ? -29.41700 14.16300 98.46800  1.000 59.46739  ? 700  ILE A CG1   1 
ATOM   1434 C  CG2   . ILE B 2 5   ? -29.63300 12.63500 96.41200  1.000 45.77307  ? 700  ILE A CG2   1 
ATOM   1435 C  CD1   . ILE B 2 5   ? -28.41400 13.63400 99.50300  1.000 60.84065  ? 700  ILE A CD1   1 
ATOM   1436 N  N     . ILE B 2 6   ? -26.13000 12.54200 95.44000  1.000 38.71072  ? 701  ILE A N     1 
ATOM   1437 C  CA    . ILE B 2 6   ? -25.50700 12.17300 94.17200  1.000 42.88780  ? 701  ILE A CA    1 
ATOM   1438 C  C     . ILE B 2 6   ? -25.56600 10.66500 93.94600  1.000 40.43399  ? 701  ILE A C     1 
ATOM   1439 O  O     . ILE B 2 6   ? -25.76800 10.22100 92.80800  1.000 46.20440  ? 701  ILE A O     1 
ATOM   1440 C  CB    . ILE B 2 6   ? -24.05600 12.70400 94.07800  1.000 47.56786  ? 701  ILE A CB    1 
ATOM   1441 C  CG1   . ILE B 2 6   ? -24.03900 14.23800 94.14400  1.000 51.03416  ? 701  ILE A CG1   1 
ATOM   1442 C  CG2   . ILE B 2 6   ? -23.37600 12.24100 92.77600  1.000 43.16304  ? 701  ILE A CG2   1 
ATOM   1443 C  CD1   . ILE B 2 6   ? -22.86900 14.89800 93.44700  1.000 51.92120  ? 701  ILE A CD1   1 
ATOM   1444 N  N     . PHE B 2 7   ? -25.38600 9.86400  95.00200  1.000 23.45769  ? 702  PHE A N     1 
ATOM   1445 C  CA    . PHE B 2 7   ? -25.59300 8.42400  94.86500  1.000 31.29579  ? 702  PHE A CA    1 
ATOM   1446 C  C     . PHE B 2 7   ? -26.97600 8.15500  94.27400  1.000 35.62830  ? 702  PHE A C     1 
ATOM   1447 O  O     . PHE B 2 7   ? -27.96200 8.80500  94.62400  1.000 38.09668  ? 702  PHE A O     1 
ATOM   1448 C  CB    . PHE B 2 7   ? -25.44800 7.69000  96.21100  1.000 27.39168  ? 702  PHE A CB    1 
ATOM   1449 C  CG    . PHE B 2 7   ? -25.77800 6.19800  96.14000  1.000 26.45143  ? 702  PHE A CG    1 
ATOM   1450 C  CD1   . PHE B 2 7   ? -27.08500 5.74500  96.17500  1.000 30.28257  ? 702  PHE A CD1   1 
ATOM   1451 C  CD2   . PHE B 2 7   ? -24.78600 5.26000  96.04500  1.000 27.70929  ? 702  PHE A CD2   1 
ATOM   1452 C  CE1   . PHE B 2 7   ? -27.38300 4.39500  96.10400  1.000 30.10089  ? 702  PHE A CE1   1 
ATOM   1453 C  CE2   . PHE B 2 7   ? -25.08700 3.90700  95.98600  1.000 31.35461  ? 702  PHE A CE2   1 
ATOM   1454 C  CZ    . PHE B 2 7   ? -26.39000 3.48700  96.00100  1.000 33.40176  ? 702  PHE A CZ    1 
ATOM   1455 N  N     . ASN B 2 8   ? -27.04400 7.18200  93.37200  1.000 43.75102  ? 703  ASN A N     1 
ATOM   1456 C  CA    . ASN B 2 8   ? -28.27500 6.91400  92.63800  1.000 36.30675  ? 703  ASN A CA    1 
ATOM   1457 C  C     . ASN B 2 8   ? -28.23000 5.47300  92.15200  1.000 40.67722  ? 703  ASN A C     1 
ATOM   1458 O  O     . ASN B 2 8   ? -27.32500 5.09900  91.39300  1.000 42.00512  ? 703  ASN A O     1 
ATOM   1459 C  CB    . ASN B 2 8   ? -28.41900 7.88600  91.48300  1.000 37.29995  ? 703  ASN A CB    1 
ATOM   1460 C  CG    . ASN B 2 8   ? -29.85000 8.08100  91.05400  1.000 39.76878  ? 703  ASN A CG    1 
ATOM   1461 O  OD1   . ASN B 2 8   ? -30.67100 7.16800  91.14100  1.000 33.65440  ? 703  ASN A OD1   1 
ATOM   1462 N  ND2   . ASN B 2 8   ? -30.15900 9.27900  90.57400  1.000 48.24562  ? 703  ASN A ND2   1 
ATOM   1463 N  N     . VAL B 2 9   ? -29.18800 4.67200  92.62000  1.000 50.10407  ? 704  VAL A N     1 
ATOM   1464 C  CA    . VAL B 2 9   ? -29.34400 3.30100  92.14000  1.000 52.61589  ? 704  VAL A CA    1 
ATOM   1465 C  C     . VAL B 2 9   ? -29.80700 3.30000  90.68600  1.000 47.89920  ? 704  VAL A C     1 
ATOM   1466 O  O     . VAL B 2 9   ? -29.47600 2.39000  89.91200  1.000 46.35494  ? 704  VAL A O     1 
ATOM   1467 C  CB    . VAL B 2 9   ? -30.31900 2.53500  93.05800  1.000 51.44663  ? 704  VAL A CB    1 
ATOM   1468 C  CG1   . VAL B 2 9   ? -30.56300 1.13100  92.54800  1.000 57.29024  ? 704  VAL A CG1   1 
ATOM   1469 C  CG2   . VAL B 2 9   ? -29.77500 2.48700  94.47500  1.000 51.42724  ? 704  VAL A CG2   1 
ATOM   1470 N  N     . HIS B 2 10  ? -30.56100 4.33100  90.28700  1.000 41.77162  ? 705  HIS A N     1 
ATOM   1471 C  CA    . HIS B 2 10  ? -31.13000 4.44800  88.94600  1.000 42.04681  ? 705  HIS A CA    1 
ATOM   1472 C  C     . HIS B 2 10  ? -30.59700 5.72400  88.30500  1.000 42.61061  ? 705  HIS A C     1 
ATOM   1473 O  O     . HIS B 2 10  ? -31.33700 6.71400  88.16800  1.000 54.53352  ? 705  HIS A O     1 
ATOM   1474 C  CB    . HIS B 2 10  ? -32.66700 4.47800  88.95800  1.000 42.81622  ? 705  HIS A CB    1 
ATOM   1475 C  CG    . HIS B 2 10  ? -33.30900 3.30300  89.62900  1.000 45.53543  ? 705  HIS A CG    1 
ATOM   1476 N  ND1   . HIS B 2 10  ? -33.00900 1.99600  89.30100  1.000 49.14273  ? 705  HIS A ND1   1 
ATOM   1477 C  CD2   . HIS B 2 10  ? -34.23800 3.23900  90.61400  1.000 48.32582  ? 705  HIS A CD2   1 
ATOM   1478 C  CE1   . HIS B 2 10  ? -33.71400 1.17800  90.06500  1.000 51.04536  ? 705  HIS A CE1   1 
ATOM   1479 N  NE2   . HIS B 2 10  ? -34.47100 1.90700  90.86800  1.000 51.85543  ? 705  HIS A NE2   1 
ATOM   1480 N  N     . PRO B 2 11  ? -29.34000 5.73600  87.86500  1.000 45.35910  ? 706  PRO A N     1 
ATOM   1481 C  CA    . PRO B 2 11  ? -28.84900 6.88500  87.09300  1.000 43.75728  ? 706  PRO A CA    1 
ATOM   1482 C  C     . PRO B 2 11  ? -29.54100 6.95800  85.74200  1.000 47.10068  ? 706  PRO A C     1 
ATOM   1483 O  O     . PRO B 2 11  ? -30.24400 6.03600  85.31600  1.000 50.84144  ? 706  PRO A O     1 
ATOM   1484 C  CB    . PRO B 2 11  ? -27.35400 6.60900  86.94500  1.000 35.90550  ? 706  PRO A CB    1 
ATOM   1485 C  CG    . PRO B 2 11  ? -27.25600 5.14700  86.99900  1.000 37.63098  ? 706  PRO A CG    1 
ATOM   1486 C  CD    . PRO B 2 11  ? -28.30700 4.68500  87.97000  1.000 45.48956  ? 706  PRO A CD    1 
ATOM   1487 N  N     . ALA B 2 12  ? -29.34800 8.08800  85.07300  1.000 35.86516  ? 707  ALA A N     1 
ATOM   1488 C  CA    . ALA B 2 12  ? -29.95300 8.27800  83.76100  1.000 32.58368  ? 707  ALA A CA    1 
ATOM   1489 C  C     . ALA B 2 12  ? -29.41900 7.21800  82.80300  1.000 39.60023  ? 707  ALA A C     1 
ATOM   1490 O  O     . ALA B 2 12  ? -28.19300 7.04900  82.69200  1.000 35.30676  ? 707  ALA A O     1 
ATOM   1491 C  CB    . ALA B 2 12  ? -29.65900 9.68200  83.23400  1.000 25.84218  ? 707  ALA A CB    1 
ATOM   1492 N  N     . PRO B 2 13  ? -30.28900 6.46600  82.11800  1.000 48.46982  ? 708  PRO A N     1 
ATOM   1493 C  CA    . PRO B 2 13  ? -29.81000 5.29500  81.35700  1.000 47.08051  ? 708  PRO A CA    1 
ATOM   1494 C  C     . PRO B 2 13  ? -28.87200 5.64100  80.19800  1.000 47.45565  ? 708  PRO A C     1 
ATOM   1495 O  O     . PRO B 2 13  ? -28.00200 4.82700  79.84900  1.000 47.94140  ? 708  PRO A O     1 
ATOM   1496 C  CB    . PRO B 2 13  ? -31.11200 4.64600  80.86900  1.000 43.01430  ? 708  PRO A CB    1 
ATOM   1497 C  CG    . PRO B 2 13  ? -32.16700 5.15300  81.80400  1.000 41.60884  ? 708  PRO A CG    1 
ATOM   1498 C  CD    . PRO B 2 13  ? -31.76000 6.55200  82.13600  1.000 42.66666  ? 708  PRO A CD    1 
ATOM   1499 N  N     . THR B 2 14  ? -29.01100 6.83100  79.60600  1.000 35.50379  ? 709  THR A N     1 
ATOM   1500 C  CA    . THR B 2 14  ? -28.13200 7.22900  78.50500  1.000 36.01544  ? 709  THR A CA    1 
ATOM   1501 C  C     . THR B 2 14  ? -26.72200 7.52900  79.01200  1.000 44.17776  ? 709  THR A C     1 
ATOM   1502 O  O     . THR B 2 14  ? -25.72800 7.19000  78.35300  1.000 49.30520  ? 709  THR A O     1 
ATOM   1503 C  CB    . THR B 2 14  ? -28.74000 8.44500  77.79000  1.000 35.83788  ? 709  THR A CB    1 
ATOM   1504 O  OG1   . THR B 2 14  ? -30.00500 8.08300  77.23300  1.000 43.32364  ? 709  THR A OG1   1 
ATOM   1505 C  CG2   . THR B 2 14  ? -27.85200 8.99900  76.70600  1.000 26.40046  ? 709  THR A CG2   1 
ATOM   1506 N  N     . ARG B 2 15  ? -26.62200 8.15800  80.18600  1.000 40.39976  ? 710  ARG A N     1 
ATOM   1507 C  CA    . ARG B 2 15  ? -25.32700 8.39300  80.80500  1.000 35.94291  ? 710  ARG A CA    1 
ATOM   1508 C  C     . ARG B 2 15  ? -24.69300 7.09200  81.29600  1.000 33.60662  ? 710  ARG A C     1 
ATOM   1509 O  O     . ARG B 2 15  ? -23.47600 6.90100  81.15700  1.000 37.00580  ? 710  ARG A O     1 
ATOM   1510 C  CB    . ARG B 2 15  ? -25.48700 9.38200  81.95400  1.000 36.71414  ? 710  ARG A CB    1 
ATOM   1511 C  CG    . ARG B 2 15  ? -24.17600 9.78200  82.61200  1.000 35.45679  ? 710  ARG A CG    1 
ATOM   1512 C  CD    . ARG B 2 15  ? -24.45200 10.67300 83.78800  1.000 24.93532  ? 710  ARG A CD    1 
ATOM   1513 N  NE    . ARG B 2 15  ? -24.64900 12.05100 83.35700  1.000 22.49138  ? 710  ARG A NE    1 
ATOM   1514 C  CZ    . ARG B 2 15  ? -23.97800 13.07300 83.86700  1.000 26.48101  ? 710  ARG A CZ    1 
ATOM   1515 N  NH1   . ARG B 2 15  ? -23.08600 12.86400 84.83100  1.000 29.62321  ? 710  ARG A NH1   1 
ATOM   1516 N  NH2   . ARG B 2 15  ? -24.20900 14.30000 83.43300  1.000 23.10640  ? 710  ARG A NH2   1 
ATOM   1517 N  N     . LYS B 2 16  ? -25.49000 6.19500  81.89500  1.000 28.45323  ? 711  LYS A N     1 
ATOM   1518 C  CA    . LYS B 2 16  ? -24.93000 4.91700  82.33300  1.000 28.88393  ? 711  LYS A CA    1 
ATOM   1519 C  C     . LYS B 2 16  ? -24.33500 4.16900  81.15100  1.000 34.75472  ? 711  LYS A C     1 
ATOM   1520 O  O     . LYS B 2 16  ? -23.30600 3.50100  81.28900  1.000 38.18123  ? 711  LYS A O     1 
ATOM   1521 C  CB    . LYS B 2 16  ? -25.99600 4.05200  83.05500  1.000 24.68308  ? 711  LYS A CB    1 
ATOM   1522 C  CG    . LYS B 2 16  ? -25.49300 2.62200  83.43000  1.000 25.07016  ? 711  LYS A CG    1 
ATOM   1523 C  CD    . LYS B 2 16  ? -26.22400 1.93700  84.59400  1.000 31.65297  ? 711  LYS A CD    1 
ATOM   1524 C  CE    . LYS B 2 16  ? -25.72100 2.38200  85.98800  1.000 42.81917  ? 711  LYS A CE    1 
ATOM   1525 N  NZ    . LYS B 2 16  ? -24.24100 2.52700  86.19800  1.000 45.17736  ? 711  LYS A NZ    1 
ATOM   1526 N  N     . ILE B 2 17  ? -24.95100 4.30400  79.97600  1.000 38.37477  ? 712  ILE A N     1 
ATOM   1527 C  CA    . ILE B 2 17  ? -24.44100 3.66300  78.76900  1.000 43.47620  ? 712  ILE A CA    1 
ATOM   1528 C  C     . ILE B 2 17  ? -23.10700 4.28000  78.35100  1.000 38.26398  ? 712  ILE A C     1 
ATOM   1529 O  O     . ILE B 2 17  ? -22.16800 3.56500  77.97600  1.000 32.40654  ? 712  ILE A O     1 
ATOM   1530 C  CB    . ILE B 2 17  ? -25.51000 3.74900  77.66200  1.000 41.54973  ? 712  ILE A CB    1 
ATOM   1531 C  CG1   . ILE B 2 17  ? -26.59000 2.69100  77.92200  1.000 45.32317  ? 712  ILE A CG1   1 
ATOM   1532 C  CG2   . ILE B 2 17  ? -24.88900 3.60400  76.28000  1.000 37.15925  ? 712  ILE A CG2   1 
ATOM   1533 C  CD1   . ILE B 2 17  ? -27.86700 2.84500  77.09800  1.000 41.00795  ? 712  ILE A CD1   1 
ATOM   1534 N  N     . ALA B 2 18  ? -22.99100 5.60700  78.45300  1.000 32.97381  ? 713  ALA A N     1 
ATOM   1535 C  CA    . ALA B 2 18  ? -21.78200 6.30300  78.03600  1.000 31.10535  ? 713  ALA A CA    1 
ATOM   1536 C  C     . ALA B 2 18  ? -20.64000 6.09100  79.02500  1.000 35.96830  ? 713  ALA A C     1 
ATOM   1537 O  O     . ALA B 2 18  ? -19.52700 5.71400  78.63400  1.000 40.15661  ? 713  ALA A O     1 
ATOM   1538 C  CB    . ALA B 2 18  ? -22.08500 7.79000  77.86400  1.000 26.30054  ? 713  ALA A CB    1 
ATOM   1539 N  N     . VAL B 2 19  ? -20.87800 6.36000  80.30600  1.000 33.02774  ? 714  VAL A N     1 
ATOM   1540 C  CA    . VAL B 2 19  ? -19.81400 6.13900  81.27700  1.000 38.00123  ? 714  VAL A CA    1 
ATOM   1541 C  C     . VAL B 2 19  ? -19.33300 4.69800  81.20900  1.000 42.09074  ? 714  VAL A C     1 
ATOM   1542 O  O     . VAL B 2 19  ? -18.12500 4.43600  81.24900  1.000 41.56228  ? 714  VAL A O     1 
ATOM   1543 C  CB    . VAL B 2 19  ? -20.27500 6.52100  82.69700  1.000 35.60340  ? 714  VAL A CB    1 
ATOM   1544 C  CG1   . VAL B 2 19  ? -19.15300 6.32300  83.68700  1.000 30.47988  ? 714  VAL A CG1   1 
ATOM   1545 C  CG2   . VAL B 2 19  ? -20.70900 7.95400  82.73500  1.000 32.40302  ? 714  VAL A CG2   1 
ATOM   1546 N  N     . ALA B 2 20  ? -20.26000 3.74200  81.07100  1.000 36.15200  ? 715  ALA A N     1 
ATOM   1547 C  CA    . ALA B 2 20  ? -19.83000 2.34600  81.07500  1.000 35.35433  ? 715  ALA A CA    1 
ATOM   1548 C  C     . ALA B 2 20  ? -19.08500 1.98200  79.80300  1.000 36.96791  ? 715  ALA A C     1 
ATOM   1549 O  O     . ALA B 2 20  ? -18.25700 1.06400  79.81500  1.000 37.76411  ? 715  ALA A O     1 
ATOM   1550 C  CB    . ALA B 2 20  ? -21.01500 1.40200  81.27100  1.000 28.06962  ? 715  ALA A CB    1 
ATOM   1551 N  N     . LYS B 2 21  ? -19.35000 2.69400  78.71500  1.000 36.47937  ? 716  LYS A N     1 
ATOM   1552 C  CA    . LYS B 2 21  ? -18.60900 2.46900  77.48200  1.000 35.76354  ? 716  LYS A CA    1 
ATOM   1553 C  C     . LYS B 2 21  ? -17.13100 2.79800  77.65800  1.000 38.64799  ? 716  LYS A C     1 
ATOM   1554 O  O     . LYS B 2 21  ? -16.28200 2.22100  76.96900  1.000 45.55991  ? 716  LYS A O     1 
ATOM   1555 C  CB    . LYS B 2 21  ? -19.23700 3.30600  76.37200  1.000 30.40100  ? 716  LYS A CB    1 
ATOM   1556 C  CG    . LYS B 2 21  ? -18.63300 3.16600  75.01400  1.000 33.82226  ? 716  LYS A CG    1 
ATOM   1557 C  CD    . LYS B 2 21  ? -19.63400 3.65100  73.97200  1.000 36.66640  ? 716  LYS A CD    1 
ATOM   1558 C  CE    . LYS B 2 21  ? -19.05100 3.71100  72.56600  1.000 37.53271  ? 716  LYS A CE    1 
ATOM   1559 N  NZ    . LYS B 2 21  ? -18.52500 5.05900  72.23700  1.000 40.28467  ? 716  LYS A NZ    1 
ATOM   1560 N  N     . GLN B 2 22  ? -16.80100 3.70600  78.57900  1.000 26.94836  ? 717  GLN A N     1 
ATOM   1561 C  CA    . GLN B 2 22  ? -15.41700 4.04500  78.88100  1.000 24.78965  ? 717  GLN A CA    1 
ATOM   1562 C  C     . GLN B 2 22  ? -15.00200 3.48600  80.22900  1.000 24.76266  ? 717  GLN A C     1 
ATOM   1563 O  O     . GLN B 2 22  ? -14.28400 4.12500  81.00000  1.000 24.31825  ? 717  GLN A O     1 
ATOM   1564 C  CB    . GLN B 2 22  ? -15.17400 5.55000  78.81200  1.000 24.08923  ? 717  GLN A CB    1 
ATOM   1565 C  CG    . GLN B 2 22  ? -16.17600 6.38600  79.49800  1.000 23.52594  ? 717  GLN A CG    1 
ATOM   1566 C  CD    . GLN B 2 22  ? -16.09900 7.83500  79.07400  1.000 23.08122  ? 717  GLN A CD    1 
ATOM   1567 O  OE1   . GLN B 2 22  ? -16.72500 8.23400  78.08400  1.000 23.20462  ? 717  GLN A OE1   1 
ATOM   1568 N  NE2   . GLN B 2 22  ? -15.36100 8.64500  79.83900  1.000 22.64617  ? 717  GLN A NE2   1 
ATOM   1569 N  N     . ASN B 2 23  ? -15.43600 2.26100  80.49200  1.000 36.01596  ? 718  ASN A N     1 
ATOM   1570 C  CA    . ASN B 2 23  ? -15.04700 1.47800  81.66200  1.000 41.20011  ? 718  ASN A CA    1 
ATOM   1571 C  C     . ASN B 2 23  ? -15.01000 2.33100  82.92300  1.000 36.37005  ? 718  ASN A C     1 
ATOM   1572 O  O     . ASN B 2 23  ? -14.13200 2.19300  83.77800  1.000 42.68848  ? 718  ASN A O     1 
ATOM   1573 C  CB    . ASN B 2 23  ? -13.72200 0.78200  81.38000  1.000 45.15485  ? 718  ASN A CB    1 
ATOM   1574 C  CG    . ASN B 2 23  ? -13.89300 -0.38400 80.41800  1.000 52.77180  ? 718  ASN A CG    1 
ATOM   1575 O  OD1   . ASN B 2 23  ? -13.91100 -1.55200 80.83000  1.000 58.75958  ? 718  ASN A OD1   1 
ATOM   1576 N  ND2   . ASN B 2 23  ? -14.08200 -0.06800 79.12800  1.000 47.75178  ? 718  ASN A ND2   1 
ATOM   1577 N  N     . TYR B 2 24  ? -15.99200 3.21400  83.03400  1.000 40.78027  ? 719  TYR A N     1 
ATOM   1578 C  CA    . TYR B 2 24  ? -16.18900 4.05600  84.19700  1.000 39.66141  ? 719  TYR A CA    1 
ATOM   1579 C  C     . TYR B 2 24  ? -14.94500 4.86500  84.51400  1.000 38.17221  ? 719  TYR A C     1 
ATOM   1580 O  O     . TYR B 2 24  ? -14.71000 5.22400  85.66900  1.000 46.67739  ? 719  TYR A O     1 
ATOM   1581 C  CB    . TYR B 2 24  ? -16.64500 3.22700  85.40200  1.000 38.01926  ? 719  TYR A CB    1 
ATOM   1582 C  CG    . TYR B 2 24  ? -18.08900 2.79700  85.28400  1.000 42.31468  ? 719  TYR A CG    1 
ATOM   1583 C  CD1   . TYR B 2 24  ? -19.11700 3.63400  85.70200  1.000 45.76527  ? 719  TYR A CD1   1 
ATOM   1584 C  CD2   . TYR B 2 24  ? -18.42900 1.56500  84.74500  1.000 42.94446  ? 719  TYR A CD2   1 
ATOM   1585 C  CE1   . TYR B 2 24  ? -20.45100 3.26200  85.58100  1.000 45.62827  ? 719  TYR A CE1   1 
ATOM   1586 C  CE2   . TYR B 2 24  ? -19.75900 1.17300  84.63600  1.000 46.63831  ? 719  TYR A CE2   1 
ATOM   1587 C  CZ    . TYR B 2 24  ? -20.76900 2.03200  85.05500  1.000 47.96232  ? 719  TYR A CZ    1 
ATOM   1588 O  OH    . TYR B 2 24  ? -22.09600 1.67300  84.94500  1.000 52.73767  ? 719  TYR A OH    1 
ATOM   1589 N  N     . ARG B 2 25  ? -14.15100 5.17900  83.48900  1.000 27.21649  ? 720  ARG A N     1 
ATOM   1590 C  CA    . ARG B 2 25  ? -12.87000 5.86500  83.66100  1.000 23.19082  ? 720  ARG A CA    1 
ATOM   1591 C  C     . ARG B 2 25  ? -12.97900 7.28000  83.11300  1.000 22.71866  ? 720  ARG A C     1 
ATOM   1592 O  O     . ARG B 2 25  ? -13.49600 7.48600  82.01300  1.000 23.54628  ? 720  ARG A O     1 
ATOM   1593 C  CB    . ARG B 2 25  ? -11.73100 5.10500  82.97800  1.000 23.91423  ? 720  ARG A CB    1 
ATOM   1594 C  CG    . ARG B 2 25  ? -11.28800 3.79800  83.66500  1.000 24.54477  ? 720  ARG A CG    1 
ATOM   1595 C  CD    . ARG B 2 25  ? -10.50300 2.89700  82.68700  1.000 35.94339  ? 720  ARG A CD    1 
ATOM   1596 N  NE    . ARG B 2 25  ? -10.31900 1.53700  83.18900  1.000 45.33841  ? 720  ARG A NE    1 
ATOM   1597 C  CZ    . ARG B 2 25  ? -9.39200  1.19200  84.08100  1.000 50.12862  ? 720  ARG A CZ    1 
ATOM   1598 N  NH1   . ARG B 2 25  ? -8.56800  2.11000  84.56200  1.000 49.06000  ? 720  ARG A NH1   1 
ATOM   1599 N  NH2   . ARG B 2 25  ? -9.29300  -0.06500 84.50300  1.000 54.15255  ? 720  ARG A NH2   1 
ATOM   1600 N  N     . CYS B 2 26  ? -12.53400 8.25800  83.89600  1.000 30.59432  ? 721  CYS A N     1 
ATOM   1601 C  CA    . CYS B 2 26  ? -12.50200 9.62700  83.40900  1.000 30.75059  ? 721  CYS A CA    1 
ATOM   1602 C  C     . CYS B 2 26  ? -11.67700 9.69700  82.12900  1.000 35.56938  ? 721  CYS A C     1 
ATOM   1603 O  O     . CYS B 2 26  ? -10.59300 9.11300  82.04200  1.000 42.01833  ? 721  CYS A O     1 
ATOM   1604 C  CB    . CYS B 2 26  ? -11.91100 10.54100 84.47700  1.000 33.00603  ? 721  CYS A CB    1 
ATOM   1605 S  SG    . CYS B 2 26  ? -11.35300 12.16200 83.85400  1.000 28.70688  ? 721  CYS A SG    1 
ATOM   1606 N  N     . ALA B 2 27  ? -12.21700 10.37500 81.11800  1.000 39.36878  ? 722  ALA A N     1 
ATOM   1607 C  CA    . ALA B 2 27  ? -11.56300 10.41300 79.82100  1.000 37.49003  ? 722  ALA A CA    1 
ATOM   1608 C  C     . ALA B 2 27  ? -10.27300 11.21900 79.82600  1.000 43.17270  ? 722  ALA A C     1 
ATOM   1609 O  O     . ALA B 2 27  ? -9.51600  11.14100 78.85100  1.000 48.78735  ? 722  ALA A O     1 
ATOM   1610 C  CB    . ALA B 2 27  ? -12.51200 10.98600 78.76900  1.000 40.99824  ? 722  ALA A CB    1 
ATOM   1611 N  N     . GLY B 2 28  ? -9.98900  11.97800 80.88600  1.000 39.66562  ? 723  GLY A N     1 
ATOM   1612 C  CA    . GLY B 2 28  ? -8.80800  12.82500 80.87200  1.000 38.82239  ? 723  GLY A CA    1 
ATOM   1613 C  C     . GLY B 2 28  ? -7.63700  12.39600 81.74000  1.000 42.99482  ? 723  GLY A C     1 
ATOM   1614 O  O     . GLY B 2 28  ? -6.47300  12.66000 81.41900  1.000 55.77284  ? 723  GLY A O     1 
ATOM   1615 N  N     . CYS B 2 29  ? -7.94500  11.75400 82.86100  1.000 23.92798  ? 724  CYS A N     1 
ATOM   1616 C  CA    . CYS B 2 29  ? -6.96700  11.31800 83.85300  1.000 24.28610  ? 724  CYS A CA    1 
ATOM   1617 C  C     . CYS B 2 29  ? -7.00600  9.82000  84.07400  1.000 26.94792  ? 724  CYS A C     1 
ATOM   1618 O  O     . CYS B 2 29  ? -6.09000  9.28800  84.72700  1.000 28.15931  ? 724  CYS A O     1 
ATOM   1619 C  CB    . CYS B 2 29  ? -7.19100  12.05200 85.19900  1.000 28.91113  ? 724  CYS A CB    1 
ATOM   1620 S  SG    . CYS B 2 29  ? -8.92100  11.90400 85.95000  1.000 33.46155  ? 724  CYS A SG    1 
ATOM   1621 N  N     . GLY B 2 30  ? -8.01900  9.13200  83.51300  1.000 23.49654  ? 725  GLY A N     1 
ATOM   1622 C  CA    . GLY B 2 30  ? -8.27800  7.71100  83.67300  1.000 23.84914  ? 725  GLY A CA    1 
ATOM   1623 C  C     . GLY B 2 30  ? -8.74000  7.26000  85.04300  1.000 23.69156  ? 725  GLY A C     1 
ATOM   1624 O  O     . GLY B 2 30  ? -8.74500  6.05000  85.30200  1.000 24.13461  ? 725  GLY A O     1 
ATOM   1625 N  N     . ILE B 2 31  ? -9.12800  8.17800  85.93400  1.000 23.13016  ? 726  ILE A N     1 
ATOM   1626 C  CA    . ILE B 2 31  ? -9.58100  7.75300  87.25600  1.000 22.94845  ? 726  ILE A CA    1 
ATOM   1627 C  C     . ILE B 2 31  ? -10.84400 6.90700  87.12200  1.000 25.64465  ? 726  ILE A C     1 
ATOM   1628 O  O     . ILE B 2 31  ? -11.74800 7.20400  86.32800  1.000 29.14621  ? 726  ILE A O     1 
ATOM   1629 C  CB    . ILE B 2 31  ? -9.77900  8.97200  88.17900  1.000 22.40416  ? 726  ILE A CB    1 
ATOM   1630 C  CG1   . ILE B 2 31  ? -9.88000  8.55100  89.62300  1.000 22.32969  ? 726  ILE A CG1   1 
ATOM   1631 C  CG2   . ILE B 2 31  ? -11.04000 9.74200  87.89800  1.000 21.77115  ? 726  ILE A CG2   1 
ATOM   1632 C  CD1   . ILE B 2 31  ? -10.01200 9.75200  90.46900  1.000 21.88631  ? 726  ILE A CD1   1 
ATOM   1633 N  N     . ARG B 2 32  ? -10.88600 5.81800  87.87600  1.000 32.13601  ? 727  ARG A N     1 
ATOM   1634 C  CA    . ARG B 2 32  ? -12.01200 4.89700  87.86000  1.000 33.67388  ? 727  ARG A CA    1 
ATOM   1635 C  C     . ARG B 2 32  ? -13.04700 5.36200  88.87700  1.000 34.34549  ? 727  ARG A C     1 
ATOM   1636 O  O     . ARG B 2 32  ? -12.73900 5.49300  90.07000  1.000 43.72046  ? 727  ARG A O     1 
ATOM   1637 C  CB    . ARG B 2 32  ? -11.53600 3.47900  88.16700  1.000 39.10549  ? 727  ARG A CB    1 
ATOM   1638 C  CG    . ARG B 2 32  ? -10.37200 3.01900  87.28000  1.000 37.58096  ? 727  ARG A CG    1 
ATOM   1639 C  CD    . ARG B 2 32  ? -9.85000  1.66300  87.69900  1.000 37.85908  ? 727  ARG A CD    1 
ATOM   1640 N  NE    . ARG B 2 32  ? -8.84200  1.78200  88.74300  1.000 44.86530  ? 727  ARG A NE    1 
ATOM   1641 C  CZ    . ARG B 2 32  ? -8.26400  0.74400  89.33500  1.000 47.07581  ? 727  ARG A CZ    1 
ATOM   1642 N  NH1   . ARG B 2 32  ? -8.61900  -0.48300 88.98300  1.000 49.35357  ? 727  ARG A NH1   1 
ATOM   1643 N  NH2   . ARG B 2 32  ? -7.32900  0.93100  90.26500  1.000 47.34410  ? 727  ARG A NH2   1 
ATOM   1644 N  N     . THR B 2 33  ? -14.26400 5.61700  88.40400  1.000 33.05836  ? 728  THR A N     1 
ATOM   1645 C  CA    . THR B 2 33  ? -15.29800 6.28200  89.18300  1.000 35.00791  ? 728  THR A CA    1 
ATOM   1646 C  C     . THR B 2 33  ? -16.35900 5.29800  89.65300  1.000 32.48475  ? 728  THR A C     1 
ATOM   1647 O  O     . THR B 2 33  ? -16.65600 4.31000  88.97900  1.000 33.40778  ? 728  THR A O     1 
ATOM   1648 C  CB    . THR B 2 33  ? -15.97900 7.37300  88.37400  1.000 32.84637  ? 728  THR A CB    1 
ATOM   1649 O  OG1   . THR B 2 33  ? -16.78500 6.75200  87.36800  1.000 43.01116  ? 728  THR A OG1   1 
ATOM   1650 C  CG2   . THR B 2 33  ? -14.93600 8.26000  87.72100  1.000 21.34109  ? 728  THR A CG2   1 
ATOM   1651 N  N     . ASP B 2 34  ? -16.91400 5.58700  90.81800  1.000 31.00692  ? 729  ASP A N     1 
ATOM   1652 C  CA    . ASP B 2 34  ? -18.01000 4.80600  91.36700  1.000 35.57606  ? 729  ASP A CA    1 
ATOM   1653 C  C     . ASP B 2 34  ? -19.17200 4.78400  90.38100  1.000 34.62894  ? 729  ASP A C     1 
ATOM   1654 O  O     . ASP B 2 34  ? -19.68600 5.85400  90.02100  1.000 32.95270  ? 729  ASP A O     1 
ATOM   1655 C  CB    . ASP B 2 34  ? -18.47200 5.40000  92.70000  1.000 38.14553  ? 729  ASP A CB    1 
ATOM   1656 C  CG    . ASP B 2 34  ? -19.13900 4.37900  93.60300  1.000 37.31657  ? 729  ASP A CG    1 
ATOM   1657 O  OD1   . ASP B 2 34  ? -19.91200 3.53200  93.10900  1.000 37.85912  ? 729  ASP A OD1   1 
ATOM   1658 O  OD2   . ASP B 2 34  ? -18.90000 4.43000  94.82200  1.000 40.09941  ? 729  ASP A OD2   1 
ATOM   1659 N  N     . PRO B 2 35  ? -19.60300 3.60700  89.91700  1.000 31.43121  ? 730  PRO A N     1 
ATOM   1660 C  CA    . PRO B 2 35  ? -20.79900 3.54100  89.05800  1.000 34.92691  ? 730  PRO A CA    1 
ATOM   1661 C  C     . PRO B 2 35  ? -22.07100 4.11400  89.69900  1.000 38.66466  ? 730  PRO A C     1 
ATOM   1662 O  O     . PRO B 2 35  ? -22.97700 4.55300  88.97600  1.000 40.32469  ? 730  PRO A O     1 
ATOM   1663 C  CB    . PRO B 2 35  ? -20.93700 2.03600  88.79000  1.000 35.38720  ? 730  PRO A CB    1 
ATOM   1664 C  CG    . PRO B 2 35  ? -19.53600 1.51300  88.91800  1.000 34.37094  ? 730  PRO A CG    1 
ATOM   1665 C  CD    . PRO B 2 35  ? -18.93600 2.30500  90.03900  1.000 28.09132  ? 730  PRO A CD    1 
ATOM   1666 N  N     . ASP B 2 36  ? -22.17000 4.13100  91.02300  1.000 44.46308  ? 731  ASP A N     1 
ATOM   1667 C  CA    . ASP B 2 36  ? -23.32100 4.70400  91.69900  1.000 38.49772  ? 731  ASP A CA    1 
ATOM   1668 C  C     . ASP B 2 36  ? -23.23600 6.22100  91.84300  1.000 39.15565  ? 731  ASP A C     1 
ATOM   1669 O  O     . ASP B 2 36  ? -24.12300 6.81300  92.47700  1.000 35.63580  ? 731  ASP A O     1 
ATOM   1670 C  CB    . ASP B 2 36  ? -23.48800 4.08300  93.08200  1.000 40.49709  ? 731  ASP A CB    1 
ATOM   1671 C  CG    . ASP B 2 36  ? -23.56800 2.57500  93.04600  1.000 49.54435  ? 731  ASP A CG    1 
ATOM   1672 O  OD1   . ASP B 2 36  ? -24.26100 2.04900  92.13000  1.000 56.25324  ? 731  ASP A OD1   1 
ATOM   1673 O  OD2   . ASP B 2 36  ? -22.94800 1.93000  93.93700  1.000 45.06899  ? 731  ASP A OD2   1 
ATOM   1674 N  N     . TYR B 2 37  ? -22.19800 6.86800  91.28100  1.000 24.69258  ? 732  TYR A N     1 
ATOM   1675 C  CA    . TYR B 2 37  ? -22.02000 8.30800  91.46400  1.000 19.52814  ? 732  TYR A CA    1 
ATOM   1676 C  C     . TYR B 2 37  ? -21.83600 9.06400  90.14400  1.000 20.07053  ? 732  TYR A C     1 
ATOM   1677 O  O     . TYR B 2 37  ? -21.43900 10.23700 90.16400  1.000 19.51998  ? 732  TYR A O     1 
ATOM   1678 C  CB    . TYR B 2 37  ? -20.84000 8.59000  92.40400  1.000 19.20843  ? 732  TYR A CB    1 
ATOM   1679 C  CG    . TYR B 2 37  ? -21.13200 8.32700  93.87900  1.000 25.64729  ? 732  TYR A CG    1 
ATOM   1680 C  CD1   . TYR B 2 37  ? -21.12000 7.03400  94.39200  1.000 26.37230  ? 732  TYR A CD1   1 
ATOM   1681 C  CD2   . TYR B 2 37  ? -21.39700 9.37700  94.76400  1.000 22.89216  ? 732  TYR A CD2   1 
ATOM   1682 C  CE1   . TYR B 2 37  ? -21.36600 6.78500  95.73500  1.000 21.53725  ? 732  TYR A CE1   1 
ATOM   1683 C  CE2   . TYR B 2 37  ? -21.64600 9.13900  96.11500  1.000 18.01569  ? 732  TYR A CE2   1 
ATOM   1684 C  CZ    . TYR B 2 37  ? -21.62200 7.84100  96.60300  1.000 20.96560  ? 732  TYR A CZ    1 
ATOM   1685 O  OH    . TYR B 2 37  ? -21.85500 7.60100  97.95900  1.000 17.77220  ? 732  TYR A OH    1 
ATOM   1686 N  N     . ILE B 2 38  ? -22.17200 8.46000  88.99900  1.000 23.49242  ? 733  ILE A N     1 
ATOM   1687 C  CA    . ILE B 2 38  ? -21.83400 9.05800  87.70500  1.000 23.87902  ? 733  ILE A CA    1 
ATOM   1688 C  C     . ILE B 2 38  ? -22.52300 10.39400 87.42900  1.000 27.72685  ? 733  ILE A C     1 
ATOM   1689 O  O     . ILE B 2 38  ? -22.21300 11.03700 86.42500  1.000 30.56633  ? 733  ILE A O     1 
ATOM   1690 C  CB    . ILE B 2 38  ? -22.13900 8.07400  86.55400  1.000 25.50168  ? 733  ILE A CB    1 
ATOM   1691 C  CG1   . ILE B 2 38  ? -23.66400 7.90600  86.38200  1.000 21.45049  ? 733  ILE A CG1   1 
ATOM   1692 C  CG2   . ILE B 2 38  ? -21.33400 6.75600  86.73300  1.000 29.29223  ? 733  ILE A CG2   1 
ATOM   1693 C  CD1   . ILE B 2 38  ? -24.07300 6.92800  85.26200  1.000 22.22188  ? 733  ILE A CD1   1 
ATOM   1694 N  N     . LYS B 2 39  ? -23.45400 10.83600 88.28100  1.000 41.77661  ? 734  LYS A N     1 
ATOM   1695 C  CA    . LYS B 2 39  ? -24.04000 12.15900 88.08700  1.000 36.17101  ? 734  LYS A CA    1 
ATOM   1696 C  C     . LYS B 2 39  ? -22.99700 13.25800 88.29300  1.000 34.47047  ? 734  LYS A C     1 
ATOM   1697 O  O     . LYS B 2 39  ? -23.15300 14.37500 87.77000  1.000 31.65958  ? 734  LYS A O     1 
ATOM   1698 C  CB    . LYS B 2 39  ? -25.23200 12.33300 89.03800  1.000 29.32350  ? 734  LYS A CB    1 
ATOM   1699 C  CG    . LYS B 2 39  ? -26.04100 13.64400 88.84400  1.000 36.45373  ? 734  LYS A CG    1 
ATOM   1700 C  CD    . LYS B 2 39  ? -26.31100 14.37200 90.15500  1.000 46.38666  ? 734  LYS A CD    1 
ATOM   1701 C  CE    . LYS B 2 39  ? -27.46300 13.70900 90.94100  1.000 56.18832  ? 734  LYS A CE    1 
ATOM   1702 N  NZ    . LYS B 2 39  ? -28.24600 14.67000 91.79900  1.000 61.57816  ? 734  LYS A NZ    1 
ATOM   1703 N  N     . ARG B 2 40  ? -21.92000 12.93700 89.02100  1.000 33.97247  ? 735  ARG A N     1 
ATOM   1704 C  CA    . ARG B 2 40  ? -20.82700 13.87100 89.28600  1.000 39.24175  ? 735  ARG A CA    1 
ATOM   1705 C  C     . ARG B 2 40  ? -20.06400 14.26400 88.01800  1.000 38.59158  ? 735  ARG A C     1 
ATOM   1706 O  O     . ARG B 2 40  ? -19.51700 15.37200 87.93700  1.000 36.29624  ? 735  ARG A O     1 
ATOM   1707 C  CB    . ARG B 2 40  ? -19.87600 13.22700 90.29100  1.000 33.89927  ? 735  ARG A CB    1 
ATOM   1708 C  CG    . ARG B 2 40  ? -19.47300 14.09200 91.42100  1.000 36.95549  ? 735  ARG A CG    1 
ATOM   1709 C  CD    . ARG B 2 40  ? -18.52800 13.33000 92.35200  1.000 51.79528  ? 735  ARG A CD    1 
ATOM   1710 N  NE    . ARG B 2 40  ? -19.08300 13.09500 93.68400  1.000 55.90935  ? 735  ARG A NE    1 
ATOM   1711 C  CZ    . ARG B 2 40  ? -19.39600 14.06400 94.53300  1.000 58.22872  ? 735  ARG A CZ    1 
ATOM   1712 N  NH1   . ARG B 2 40  ? -19.89600 13.78400 95.72700  1.000 60.31574  ? 735  ARG A NH1   1 
ATOM   1713 N  NH2   . ARG B 2 40  ? -19.25100 15.32000 94.16100  1.000 62.35212  ? 735  ARG A NH2   1 
ATOM   1714 N  N     . LEU B 2 41  ? -20.01600 13.37600 87.02800  1.000 27.17001  ? 736  LEU A N     1 
ATOM   1715 C  CA    . LEU B 2 41  ? -19.23600 13.59400 85.82200  1.000 28.42278  ? 736  LEU A CA    1 
ATOM   1716 C  C     . LEU B 2 41  ? -19.89200 14.62800 84.89700  1.000 26.89849  ? 736  LEU A C     1 
ATOM   1717 O  O     . LEU B 2 41  ? -21.10700 14.84900 84.91200  1.000 27.26702  ? 736  LEU A O     1 
ATOM   1718 C  CB    . LEU B 2 41  ? -19.05600 12.27300 85.07400  1.000 27.02908  ? 736  LEU A CB    1 
ATOM   1719 C  CG    . LEU B 2 41  ? -18.60100 11.09600 85.93600  1.000 22.68548  ? 736  LEU A CG    1 
ATOM   1720 C  CD1   . LEU B 2 41  ? -18.71800 9.81400  85.16300  1.000 20.95325  ? 736  LEU A CD1   1 
ATOM   1721 C  CD2   . LEU B 2 41  ? -17.16100 11.29200 86.40300  1.000 27.27055  ? 736  LEU A CD2   1 
ATOM   1722 N  N     . ARG B 2 42  ? -19.06200 15.23500 84.05400  1.000 24.31461  ? 737  ARG A N     1 
ATOM   1723 C  CA    . ARG B 2 42  ? -19.48900 16.23300 83.08700  1.000 24.25778  ? 737  ARG A CA    1 
ATOM   1724 C  C     . ARG B 2 42  ? -19.15900 15.82400 81.65100  1.000 24.80418  ? 737  ARG A C     1 
ATOM   1725 O  O     . ARG B 2 42  ? -18.07500 15.31100 81.36800  1.000 21.75655  ? 737  ARG A O     1 
ATOM   1726 C  CB    . ARG B 2 42  ? -18.84100 17.55300 83.39100  1.000 20.87529  ? 737  ARG A CB    1 
ATOM   1727 C  CG    . ARG B 2 42  ? -19.08000 17.97300 84.77500  1.000 20.62754  ? 737  ARG A CG    1 
ATOM   1728 C  CD    . ARG B 2 42  ? -18.34800 19.26400 85.03900  1.000 23.47096  ? 737  ARG A CD    1 
ATOM   1729 N  NE    . ARG B 2 42  ? -18.90700 19.89500 86.22000  1.000 30.32191  ? 737  ARG A NE    1 
ATOM   1730 C  CZ    . ARG B 2 42  ? -18.27900 20.78700 86.96400  1.000 28.09684  ? 737  ARG A CZ    1 
ATOM   1731 N  NH1   . ARG B 2 42  ? -17.04600 21.14900 86.65100  1.000 26.98636  ? 737  ARG A NH1   1 
ATOM   1732 N  NH2   . ARG B 2 42  ? -18.90000 21.30400 88.02800  1.000 26.57714  ? 737  ARG A NH2   1 
ATOM   1733 N  N     . TYR B 2 43  ? -20.11000 16.07700 80.74400  1.000 33.73444  ? 738  TYR A N     1 
ATOM   1734 C  CA    . TYR B 2 43  ? -19.97700 15.72200 79.33400  1.000 25.56988  ? 738  TYR A CA    1 
ATOM   1735 C  C     . TYR B 2 43  ? -19.24600 16.81100 78.58200  1.000 29.45176  ? 738  TYR A C     1 
ATOM   1736 O  O     . TYR B 2 43  ? -19.63900 17.98000 78.63000  1.000 31.24375  ? 738  TYR A O     1 
ATOM   1737 C  CB    . TYR B 2 43  ? -21.32600 15.52000 78.67700  1.000 22.37051  ? 738  TYR A CB    1 
ATOM   1738 C  CG    . TYR B 2 43  ? -21.28100 14.85500 77.32800  1.000 22.77992  ? 738  TYR A CG    1 
ATOM   1739 C  CD1   . TYR B 2 43  ? -21.01400 13.49300 77.22200  1.000 27.05038  ? 738  TYR A CD1   1 
ATOM   1740 C  CD2   . TYR B 2 43  ? -21.55100 15.57300 76.14800  1.000 23.18026  ? 738  TYR A CD2   1 
ATOM   1741 C  CE1   . TYR B 2 43  ? -20.99100 12.85900 75.98100  1.000 30.19021  ? 738  TYR A CE1   1 
ATOM   1742 C  CE2   . TYR B 2 43  ? -21.53700 14.94200 74.89800  1.000 23.84617  ? 738  TYR A CE2   1 
ATOM   1743 C  CZ    . TYR B 2 43  ? -21.25500 13.58000 74.82900  1.000 30.72522  ? 738  TYR A CZ    1 
ATOM   1744 O  OH    . TYR B 2 43  ? -21.22900 12.90100 73.62700  1.000 31.53878  ? 738  TYR A OH    1 
ATOM   1745 N  N     . CYS B 2 44  ? -18.18700 16.40300 77.88300  1.000 32.13438  ? 739  CYS A N     1 
ATOM   1746 C  CA    . CYS B 2 44  ? -17.40100 17.27400 77.02800  1.000 33.13813  ? 739  CYS A CA    1 
ATOM   1747 C  C     . CYS B 2 44  ? -18.04200 17.26400 75.65000  1.000 36.29238  ? 739  CYS A C     1 
ATOM   1748 O  O     . CYS B 2 44  ? -17.99400 16.24900 74.94200  1.000 32.57488  ? 739  CYS A O     1 
ATOM   1749 C  CB    . CYS B 2 44  ? -15.95300 16.79900 76.95600  1.000 36.63069  ? 739  CYS A CB    1 
ATOM   1750 S  SG    . CYS B 2 44  ? -14.97600 17.79000 75.84000  1.000 30.98132  ? 739  CYS A SG    1 
ATOM   1751 N  N     . GLU B 2 45  ? -18.64200 18.39100 75.26100  1.000 47.70403  ? 740  GLU A N     1 
ATOM   1752 C  CA    . GLU B 2 45  ? -19.42300 18.38000 74.03400  1.000 50.30201  ? 740  GLU A CA    1 
ATOM   1753 C  C     . GLU B 2 45  ? -18.55700 18.28200 72.79300  1.000 52.40969  ? 740  GLU A C     1 
ATOM   1754 O  O     . GLU B 2 45  ? -19.10100 18.07000 71.70400  1.000 54.29205  ? 740  GLU A O     1 
ATOM   1755 C  CB    . GLU B 2 45  ? -20.35200 19.60600 73.94500  1.000 51.76619  ? 740  GLU A CB    1 
ATOM   1756 C  CG    . GLU B 2 45  ? -21.68200 19.42300 74.70600  1.000 60.51711  ? 740  GLU A CG    1 
ATOM   1757 C  CD    . GLU B 2 45  ? -22.66000 18.40700 74.05800  1.000 70.12893  ? 740  GLU A CD    1 
ATOM   1758 O  OE1   . GLU B 2 45  ? -23.87200 18.45700 74.39100  1.000 74.69494  ? 740  GLU A OE1   1 
ATOM   1759 O  OE2   . GLU B 2 45  ? -22.24100 17.56300 73.22800  1.000 71.49025  ? 740  GLU A OE2   1 
ATOM   1760 N  N     . TYR B 2 46  ? -17.23500 18.39200 72.92100  1.000 45.74196  ? 741  TYR A N     1 
ATOM   1761 C  CA    . TYR B 2 46  ? -16.35800 18.24600 71.76400  1.000 41.94910  ? 741  TYR A CA    1 
ATOM   1762 C  C     . TYR B 2 46  ? -15.79200 16.83600 71.63400  1.000 37.10682  ? 741  TYR A C     1 
ATOM   1763 O  O     . TYR B 2 46  ? -15.84700 16.23600 70.55900  1.000 37.37850  ? 741  TYR A O     1 
ATOM   1764 C  CB    . TYR B 2 46  ? -15.20900 19.25200 71.82700  1.000 39.13452  ? 741  TYR A CB    1 
ATOM   1765 C  CG    . TYR B 2 46  ? -14.10100 18.90400 70.86800  1.000 47.95698  ? 741  TYR A CG    1 
ATOM   1766 C  CD1   . TYR B 2 46  ? -14.18600 19.27600 69.53300  1.000 47.66501  ? 741  TYR A CD1   1 
ATOM   1767 C  CD2   . TYR B 2 46  ? -12.97500 18.18100 71.28400  1.000 51.50332  ? 741  TYR A CD2   1 
ATOM   1768 C  CE1   . TYR B 2 46  ? -13.19600 18.95700 68.63400  1.000 42.24479  ? 741  TYR A CE1   1 
ATOM   1769 C  CE2   . TYR B 2 46  ? -11.97000 17.85000 70.38400  1.000 48.41335  ? 741  TYR A CE2   1 
ATOM   1770 C  CZ    . TYR B 2 46  ? -12.09200 18.25100 69.05300  1.000 44.66096  ? 741  TYR A CZ    1 
ATOM   1771 O  OH    . TYR B 2 46  ? -11.12400 17.94400 68.12300  1.000 42.03429  ? 741  TYR A OH    1 
ATOM   1772 N  N     . LEU B 2 47  ? -15.22500 16.29600 72.70200  1.000 34.34186  ? 742  LEU A N     1 
ATOM   1773 C  CA    . LEU B 2 47  ? -14.66400 14.95700 72.62000  1.000 34.89922  ? 742  LEU A CA    1 
ATOM   1774 C  C     . LEU B 2 47  ? -15.72300 13.87100 72.69400  1.000 35.95263  ? 742  LEU A C     1 
ATOM   1775 O  O     . LEU B 2 47  ? -15.42600 12.71800 72.36200  1.000 40.85386  ? 742  LEU A O     1 
ATOM   1776 C  CB    . LEU B 2 47  ? -13.64000 14.75200 73.73500  1.000 37.27833  ? 742  LEU A CB    1 
ATOM   1777 C  CG    . LEU B 2 47  ? -12.51800 13.85300 73.24500  1.000 45.66678  ? 742  LEU A CG    1 
ATOM   1778 C  CD1   . LEU B 2 47  ? -11.52400 14.67100 72.38300  1.000 44.62437  ? 742  LEU A CD1   1 
ATOM   1779 C  CD2   . LEU B 2 47  ? -11.83500 13.16700 74.40900  1.000 48.79443  ? 742  LEU A CD2   1 
ATOM   1780 N  N     . GLY B 2 48  ? -16.94100 14.21200 73.12200  1.000 23.10311  ? 743  GLY A N     1 
ATOM   1781 C  CA    . GLY B 2 48  ? -18.01100 13.24600 73.26100  1.000 23.38113  ? 743  GLY A CA    1 
ATOM   1782 C  C     . GLY B 2 48  ? -17.89700 12.26300 74.40400  1.000 30.15120  ? 743  GLY A C     1 
ATOM   1783 O  O     . GLY B 2 48  ? -18.60300 11.25100 74.39200  1.000 38.90305  ? 743  GLY A O     1 
ATOM   1784 N  N     . LYS B 2 49  ? -17.05300 12.52100 75.40000  1.000 33.82954  ? 744  LYS A N     1 
ATOM   1785 C  CA    . LYS B 2 49  ? -16.85100 11.57900 76.49200  1.000 31.39477  ? 744  LYS A CA    1 
ATOM   1786 C  C     . LYS B 2 49  ? -17.04900 12.29100 77.82600  1.000 31.41755  ? 744  LYS A C     1 
ATOM   1787 O  O     . LYS B 2 49  ? -17.13100 13.52300 77.89500  1.000 32.94484  ? 744  LYS A O     1 
ATOM   1788 C  CB    . LYS B 2 49  ? -15.46300 10.91100 76.41000  1.000 32.59246  ? 744  LYS A CB    1 
ATOM   1789 C  CG    . LYS B 2 49  ? -15.10900 10.39400 75.00900  1.000 35.29463  ? 744  LYS A CG    1 
ATOM   1790 C  CD    . LYS B 2 49  ? -13.91800 9.43600  74.99000  1.000 38.33769  ? 744  LYS A CD    1 
ATOM   1791 C  CE    . LYS B 2 49  ? -14.31500 7.96400  74.82200  1.000 41.20669  ? 744  LYS A CE    1 
ATOM   1792 N  NZ    . LYS B 2 49  ? -13.41400 6.99200  75.60400  1.000 44.84105  ? 744  LYS A NZ    1 
ATOM   1793 N  N     . TYR B 2 50  ? -17.14700 11.50100 78.89600  1.000 30.97300  ? 745  TYR A N     1 
ATOM   1794 C  CA    . TYR B 2 50  ? -17.36700 12.02700 80.24100  1.000 28.38175  ? 745  TYR A CA    1 
ATOM   1795 C  C     . TYR B 2 50  ? -16.04600 12.17500 80.99700  1.000 31.66293  ? 745  TYR A C     1 
ATOM   1796 O  O     . TYR B 2 50  ? -15.07100 11.45500 80.74300  1.000 30.90763  ? 745  TYR A O     1 
ATOM   1797 C  CB    . TYR B 2 50  ? -18.33200 11.13300 81.03400  1.000 27.91244  ? 745  TYR A CB    1 
ATOM   1798 C  CG    . TYR B 2 50  ? -19.76900 11.45800 80.72100  1.000 40.40371  ? 745  TYR A CG    1 
ATOM   1799 C  CD1   . TYR B 2 50  ? -20.43600 12.48400 81.38800  1.000 43.98008  ? 745  TYR A CD1   1 
ATOM   1800 C  CD2   . TYR B 2 50  ? -20.44900 10.77600 79.72600  1.000 41.54343  ? 745  TYR A CD2   1 
ATOM   1801 C  CE1   . TYR B 2 50  ? -21.75300 12.80300 81.08200  1.000 45.49754  ? 745  TYR A CE1   1 
ATOM   1802 C  CE2   . TYR B 2 50  ? -21.76000 11.08200 79.41900  1.000 44.32821  ? 745  TYR A CE2   1 
ATOM   1803 C  CZ    . TYR B 2 50  ? -22.41300 12.09500 80.09200  1.000 44.21527  ? 745  TYR A CZ    1 
ATOM   1804 O  OH    . TYR B 2 50  ? -23.72900 12.39000 79.75700  1.000 40.08396  ? 745  TYR A OH    1 
ATOM   1805 N  N     . PHE B 2 51  ? -16.03100 13.13200 81.92900  1.000 26.65998  ? 746  PHE A N     1 
ATOM   1806 C  CA    . PHE B 2 51  ? -14.84200 13.55800 82.65000  1.000 26.08534  ? 746  PHE A CA    1 
ATOM   1807 C  C     . PHE B 2 51  ? -15.19400 13.79200 84.10900  1.000 25.96736  ? 746  PHE A C     1 
ATOM   1808 O  O     . PHE B 2 51  ? -16.30300 14.22900 84.41800  1.000 22.00682  ? 746  PHE A O     1 
ATOM   1809 C  CB    . PHE B 2 51  ? -14.27500 14.86900 82.09300  1.000 28.64305  ? 746  PHE A CB    1 
ATOM   1810 C  CG    . PHE B 2 51  ? -13.56700 14.73800 80.77300  1.000 33.19134  ? 746  PHE A CG    1 
ATOM   1811 C  CD1   . PHE B 2 51  ? -14.27000 14.42600 79.62700  1.000 28.27972  ? 746  PHE A CD1   1 
ATOM   1812 C  CD2   . PHE B 2 51  ? -12.20300 14.98300 80.67300  1.000 37.55699  ? 746  PHE A CD2   1 
ATOM   1813 C  CE1   . PHE B 2 51  ? -13.63200 14.32500 78.41700  1.000 25.54705  ? 746  PHE A CE1   1 
ATOM   1814 C  CE2   . PHE B 2 51  ? -11.55900 14.88200 79.45000  1.000 35.56644  ? 746  PHE A CE2   1 
ATOM   1815 C  CZ    . PHE B 2 51  ? -12.28700 14.55700 78.32000  1.000 29.24906  ? 746  PHE A CZ    1 
ATOM   1816 N  N     . CYS B 2 52  ? -14.22100 13.54400 84.99400  1.000 20.77520  ? 747  CYS A N     1 
ATOM   1817 C  CA    . CYS B 2 52  ? -14.26600 13.95600 86.40000  1.000 20.51512  ? 747  CYS A CA    1 
ATOM   1818 C  C     . CYS B 2 52  ? -14.26300 15.48700 86.51800  1.000 23.58366  ? 747  CYS A C     1 
ATOM   1819 O  O     . CYS B 2 52  ? -13.82000 16.20500 85.60900  1.000 21.12373  ? 747  CYS A O     1 
ATOM   1820 C  CB    . CYS B 2 52  ? -13.04700 13.40700 87.16700  1.000 20.69695  ? 747  CYS A CB    1 
ATOM   1821 S  SG    . CYS B 2 52  ? -11.46100 14.18600 86.70300  1.000 29.93697  ? 747  CYS A SG    1 
ATOM   1822 N  N     . GLN B 2 53  ? -14.72900 15.99200 87.67300  1.000 36.31661  ? 748  GLN A N     1 
ATOM   1823 C  CA    . GLN B 2 53  ? -14.82800 17.44200 87.85200  1.000 31.69078  ? 748  GLN A CA    1 
ATOM   1824 C  C     . GLN B 2 53  ? -13.46200 18.12900 88.00000  1.000 35.93594  ? 748  GLN A C     1 
ATOM   1825 O  O     . GLN B 2 53  ? -13.39900 19.36200 88.05700  1.000 37.23853  ? 748  GLN A O     1 
ATOM   1826 C  CB    . GLN B 2 53  ? -15.72000 17.74800 89.04900  1.000 35.62659  ? 748  GLN A CB    1 
ATOM   1827 C  CG    . GLN B 2 53  ? -17.08400 17.05200 88.98000  1.000 47.84149  ? 748  GLN A CG    1 
ATOM   1828 C  CD    . GLN B 2 53  ? -18.19300 17.82800 89.67100  1.000 53.03958  ? 748  GLN A CD    1 
ATOM   1829 O  OE1   . GLN B 2 53  ? -17.93300 18.76100 90.43300  1.000 55.40980  ? 748  GLN A OE1   1 
ATOM   1830 N  NE2   . GLN B 2 53  ? -19.43600 17.44400 89.40700  1.000 54.18845  ? 748  GLN A NE2   1 
ATOM   1831 N  N     . CYS B 2 54  ? -12.36300 17.38700 88.03200  1.000 32.94756  ? 749  CYS A N     1 
ATOM   1832 C  CA    . CYS B 2 54  ? -11.06400 18.04600 87.97600  1.000 35.81825  ? 749  CYS A CA    1 
ATOM   1833 C  C     . CYS B 2 54  ? -10.59700 18.30200 86.54800  1.000 35.23476  ? 749  CYS A C     1 
ATOM   1834 O  O     . CYS B 2 54  ? -10.20700 19.42300 86.21600  1.000 37.93312  ? 749  CYS A O     1 
ATOM   1835 C  CB    . CYS B 2 54  ? -10.01900 17.21600 88.71500  1.000 38.97940  ? 749  CYS A CB    1 
ATOM   1836 S  SG    . CYS B 2 54  ? -10.12200 17.25600 90.54200  1.000 48.68931  ? 749  CYS A SG    1 
ATOM   1837 N  N     . CYS B 2 55  ? -10.63300 17.27600 85.69700  1.000 26.36486  ? 750  CYS A N     1 
ATOM   1838 C  CA    . CYS B 2 55  ? -10.30500 17.40900 84.27700  1.000 26.81110  ? 750  CYS A CA    1 
ATOM   1839 C  C     . CYS B 2 55  ? -11.27500 18.29500 83.49400  1.000 30.51072  ? 750  CYS A C     1 
ATOM   1840 O  O     . CYS B 2 55  ? -10.88900 18.82000 82.44200  1.000 33.42437  ? 750  CYS A O     1 
ATOM   1841 C  CB    . CYS B 2 55  ? -10.29500 16.04200 83.61200  1.000 28.63222  ? 750  CYS A CB    1 
ATOM   1842 S  SG    . CYS B 2 55  ? -9.25700  14.80000 84.48700  1.000 30.38836  ? 750  CYS A SG    1 
ATOM   1843 N  N     . HIS B 2 56  ? -12.52300 18.43100 83.94700  1.000 26.90268  ? 751  HIS A N     1 
ATOM   1844 C  CA    . HIS B 2 56  ? -13.54700 19.20300 83.25800  1.000 27.18934  ? 751  HIS A CA    1 
ATOM   1845 C  C     . HIS B 2 56  ? -14.13200 20.17700 84.27200  1.000 29.84777  ? 751  HIS A C     1 
ATOM   1846 O  O     . HIS B 2 56  ? -14.74700 19.75300 85.25400  1.000 32.82683  ? 751  HIS A O     1 
ATOM   1847 C  CB    . HIS B 2 56  ? -14.60500 18.25600 82.69000  1.000 32.39518  ? 751  HIS A CB    1 
ATOM   1848 C  CG    . HIS B 2 56  ? -15.69400 18.91800 81.89800  1.000 32.00137  ? 751  HIS A CG    1 
ATOM   1849 N  ND1   . HIS B 2 56  ? -16.23300 20.14800 82.22200  1.000 35.56026  ? 751  HIS A ND1   1 
ATOM   1850 C  CD2   . HIS B 2 56  ? -16.38700 18.48700 80.81900  1.000 32.61048  ? 751  HIS A CD2   1 
ATOM   1851 C  CE1   . HIS B 2 56  ? -17.18300 20.46000 81.35900  1.000 35.40366  ? 751  HIS A CE1   1 
ATOM   1852 N  NE2   . HIS B 2 56  ? -17.29400 19.46800 80.49300  1.000 36.06989  ? 751  HIS A NE2   1 
ATOM   1853 N  N     . GLU B 2 57  ? -13.95900 21.47700 84.02100  1.000 37.83035  ? 752  GLU A N     1 
ATOM   1854 C  CA    . GLU B 2 57  ? -14.32900 22.55100 84.94100  1.000 32.97557  ? 752  GLU A CA    1 
ATOM   1855 C  C     . GLU B 2 57  ? -15.32700 23.52100 84.29900  1.000 37.04339  ? 752  GLU A C     1 
ATOM   1856 O  O     . GLU B 2 57  ? -15.39600 24.69200 84.67400  1.000 43.99867  ? 752  GLU A O     1 
ATOM   1857 C  CB    . GLU B 2 57  ? -13.08200 23.30200 85.43000  1.000 30.80114  ? 752  GLU A CB    1 
ATOM   1858 C  CG    . GLU B 2 57  ? -11.97000 22.37200 85.97700  1.000 50.58593  ? 752  GLU A CG    1 
ATOM   1859 C  CD    . GLU B 2 57  ? -10.77300 23.08300 86.65200  1.000 64.23615  ? 752  GLU A CD    1 
ATOM   1860 O  OE1   . GLU B 2 57  ? -10.05500 23.86300 85.98300  1.000 66.70095  ? 752  GLU A OE1   1 
ATOM   1861 O  OE2   . GLU B 2 57  ? -10.53400 22.82900 87.86000  1.000 69.98912  ? 752  GLU A OE2   1 
ATOM   1862 N  N     . ASN B 2 58  ? -16.09100 23.05100 83.31500  1.000 35.16035  ? 753  ASN A N     1 
ATOM   1863 C  CA    . ASN B 2 58  ? -17.13600 23.84600 82.66300  1.000 40.97677  ? 753  ASN A CA    1 
ATOM   1864 C  C     . ASN B 2 58  ? -16.57100 25.04100 81.88900  1.000 44.18571  ? 753  ASN A C     1 
ATOM   1865 O  O     . ASN B 2 58  ? -17.16700 26.12400 81.85800  1.000 50.80596  ? 753  ASN A O     1 
ATOM   1866 C  CB    . ASN B 2 58  ? -18.19400 24.30700 83.66900  1.000 41.86941  ? 753  ASN A CB    1 
ATOM   1867 C  CG    . ASN B 2 58  ? -19.26400 23.26300 83.90500  1.000 39.87200  ? 753  ASN A CG    1 
ATOM   1868 O  OD1   . ASN B 2 58  ? -19.50700 22.40400 83.05000  1.000 36.04406  ? 753  ASN A OD1   1 
ATOM   1869 N  ND2   . ASN B 2 58  ? -19.89500 23.31800 85.08000  1.000 39.41884  ? 753  ASN A ND2   1 
ATOM   1870 N  N     . ALA B 2 59  ? -15.42800 24.84400 81.23700  1.000 32.64471  ? 754  ALA A N     1 
ATOM   1871 C  CA    . ALA B 2 59  ? -14.98500 25.79900 80.22800  1.000 35.07598  ? 754  ALA A CA    1 
ATOM   1872 C  C     . ALA B 2 59  ? -15.91000 25.72500 79.01500  1.000 38.04935  ? 754  ALA A C     1 
ATOM   1873 O  O     . ALA B 2 59  ? -16.42600 24.65800 78.66600  1.000 36.60471  ? 754  ALA A O     1 
ATOM   1874 C  CB    . ALA B 2 59  ? -13.53300 25.51900 79.81600  1.000 33.13571  ? 754  ALA A CB    1 
ATOM   1875 N  N     . GLN B 2 60  ? -16.13000 26.86300 78.37100  1.000 48.71464  ? 755  GLN A N     1 
ATOM   1876 C  CA    . GLN B 2 60  ? -17.05400 26.93100 77.24800  1.000 45.30470  ? 755  GLN A CA    1 
ATOM   1877 C  C     . GLN B 2 60  ? -16.30000 27.20900 75.95300  1.000 50.42212  ? 755  GLN A C     1 
ATOM   1878 O  O     . GLN B 2 60  ? -15.25500 27.86700 75.95100  1.000 57.07030  ? 755  GLN A O     1 
ATOM   1879 C  CB    . GLN B 2 60  ? -18.11800 27.99900 77.48700  1.000 42.13161  ? 755  GLN A CB    1 
ATOM   1880 C  CG    . GLN B 2 60  ? -19.23100 27.52600 78.39500  1.000 50.28377  ? 755  GLN A CG    1 
ATOM   1881 C  CD    . GLN B 2 60  ? -20.25500 28.59400 78.62100  1.000 52.54124  ? 755  GLN A CD    1 
ATOM   1882 O  OE1   . GLN B 2 60  ? -20.04400 29.52000 79.40900  1.000 57.41709  ? 755  GLN A OE1   1 
ATOM   1883 N  NE2   . GLN B 2 60  ? -21.36600 28.49700 77.90500  1.000 48.26715  ? 755  GLN A NE2   1 
ATOM   1884 N  N     . MET B 2 61  ? -16.84100 26.69500 74.85000  1.000 42.81102  ? 756  MET A N     1 
ATOM   1885 C  CA    . MET B 2 61  ? -16.11800 26.69300 73.58400  1.000 40.06221  ? 756  MET A CA    1 
ATOM   1886 C  C     . MET B 2 61  ? -17.08500 26.35000 72.45400  1.000 44.29523  ? 756  MET A C     1 
ATOM   1887 O  O     . MET B 2 61  ? -17.94000 25.47000 72.61400  1.000 41.69993  ? 756  MET A O     1 
ATOM   1888 C  CB    . MET B 2 61  ? -14.96100 25.67800 73.63600  1.000 33.72779  ? 756  MET A CB    1 
ATOM   1889 C  CG    . MET B 2 61  ? -13.78400 26.07300 72.84600  1.000 39.42066  ? 756  MET A CG    1 
ATOM   1890 S  SD    . MET B 2 61  ? -12.95800 27.51000 73.57000  1.000 47.64314  ? 756  MET A SD    1 
ATOM   1891 C  CE    . MET B 2 61  ? -11.86000 27.92300 72.21100  1.000 45.59127  ? 756  MET A CE    1 
ATOM   1892 N  N     . ALA B 2 62  ? -16.95600 27.04200 71.31600  1.000 44.74655  ? 757  ALA A N     1 
ATOM   1893 C  CA    . ALA B 2 62  ? -17.71800 26.60500 70.14900  1.000 43.52094  ? 757  ALA A CA    1 
ATOM   1894 C  C     . ALA B 2 62  ? -17.16700 25.26700 69.67800  1.000 36.98200  ? 757  ALA A C     1 
ATOM   1895 O  O     . ALA B 2 62  ? -16.04000 24.88700 70.00200  1.000 36.85158  ? 757  ALA A O     1 
ATOM   1896 C  CB    . ALA B 2 62  ? -17.68000 27.64300 69.02600  1.000 40.13770  ? 757  ALA A CB    1 
ATOM   1897 N  N     . ILE B 2 63  ? -17.99000 24.51500 68.95300  1.000 31.63215  ? 758  ILE A N     1 
ATOM   1898 C  CA    . ILE B 2 63  ? -17.72500 23.11100 68.67900  1.000 34.14153  ? 758  ILE A CA    1 
ATOM   1899 C  C     . ILE B 2 63  ? -17.59900 22.92800 67.17100  1.000 46.04492  ? 758  ILE A C     1 
ATOM   1900 O  O     . ILE B 2 63  ? -18.48800 23.35300 66.43200  1.000 50.04742  ? 758  ILE A O     1 
ATOM   1901 C  CB    . ILE B 2 63  ? -18.81400 22.18700 69.24900  1.000 32.13205  ? 758  ILE A CB    1 
ATOM   1902 C  CG1   . ILE B 2 63  ? -19.05600 22.50100 70.73000  1.000 34.65799  ? 758  ILE A CG1   1 
ATOM   1903 C  CG2   . ILE B 2 63  ? -18.37900 20.74100 69.12900  1.000 35.00427  ? 758  ILE A CG2   1 
ATOM   1904 C  CD1   . ILE B 2 63  ? -17.83700 22.24100 71.60900  1.000 32.00798  ? 758  ILE A CD1   1 
ATOM   1905 N  N     . PRO B 2 64  ? -16.51400 22.30200 66.67300  1.000 55.90569  ? 759  PRO A N     1 
ATOM   1906 C  CA    . PRO B 2 64  ? -16.32900 22.14600 65.22300  1.000 54.87283  ? 759  PRO A CA    1 
ATOM   1907 C  C     . PRO B 2 64  ? -17.52400 21.54200 64.50000  1.000 53.27368  ? 759  PRO A C     1 
ATOM   1908 O  O     . PRO B 2 64  ? -18.04500 22.14300 63.55700  1.000 53.43327  ? 759  PRO A O     1 
ATOM   1909 C  CB    . PRO B 2 64  ? -15.10800 21.21900 65.13500  1.000 52.86967  ? 759  PRO A CB    1 
ATOM   1910 C  CG    . PRO B 2 64  ? -14.33800 21.54000 66.34300  1.000 54.84561  ? 759  PRO A CG    1 
ATOM   1911 C  CD    . PRO B 2 64  ? -15.37600 21.74500 67.42000  1.000 56.38394  ? 759  PRO A CD    1 
ATOM   1912 N  N     . SER B 2 65  ? -17.94600 20.34600 64.93100  1.000 51.83531  ? 760  SER A N     1 
ATOM   1913 C  CA    . SER B 2 65  ? -19.08900 19.66100 64.32600  1.000 52.47855  ? 760  SER A CA    1 
ATOM   1914 C  C     . SER B 2 65  ? -20.34700 20.51900 64.34400  1.000 58.25501  ? 760  SER A C     1 
ATOM   1915 O  O     . SER B 2 65  ? -21.13700 20.50300 63.38800  1.000 62.45252  ? 760  SER A O     1 
ATOM   1916 C  CB    . SER B 2 65  ? -19.36200 18.34500 65.04900  1.000 48.85046  ? 760  SER A CB    1 
ATOM   1917 O  OG    . SER B 2 65  ? -18.73200 17.24300 64.41400  1.000 56.67403  ? 760  SER A OG    1 
ATOM   1918 N  N     . ARG B 2 66  ? -20.55500 21.27100 65.42400  1.000 51.06070  ? 761  ARG A N     1 
ATOM   1919 C  CA    . ARG B 2 66  ? -21.72500 22.12400 65.52500  1.000 48.81256  ? 761  ARG A CA    1 
ATOM   1920 C  C     . ARG B 2 66  ? -21.59100 23.39800 64.70200  1.000 48.93465  ? 761  ARG A C     1 
ATOM   1921 O  O     . ARG B 2 66  ? -22.57700 24.11800 64.56100  1.000 55.62234  ? 761  ARG A O     1 
ATOM   1922 C  CB    . ARG B 2 66  ? -21.99800 22.44700 66.99900  1.000 50.25970  ? 761  ARG A CB    1 
ATOM   1923 C  CG    . ARG B 2 66  ? -22.98400 21.47400 67.66000  1.000 54.78207  ? 761  ARG A CG    1 
ATOM   1924 C  CD    . ARG B 2 66  ? -23.42000 21.92400 69.04800  1.000 62.13983  ? 761  ARG A CD    1 
ATOM   1925 N  NE    . ARG B 2 66  ? -24.26800 20.94500 69.73100  1.000 65.42998  ? 761  ARG A NE    1 
ATOM   1926 C  CZ    . ARG B 2 66  ? -23.80100 19.86100 70.33900  1.000 69.61274  ? 761  ARG A CZ    1 
ATOM   1927 N  NH1   . ARG B 2 66  ? -22.49400 19.62200 70.33700  1.000 68.00228  ? 761  ARG A NH1   1 
ATOM   1928 N  NH2   . ARG B 2 66  ? -24.63200 19.01200 70.93200  1.000 73.44731  ? 761  ARG A NH2   1 
ATOM   1929 N  N     . VAL B 2 67  ? -20.41100 23.69300 64.15100  1.000 44.99578  ? 762  VAL A N     1 
ATOM   1930 C  CA    . VAL B 2 67  ? -20.24300 24.82000 63.23500  1.000 42.68154  ? 762  VAL A CA    1 
ATOM   1931 C  C     . VAL B 2 67  ? -20.42200 24.31200 61.80400  1.000 44.28472  ? 762  VAL A C     1 
ATOM   1932 O  O     . VAL B 2 67  ? -20.88300 25.04700 60.92500  1.000 47.39661  ? 762  VAL A O     1 
ATOM   1933 C  CB    . VAL B 2 67  ? -18.87600 25.51300 63.43500  1.000 40.69349  ? 762  VAL A CB    1 
ATOM   1934 C  CG1   . VAL B 2 67  ? -18.61700 26.59300 62.38300  1.000 35.99327  ? 762  VAL A CG1   1 
ATOM   1935 C  CG2   . VAL B 2 67  ? -18.80100 26.14200 64.79900  1.000 43.77680  ? 762  VAL A CG2   1 
ATOM   1936 N  N     . LEU B 2 68  ? -20.09300 23.04500 61.56300  1.000 38.77450  ? 763  LEU A N     1 
ATOM   1937 C  CA    . LEU B 2 68  ? -20.11100 22.48800 60.22100  1.000 40.03833  ? 763  LEU A CA    1 
ATOM   1938 C  C     . LEU B 2 68  ? -21.41800 21.79200 59.86200  1.000 47.56013  ? 763  LEU A C     1 
ATOM   1939 O  O     . LEU B 2 68  ? -21.63400 21.50400 58.68000  1.000 48.23710  ? 763  LEU A O     1 
ATOM   1940 C  CB    . LEU B 2 68  ? -18.93100 21.51700 60.04900  1.000 44.49881  ? 763  LEU A CB    1 
ATOM   1941 C  CG    . LEU B 2 68  ? -17.54000 22.17100 60.17400  1.000 46.56221  ? 763  LEU A CG    1 
ATOM   1942 C  CD1   . LEU B 2 68  ? -16.41100 21.15900 60.02600  1.000 44.83188  ? 763  LEU A CD1   1 
ATOM   1943 C  CD2   . LEU B 2 68  ? -17.36900 23.32200 59.17200  1.000 37.90610  ? 763  LEU A CD2   1 
ATOM   1944 N  N     . ARG B 2 69  ? -22.29600 21.52000 60.83600  1.000 71.87896  ? 764  ARG A N     1 
ATOM   1945 C  CA    . ARG B 2 69  ? -23.60200 20.91300 60.55900  1.000 75.88649  ? 764  ARG A CA    1 
ATOM   1946 C  C     . ARG B 2 69  ? -24.74300 21.93300 60.52000  1.000 65.85684  ? 764  ARG A C     1 
ATOM   1947 O  O     . ARG B 2 69  ? -25.54500 21.91600 59.58200  1.000 68.08945  ? 764  ARG A O     1 
ATOM   1948 C  CB    . ARG B 2 69  ? -23.92000 19.79800 61.56800  1.000 79.01623  ? 764  ARG A CB    1 
ATOM   1949 C  CG    . ARG B 2 69  ? -23.06500 18.52000 61.41000  1.000 85.46483  ? 764  ARG A CG    1 
ATOM   1950 C  CD    . ARG B 2 69  ? -22.41000 18.40900 60.01500  1.000 93.75811  ? 764  ARG A CD    1 
ATOM   1951 N  NE    . ARG B 2 69  ? -23.31600 17.94600 58.95700  1.000 98.98034  ? 764  ARG A NE    1 
ATOM   1952 C  CZ    . ARG B 2 69  ? -23.34000 16.72100 58.42700  1.000 100.02602 ? 764  ARG A CZ    1 
ATOM   1953 N  NH1   . ARG B 2 69  ? -22.47800 15.78500 58.82000  1.000 98.03082  ? 764  ARG A NH1   1 
ATOM   1954 N  NH2   . ARG B 2 69  ? -24.22100 16.44600 57.46800  1.000 102.69638 ? 764  ARG A NH2   1 
ATOM   1955 N  N     . LYS B 2 70  ? -24.85000 22.80100 61.52200  1.000 36.94246  ? 765  LYS A N     1 
ATOM   1956 C  CA    . LYS B 2 70  ? -25.55900 24.07300 61.43800  1.000 36.30413  ? 765  LYS A CA    1 
ATOM   1957 C  C     . LYS B 2 70  ? -24.51900 25.16900 61.61100  1.000 43.43159  ? 765  LYS A C     1 
ATOM   1958 O  O     . LYS B 2 70  ? -23.35700 24.89000 61.89100  1.000 55.93111  ? 765  LYS A O     1 
ATOM   1959 C  CB    . LYS B 2 70  ? -26.66300 24.17100 62.50700  1.000 38.45057  ? 765  LYS A CB    1 
ATOM   1960 C  CG    . LYS B 2 70  ? -27.40400 22.83800 62.72800  1.000 41.69714  ? 765  LYS A CG    1 
ATOM   1961 C  CD    . LYS B 2 70  ? -28.90700 23.00300 62.86500  1.000 53.02694  ? 765  LYS A CD    1 
ATOM   1962 C  CE    . LYS B 2 70  ? -29.63400 21.65400 62.77500  1.000 63.12421  ? 765  LYS A CE    1 
ATOM   1963 N  NZ    . LYS B 2 70  ? -30.48300 21.35300 63.98200  1.000 68.95691  ? 765  LYS A NZ    1 
ATOM   1964 N  N     . TRP B 2 71  ? -24.91500 26.42400 61.44900  1.000 49.27151  ? 766  TRP A N     1 
ATOM   1965 C  CA    . TRP B 2 71  ? -23.93700 27.51800 61.51700  1.000 54.77737  ? 766  TRP A CA    1 
ATOM   1966 C  C     . TRP B 2 71  ? -23.82500 28.04600 62.94600  1.000 50.25867  ? 766  TRP A C     1 
ATOM   1967 O  O     . TRP B 2 71  ? -23.93100 29.24000 63.22300  1.000 43.89671  ? 766  TRP A O     1 
ATOM   1968 C  CB    . TRP B 2 71  ? -24.31800 28.61700 60.52800  1.000 53.03154  ? 766  TRP A CB    1 
ATOM   1969 C  CG    . TRP B 2 71  ? -23.22900 29.59700 60.10800  1.000 48.57560  ? 766  TRP A CG    1 
ATOM   1970 C  CD1   . TRP B 2 71  ? -23.31200 30.96000 60.14100  1.000 51.09123  ? 766  TRP A CD1   1 
ATOM   1971 C  CD2   . TRP B 2 71  ? -21.93100 29.29500 59.57000  1.000 51.61577  ? 766  TRP A CD2   1 
ATOM   1972 N  NE1   . TRP B 2 71  ? -22.15500 31.52900 59.66800  1.000 54.31034  ? 766  TRP A NE1   1 
ATOM   1973 C  CE2   . TRP B 2 71  ? -21.28400 30.53100 59.31800  1.000 53.25341  ? 766  TRP A CE2   1 
ATOM   1974 C  CE3   . TRP B 2 71  ? -21.24600 28.10600 59.28700  1.000 51.39813  ? 766  TRP A CE3   1 
ATOM   1975 C  CZ2   . TRP B 2 71  ? -19.98600 30.61300 58.79800  1.000 49.77167  ? 766  TRP A CZ2   1 
ATOM   1976 C  CZ3   . TRP B 2 71  ? -19.94500 28.19000 58.76200  1.000 47.42982  ? 766  TRP A CZ3   1 
ATOM   1977 C  CH2   . TRP B 2 71  ? -19.33700 29.43400 58.52400  1.000 49.44337  ? 766  TRP A CH2   1 
ATOM   1978 N  N     . ASP B 2 72  ? -23.56600 27.11000 63.86500  1.000 51.24434  ? 767  ASP A N     1 
ATOM   1979 C  CA    . ASP B 2 72  ? -23.80300 27.28800 65.29800  1.000 52.85015  ? 767  ASP A CA    1 
ATOM   1980 C  C     . ASP B 2 72  ? -22.48100 27.54100 66.01000  1.000 47.96668  ? 767  ASP A C     1 
ATOM   1981 O  O     . ASP B 2 72  ? -21.69400 26.61300 66.22300  1.000 41.54200  ? 767  ASP A O     1 
ATOM   1982 C  CB    . ASP B 2 72  ? -24.51100 26.06400 65.88500  1.000 52.88574  ? 767  ASP A CB    1 
ATOM   1983 C  CG    . ASP B 2 72  ? -24.82400 26.21600 67.36400  1.000 52.51442  ? 767  ASP A CG    1 
ATOM   1984 O  OD1   . ASP B 2 72  ? -24.79900 27.36000 67.86500  1.000 53.71104  ? 767  ASP A OD1   1 
ATOM   1985 O  OD2   . ASP B 2 72  ? -25.08800 25.18100 68.02200  1.000 50.26049  ? 767  ASP A OD2   1 
ATOM   1986 N  N     . PHE B 2 73  ? -22.27300 28.79200 66.41100  1.000 46.79538  ? 768  PHE A N     1 
ATOM   1987 C  CA    . PHE B 2 73  ? -21.06700 29.24900 67.07200  1.000 44.13257  ? 768  PHE A CA    1 
ATOM   1988 C  C     . PHE B 2 73  ? -21.22600 29.38100 68.58000  1.000 51.13675  ? 768  PHE A C     1 
ATOM   1989 O  O     . PHE B 2 73  ? -20.29200 29.83100 69.25700  1.000 53.77187  ? 768  PHE A O     1 
ATOM   1990 C  CB    . PHE B 2 73  ? -20.64600 30.58700 66.47800  1.000 41.34793  ? 768  PHE A CB    1 
ATOM   1991 C  CG    . PHE B 2 73  ? -20.05500 30.46300 65.12400  1.000 50.27912  ? 768  PHE A CG    1 
ATOM   1992 C  CD1   . PHE B 2 73  ? -20.86700 30.29000 64.01700  1.000 51.27947  ? 768  PHE A CD1   1 
ATOM   1993 C  CD2   . PHE B 2 73  ? -18.67800 30.50800 64.94700  1.000 50.89851  ? 768  PHE A CD2   1 
ATOM   1994 C  CE1   . PHE B 2 73  ? -20.31900 30.16900 62.75600  1.000 48.26646  ? 768  PHE A CE1   1 
ATOM   1995 C  CE2   . PHE B 2 73  ? -18.12200 30.39100 63.68900  1.000 44.89086  ? 768  PHE A CE2   1 
ATOM   1996 C  CZ    . PHE B 2 73  ? -18.94400 30.21800 62.59400  1.000 45.82250  ? 768  PHE A CZ    1 
ATOM   1997 N  N     . SER B 2 74  ? -22.37800 29.00700 69.12100  1.000 52.77614  ? 769  SER A N     1 
ATOM   1998 C  CA    . SER B 2 74  ? -22.60700 29.16400 70.54900  1.000 51.42439  ? 769  SER A CA    1 
ATOM   1999 C  C     . SER B 2 74  ? -21.69900 28.21500 71.31600  1.000 46.40471  ? 769  SER A C     1 
ATOM   2000 O  O     . SER B 2 74  ? -21.40300 27.10300 70.86000  1.000 41.72135  ? 769  SER A O     1 
ATOM   2001 C  CB    . SER B 2 74  ? -24.07800 28.91000 70.89300  1.000 50.94971  ? 769  SER A CB    1 
ATOM   2002 O  OG    . SER B 2 74  ? -24.59800 27.80800 70.16700  1.000 52.43406  ? 769  SER A OG    1 
ATOM   2003 N  N     . LYS B 2 75  ? -21.23900 28.67600 72.47300  1.000 57.51130  ? 770  LYS A N     1 
ATOM   2004 C  CA    . LYS B 2 75  ? -20.26600 27.93800 73.26300  1.000 56.05850  ? 770  LYS A CA    1 
ATOM   2005 C  C     . LYS B 2 75  ? -20.94900 26.82300 74.05100  1.000 55.40001  ? 770  LYS A C     1 
ATOM   2006 O  O     . LYS B 2 75  ? -22.10300 26.93900 74.47000  1.000 56.59710  ? 770  LYS A O     1 
ATOM   2007 C  CB    . LYS B 2 75  ? -19.52900 28.88900 74.20600  1.000 54.19989  ? 770  LYS A CB    1 
ATOM   2008 C  CG    . LYS B 2 75  ? -19.10000 30.19700 73.53800  1.000 56.55364  ? 770  LYS A CG    1 
ATOM   2009 C  CD    . LYS B 2 75  ? -17.78400 30.70800 74.08900  1.000 62.68918  ? 770  LYS A CD    1 
ATOM   2010 C  CE    . LYS B 2 75  ? -17.01700 31.48600 73.04000  1.000 66.73077  ? 770  LYS A CE    1 
ATOM   2011 N  NZ    . LYS B 2 75  ? -15.99900 30.62500 72.35000  1.000 68.44200  ? 770  LYS A NZ    1 
ATOM   2012 N  N     . TYR B 2 76  ? -20.22400 25.72700 74.22400  1.000 48.36356  ? 771  TYR A N     1 
ATOM   2013 C  CA    . TYR B 2 76  ? -20.71000 24.53900 74.89900  1.000 41.83135  ? 771  TYR A CA    1 
ATOM   2014 C  C     . TYR B 2 76  ? -19.68500 24.11200 75.93600  1.000 45.11538  ? 771  TYR A C     1 
ATOM   2015 O  O     . TYR B 2 76  ? -18.50400 24.45200 75.83600  1.000 49.26151  ? 771  TYR A O     1 
ATOM   2016 C  CB    . TYR B 2 76  ? -20.95700 23.40700 73.91700  1.000 43.91621  ? 771  TYR A CB    1 
ATOM   2017 C  CG    . TYR B 2 76  ? -22.14100 23.63700 73.01900  1.000 49.31877  ? 771  TYR A CG    1 
ATOM   2018 C  CD1   . TYR B 2 76  ? -22.00400 24.29300 71.79700  1.000 55.33478  ? 771  TYR A CD1   1 
ATOM   2019 C  CD2   . TYR B 2 76  ? -23.39600 23.18300 73.38300  1.000 47.66246  ? 771  TYR A CD2   1 
ATOM   2020 C  CE1   . TYR B 2 76  ? -23.10100 24.50100 70.97500  1.000 60.80234  ? 771  TYR A CE1   1 
ATOM   2021 C  CE2   . TYR B 2 76  ? -24.49400 23.37900 72.57500  1.000 54.63464  ? 771  TYR A CE2   1 
ATOM   2022 C  CZ    . TYR B 2 76  ? -24.35200 24.03300 71.37700  1.000 61.54205  ? 771  TYR A CZ    1 
ATOM   2023 O  OH    . TYR B 2 76  ? -25.47000 24.20600 70.59600  1.000 62.83529  ? 771  TYR A OH    1 
ATOM   2024 N  N     . TYR B 2 77  ? -20.15000 23.37700 76.94300  1.000 42.47164  ? 772  TYR A N     1 
ATOM   2025 C  CA    . TYR B 2 77  ? -19.26700 22.95000 78.01700  1.000 35.50246  ? 772  TYR A CA    1 
ATOM   2026 C  C     . TYR B 2 77  ? -18.25800 21.93800 77.48800  1.000 40.60266  ? 772  TYR A C     1 
ATOM   2027 O  O     . TYR B 2 77  ? -18.64000 20.86900 77.00100  1.000 46.83027  ? 772  TYR A O     1 
ATOM   2028 C  CB    . TYR B 2 77  ? -20.08700 22.34200 79.14600  1.000 40.66899  ? 772  TYR A CB    1 
ATOM   2029 C  CG    . TYR B 2 77  ? -20.84600 23.34000 79.97300  1.000 40.68663  ? 772  TYR A CG    1 
ATOM   2030 C  CD1   . TYR B 2 77  ? -20.28700 24.56600 80.31500  1.000 44.28643  ? 772  TYR A CD1   1 
ATOM   2031 C  CD2   . TYR B 2 77  ? -22.12100 23.06300 80.40200  1.000 39.71690  ? 772  TYR A CD2   1 
ATOM   2032 C  CE1   . TYR B 2 77  ? -20.98500 25.47400 81.07400  1.000 46.14636  ? 772  TYR A CE1   1 
ATOM   2033 C  CE2   . TYR B 2 77  ? -22.82700 23.96900 81.15900  1.000 46.53040  ? 772  TYR A CE2   1 
ATOM   2034 C  CZ    . TYR B 2 77  ? -22.25900 25.16800 81.49500  1.000 46.66232  ? 772  TYR A CZ    1 
ATOM   2035 O  OH    . TYR B 2 77  ? -22.97300 26.06100 82.26200  1.000 49.87494  ? 772  TYR A OH    1 
ATOM   2036 N  N     . VAL B 2 78  ? -16.97000 22.27700 77.56900  1.000 32.91320  ? 773  VAL A N     1 
ATOM   2037 C  CA    . VAL B 2 78  ? -15.90700 21.38600 77.12200  1.000 30.45745  ? 773  VAL A CA    1 
ATOM   2038 C  C     . VAL B 2 78  ? -14.94300 21.07500 78.26400  1.000 30.54603  ? 773  VAL A C     1 
ATOM   2039 O  O     . VAL B 2 78  ? -14.66500 21.90600 79.13800  1.000 34.70834  ? 773  VAL A O     1 
ATOM   2040 C  CB    . VAL B 2 78  ? -15.13600 21.97100 75.92200  1.000 26.35537  ? 773  VAL A CB    1 
ATOM   2041 C  CG1   . VAL B 2 78  ? -16.06900 22.23500 74.77600  1.000 26.09215  ? 773  VAL A CG1   1 
ATOM   2042 C  CG2   . VAL B 2 78  ? -14.38900 23.23900 76.32800  1.000 26.28814  ? 773  VAL A CG2   1 
ATOM   2043 N  N     . SER B 2 79  ? -14.42800 19.84900 78.23500  1.000 23.19330  ? 774  SER A N     1 
ATOM   2044 C  CA    . SER B 2 79  ? -13.31700 19.44800 79.08400  1.000 21.95360  ? 774  SER A CA    1 
ATOM   2045 C  C     . SER B 2 79  ? -12.11700 20.36800 78.88700  1.000 28.88852  ? 774  SER A C     1 
ATOM   2046 O  O     . SER B 2 79  ? -11.92000 20.96100 77.82300  1.000 33.54950  ? 774  SER A O     1 
ATOM   2047 C  CB    . SER B 2 79  ? -12.93900 17.99300 78.79800  1.000 25.25480  ? 774  SER A CB    1 
ATOM   2048 O  OG    . SER B 2 79  ? -11.98600 17.88800 77.74600  1.000 32.16447  ? 774  SER A OG    1 
ATOM   2049 N  N     . ASN B 2 80  ? -11.30400 20.46400 79.94600  1.000 47.76551  ? 775  ASN A N     1 
ATOM   2050 C  CA    . ASN B 2 80  ? -10.06700 21.24000 79.90600  1.000 44.54015  ? 775  ASN A CA    1 
ATOM   2051 C  C     . ASN B 2 80  ? -9.17600  20.81400 78.74600  1.000 42.87217  ? 775  ASN A C     1 
ATOM   2052 O  O     . ASN B 2 80  ? -8.65700  21.66000 78.01200  1.000 48.76674  ? 775  ASN A O     1 
ATOM   2053 C  CB    . ASN B 2 80  ? -9.32100  21.08300 81.22600  1.000 46.34326  ? 775  ASN A CB    1 
ATOM   2054 C  CG    . ASN B 2 80  ? -9.62500  22.19100 82.18800  1.000 47.30248  ? 775  ASN A CG    1 
ATOM   2055 O  OD1   . ASN B 2 80  ? -10.50300 23.01400 81.93700  1.000 51.06876  ? 775  ASN A OD1   1 
ATOM   2056 N  ND2   . ASN B 2 80  ? -8.89200  22.23500 83.29000  1.000 45.35264  ? 775  ASN A ND2   1 
ATOM   2057 N  N     . PHE B 2 81  ? -8.98200  19.50100 78.56800  1.000 33.62542  ? 776  PHE A N     1 
ATOM   2058 C  CA    . PHE B 2 81  ? -8.19700  19.00300 77.43600  1.000 30.38793  ? 776  PHE A CA    1 
ATOM   2059 C  C     . PHE B 2 81  ? -8.73600  19.50500 76.09600  1.000 35.75679  ? 776  PHE A C     1 
ATOM   2060 O  O     . PHE B 2 81  ? -7.95600  19.83800 75.20000  1.000 39.84658  ? 776  PHE A O     1 
ATOM   2061 C  CB    . PHE B 2 81  ? -8.16400  17.47400 77.45100  1.000 36.10227  ? 776  PHE A CB    1 
ATOM   2062 C  CG    . PHE B 2 81  ? -7.75400  16.84900 76.13100  1.000 42.55403  ? 776  PHE A CG    1 
ATOM   2063 C  CD1   . PHE B 2 81  ? -6.42500  16.49300 75.90500  1.000 43.33629  ? 776  PHE A CD1   1 
ATOM   2064 C  CD2   . PHE B 2 81  ? -8.69400  16.59300 75.13300  1.000 42.43571  ? 776  PHE A CD2   1 
ATOM   2065 C  CE1   . PHE B 2 81  ? -6.04100  15.91500 74.73100  1.000 36.91747  ? 776  PHE A CE1   1 
ATOM   2066 C  CE2   . PHE B 2 81  ? -8.30900  16.02100 73.93700  1.000 39.05705  ? 776  PHE A CE2   1 
ATOM   2067 C  CZ    . PHE B 2 81  ? -6.98500  15.67800 73.73700  1.000 38.30198  ? 776  PHE A CZ    1 
ATOM   2068 N  N     . SER B 2 82  ? -10.06300 19.51900 75.92000  1.000 31.48383  ? 777  SER A N     1 
ATOM   2069 C  CA    . SER B 2 82  ? -10.62000 19.98400 74.65300  1.000 34.67230  ? 777  SER A CA    1 
ATOM   2070 C  C     . SER B 2 82  ? -10.50400 21.49900 74.49100  1.000 32.36148  ? 777  SER A C     1 
ATOM   2071 O  O     . SER B 2 82  ? -10.27800 21.99000 73.38400  1.000 29.82568  ? 777  SER A O     1 
ATOM   2072 C  CB    . SER B 2 82  ? -12.08700 19.56500 74.48800  1.000 33.23100  ? 777  SER A CB    1 
ATOM   2073 O  OG    . SER B 2 82  ? -12.30500 18.15400 74.52100  1.000 27.83711  ? 777  SER A OG    1 
ATOM   2074 N  N     . LYS B 2 83  ? -10.70000 22.27500 75.55200  1.000 35.90147  ? 778  LYS A N     1 
ATOM   2075 C  CA    . LYS B 2 83  ? -10.53300 23.71400 75.38300  1.000 34.61849  ? 778  LYS A CA    1 
ATOM   2076 C  C     . LYS B 2 83  ? -9.11400  24.01500 74.96800  1.000 39.65734  ? 778  LYS A C     1 
ATOM   2077 O  O     . LYS B 2 83  ? -8.88900  24.77800 74.02600  1.000 35.50926  ? 778  LYS A O     1 
ATOM   2078 C  CB    . LYS B 2 83  ? -10.88500 24.46500 76.66600  1.000 33.68775  ? 778  LYS A CB    1 
ATOM   2079 C  CG    . LYS B 2 83  ? -10.59900 25.96100 76.58500  1.000 37.25695  ? 778  LYS A CG    1 
ATOM   2080 C  CD    . LYS B 2 83  ? -10.83300 26.64700 77.92900  1.000 42.84840  ? 778  LYS A CD    1 
ATOM   2081 C  CE    . LYS B 2 83  ? -10.53800 28.15400 77.88700  1.000 44.41137  ? 778  LYS A CE    1 
ATOM   2082 N  NZ    . LYS B 2 83  ? -11.62900 29.00500 77.31800  1.000 44.70354  ? 778  LYS A NZ    1 
ATOM   2083 N  N     . ASP B 2 84  ? -8.14900  23.37000 75.63800  1.000 55.76725  ? 779  ASP A N     1 
ATOM   2084 C  CA    . ASP B 2 84  ? -6.73400  23.51500 75.30900  1.000 54.14245  ? 779  ASP A CA    1 
ATOM   2085 C  C     . ASP B 2 84  ? -6.45400  23.15100 73.85600  1.000 52.71697  ? 779  ASP A C     1 
ATOM   2086 O  O     . ASP B 2 84  ? -5.72900  23.86500 73.15800  1.000 53.52066  ? 779  ASP A O     1 
ATOM   2087 C  CB    . ASP B 2 84  ? -5.89800  22.64000 76.24100  1.000 54.42710  ? 779  ASP A CB    1 
ATOM   2088 C  CG    . ASP B 2 84  ? -5.66600  23.28200 77.59200  1.000 67.93069  ? 779  ASP A CG    1 
ATOM   2089 O  OD1   . ASP B 2 84  ? -4.98200  22.65900 78.44200  1.000 73.67689  ? 779  ASP A OD1   1 
ATOM   2090 O  OD2   . ASP B 2 84  ? -6.16200  24.40700 77.80600  1.000 71.83715  ? 779  ASP A OD2   1 
ATOM   2091 N  N     . LEU B 2 85  ? -7.02200  22.04900 73.38000  1.000 42.57174  ? 780  LEU A N     1 
ATOM   2092 C  CA    . LEU B 2 85  ? -6.65000  21.56100 72.06500  1.000 44.14871  ? 780  LEU A CA    1 
ATOM   2093 C  C     . LEU B 2 85  ? -7.31500  22.37300 70.97200  1.000 48.03296  ? 780  LEU A C     1 
ATOM   2094 O  O     . LEU B 2 85  ? -6.67500  22.71400 69.96900  1.000 51.41329  ? 780  LEU A O     1 
ATOM   2095 C  CB    . LEU B 2 85  ? -6.99500  20.08800 71.93200  1.000 42.22890  ? 780  LEU A CB    1 
ATOM   2096 C  CG    . LEU B 2 85  ? -6.63800  19.50700 70.58000  1.000 46.82249  ? 780  LEU A CG    1 
ATOM   2097 C  CD1   . LEU B 2 85  ? -5.67400  18.34100 70.75800  1.000 57.57230  ? 780  LEU A CD1   1 
ATOM   2098 C  CD2   . LEU B 2 85  ? -7.89700  19.04700 69.87200  1.000 40.99984  ? 780  LEU A CD2   1 
ATOM   2099 N  N     . LEU B 2 86  ? -8.58500  22.72300 71.16100  1.000 53.21298  ? 781  LEU A N     1 
ATOM   2100 C  CA    . LEU B 2 86  ? -9.24700  23.59500 70.19800  1.000 56.88917  ? 781  LEU A CA    1 
ATOM   2101 C  C     . LEU B 2 86  ? -8.51900  24.92800 70.07500  1.000 55.15845  ? 781  LEU A C     1 
ATOM   2102 O  O     . LEU B 2 86  ? -8.39100  25.47100 68.97300  1.000 60.64008  ? 781  LEU A O     1 
ATOM   2103 C  CB    . LEU B 2 86  ? -10.71600 23.79100 70.58800  1.000 53.34142  ? 781  LEU A CB    1 
ATOM   2104 C  CG    . LEU B 2 86  ? -11.67900 22.67400 70.18000  1.000 53.36626  ? 781  LEU A CG    1 
ATOM   2105 C  CD1   . LEU B 2 86  ? -11.02500 21.29600 70.26200  1.000 57.60645  ? 781  LEU A CD1   1 
ATOM   2106 C  CD2   . LEU B 2 86  ? -12.94400 22.70700 71.03400  1.000 55.09469  ? 781  LEU A CD2   1 
ATOM   2107 N  N     . ILE B 2 87  ? -8.02600  25.47100 71.18800  1.000 39.07107  ? 782  ILE A N     1 
ATOM   2108 C  CA    . ILE B 2 87  ? -7.31400  26.74100 71.11200  1.000 38.91915  ? 782  ILE A CA    1 
ATOM   2109 C  C     . ILE B 2 87  ? -6.03800  26.56200 70.31000  1.000 46.22786  ? 782  ILE A C     1 
ATOM   2110 O  O     . ILE B 2 87  ? -5.67000  27.41300 69.49000  1.000 50.32501  ? 782  ILE A O     1 
ATOM   2111 C  CB    . ILE B 2 87  ? -7.03800  27.28000 72.52300  1.000 35.98054  ? 782  ILE A CB    1 
ATOM   2112 C  CG1   . ILE B 2 87  ? -8.30700  27.88700 73.12800  1.000 31.71319  ? 782  ILE A CG1   1 
ATOM   2113 C  CG2   . ILE B 2 87  ? -5.90700  28.28800 72.48300  1.000 40.75213  ? 782  ILE A CG2   1 
ATOM   2114 C  CD1   . ILE B 2 87  ? -8.13300  28.39500 74.56600  1.000 30.32488  ? 782  ILE A CD1   1 
ATOM   2115 N  N     . LYS B 2 88  ? -5.38400  25.41500 70.48500  1.000 56.08124  ? 783  LYS A N     1 
ATOM   2116 C  CA    . LYS B 2 88  ? -4.14300  25.15000 69.77800  1.000 50.90034  ? 783  LYS A CA    1 
ATOM   2117 C  C     . LYS B 2 88  ? -4.35700  25.14900 68.26100  1.000 56.48244  ? 783  LYS A C     1 
ATOM   2118 O  O     . LYS B 2 88  ? -3.62500  25.82000 67.52700  1.000 64.26421  ? 783  LYS A O     1 
ATOM   2119 C  CB    . LYS B 2 88  ? -3.56600  23.82800 70.26900  1.000 46.34090  ? 783  LYS A CB    1 
ATOM   2120 C  CG    . LYS B 2 88  ? -2.25700  23.48400 69.61100  1.000 58.70074  ? 783  LYS A CG    1 
ATOM   2121 C  CD    . LYS B 2 88  ? -1.43400  22.49200 70.42700  1.000 65.32329  ? 783  LYS A CD    1 
ATOM   2122 C  CE    . LYS B 2 88  ? -1.63100  21.05700 69.95100  1.000 66.53401  ? 783  LYS A CE    1 
ATOM   2123 N  NZ    . LYS B 2 88  ? -1.47700  20.09200 71.07400  1.000 67.73093  ? 783  LYS A NZ    1 
ATOM   2124 N  N     . ILE B 2 89  ? -5.38600  24.44300 67.77300  1.000 51.54231  ? 784  ILE A N     1 
ATOM   2125 C  CA    . ILE B 2 89  ? -5.58500  24.23800 66.33300  1.000 48.05401  ? 784  ILE A CA    1 
ATOM   2126 C  C     . ILE B 2 89  ? -6.44600  25.32200 65.70200  1.000 47.92949  ? 784  ILE A C     1 
ATOM   2127 O  O     . ILE B 2 89  ? -7.05100  25.09600 64.64600  1.000 48.30585  ? 784  ILE A O     1 
ATOM   2128 C  CB    . ILE B 2 89  ? -6.22600  22.86900 66.05100  1.000 42.31023  ? 784  ILE A CB    1 
ATOM   2129 C  CG1   . ILE B 2 89  ? -7.54100  22.74400 66.83200  1.000 41.22167  ? 784  ILE A CG1   1 
ATOM   2130 C  CG2   . ILE B 2 89  ? -5.27400  21.75200 66.40100  1.000 43.79133  ? 784  ILE A CG2   1 
ATOM   2131 C  CD1   . ILE B 2 89  ? -8.66500  22.06900 66.07900  1.000 38.76404  ? 784  ILE A CD1   1 
ATOM   2132 N  N     . TRP B 2 90  ? -6.52600  26.49100 66.34400  1.000 43.43961  ? 785  TRP A N     1 
ATOM   2133 C  CA    . TRP B 2 90  ? -7.43100  27.53900 65.87300  1.000 40.08974  ? 785  TRP A CA    1 
ATOM   2134 C  C     . TRP B 2 90  ? -7.14000  27.91400 64.42300  1.000 44.78936  ? 785  TRP A C     1 
ATOM   2135 O  O     . TRP B 2 90  ? -8.04800  27.93400 63.58400  1.000 45.46279  ? 785  TRP A O     1 
ATOM   2136 C  CB    . TRP B 2 90  ? -7.31800  28.75900 66.78200  1.000 42.78104  ? 785  TRP A CB    1 
ATOM   2137 C  CG    . TRP B 2 90  ? -8.31600  29.84500 66.53600  1.000 48.79137  ? 785  TRP A CG    1 
ATOM   2138 C  CD1   . TRP B 2 90  ? -8.06700  31.08700 66.01200  1.000 54.43892  ? 785  TRP A CD1   1 
ATOM   2139 C  CD2   . TRP B 2 90  ? -9.71600  29.81200 66.84500  1.000 53.35945  ? 785  TRP A CD2   1 
ATOM   2140 N  NE1   . TRP B 2 90  ? -9.23300  31.82000 65.95600  1.000 59.13682  ? 785  TRP A NE1   1 
ATOM   2141 C  CE2   . TRP B 2 90  ? -10.25900 31.06200 66.46100  1.000 56.00862  ? 785  TRP A CE2   1 
ATOM   2142 C  CE3   . TRP B 2 90  ? -10.56800 28.84500 67.39900  1.000 54.93900  ? 785  TRP A CE3   1 
ATOM   2143 C  CZ2   . TRP B 2 90  ? -11.61300 31.36700 66.61400  1.000 55.14975  ? 785  TRP A CZ2   1 
ATOM   2144 C  CZ3   . TRP B 2 90  ? -11.91700 29.15200 67.54800  1.000 53.85581  ? 785  TRP A CZ3   1 
ATOM   2145 C  CH2   . TRP B 2 90  ? -12.42400 30.40200 67.15800  1.000 52.86292  ? 785  TRP A CH2   1 
ATOM   2146 N  N     . ASN B 2 91  ? -5.86800  28.17200 64.10000  1.000 47.42916  ? 786  ASN A N     1 
ATOM   2147 C  CA    . ASN B 2 91  ? -5.48000  28.63200 62.77100  1.000 43.22843  ? 786  ASN A CA    1 
ATOM   2148 C  C     . ASN B 2 91  ? -5.05000  27.49600 61.83600  1.000 39.90306  ? 786  ASN A C     1 
ATOM   2149 O  O     . ASN B 2 91  ? -4.61100  27.76800 60.71500  1.000 40.39856  ? 786  ASN A O     1 
ATOM   2150 C  CB    . ASN B 2 91  ? -4.37400  29.68200 62.88800  1.000 46.01115  ? 786  ASN A CB    1 
ATOM   2151 C  CG    . ASN B 2 91  ? -4.81000  30.89800 63.69000  1.000 51.18981  ? 786  ASN A CG    1 
ATOM   2152 O  OD1   . ASN B 2 91  ? -5.97800  31.29400 63.64700  1.000 53.41696  ? 786  ASN A OD1   1 
ATOM   2153 N  ND2   . ASN B 2 91  ? -3.87900  31.48000 64.45000  1.000 51.60712  ? 786  ASN A ND2   1 
ATOM   2154 N  N     . ASP B 2 92  ? -5.21100  26.24100 62.25600  1.000 53.92586  ? 787  ASP A N     1 
ATOM   2155 C  CA    . ASP B 2 92  ? -4.85600  25.07200 61.44300  1.000 57.89186  ? 787  ASP A CA    1 
ATOM   2156 C  C     . ASP B 2 92  ? -5.94200  24.75200 60.42000  1.000 60.26392  ? 787  ASP A C     1 
ATOM   2157 O  O     . ASP B 2 92  ? -7.10800  24.58600 60.80300  1.000 61.68275  ? 787  ASP A O     1 
ATOM   2158 C  CB    . ASP B 2 92  ? -4.65800  23.85400 62.33300  1.000 65.50130  ? 787  ASP A CB    1 
ATOM   2159 C  CG    . ASP B 2 92  ? -3.39700  23.92500 63.15400  1.000 69.49805  ? 787  ASP A CG    1 
ATOM   2160 O  OD1   . ASP B 2 92  ? -2.94100  22.84700 63.60100  1.000 69.17151  ? 787  ASP A OD1   1 
ATOM   2161 O  OD2   . ASP B 2 92  ? -2.86800  25.04400 63.34800  1.000 72.42343  ? 787  ASP A OD2   1 
ATOM   2162 N  N     . PRO B 2 93  ? -5.60400  24.60200 59.12700  1.000 61.09185  ? 788  PRO A N     1 
ATOM   2163 C  CA    . PRO B 2 93  ? -6.61400  24.26400 58.09600  1.000 58.18477  ? 788  PRO A CA    1 
ATOM   2164 C  C     . PRO B 2 93  ? -6.99500  22.78900 58.10200  1.000 57.35575  ? 788  PRO A C     1 
ATOM   2165 O  O     . PRO B 2 93  ? -6.52200  21.98000 57.30100  1.000 59.12473  ? 788  PRO A O     1 
ATOM   2166 C  CB    . PRO B 2 93  ? -5.91200  24.65200 56.79300  1.000 57.26426  ? 788  PRO A CB    1 
ATOM   2167 C  CG    . PRO B 2 93  ? -4.49400  24.49100 57.08300  1.000 62.33136  ? 788  PRO A CG    1 
ATOM   2168 C  CD    . PRO B 2 93  ? -4.31200  24.93400 58.51500  1.000 64.35019  ? 788  PRO A CD    1 
ATOM   2169 N  N     . LEU B 2 94  ? -7.89900  22.43500 59.02000  1.000 46.95503  ? 789  LEU A N     1 
ATOM   2170 C  CA    . LEU B 2 94  ? -8.22800  21.03600 59.25900  1.000 45.30784  ? 789  LEU A CA    1 
ATOM   2171 C  C     . LEU B 2 94  ? -9.59100  20.60600 58.74100  1.000 42.57758  ? 789  LEU A C     1 
ATOM   2172 O  O     . LEU B 2 94  ? -9.79100  19.40400 58.52600  1.000 41.91229  ? 789  LEU A O     1 
ATOM   2173 C  CB    . LEU B 2 94  ? -8.15500  20.72000 60.75800  1.000 41.93714  ? 789  LEU A CB    1 
ATOM   2174 C  CG    . LEU B 2 94  ? -6.71300  20.74300 61.25700  1.000 37.59015  ? 789  LEU A CG    1 
ATOM   2175 C  CD1   . LEU B 2 94  ? -6.70100  20.70600 62.77100  1.000 37.77007  ? 789  LEU A CD1   1 
ATOM   2176 C  CD2   . LEU B 2 94  ? -5.93100  19.58500 60.64800  1.000 36.15548  ? 789  LEU A CD2   1 
ATOM   2177 N  N     . PHE B 2 95  ? -10.52300 21.53600 58.52300  1.000 42.52218  ? 790  PHE A N     1 
ATOM   2178 C  CA    . PHE B 2 95  ? -11.92700 21.19200 58.30700  1.000 45.14800  ? 790  PHE A CA    1 
ATOM   2179 C  C     . PHE B 2 95  ? -12.29400 21.36600 56.83800  1.000 45.78529  ? 790  PHE A C     1 
ATOM   2180 O  O     . PHE B 2 95  ? -12.20200 22.47300 56.29800  1.000 48.93855  ? 790  PHE A O     1 
ATOM   2181 C  CB    . PHE B 2 95  ? -12.82100 22.02700 59.22800  1.000 41.46887  ? 790  PHE A CB    1 
ATOM   2182 C  CG    . PHE B 2 95  ? -12.44300 21.89700 60.67100  1.000 42.00224  ? 790  PHE A CG    1 
ATOM   2183 C  CD1   . PHE B 2 95  ? -12.79800 20.77000 61.39200  1.000 39.36626  ? 790  PHE A CD1   1 
ATOM   2184 C  CD2   . PHE B 2 95  ? -11.64200 22.85200 61.28500  1.000 50.74077  ? 790  PHE A CD2   1 
ATOM   2185 C  CE1   . PHE B 2 95  ? -12.40500 20.62200 62.72100  1.000 42.57714  ? 790  PHE A CE1   1 
ATOM   2186 C  CE2   . PHE B 2 95  ? -11.24400 22.70600 62.61500  1.000 51.14168  ? 790  PHE A CE2   1 
ATOM   2187 C  CZ    . PHE B 2 95  ? -11.63300 21.59400 63.32800  1.000 45.47853  ? 790  PHE A CZ    1 
ATOM   2188 N  N     . ASN B 2 96  ? -12.70700 20.26300 56.19900  1.000 56.27590  ? 791  ASN A N     1 
ATOM   2189 C  CA    . ASN B 2 96  ? -13.03800 20.22000 54.77200  1.000 59.42929  ? 791  ASN A CA    1 
ATOM   2190 C  C     . ASN B 2 96  ? -14.55900 20.25300 54.61700  1.000 59.70368  ? 791  ASN A C     1 
ATOM   2191 O  O     . ASN B 2 96  ? -15.22300 19.22300 54.75100  1.000 67.51381  ? 791  ASN A O     1 
ATOM   2192 C  CB    . ASN B 2 96  ? -12.44100 18.96800 54.13400  1.000 66.90672  ? 791  ASN A CB    1 
ATOM   2193 C  CG    . ASN B 2 96  ? -12.40800 19.03000 52.60600  1.000 71.41780  ? 791  ASN A CG    1 
ATOM   2194 O  OD1   . ASN B 2 96  ? -13.35000 19.49900 51.95500  1.000 65.93296  ? 791  ASN A OD1   1 
ATOM   2195 N  ND2   . ASN B 2 96  ? -11.32300 18.52300 52.02900  1.000 75.62828  ? 791  ASN A ND2   1 
ATOM   2196 N  N     . VAL B 2 97  ? -15.10500 21.43900 54.30700  1.000 36.88105  ? 792  VAL A N     1 
ATOM   2197 C  CA    . VAL B 2 97  ? -16.55400 21.64700 54.31800  1.000 34.74751  ? 792  VAL A CA    1 
ATOM   2198 C  C     . VAL B 2 97  ? -17.26000 20.72500 53.32400  1.000 46.03911  ? 792  VAL A C     1 
ATOM   2199 O  O     . VAL B 2 97  ? -18.32200 20.16100 53.62600  1.000 46.03252  ? 792  VAL A O     1 
ATOM   2200 C  CB    . VAL B 2 97  ? -16.87700 23.12900 54.04700  1.000 38.24835  ? 792  VAL A CB    1 
ATOM   2201 C  CG1   . VAL B 2 97  ? -18.31800 23.30400 53.54300  1.000 35.78492  ? 792  VAL A CG1   1 
ATOM   2202 C  CG2   . VAL B 2 97  ? -16.63200 23.96800 55.30500  1.000 38.63294  ? 792  VAL A CG2   1 
ATOM   2203 N  N     . GLN B 2 98  ? -16.69600 20.55900 52.12200  1.000 67.21582  ? 793  GLN A N     1 
ATOM   2204 C  CA    . GLN B 2 98  ? -17.35100 19.70800 51.13100  1.000 75.03646  ? 793  GLN A CA    1 
ATOM   2205 C  C     . GLN B 2 98  ? -17.33300 18.23900 51.56100  1.000 77.76502  ? 793  GLN A C     1 
ATOM   2206 O  O     . GLN B 2 98  ? -18.30200 17.50400 51.32100  1.000 79.46587  ? 793  GLN A O     1 
ATOM   2207 C  CB    . GLN B 2 98  ? -16.68900 19.88600 49.76100  1.000 81.13202  ? 793  GLN A CB    1 
ATOM   2208 C  CG    . GLN B 2 98  ? -17.60400 19.60600 48.56500  1.000 85.72945  ? 793  GLN A CG    1 
ATOM   2209 C  CD    . GLN B 2 98  ? -17.16900 18.39100 47.75600  1.000 93.60114  ? 793  GLN A CD    1 
ATOM   2210 O  OE1   . GLN B 2 98  ? -15.99000 18.02300 47.74900  1.000 98.61918  ? 793  GLN A OE1   1 
ATOM   2211 N  NE2   . GLN B 2 98  ? -18.12500 17.75900 47.07100  1.000 95.57710  ? 793  GLN A NE2   1 
ATOM   2212 N  N     . ASP B 2 99  ? -16.24800 17.80200 52.22300  1.000 77.30983  ? 794  ASP A N     1 
ATOM   2213 C  CA    . ASP B 2 99  ? -16.12600 16.40700 52.65400  1.000 78.13638  ? 794  ASP A CA    1 
ATOM   2214 C  C     . ASP B 2 99  ? -16.96300 16.09700 53.89000  1.000 73.82728  ? 794  ASP A C     1 
ATOM   2215 O  O     . ASP B 2 99  ? -17.35300 14.94200 54.09800  1.000 77.69699  ? 794  ASP A O     1 
ATOM   2216 C  CB    . ASP B 2 99  ? -14.66900 16.07300 52.95400  1.000 80.60430  ? 794  ASP A CB    1 
ATOM   2217 C  CG    . ASP B 2 99  ? -13.87000 15.83000 51.71800  1.000 83.17851  ? 794  ASP A CG    1 
ATOM   2218 O  OD1   . ASP B 2 99  ? -14.43500 15.98700 50.61900  1.000 86.30449  ? 794  ASP A OD1   1 
ATOM   2219 O  OD2   . ASP B 2 99  ? -12.68000 15.46600 51.84800  1.000 82.76214  ? 794  ASP A OD2   1 
ATOM   2220 N  N     . ILE B 2 100 ? -17.21700 17.09500 54.73000  1.000 56.30640  ? 795  ILE A N     1 
ATOM   2221 C  CA    . ILE B 2 100 ? -17.92700 16.91300 55.99200  1.000 52.47441  ? 795  ILE A CA    1 
ATOM   2222 C  C     . ILE B 2 100 ? -19.41300 17.17100 55.76700  1.000 52.20130  ? 795  ILE A C     1 
ATOM   2223 O  O     . ILE B 2 100 ? -20.24800 16.28900 56.00600  1.000 52.79455  ? 795  ILE A O     1 
ATOM   2224 C  CB    . ILE B 2 100 ? -17.33100 17.82600 57.08800  1.000 44.56608  ? 795  ILE A CB    1 
ATOM   2225 C  CG1   . ILE B 2 100 ? -15.91900 17.34500 57.46400  1.000 43.70275  ? 795  ILE A CG1   1 
ATOM   2226 C  CG2   . ILE B 2 100 ? -18.21800 17.87200 58.30700  1.000 34.18942  ? 795  ILE A CG2   1 
ATOM   2227 C  CD1   . ILE B 2 100 ? -15.22500 18.20400 58.47700  1.000 40.26258  ? 795  ILE A CD1   1 
ATOM   2228 N  N     . ASN B 2 101 ? -19.75500 18.36800 55.27700  1.000 54.23598  ? 796  ASN A N     1 
ATOM   2229 C  CA    . ASN B 2 101 ? -21.15400 18.69000 54.99000  1.000 58.93775  ? 796  ASN A CA    1 
ATOM   2230 C  C     . ASN B 2 101 ? -21.21900 19.69000 53.83700  1.000 62.74462  ? 796  ASN A C     1 
ATOM   2231 O  O     . ASN B 2 101 ? -21.01400 20.89400 54.03400  1.000 57.46206  ? 796  ASN A O     1 
ATOM   2232 C  CB    . ASN B 2 101 ? -21.85800 19.23300 56.22300  1.000 56.61944  ? 796  ASN A CB    1 
ATOM   2233 C  CG    . ASN B 2 101 ? -23.24400 19.72500 55.90900  1.000 58.04102  ? 796  ASN A CG    1 
ATOM   2234 O  OD1   . ASN B 2 101 ? -23.54200 20.90500 56.09700  1.000 58.18552  ? 796  ASN A OD1   1 
ATOM   2235 N  ND2   . ASN B 2 101 ? -24.10400 18.82300 55.38900  1.000 57.97903  ? 796  ASN A ND2   1 
ATOM   2236 N  N     . SER B 2 102 ? -21.55500 19.19100 52.64400  1.000 74.74926  ? 797  SER A N     1 
ATOM   2237 C  CA    . SER B 2 102 ? -21.61300 20.06500 51.47800  1.000 74.05778  ? 797  SER A CA    1 
ATOM   2238 C  C     . SER B 2 102 ? -22.83700 20.97600 51.51800  1.000 72.00725  ? 797  SER A C     1 
ATOM   2239 O  O     . SER B 2 102 ? -22.80600 22.08500 50.96700  1.000 75.32516  ? 797  SER A O     1 
ATOM   2240 C  CB    . SER B 2 102 ? -21.60000 19.22100 50.20900  1.000 76.97478  ? 797  SER A CB    1 
ATOM   2241 O  OG    . SER B 2 102 ? -20.65000 18.17400 50.32700  1.000 80.76817  ? 797  SER A OG    1 
ATOM   2242 N  N     . ALA B 2 103 ? -23.90700 20.53900 52.18600  1.000 60.31933  ? 798  ALA A N     1 
ATOM   2243 C  CA    . ALA B 2 103 ? -25.14700 21.30900 52.26200  1.000 54.44677  ? 798  ALA A CA    1 
ATOM   2244 C  C     . ALA B 2 103 ? -24.96600 22.67200 52.91700  1.000 54.82697  ? 798  ALA A C     1 
ATOM   2245 O  O     . ALA B 2 103 ? -25.76700 23.57800 52.66700  1.000 51.97467  ? 798  ALA A O     1 
ATOM   2246 C  CB    . ALA B 2 103 ? -26.19600 20.51400 53.03900  1.000 50.79947  ? 798  ALA A CB    1 
ATOM   2247 N  N     . LEU B 2 104 ? -23.95100 22.82800 53.77200  1.000 61.85100  ? 799  LEU A N     1 
ATOM   2248 C  CA    . LEU B 2 104 ? -23.75500 24.09100 54.47800  1.000 60.66749  ? 799  LEU A CA    1 
ATOM   2249 C  C     . LEU B 2 104 ? -23.46800 25.23700 53.51400  1.000 63.75676  ? 799  LEU A C     1 
ATOM   2250 O  O     . LEU B 2 104 ? -23.77100 26.40000 53.82100  1.000 59.68424  ? 799  LEU A O     1 
ATOM   2251 C  CB    . LEU B 2 104 ? -22.61900 23.94200 55.48600  1.000 57.20860  ? 799  LEU A CB    1 
ATOM   2252 C  CG    . LEU B 2 104 ? -22.23500 25.16000 56.32400  1.000 53.76093  ? 799  LEU A CG    1 
ATOM   2253 C  CD1   . LEU B 2 104 ? -23.16200 25.33300 57.52600  1.000 50.39167  ? 799  LEU A CD1   1 
ATOM   2254 C  CD2   . LEU B 2 104 ? -20.78700 25.04000 56.74700  1.000 49.13475  ? 799  LEU A CD2   1 
ATOM   2255 N  N     . TYR B 2 105 ? -22.89800 24.92200 52.34200  1.000 63.08547  ? 800  TYR A N     1 
ATOM   2256 C  CA    . TYR B 2 105 ? -22.59300 25.92900 51.33200  1.000 58.27736  ? 800  TYR A CA    1 
ATOM   2257 C  C     . TYR B 2 105 ? -23.83600 26.63500 50.80200  1.000 59.01974  ? 800  TYR A C     1 
ATOM   2258 O  O     . TYR B 2 105 ? -23.72300 27.75500 50.29600  1.000 52.32102  ? 800  TYR A O     1 
ATOM   2259 C  CB    . TYR B 2 105 ? -21.84600 25.28500 50.17500  1.000 55.58000  ? 800  TYR A CB    1 
ATOM   2260 C  CG    . TYR B 2 105 ? -20.35000 25.24500 50.34800  1.000 54.26779  ? 800  TYR A CG    1 
ATOM   2261 C  CD1   . TYR B 2 105 ? -19.66000 26.31300 50.92900  1.000 52.08675  ? 800  TYR A CD1   1 
ATOM   2262 C  CD2   . TYR B 2 105 ? -19.61700 24.13900 49.92000  1.000 51.04288  ? 800  TYR A CD2   1 
ATOM   2263 C  CE1   . TYR B 2 105 ? -18.27100 26.27000 51.08800  1.000 46.95750  ? 800  TYR A CE1   1 
ATOM   2264 C  CE2   . TYR B 2 105 ? -18.24100 24.08500 50.07400  1.000 49.85619  ? 800  TYR A CE2   1 
ATOM   2265 C  CZ    . TYR B 2 105 ? -17.56600 25.14900 50.65600  1.000 49.24788  ? 800  TYR A CZ    1 
ATOM   2266 O  OH    . TYR B 2 105 ? -16.18400 25.08100 50.78100  1.000 51.42215  ? 800  TYR A OH    1 
ATOM   2267 N  N     . ARG B 2 106 ? -25.01700 26.01900 50.90900  1.000 76.32166  ? 801  ARG A N     1 
ATOM   2268 C  CA    . ARG B 2 106 ? -26.25900 26.66200 50.48800  1.000 76.84410  ? 801  ARG A CA    1 
ATOM   2269 C  C     . ARG B 2 106 ? -27.04400 27.29400 51.62700  1.000 69.62776  ? 801  ARG A C     1 
ATOM   2270 O  O     . ARG B 2 106 ? -27.93000 28.11200 51.35700  1.000 68.89234  ? 801  ARG A O     1 
ATOM   2271 C  CB    . ARG B 2 106 ? -27.15100 25.66900 49.74000  1.000 82.52991  ? 801  ARG A CB    1 
ATOM   2272 C  CG    . ARG B 2 106 ? -26.40200 24.97800 48.61500  1.000 90.52536  ? 801  ARG A CG    1 
ATOM   2273 C  CD    . ARG B 2 106 ? -27.28300 24.06600 47.78800  1.000 96.41790  ? 801  ARG A CD    1 
ATOM   2274 N  NE    . ARG B 2 106 ? -27.32700 22.72300 48.35900  1.000 100.87817 ? 801  ARG A NE    1 
ATOM   2275 C  CZ    . ARG B 2 106 ? -26.41400 21.78100 48.13400  1.000 100.76800 ? 801  ARG A CZ    1 
ATOM   2276 N  NH1   . ARG B 2 106 ? -25.36300 22.03600 47.36000  1.000 101.38357 ? 801  ARG A NH1   1 
ATOM   2277 N  NH2   . ARG B 2 106 ? -26.54000 20.58500 48.69900  1.000 97.23500  ? 801  ARG A NH2   1 
ATOM   2278 N  N     . LYS B 2 107 ? -26.73400 26.96200 52.88100  1.000 56.98808  ? 802  LYS A N     1 
ATOM   2279 C  CA    . LYS B 2 107 ? -27.39600 27.60600 54.00800  1.000 59.55443  ? 802  LYS A CA    1 
ATOM   2280 C  C     . LYS B 2 107 ? -26.70700 28.89900 54.44600  1.000 63.12424  ? 802  LYS A C     1 
ATOM   2281 O  O     . LYS B 2 107 ? -27.38900 29.82000 54.92100  1.000 68.39795  ? 802  LYS A O     1 
ATOM   2282 C  CB    . LYS B 2 107 ? -27.50600 26.62700 55.18600  1.000 56.95346  ? 802  LYS A CB    1 
ATOM   2283 C  CG    . LYS B 2 107 ? -28.43700 25.42600 54.92000  1.000 67.29669  ? 802  LYS A CG    1 
ATOM   2284 C  CD    . LYS B 2 107 ? -29.90800 25.86500 54.68800  1.000 75.57970  ? 802  LYS A CD    1 
ATOM   2285 C  CE    . LYS B 2 107 ? -30.91300 25.04600 55.49300  1.000 80.22194  ? 802  LYS A CE    1 
ATOM   2286 N  NZ    . LYS B 2 107 ? -31.43200 25.79200 56.68100  1.000 79.98033  ? 802  LYS A NZ    1 
ATOM   2287 N  N     . VAL B 2 108 ? -25.38700 29.01400 54.28200  1.000 51.23636  ? 803  VAL A N     1 
ATOM   2288 C  CA    . VAL B 2 108 ? -24.66300 30.22900 54.65500  1.000 52.39018  ? 803  VAL A CA    1 
ATOM   2289 C  C     . VAL B 2 108 ? -24.26300 30.95800 53.38300  1.000 54.21456  ? 803  VAL A C     1 
ATOM   2290 O  O     . VAL B 2 108 ? -23.57000 30.40300 52.52300  1.000 52.20087  ? 803  VAL A O     1 
ATOM   2291 C  CB    . VAL B 2 108 ? -23.42900 29.93600 55.52500  1.000 46.66302  ? 803  VAL A CB    1 
ATOM   2292 C  CG1   . VAL B 2 108 ? -23.00700 31.19700 56.30000  1.000 37.99621  ? 803  VAL A CG1   1 
ATOM   2293 C  CG2   . VAL B 2 108 ? -23.68800 28.77200 56.46800  1.000 44.94113  ? 803  VAL A CG2   1 
ATOM   2294 N  N     . LYS B 2 109 ? -24.70600 32.20100 53.26000  1.000 62.32745  ? 804  LYS A N     1 
ATOM   2295 C  CA    . LYS B 2 109 ? -24.34800 32.97000 52.08200  1.000 67.02134  ? 804  LYS A CA    1 
ATOM   2296 C  C     . LYS B 2 109 ? -22.93200 33.50100 52.20200  1.000 65.76536  ? 804  LYS A C     1 
ATOM   2297 O  O     . LYS B 2 109 ? -22.15300 33.42900 51.24600  1.000 63.74447  ? 804  LYS A O     1 
ATOM   2298 C  CB    . LYS B 2 109 ? -25.35400 34.10800 51.87800  1.000 71.25364  ? 804  LYS A CB    1 
ATOM   2299 C  CG    . LYS B 2 109 ? -26.46300 33.78100 50.89100  1.000 77.65120  ? 804  LYS A CG    1 
ATOM   2300 C  CD    . LYS B 2 109 ? -27.21400 35.05300 50.47700  1.000 83.37634  ? 804  LYS A CD    1 
ATOM   2301 C  CE    . LYS B 2 109 ? -26.74800 35.58500 49.11100  1.000 83.51082  ? 804  LYS A CE    1 
ATOM   2302 N  NZ    . LYS B 2 109 ? -25.33400 36.10200 49.09600  1.000 84.34115  ? 804  LYS A NZ    1 
ATOM   2303 N  N     . LEU B 2 110 ? -22.59100 34.02300 53.37800  1.000 65.88924  ? 805  LEU A N     1 
ATOM   2304 C  CA    . LEU B 2 110 ? -21.25700 34.55800 53.60500  1.000 61.23965  ? 805  LEU A CA    1 
ATOM   2305 C  C     . LEU B 2 110 ? -20.18800 33.49100 53.40800  1.000 63.42695  ? 805  LEU A C     1 
ATOM   2306 O  O     . LEU B 2 110 ? -19.05000 33.81200 53.04100  1.000 63.15872  ? 805  LEU A O     1 
ATOM   2307 C  CB    . LEU B 2 110 ? -21.16800 35.15800 55.00700  1.000 56.44826  ? 805  LEU A CB    1 
ATOM   2308 C  CG    . LEU B 2 110 ? -21.17600 36.68500 55.00400  1.000 65.00573  ? 805  LEU A CG    1 
ATOM   2309 C  CD1   . LEU B 2 110 ? -22.41900 37.20200 54.29500  1.000 70.75982  ? 805  LEU A CD1   1 
ATOM   2310 C  CD2   . LEU B 2 110 ? -21.11100 37.21300 56.42500  1.000 64.06643  ? 805  LEU A CD2   1 
ATOM   2311 N  N     . LEU B 2 111 ? -20.54100 32.21900 53.61600  1.000 52.69023  ? 806  LEU A N     1 
ATOM   2312 C  CA    . LEU B 2 111 ? -19.59100 31.14500 53.36700  1.000 47.73502  ? 806  LEU A CA    1 
ATOM   2313 C  C     . LEU B 2 111 ? -19.50500 30.80100 51.88100  1.000 52.61135  ? 806  LEU A C     1 
ATOM   2314 O  O     . LEU B 2 111 ? -18.40300 30.62100 51.35100  1.000 48.76540  ? 806  LEU A O     1 
ATOM   2315 C  CB    . LEU B 2 111 ? -19.96100 29.90500 54.18100  1.000 42.02108  ? 806  LEU A CB    1 
ATOM   2316 C  CG    . LEU B 2 111 ? -18.90800 28.80200 54.04600  1.000 41.88466  ? 806  LEU A CG    1 
ATOM   2317 C  CD1   . LEU B 2 111 ? -17.55500 29.26100 54.56400  1.000 34.85807  ? 806  LEU A CD1   1 
ATOM   2318 C  CD2   . LEU B 2 111 ? -19.34000 27.54800 54.74600  1.000 43.45706  ? 806  LEU A CD2   1 
ATOM   2319 N  N     . ASN B 2 112 ? -20.64300 30.69800 51.18900  1.000 64.73167  ? 807  ASN A N     1 
ATOM   2320 C  CA    . ASN B 2 112 ? -20.58200 30.48500 49.74400  1.000 66.85225  ? 807  ASN A CA    1 
ATOM   2321 C  C     . ASN B 2 112 ? -19.81200 31.60000 49.05800  1.000 62.94633  ? 807  ASN A C     1 
ATOM   2322 O  O     . ASN B 2 112 ? -19.10600 31.35600 48.06800  1.000 55.06246  ? 807  ASN A O     1 
ATOM   2323 C  CB    . ASN B 2 112 ? -21.98000 30.38900 49.13400  1.000 69.90809  ? 807  ASN A CB    1 
ATOM   2324 C  CG    . ASN B 2 112 ? -21.95400 29.83800 47.71300  1.000 71.09203  ? 807  ASN A CG    1 
ATOM   2325 O  OD1   . ASN B 2 112 ? -21.15700 28.94700 47.40500  1.000 71.90554  ? 807  ASN A OD1   1 
ATOM   2326 N  ND2   . ASN B 2 112 ? -22.80900 30.37600 46.83800  1.000 69.87274  ? 807  ASN A ND2   1 
ATOM   2327 N  N     . GLN B 2 113 ? -19.92600 32.82500 49.57300  1.000 59.29675  ? 808  GLN A N     1 
ATOM   2328 C  CA    . GLN B 2 113 ? -19.18600 33.92600 48.97800  1.000 57.21986  ? 808  GLN A CA    1 
ATOM   2329 C  C     . GLN B 2 113 ? -17.68400 33.69000 49.05800  1.000 59.51711  ? 808  GLN A C     1 
ATOM   2330 O  O     . GLN B 2 113 ? -16.96700 33.93400 48.08200  1.000 64.64414  ? 808  GLN A O     1 
ATOM   2331 C  CB    . GLN B 2 113 ? -19.57500 35.24000 49.64600  1.000 58.10354  ? 808  GLN A CB    1 
ATOM   2332 C  CG    . GLN B 2 113 ? -20.96600 35.69300 49.27400  1.000 66.33943  ? 808  GLN A CG    1 
ATOM   2333 C  CD    . GLN B 2 113 ? -21.26400 37.07100 49.79500  1.000 72.35610  ? 808  GLN A CD    1 
ATOM   2334 O  OE1   . GLN B 2 113 ? -20.39700 37.71400 50.40100  1.000 71.05661  ? 808  GLN A OE1   1 
ATOM   2335 N  NE2   . GLN B 2 113 ? -22.51100 37.52300 49.60900  1.000 75.09642  ? 808  GLN A NE2   1 
ATOM   2336 N  N     . VAL B 2 114 ? -17.18300 33.20100 50.20000  1.000 53.60452  ? 809  VAL A N     1 
ATOM   2337 C  CA    . VAL B 2 114 ? -15.74300 32.97200 50.26100  1.000 48.71858  ? 809  VAL A CA    1 
ATOM   2338 C  C     . VAL B 2 114 ? -15.36300 31.71400 49.47700  1.000 44.90964  ? 809  VAL A C     1 
ATOM   2339 O  O     . VAL B 2 114 ? -14.30200 31.67600 48.84500  1.000 41.20317  ? 809  VAL A O     1 
ATOM   2340 C  CB    . VAL B 2 114 ? -15.21300 32.94700 51.71200  1.000 45.04674  ? 809  VAL A CB    1 
ATOM   2341 C  CG1   . VAL B 2 114 ? -15.63400 34.19500 52.46900  1.000 46.40488  ? 809  VAL A CG1   1 
ATOM   2342 C  CG2   . VAL B 2 114 ? -15.59600 31.66800 52.45900  1.000 42.31148  ? 809  VAL A CG2   1 
ATOM   2343 N  N     . ARG B 2 115 ? -16.22300 30.69600 49.44800  1.000 45.63996  ? 810  ARG A N     1 
ATOM   2344 C  CA    . ARG B 2 115 ? -15.98000 29.57500 48.54900  1.000 48.77541  ? 810  ARG A CA    1 
ATOM   2345 C  C     . ARG B 2 115 ? -15.78500 30.06300 47.12200  1.000 52.76453  ? 810  ARG A C     1 
ATOM   2346 O  O     . ARG B 2 115 ? -14.81500 29.69600 46.44800  1.000 50.57922  ? 810  ARG A O     1 
ATOM   2347 C  CB    . ARG B 2 115 ? -17.13700 28.58600 48.59500  1.000 49.04528  ? 810  ARG A CB    1 
ATOM   2348 C  CG    . ARG B 2 115 ? -17.09200 27.63200 47.42400  1.000 46.76774  ? 810  ARG A CG    1 
ATOM   2349 C  CD    . ARG B 2 115 ? -18.17500 26.60500 47.49000  1.000 49.05406  ? 810  ARG A CD    1 
ATOM   2350 N  NE    . ARG B 2 115 ? -19.30600 26.94200 46.63500  1.000 58.56802  ? 810  ARG A NE    1 
ATOM   2351 C  CZ    . ARG B 2 115 ? -19.45700 26.46500 45.40100  1.000 58.74268  ? 810  ARG A CZ    1 
ATOM   2352 N  NH1   . ARG B 2 115 ? -18.53000 25.64400 44.88900  1.000 52.23817  ? 810  ARG A NH1   1 
ATOM   2353 N  NH2   . ARG B 2 115 ? -20.52800 26.80200 44.68400  1.000 50.85913  ? 810  ARG A NH2   1 
ATOM   2354 N  N     . LEU B 2 116 ? -16.71200 30.89100 46.64600  1.000 54.67285  ? 811  LEU A N     1 
ATOM   2355 C  CA    . LEU B 2 116 ? -16.58000 31.45500 45.31200  1.000 50.33791  ? 811  LEU A CA    1 
ATOM   2356 C  C     . LEU B 2 116 ? -15.33400 32.32300 45.20700  1.000 50.28285  ? 811  LEU A C     1 
ATOM   2357 O  O     . LEU B 2 116 ? -14.53900 32.15000 44.28000  1.000 58.92768  ? 811  LEU A O     1 
ATOM   2358 C  CB    . LEU B 2 116 ? -17.85000 32.23500 44.95000  1.000 49.31893  ? 811  LEU A CB    1 
ATOM   2359 C  CG    . LEU B 2 116 ? -19.14500 31.41400 44.80400  1.000 52.90729  ? 811  LEU A CG    1 
ATOM   2360 C  CD1   . LEU B 2 116 ? -20.03800 32.06000 43.77700  1.000 52.05488  ? 811  LEU A CD1   1 
ATOM   2361 C  CD2   . LEU B 2 116 ? -18.93400 29.93000 44.46300  1.000 53.77801  ? 811  LEU A CD2   1 
ATOM   2362 N  N     . LEU B 2 117 ? -15.13600 33.25000 46.14600  1.000 44.38579  ? 812  LEU A N     1 
ATOM   2363 C  CA    . LEU B 2 117 ? -13.91700 34.04900 46.13700  1.000 50.99521  ? 812  LEU A CA    1 
ATOM   2364 C  C     . LEU B 2 117 ? -12.67200 33.16500 46.12100  1.000 56.13867  ? 812  LEU A C     1 
ATOM   2365 O  O     . LEU B 2 117 ? -11.69900 33.45700 45.41500  1.000 56.78425  ? 812  LEU A O     1 
ATOM   2366 C  CB    . LEU B 2 117 ? -13.89000 34.97900 47.34500  1.000 54.67172  ? 812  LEU A CB    1 
ATOM   2367 C  CG    . LEU B 2 117 ? -14.68600 36.27900 47.21400  1.000 59.74754  ? 812  LEU A CG    1 
ATOM   2368 C  CD1   . LEU B 2 117 ? -14.75900 37.03400 48.56900  1.000 62.23962  ? 812  LEU A CD1   1 
ATOM   2369 C  CD2   . LEU B 2 117 ? -14.08500 37.15200 46.13900  1.000 54.68821  ? 812  LEU A CD2   1 
ATOM   2370 N  N     . ARG B 2 118 ? -12.69600 32.06200 46.86800  1.000 57.44479  ? 813  ARG A N     1 
ATOM   2371 C  CA    . ARG B 2 118 ? -11.53700 31.17500 46.89300  1.000 55.96892  ? 813  ARG A CA    1 
ATOM   2372 C  C     . ARG B 2 118 ? -11.35900 30.40600 45.58800  1.000 52.58061  ? 813  ARG A C     1 
ATOM   2373 O  O     . ARG B 2 118 ? -10.22800 30.03100 45.25100  1.000 46.10302  ? 813  ARG A O     1 
ATOM   2374 C  CB    . ARG B 2 118 ? -11.64000 30.18800 48.05800  1.000 50.84059  ? 813  ARG A CB    1 
ATOM   2375 C  CG    . ARG B 2 118 ? -11.24200 30.78300 49.37800  1.000 46.76941  ? 813  ARG A CG    1 
ATOM   2376 C  CD    . ARG B 2 118 ? -11.48200 29.81000 50.49300  1.000 47.12306  ? 813  ARG A CD    1 
ATOM   2377 N  NE    . ARG B 2 118 ? -10.71100 28.58800 50.33900  1.000 48.71159  ? 813  ARG A NE    1 
ATOM   2378 C  CZ    . ARG B 2 118 ? -10.51500 27.72000 51.32400  1.000 51.58884  ? 813  ARG A CZ    1 
ATOM   2379 N  NH1   . ARG B 2 118 ? -11.06100 27.95300 52.50800  1.000 47.35626  ? 813  ARG A NH1   1 
ATOM   2380 N  NH2   . ARG B 2 118 ? -9.78800  26.62100 51.13100  1.000 53.55216  ? 813  ARG A NH2   1 
ATOM   2381 N  N     . VAL B 2 119 ? -12.44800 30.11500 44.86800  1.000 46.60773  ? 814  VAL A N     1 
ATOM   2382 C  CA    . VAL B 2 119 ? -12.30100 29.43300 43.58600  1.000 42.10226  ? 814  VAL A CA    1 
ATOM   2383 C  C     . VAL B 2 119 ? -11.56000 30.33200 42.61100  1.000 44.16201  ? 814  VAL A C     1 
ATOM   2384 O  O     . VAL B 2 119 ? -10.60000 29.90900 41.95900  1.000 43.99572  ? 814  VAL A O     1 
ATOM   2385 C  CB    . VAL B 2 119 ? -13.67000 28.98800 43.04100  1.000 43.19948  ? 814  VAL A CB    1 
ATOM   2386 C  CG1   . VAL B 2 119 ? -13.53900 28.42500 41.65400  1.000 39.55265  ? 814  VAL A CG1   1 
ATOM   2387 C  CG2   . VAL B 2 119 ? -14.26500 27.91200 43.94100  1.000 47.81260  ? 814  VAL A CG2   1 
ATOM   2388 N  N     . GLN B 2 120 ? -11.95300 31.60800 42.55100  1.000 48.91093  ? 815  GLN A N     1 
ATOM   2389 C  CA    . GLN B 2 120 ? -11.26700 32.56800 41.69200  1.000 46.61813  ? 815  GLN A CA    1 
ATOM   2390 C  C     . GLN B 2 120 ? -9.79700  32.70500 42.07100  1.000 50.63917  ? 815  GLN A C     1 
ATOM   2391 O  O     . GLN B 2 120 ? -8.91700  32.67800 41.19800  1.000 52.07181  ? 815  GLN A O     1 
ATOM   2392 C  CB    . GLN B 2 120 ? -11.97200 33.92300 41.75300  1.000 41.97392  ? 815  GLN A CB    1 
ATOM   2393 C  CG    . GLN B 2 120 ? -13.40000 33.86300 41.26700  1.000 47.90258  ? 815  GLN A CG    1 
ATOM   2394 C  CD    . GLN B 2 120 ? -14.12700 35.19600 41.38300  1.000 60.09764  ? 815  GLN A CD    1 
ATOM   2395 O  OE1   . GLN B 2 120 ? -13.70300 36.09900 42.11300  1.000 64.91669  ? 815  GLN A OE1   1 
ATOM   2396 N  NE2   . GLN B 2 120 ? -15.24000 35.31600 40.67500  1.000 64.25857  ? 815  GLN A NE2   1 
ATOM   2397 N  N     . LEU B 2 121 ? -9.51300  32.84100 43.37300  1.000 48.72941  ? 816  LEU A N     1 
ATOM   2398 C  CA    . LEU B 2 121 ? -8.13900  33.06600 43.83200  1.000 41.55538  ? 816  LEU A CA    1 
ATOM   2399 C  C     . LEU B 2 121 ? -7.21700  31.91200 43.46200  1.000 47.70218  ? 816  LEU A C     1 
ATOM   2400 O  O     . LEU B 2 121 ? -6.03600  32.13700 43.18100  1.000 56.42940  ? 816  LEU A O     1 
ATOM   2401 C  CB    . LEU B 2 121 ? -8.10000  33.29100 45.34500  1.000 42.54202  ? 816  LEU A CB    1 
ATOM   2402 C  CG    . LEU B 2 121 ? -8.50700  34.66200 45.87600  1.000 47.97619  ? 816  LEU A CG    1 
ATOM   2403 C  CD1   . LEU B 2 121 ? -8.42300  34.68500 47.39100  1.000 46.67017  ? 816  LEU A CD1   1 
ATOM   2404 C  CD2   . LEU B 2 121 ? -7.63200  35.74600 45.27500  1.000 50.56462  ? 816  LEU A CD2   1 
ATOM   2405 N  N     . CYS B 2 122 ? -7.72900  30.67400 43.46200  1.000 48.99458  ? 817  CYS A N     1 
ATOM   2406 C  CA    . CYS B 2 122 ? -6.91600  29.51800 43.07300  1.000 52.36972  ? 817  CYS A CA    1 
ATOM   2407 C  C     . CYS B 2 122 ? -6.58400  29.50400 41.58600  1.000 57.51317  ? 817  CYS A C     1 
ATOM   2408 O  O     . CYS B 2 122 ? -5.51300  29.01100 41.19700  1.000 57.76084  ? 817  CYS A O     1 
ATOM   2409 C  CB    . CYS B 2 122 ? -7.59100  28.20000 43.46200  1.000 50.98553  ? 817  CYS A CB    1 
ATOM   2410 S  SG    . CYS B 2 122 ? -7.83900  27.93900 45.27800  1.000 57.10227  ? 817  CYS A SG    1 
ATOM   2411 N  N     . HIS B 2 123 ? -7.47100  30.03700 40.74400  1.000 62.31534  ? 818  HIS A N     1 
ATOM   2412 C  CA    . HIS B 2 123 ? -7.15000  30.14900 39.33100  1.000 58.82075  ? 818  HIS A CA    1 
ATOM   2413 C  C     . HIS B 2 123 ? -6.24300  31.33500 39.07700  1.000 55.23642  ? 818  HIS A C     1 
ATOM   2414 O  O     . HIS B 2 123 ? -5.31700  31.24400 38.27100  1.000 63.00486  ? 818  HIS A O     1 
ATOM   2415 C  CB    . HIS B 2 123 ? -8.42300  30.27800 38.51500  1.000 64.83423  ? 818  HIS A CB    1 
ATOM   2416 C  CG    . HIS B 2 123 ? -9.21800  29.01600 38.45500  1.000 70.35788  ? 818  HIS A CG    1 
ATOM   2417 N  ND1   . HIS B 2 123 ? -8.68900  27.83500 37.98500  1.000 71.74069  ? 818  HIS A ND1   1 
ATOM   2418 C  CD2   . HIS B 2 123 ? -10.50100 28.74600 38.80400  1.000 72.19614  ? 818  HIS A CD2   1 
ATOM   2419 C  CE1   . HIS B 2 123 ? -9.61100  26.88900 38.04700  1.000 72.52482  ? 818  HIS A CE1   1 
ATOM   2420 N  NE2   . HIS B 2 123 ? -10.72000 27.41600 38.53700  1.000 71.23328  ? 818  HIS A NE2   1 
ATOM   2421 N  N     . MET B 2 124 ? -6.48600  32.45500 39.75600  1.000 43.68638  ? 819  MET A N     1 
ATOM   2422 C  CA    . MET B 2 124 ? -5.57700  33.58600 39.61400  1.000 48.88624  ? 819  MET A CA    1 
ATOM   2423 C  C     . MET B 2 124 ? -4.16400  33.22400 40.06800  1.000 54.30612  ? 819  MET A C     1 
ATOM   2424 O  O     . MET B 2 124 ? -3.17800  33.67800 39.47600  1.000 59.22005  ? 819  MET A O     1 
ATOM   2425 C  CB    . MET B 2 124 ? -6.10300  34.78200 40.40000  1.000 48.67635  ? 819  MET A CB    1 
ATOM   2426 C  CG    . MET B 2 124 ? -7.50700  35.17100 40.02600  1.000 55.30181  ? 819  MET A CG    1 
ATOM   2427 S  SD    . MET B 2 124 ? -7.87200  36.83200 40.59300  1.000 60.16702  ? 819  MET A SD    1 
ATOM   2428 C  CE    . MET B 2 124 ? -9.51500  37.02400 39.91600  1.000 56.74412  ? 819  MET A CE    1 
ATOM   2429 N  N     . LYS B 2 125 ? -4.04700  32.40400 41.11700  1.000 52.37526  ? 820  LYS A N     1 
ATOM   2430 C  CA    . LYS B 2 125 ? -2.73500  32.04400 41.64100  1.000 47.44232  ? 820  LYS A CA    1 
ATOM   2431 C  C     . LYS B 2 125 ? -1.95400  31.21500 40.62900  1.000 47.76350  ? 820  LYS A C     1 
ATOM   2432 O  O     . LYS B 2 125 ? -0.76200  31.45700 40.41400  1.000 46.23739  ? 820  LYS A O     1 
ATOM   2433 C  CB    . LYS B 2 125 ? -2.89900  31.29500 42.97100  1.000 48.42150  ? 820  LYS A CB    1 
ATOM   2434 C  CG    . LYS B 2 125 ? -1.60200  30.87800 43.67900  1.000 45.83206  ? 820  LYS A CG    1 
ATOM   2435 C  CD    . LYS B 2 125 ? -1.12000  31.99300 44.58100  1.000 49.96650  ? 820  LYS A CD    1 
ATOM   2436 C  CE    . LYS B 2 125 ? -0.44400  31.49400 45.84900  1.000 56.85702  ? 820  LYS A CE    1 
ATOM   2437 N  NZ    . LYS B 2 125 ? -1.40000  30.96100 46.85300  1.000 57.66172  ? 820  LYS A NZ    1 
ATOM   2438 N  N     . ASN B 2 126 ? -2.62000  30.25100 39.97700  1.000 57.34706  ? 821  ASN A N     1 
ATOM   2439 C  CA    . ASN B 2 126 ? -1.95700  29.39900 38.99100  1.000 54.44785  ? 821  ASN A CA    1 
ATOM   2440 C  C     . ASN B 2 126 ? -1.44000  30.20300 37.81100  1.000 56.11011  ? 821  ASN A C     1 
ATOM   2441 O  O     . ASN B 2 126 ? -0.39800  29.86700 37.23500  1.000 64.52088  ? 821  ASN A O     1 
ATOM   2442 C  CB    . ASN B 2 126 ? -2.92200  28.32200 38.50200  1.000 56.82795  ? 821  ASN A CB    1 
ATOM   2443 C  CG    . ASN B 2 126 ? -3.04400  27.17200 39.47100  1.000 64.48392  ? 821  ASN A CG    1 
ATOM   2444 O  OD1   . ASN B 2 126 ? -2.14800  26.93500 40.29300  1.000 68.32018  ? 821  ASN A OD1   1 
ATOM   2445 N  ND2   . ASN B 2 126 ? -4.15900  26.45500 39.39800  1.000 64.65207  ? 821  ASN A ND2   1 
ATOM   2446 N  N     . MET B 2 127 ? -2.15500  31.25500 37.43400  1.000 47.24788  ? 822  MET A N     1 
ATOM   2447 C  CA    . MET B 2 127 ? -1.69500  32.11200 36.35600  1.000 54.95486  ? 822  MET A CA    1 
ATOM   2448 C  C     . MET B 2 127 ? -0.55600  33.01900 36.80700  1.000 57.34942  ? 822  MET A C     1 
ATOM   2449 O  O     . MET B 2 127 ? 0.40700   33.23400 36.05700  1.000 61.43805  ? 822  MET A O     1 
ATOM   2450 C  CB    . MET B 2 127 ? -2.86900  32.92400 35.82100  1.000 57.63604  ? 822  MET A CB    1 
ATOM   2451 C  CG    . MET B 2 127 ? -3.88800  32.05500 35.13400  1.000 58.82145  ? 822  MET A CG    1 
ATOM   2452 S  SD    . MET B 2 127 ? -5.28900  32.96600 34.50500  1.000 63.95159  ? 822  MET A SD    1 
ATOM   2453 C  CE    . MET B 2 127 ? -4.46000  34.36400 33.75000  1.000 64.73636  ? 822  MET A CE    1 
ATOM   2454 N  N     . PHE B 2 128 ? -0.64100  33.55500 38.02300  1.000 52.86493  ? 823  PHE A N     1 
ATOM   2455 C  CA    . PHE B 2 128 ? 0.42600   34.42200 38.50800  1.000 59.06332  ? 823  PHE A CA    1 
ATOM   2456 C  C     . PHE B 2 128 ? 1.70600   33.64700 38.82700  1.000 60.50909  ? 823  PHE A C     1 
ATOM   2457 O  O     . PHE B 2 128 ? 2.79000   34.24100 38.84100  1.000 62.69268  ? 823  PHE A O     1 
ATOM   2458 C  CB    . PHE B 2 128 ? -0.05800  35.20500 39.72500  1.000 58.24715  ? 823  PHE A CB    1 
ATOM   2459 C  CG    . PHE B 2 128 ? -1.21300  36.12100 39.42800  1.000 66.25758  ? 823  PHE A CG    1 
ATOM   2460 C  CD1   . PHE B 2 128 ? -1.47100  36.52700 38.12900  1.000 68.38323  ? 823  PHE A CD1   1 
ATOM   2461 C  CD2   . PHE B 2 128 ? -2.04900  36.57200 40.44100  1.000 70.46895  ? 823  PHE A CD2   1 
ATOM   2462 C  CE1   . PHE B 2 128 ? -2.53400  37.36700 37.84100  1.000 68.22018  ? 823  PHE A CE1   1 
ATOM   2463 C  CE2   . PHE B 2 128 ? -3.11000  37.41300 40.15800  1.000 70.72174  ? 823  PHE A CE2   1 
ATOM   2464 C  CZ    . PHE B 2 128 ? -3.35000  37.81000 38.85100  1.000 70.33173  ? 823  PHE A CZ    1 
ATOM   2465 N  N     . LYS B 2 129 ? 1.61200   32.33700 39.05700  1.000 47.69758  ? 824  LYS A N     1 
ATOM   2466 C  CA    . LYS B 2 129 ? 2.81300   31.52800 39.20400  1.000 43.47383  ? 824  LYS A CA    1 
ATOM   2467 C  C     . LYS B 2 129 ? 3.61100   31.44200 37.91000  1.000 50.42707  ? 824  LYS A C     1 
ATOM   2468 O  O     . LYS B 2 129 ? 4.81500   31.18500 37.96300  1.000 51.68960  ? 824  LYS A O     1 
ATOM   2469 C  CB    . LYS B 2 129 ? 2.45300   30.11600 39.67900  1.000 40.04268  ? 824  LYS A CB    1 
ATOM   2470 C  CG    . LYS B 2 129 ? 2.14800   30.01600 41.17200  1.000 44.15484  ? 824  LYS A CG    1 
ATOM   2471 C  CD    . LYS B 2 129 ? 1.68600   28.61400 41.55400  1.000 51.10735  ? 824  LYS A CD    1 
ATOM   2472 C  CE    . LYS B 2 129 ? 1.30700   28.52100 43.03600  1.000 55.25324  ? 824  LYS A CE    1 
ATOM   2473 N  NZ    . LYS B 2 129 ? 0.74100   27.18400 43.40300  1.000 54.81445  ? 824  LYS A NZ    1 
ATOM   2474 N  N     . THR B 2 130 ? 2.97600   31.64700 36.75300  1.000 52.71265  ? 825  THR A N     1 
ATOM   2475 C  CA    . THR B 2 130 ? 3.63400   31.47300 35.46600  1.000 44.45224  ? 825  THR A CA    1 
ATOM   2476 C  C     . THR B 2 130 ? 3.74800   32.76900 34.67100  1.000 49.57019  ? 825  THR A C     1 
ATOM   2477 O  O     . THR B 2 130 ? 4.12400   32.73000 33.49200  1.000 53.10074  ? 825  THR A O     1 
ATOM   2478 C  CB    . THR B 2 130 ? 2.90700   30.40900 34.63800  1.000 44.25297  ? 825  THR A CB    1 
ATOM   2479 O  OG1   . THR B 2 130 ? 1.57600   30.84700 34.32200  1.000 48.90004  ? 825  THR A OG1   1 
ATOM   2480 C  CG2   . THR B 2 130 ? 2.85100   29.08900 35.40400  1.000 37.26921  ? 825  THR A CG2   1 
ATOM   2481 N  N     . CYS B 2 131 ? 3.44700   33.91200 35.28900  1.000 61.78269  ? 826  CYS A N     1 
ATOM   2482 C  CA    . CYS B 2 131 ? 3.55600   35.22800 34.66400  1.000 63.84313  ? 826  CYS A CA    1 
ATOM   2483 C  C     . CYS B 2 131 ? 4.63200   36.01500 35.40100  1.000 66.50538  ? 826  CYS A C     1 
ATOM   2484 O  O     . CYS B 2 131 ? 4.44000   36.40800 36.55400  1.000 71.67305  ? 826  CYS A O     1 
ATOM   2485 C  CB    . CYS B 2 131 ? 2.21400   35.95500 34.69500  1.000 70.78393  ? 826  CYS A CB    1 
ATOM   2486 S  SG    . CYS B 2 131 ? 2.26200   37.64600 34.07900  1.000 75.18905  ? 826  CYS A SG    1 
ATOM   2487 N  N     . ARG B 2 132 ? 5.77100   36.23100 34.74600  1.000 60.40606  ? 827  ARG A N     1 
ATOM   2488 C  CA    . ARG B 2 132 ? 6.90800   36.84400 35.42400  1.000 56.07626  ? 827  ARG A CA    1 
ATOM   2489 C  C     . ARG B 2 132 ? 6.65800   38.30300 35.77500  1.000 57.49746  ? 827  ARG A C     1 
ATOM   2490 O  O     . ARG B 2 132 ? 7.43900   38.87500 36.54600  1.000 59.53764  ? 827  ARG A O     1 
ATOM   2491 C  CB    . ARG B 2 132 ? 8.17400   36.72600 34.56200  1.000 54.29235  ? 827  ARG A CB    1 
ATOM   2492 C  CG    . ARG B 2 132 ? 8.02600   37.32400 33.17200  1.000 54.82428  ? 827  ARG A CG    1 
ATOM   2493 C  CD    . ARG B 2 132 ? 9.15200   36.96500 32.18700  1.000 48.65419  ? 827  ARG A CD    1 
ATOM   2494 N  NE    . ARG B 2 132 ? 8.81000   37.49400 30.87100  1.000 53.12546  ? 827  ARG A NE    1 
ATOM   2495 C  CZ    . ARG B 2 132 ? 8.85500   38.78300 30.53300  1.000 60.85842  ? 827  ARG A CZ    1 
ATOM   2496 N  NH1   . ARG B 2 132 ? 9.25200   39.70000 31.41100  1.000 63.86517  ? 827  ARG A NH1   1 
ATOM   2497 N  NH2   . ARG B 2 132 ? 8.49900   39.16100 29.30600  1.000 60.55278  ? 827  ARG A NH2   1 
ATOM   2498 N  N     . LEU B 2 133 ? 5.59400   38.91200 35.24300  1.000 55.96081  ? 828  LEU A N     1 
ATOM   2499 C  CA    . LEU B 2 133 ? 5.30500   40.30700 35.53500  1.000 61.57808  ? 828  LEU A CA    1 
ATOM   2500 C  C     . LEU B 2 133 ? 4.37100   40.49200 36.71300  1.000 68.64862  ? 828  LEU A C     1 
ATOM   2501 O  O     . LEU B 2 133 ? 4.26000   41.61100 37.22600  1.000 73.84471  ? 828  LEU A O     1 
ATOM   2502 C  CB    . LEU B 2 133 ? 4.69500   41.00500 34.32400  1.000 65.07174  ? 828  LEU A CB    1 
ATOM   2503 C  CG    . LEU B 2 133 ? 5.50800   40.91800 33.03700  1.000 69.75123  ? 828  LEU A CG    1 
ATOM   2504 C  CD1   . LEU B 2 133 ? 4.76600   41.62800 31.91000  1.000 69.51970  ? 828  LEU A CD1   1 
ATOM   2505 C  CD2   . LEU B 2 133 ? 6.88900   41.51700 33.26900  1.000 73.03749  ? 828  LEU A CD2   1 
ATOM   2506 N  N     . ALA B 2 134 ? 3.71400   39.43200 37.16100  1.000 78.28348  ? 829  ALA A N     1 
ATOM   2507 C  CA    . ALA B 2 134 ? 2.78900   39.50500 38.29300  1.000 76.88666  ? 829  ALA A CA    1 
ATOM   2508 C  C     . ALA B 2 134 ? 3.41600   38.94600 39.56300  1.000 77.11736  ? 829  ALA A C     1 
ATOM   2509 O  O     . ALA B 2 134 ? 2.80800   38.11100 40.22700  1.000 79.42812  ? 829  ALA A O     1 
ATOM   2510 C  CB    . ALA B 2 134 ? 1.49900   38.76000 37.96100  1.000 71.19579  ? 829  ALA A CB    1 
ATOM   2511 N  N     . LYS B 2 135 ? 4.62600   39.36900 39.93600  1.000 77.84464  ? 830  LYS A N     1 
ATOM   2512 C  CA    . LYS B 2 135 ? 5.23400   38.77300 41.12300  1.000 77.46304  ? 830  LYS A CA    1 
ATOM   2513 C  C     . LYS B 2 135 ? 5.06000   39.60900 42.38800  1.000 79.30781  ? 830  LYS A C     1 
ATOM   2514 O  O     . LYS B 2 135 ? 5.23900   39.07900 43.50100  1.000 74.88982  ? 830  LYS A O     1 
ATOM   2515 C  CB    . LYS B 2 135 ? 6.71100   38.48600 40.89900  1.000 72.38872  ? 830  LYS A CB    1 
ATOM   2516 C  CG    . LYS B 2 135 ? 7.28200   37.57700 41.96800  1.000 75.14634  ? 830  LYS A CG    1 
ATOM   2517 C  CD    . LYS B 2 135 ? 7.25000   36.11600 41.53600  1.000 78.91637  ? 830  LYS A CD    1 
ATOM   2518 C  CE    . LYS B 2 135 ? 7.89800   35.91100 40.16700  1.000 83.05568  ? 830  LYS A CE    1 
ATOM   2519 N  NZ    . LYS B 2 135 ? 8.55600   34.57300 40.08000  1.000 83.80537  ? 830  LYS A NZ    1 
ATOM   2520 N  N     . GLU B 2 136 ? 4.67800   40.88600 42.26300  1.000 93.30848  ? 831  GLU A N     1 
ATOM   2521 C  CA    . GLU B 2 136 ? 4.22400   41.58600 43.45000  1.000 95.25892  ? 831  GLU A CA    1 
ATOM   2522 C  C     . GLU B 2 136 ? 2.76800   41.26800 43.77300  1.000 95.73760  ? 831  GLU A C     1 
ATOM   2523 O  O     . GLU B 2 136 ? 2.33700   41.46100 44.91500  1.000 101.48317 ? 831  GLU A O     1 
ATOM   2524 C  CB    . GLU B 2 136 ? 4.44300   43.08500 43.28300  1.000 102.38281 ? 831  GLU A CB    1 
ATOM   2525 C  CG    . GLU B 2 136 ? 4.13500   43.67100 41.90700  1.000 109.01284 ? 831  GLU A CG    1 
ATOM   2526 C  CD    . GLU B 2 136 ? 4.04800   45.19600 41.92000  1.000 113.76049 ? 831  GLU A CD    1 
ATOM   2527 O  OE1   . GLU B 2 136 ? 4.25300   45.78700 42.99700  1.000 116.07880 ? 831  GLU A OE1   1 
ATOM   2528 O  OE2   . GLU B 2 136 ? 3.76600   45.80600 40.86200  1.000 114.52951 ? 831  GLU A OE2   1 
ATOM   2529 N  N     . LEU B 2 137 ? 2.00600   40.76100 42.80200  1.000 68.26985  ? 832  LEU A N     1 
ATOM   2530 C  CA    . LEU B 2 137 ? 0.64800   40.30000 43.08000  1.000 59.19535  ? 832  LEU A CA    1 
ATOM   2531 C  C     . LEU B 2 137 ? 0.64100   38.94300 43.77300  1.000 58.31768  ? 832  LEU A C     1 
ATOM   2532 O  O     . LEU B 2 137 ? -0.28800  38.64400 44.52700  1.000 57.11678  ? 832  LEU A O     1 
ATOM   2533 C  CB    . LEU B 2 137 ? -0.16600  40.22000 41.78800  1.000 53.26881  ? 832  LEU A CB    1 
ATOM   2534 C  CG    . LEU B 2 137 ? -1.65600  40.52000 41.93800  1.000 65.67852  ? 832  LEU A CG    1 
ATOM   2535 C  CD1   . LEU B 2 137 ? -1.89700  41.53800 43.06000  1.000 74.35426  ? 832  LEU A CD1   1 
ATOM   2536 C  CD2   . LEU B 2 137 ? -2.23800  41.00500 40.62300  1.000 65.85295  ? 832  LEU A CD2   1 
ATOM   2537 N  N     . LEU B 2 138 ? 1.65400   38.11100 43.51600  1.000 59.65203  ? 833  LEU A N     1 
ATOM   2538 C  CA    . LEU B 2 138 ? 1.78800   36.84800 44.23300  1.000 56.25224  ? 833  LEU A CA    1 
ATOM   2539 C  C     . LEU B 2 138 ? 2.13100   37.08600 45.69500  1.000 60.09845  ? 833  LEU A C     1 
ATOM   2540 O  O     . LEU B 2 138 ? 1.74400   36.30500 46.57100  1.000 61.93435  ? 833  LEU A O     1 
ATOM   2541 C  CB    . LEU B 2 138 ? 2.86600   35.98400 43.57900  1.000 54.27400  ? 833  LEU A CB    1 
ATOM   2542 C  CG    . LEU B 2 138 ? 2.37700   34.91200 42.62100  1.000 48.86460  ? 833  LEU A CG    1 
ATOM   2543 C  CD1   . LEU B 2 138 ? 3.46200   33.89500 42.32500  1.000 38.40925  ? 833  LEU A CD1   1 
ATOM   2544 C  CD2   . LEU B 2 138 ? 1.18500   34.25200 43.25900  1.000 55.40734  ? 833  LEU A CD2   1 
ATOM   2545 N  N     . ASP B 2 139 ? 2.88200   38.15100 45.97300  1.000 81.53396  ? 834  ASP A N     1 
ATOM   2546 C  CA    . ASP B 2 139 ? 3.22500   38.46600 47.34900  1.000 84.32732  ? 834  ASP A CA    1 
ATOM   2547 C  C     . ASP B 2 139 ? 2.00700   38.94900 48.11600  1.000 82.57180  ? 834  ASP A C     1 
ATOM   2548 O  O     . ASP B 2 139 ? 1.88800   38.66900 49.31200  1.000 91.73656  ? 834  ASP A O     1 
ATOM   2549 C  CB    . ASP B 2 139 ? 4.34200   39.51200 47.38900  1.000 91.23770  ? 834  ASP A CB    1 
ATOM   2550 C  CG    . ASP B 2 139 ? 5.57100   39.10400 46.57200  1.000 92.76567  ? 834  ASP A CG    1 
ATOM   2551 O  OD1   . ASP B 2 139 ? 5.66200   37.92800 46.14700  1.000 92.44805  ? 834  ASP A OD1   1 
ATOM   2552 O  OD2   . ASP B 2 139 ? 6.44100   39.97300 46.34700  1.000 94.83690  ? 834  ASP A OD2   1 
ATOM   2553 N  N     . SER B 2 140 ? 1.08900   39.66400 47.45200  1.000 68.61523  ? 835  SER A N     1 
ATOM   2554 C  CA    . SER B 2 140 ? -0.15200  40.07300 48.10700  1.000 64.59300  ? 835  SER A CA    1 
ATOM   2555 C  C     . SER B 2 140 ? -1.07000  38.89600 48.37500  1.000 65.84067  ? 835  SER A C     1 
ATOM   2556 O  O     . SER B 2 140 ? -1.95500  39.00200 49.22900  1.000 75.25466  ? 835  SER A O     1 
ATOM   2557 C  CB    . SER B 2 140 ? -0.93400  41.07900 47.26100  1.000 63.47246  ? 835  SER A CB    1 
ATOM   2558 O  OG    . SER B 2 140 ? -1.71600  40.38800 46.29100  1.000 61.65497  ? 835  SER A OG    1 
ATOM   2559 N  N     . PHE B 2 141 ? -0.92400  37.80500 47.62500  1.000 58.64801  ? 836  PHE A N     1 
ATOM   2560 C  CA    . PHE B 2 141 ? -1.73600  36.61900 47.85100  1.000 59.67589  ? 836  PHE A CA    1 
ATOM   2561 C  C     . PHE B 2 141 ? -1.37900  35.91700 49.15000  1.000 63.52686  ? 836  PHE A C     1 
ATOM   2562 O  O     . PHE B 2 141 ? -2.12800  35.04000 49.59300  1.000 67.32721  ? 836  PHE A O     1 
ATOM   2563 C  CB    . PHE B 2 141 ? -1.59400  35.63800 46.68200  1.000 55.56551  ? 836  PHE A CB    1 
ATOM   2564 C  CG    . PHE B 2 141 ? -2.67100  35.76900 45.65000  1.000 53.62168  ? 836  PHE A CG    1 
ATOM   2565 C  CD1   . PHE B 2 141 ? -3.11700  37.02200 45.25900  1.000 54.35814  ? 836  PHE A CD1   1 
ATOM   2566 C  CD2   . PHE B 2 141 ? -3.24600  34.64400 45.07500  1.000 52.79749  ? 836  PHE A CD2   1 
ATOM   2567 C  CE1   . PHE B 2 141 ? -4.11400  37.15200 44.31800  1.000 54.44983  ? 836  PHE A CE1   1 
ATOM   2568 C  CE2   . PHE B 2 141 ? -4.24800  34.76600 44.12800  1.000 52.96528  ? 836  PHE A CE2   1 
ATOM   2569 C  CZ    . PHE B 2 141 ? -4.67500  36.02500 43.74600  1.000 55.49341  ? 836  PHE A CZ    1 
ATOM   2570 N  N     . ASP B 2 142 ? -0.26000  36.27600 49.76600  1.000 76.70133  ? 837  ASP A N     1 
ATOM   2571 C  CA    . ASP B 2 142 ? 0.16700   35.65700 51.00700  1.000 83.10006  ? 837  ASP A CA    1 
ATOM   2572 C  C     . ASP B 2 142 ? 0.00100   36.59000 52.20100  1.000 80.96324  ? 837  ASP A C     1 
ATOM   2573 O  O     . ASP B 2 142 ? 0.48900   36.28100 53.29100  1.000 82.20969  ? 837  ASP A O     1 
ATOM   2574 C  CB    . ASP B 2 142 ? 1.60900   35.16800 50.86700  1.000 91.07282  ? 837  ASP A CB    1 
ATOM   2575 C  CG    . ASP B 2 142 ? 1.76200   34.15000 49.74300  1.000 97.99508  ? 837  ASP A CG    1 
ATOM   2576 O  OD1   . ASP B 2 142 ? 2.55500   34.41300 48.80500  1.000 104.58710 ? 837  ASP A OD1   1 
ATOM   2577 O  OD2   . ASP B 2 142 ? 1.08200   33.09800 49.78800  1.000 94.41360  ? 837  ASP A OD2   1 
ATOM   2578 N  N     . THR B 2 143 ? -0.68900  37.72100 52.02500  1.000 58.60387  ? 838  THR A N     1 
ATOM   2579 C  CA    . THR B 2 143 ? -1.18900  38.45500 53.18200  1.000 58.65649  ? 838  THR A CA    1 
ATOM   2580 C  C     . THR B 2 143 ? -2.36300  37.74800 53.84300  1.000 56.85445  ? 838  THR A C     1 
ATOM   2581 O  O     . THR B 2 143 ? -2.81100  38.18700 54.90500  1.000 56.37124  ? 838  THR A O     1 
ATOM   2582 C  CB    . THR B 2 143 ? -1.60100  39.88900 52.80400  1.000 56.70150  ? 838  THR A CB    1 
ATOM   2583 O  OG1   . THR B 2 143 ? -2.61500  39.87200 51.78300  1.000 51.71057  ? 838  THR A OG1   1 
ATOM   2584 C  CG2   . THR B 2 143 ? -0.37800  40.67900 52.32200  1.000 60.54788  ? 838  THR A CG2   1 
ATOM   2585 N  N     . VAL B 2 144 ? -2.87200  36.68100 53.23600  1.000 60.97930  ? 839  VAL A N     1 
ATOM   2586 C  CA    . VAL B 2 144 ? -3.92500  35.86000 53.82200  1.000 60.12428  ? 839  VAL A CA    1 
ATOM   2587 C  C     . VAL B 2 144 ? -3.33600  34.46700 54.03100  1.000 62.54113  ? 839  VAL A C     1 
ATOM   2588 O  O     . VAL B 2 144 ? -2.28000  34.16200 53.45900  1.000 63.37695  ? 839  VAL A O     1 
ATOM   2589 C  CB    . VAL B 2 144 ? -5.18200  35.85400 52.93600  1.000 61.04453  ? 839  VAL A CB    1 
ATOM   2590 C  CG1   . VAL B 2 144 ? -5.74600  37.26900 52.83200  1.000 63.98555  ? 839  VAL A CG1   1 
ATOM   2591 C  CG2   . VAL B 2 144 ? -4.87800  35.27500 51.55900  1.000 62.47268  ? 839  VAL A CG2   1 
ATOM   2592 N  N     . PRO B 2 145 ? -3.94400  33.61200 54.86200  1.000 69.70315  ? 840  PRO A N     1 
ATOM   2593 C  CA    . PRO B 2 145 ? -3.36800  32.28000 55.10900  1.000 66.17696  ? 840  PRO A CA    1 
ATOM   2594 C  C     . PRO B 2 145 ? -3.04700  31.54000 53.81800  1.000 62.77571  ? 840  PRO A C     1 
ATOM   2595 O  O     . PRO B 2 145 ? -3.66100  31.76900 52.77800  1.000 71.06803  ? 840  PRO A O     1 
ATOM   2596 C  CB    . PRO B 2 145 ? -4.47300  31.56500 55.89200  1.000 68.60514  ? 840  PRO A CB    1 
ATOM   2597 C  CG    . PRO B 2 145 ? -5.22900  32.66000 56.56300  1.000 66.93340  ? 840  PRO A CG    1 
ATOM   2598 C  CD    . PRO B 2 145 ? -5.15100  33.85600 55.67900  1.000 69.35468  ? 840  PRO A CD    1 
ATOM   2599 N  N     . GLY B 2 146 ? -2.07400  30.63700 53.89200  1.000 48.45413  ? 841  GLY A N     1 
ATOM   2600 C  CA    . GLY B 2 146 ? -1.61600  29.97500 52.68200  1.000 46.16193  ? 841  GLY A CA    1 
ATOM   2601 C  C     . GLY B 2 146 ? -2.70200  29.16700 51.99800  1.000 43.04223  ? 841  GLY A C     1 
ATOM   2602 O  O     . GLY B 2 146 ? -2.77700  29.12600 50.76400  1.000 41.13671  ? 841  GLY A O     1 
ATOM   2603 N  N     . HIS B 2 147 ? -3.56600  28.52500 52.78700  1.000 49.35570  ? 842  HIS A N     1 
ATOM   2604 C  CA    . HIS B 2 147 ? -4.48000  27.51600 52.26300  1.000 51.26745  ? 842  HIS A CA    1 
ATOM   2605 C  C     . HIS B 2 147 ? -5.71600  28.11300 51.61300  1.000 52.71013  ? 842  HIS A C     1 
ATOM   2606 O  O     . HIS B 2 147 ? -6.44500  27.39500 50.92300  1.000 55.51903  ? 842  HIS A O     1 
ATOM   2607 C  CB    . HIS B 2 147 ? -4.91400  26.56800 53.38300  1.000 54.37613  ? 842  HIS A CB    1 
ATOM   2608 C  CG    . HIS B 2 147 ? -5.74800  27.22800 54.43700  1.000 60.22092  ? 842  HIS A CG    1 
ATOM   2609 N  ND1   . HIS B 2 147 ? -5.20300  27.95300 55.47600  1.000 62.22049  ? 842  HIS A ND1   1 
ATOM   2610 C  CD2   . HIS B 2 147 ? -7.09000  27.27700 54.61100  1.000 61.60777  ? 842  HIS A CD2   1 
ATOM   2611 C  CE1   . HIS B 2 147 ? -6.17200  28.41700 56.24400  1.000 61.08969  ? 842  HIS A CE1   1 
ATOM   2612 N  NE2   . HIS B 2 147 ? -7.32700  28.02000 55.74100  1.000 61.39411  ? 842  HIS A NE2   1 
ATOM   2613 N  N     . LEU B 2 148 ? -5.97700  29.40000 51.82300  1.000 44.38322  ? 843  LEU A N     1 
ATOM   2614 C  CA    . LEU B 2 148 ? -7.17800  30.00500 51.26100  1.000 46.99881  ? 843  LEU A CA    1 
ATOM   2615 C  C     . LEU B 2 148 ? -7.08200  30.12100 49.74500  1.000 53.17673  ? 843  LEU A C     1 
ATOM   2616 O  O     . LEU B 2 148 ? -8.10200  30.07900 49.04500  1.000 54.76503  ? 843  LEU A O     1 
ATOM   2617 C  CB    . LEU B 2 148 ? -7.41400  31.37800 51.89800  1.000 47.05553  ? 843  LEU A CB    1 
ATOM   2618 C  CG    . LEU B 2 148 ? -8.00300  31.35500 53.31800  1.000 42.14381  ? 843  LEU A CG    1 
ATOM   2619 C  CD1   . LEU B 2 148 ? -8.32300  32.75400 53.82700  1.000 41.26660  ? 843  LEU A CD1   1 
ATOM   2620 C  CD2   . LEU B 2 148 ? -9.24300  30.49800 53.31100  1.000 37.19565  ? 843  LEU A CD2   1 
ATOM   2621 N  N     . THR B 2 149 ? -5.87100  30.24200 49.21500  1.000 58.00166  ? 844  THR A N     1 
ATOM   2622 C  CA    . THR B 2 149 ? -5.68500  30.42600 47.78900  1.000 54.88168  ? 844  THR A CA    1 
ATOM   2623 C  C     . THR B 2 149 ? -5.06100  29.22200 47.09900  1.000 56.44320  ? 844  THR A C     1 
ATOM   2624 O  O     . THR B 2 149 ? -4.95300  29.22700 45.86400  1.000 60.65585  ? 844  THR A O     1 
ATOM   2625 C  CB    . THR B 2 149 ? -4.82600  31.66900 47.53600  1.000 54.48455  ? 844  THR A CB    1 
ATOM   2626 O  OG1   . THR B 2 149 ? -3.51100  31.43400 48.06900  1.000 61.60952  ? 844  THR A OG1   1 
ATOM   2627 C  CG2   . THR B 2 149 ? -5.43800  32.88800 48.20200  1.000 54.02863  ? 844  THR A CG2   1 
ATOM   2628 N  N     . GLU B 2 150 ? -4.64700  28.19400 47.84400  1.000 58.29997  ? 845  GLU A N     1 
ATOM   2629 C  CA    . GLU B 2 150 ? -4.19900  26.98700 47.17500  1.000 61.20444  ? 845  GLU A CA    1 
ATOM   2630 C  C     . GLU B 2 150 ? -5.17600  25.82900 47.30400  1.000 67.26670  ? 845  GLU A C     1 
ATOM   2631 O  O     . GLU B 2 150 ? -5.12000  24.88800 46.49100  1.000 68.40025  ? 845  GLU A O     1 
ATOM   2632 C  CB    . GLU B 2 150 ? -2.82500  26.57500 47.67600  1.000 64.20761  ? 845  GLU A CB    1 
ATOM   2633 C  CG    . GLU B 2 150 ? -1.88600  27.75600 47.77600  1.000 72.28867  ? 845  GLU A CG    1 
ATOM   2634 C  CD    . GLU B 2 150 ? -0.61800  27.58700 46.94900  1.000 72.13863  ? 845  GLU A CD    1 
ATOM   2635 O  OE1   . GLU B 2 150 ? -0.47200  26.54400 46.26400  1.000 70.04176  ? 845  GLU A OE1   1 
ATOM   2636 O  OE2   . GLU B 2 150 ? 0.21500   28.52600 46.98100  1.000 75.19592  ? 845  GLU A OE2   1 
ATOM   2637 N  N     . ASP B 2 151 ? -6.10500  25.88900 48.26500  1.000 83.10536  ? 846  ASP A N     1 
ATOM   2638 C  CA    . ASP B 2 151 ? -7.18600  24.91700 48.33000  1.000 80.95191  ? 846  ASP A CA    1 
ATOM   2639 C  C     . ASP B 2 151 ? -8.51800  25.64600 48.40300  1.000 76.39808  ? 846  ASP A C     1 
ATOM   2640 O  O     . ASP B 2 151 ? -8.58000  26.84900 48.66000  1.000 82.79651  ? 846  ASP A O     1 
ATOM   2641 C  CB    . ASP B 2 151 ? -7.00400  23.97300 49.51600  1.000 83.06383  ? 846  ASP A CB    1 
ATOM   2642 C  CG    . ASP B 2 151 ? -6.56200  22.59700 49.09200  1.000 86.82188  ? 846  ASP A CG    1 
ATOM   2643 O  OD1   . ASP B 2 151 ? -6.93100  22.17700 47.97900  1.000 89.68483  ? 846  ASP A OD1   1 
ATOM   2644 O  OD2   . ASP B 2 151 ? -5.80700  21.95600 49.86200  1.000 87.32779  ? 846  ASP A OD2   1 
ATOM   2645 N  N     . LEU B 2 152 ? -9.59200  24.90300 48.16400  1.000 61.65553  ? 847  LEU A N     1 
ATOM   2646 C  CA    . LEU B 2 152 ? -10.92100 25.48900 48.05300  1.000 66.06691  ? 847  LEU A CA    1 
ATOM   2647 C  C     . LEU B 2 152 ? -11.85100 25.14200 49.19400  1.000 72.88040  ? 847  LEU A C     1 
ATOM   2648 O  O     . LEU B 2 152 ? -12.75500 25.93000 49.49500  1.000 78.81900  ? 847  LEU A O     1 
ATOM   2649 C  CB    . LEU B 2 152 ? -11.60800 25.05400 46.74900  1.000 68.32460  ? 847  LEU A CB    1 
ATOM   2650 C  CG    . LEU B 2 152 ? -10.76300 25.14900 45.46700  1.000 68.57184  ? 847  LEU A CG    1 
ATOM   2651 C  CD1   . LEU B 2 152 ? -10.04800 23.83500 45.15700  1.000 67.34957  ? 847  LEU A CD1   1 
ATOM   2652 C  CD2   . LEU B 2 152 ? -11.61500 25.59300 44.30100  1.000 68.99521  ? 847  LEU A CD2   1 
ATOM   2653 N  N     . HIS B 2 153 ? -11.66400 23.98900 49.83300  1.000 65.26515  ? 848  HIS A N     1 
ATOM   2654 C  CA    . HIS B 2 153 ? -12.64800 23.46500 50.77200  1.000 65.66950  ? 848  HIS A CA    1 
ATOM   2655 C  C     . HIS B 2 153 ? -12.10700 23.30000 52.18600  1.000 63.35049  ? 848  HIS A C     1 
ATOM   2656 O  O     . HIS B 2 153 ? -12.81800 22.79800 53.05700  1.000 59.59526  ? 848  HIS A O     1 
ATOM   2657 C  CB    . HIS B 2 153 ? -13.19400 22.13800 50.25100  1.000 63.70598  ? 848  HIS A CB    1 
ATOM   2658 C  CG    . HIS B 2 153 ? -14.04600 22.29000 49.03300  1.000 61.43111  ? 848  HIS A CG    1 
ATOM   2659 N  ND1   . HIS B 2 153 ? -15.20900 23.03600 49.03100  1.000 55.92802  ? 848  HIS A ND1   1 
ATOM   2660 C  CD2   . HIS B 2 153 ? -13.89500 21.82200 47.77300  1.000 56.36509  ? 848  HIS A CD2   1 
ATOM   2661 C  CE1   . HIS B 2 153 ? -15.74600 23.00200 47.82800  1.000 56.34518  ? 848  HIS A CE1   1 
ATOM   2662 N  NE2   . HIS B 2 153 ? -14.96700 22.27500 47.04400  1.000 59.71056  ? 848  HIS A NE2   1 
ATOM   2663 N  N     . LEU B 2 154 ? -10.87800 23.72000 52.44500  1.000 67.15073  ? 849  LEU A N     1 
ATOM   2664 C  CA    . LEU B 2 154 ? -10.29400 23.59700 53.76900  1.000 58.02496  ? 849  LEU A CA    1 
ATOM   2665 C  C     . LEU B 2 154 ? -10.43000 24.92100 54.49600  1.000 52.65824  ? 849  LEU A C     1 
ATOM   2666 O  O     . LEU B 2 154 ? -10.03000 25.96600 53.97700  1.000 55.82121  ? 849  LEU A O     1 
ATOM   2667 C  CB    . LEU B 2 154 ? -8.82900  23.17600 53.67800  1.000 57.23227  ? 849  LEU A CB    1 
ATOM   2668 C  CG    . LEU B 2 154 ? -8.74700  21.67900 53.40800  1.000 59.28207  ? 849  LEU A CG    1 
ATOM   2669 C  CD1   . LEU B 2 154 ? -7.32700  21.23400 53.10000  1.000 56.58422  ? 849  LEU A CD1   1 
ATOM   2670 C  CD2   . LEU B 2 154 ? -9.32500  20.92500 54.60300  1.000 59.15410  ? 849  LEU A CD2   1 
ATOM   2671 N  N     . TYR B 2 155 ? -11.00800 24.87800 55.68400  1.000 44.02158  ? 850  TYR A N     1 
ATOM   2672 C  CA    . TYR B 2 155 ? -11.07300 26.04000 56.55100  1.000 41.99109  ? 850  TYR A CA    1 
ATOM   2673 C  C     . TYR B 2 155 ? -10.48600 25.68800 57.91100  1.000 42.40465  ? 850  TYR A C     1 
ATOM   2674 O  O     . TYR B 2 155 ? -10.48000 24.52200 58.32300  1.000 39.51721  ? 850  TYR A O     1 
ATOM   2675 C  CB    . TYR B 2 155 ? -12.51800 26.55300 56.71300  1.000 36.48595  ? 850  TYR A CB    1 
ATOM   2676 C  CG    . TYR B 2 155 ? -13.18000 27.05400 55.43400  1.000 39.50359  ? 850  TYR A CG    1 
ATOM   2677 C  CD1   . TYR B 2 155 ? -13.70100 26.15500 54.49400  1.000 36.99539  ? 850  TYR A CD1   1 
ATOM   2678 C  CD2   . TYR B 2 155 ? -13.30900 28.42300 55.17800  1.000 41.35769  ? 850  TYR A CD2   1 
ATOM   2679 C  CE1   . TYR B 2 155 ? -14.31200 26.59800 53.33800  1.000 32.23794  ? 850  TYR A CE1   1 
ATOM   2680 C  CE2   . TYR B 2 155 ? -13.92200 28.88000 54.01600  1.000 41.59816  ? 850  TYR A CE2   1 
ATOM   2681 C  CZ    . TYR B 2 155 ? -14.42000 27.96100 53.10400  1.000 42.45866  ? 850  TYR A CZ    1 
ATOM   2682 O  OH    . TYR B 2 155 ? -15.02500 28.40300 51.95200  1.000 50.63881  ? 850  TYR A OH    1 
ATOM   2683 N  N     . SER B 2 156 ? -9.95200  26.70100 58.58100  1.000 48.45879  ? 851  SER A N     1 
ATOM   2684 C  CA    . SER B 2 156 ? -9.65800  26.61700 59.99900  1.000 52.10070  ? 851  SER A CA    1 
ATOM   2685 C  C     . SER B 2 156 ? -10.80400 27.26000 60.76800  1.000 50.58287  ? 851  SER A C     1 
ATOM   2686 O  O     . SER B 2 156 ? -11.65300 27.95100 60.19300  1.000 49.08300  ? 851  SER A O     1 
ATOM   2687 C  CB    . SER B 2 156 ? -8.33900  27.31700 60.33600  1.000 50.98301  ? 851  SER A CB    1 
ATOM   2688 O  OG    . SER B 2 156 ? -8.37900  28.67600 59.95400  1.000 53.59465  ? 851  SER A OG    1 
ATOM   2689 N  N     . LEU B 2 157 ? -10.81500 27.02900 62.08800  1.000 41.11416  ? 852  LEU A N     1 
ATOM   2690 C  CA    . LEU B 2 157 ? -11.80400 27.67600 62.94500  1.000 38.60849  ? 852  LEU A CA    1 
ATOM   2691 C  C     . LEU B 2 157 ? -11.71900 29.19800 62.84000  1.000 41.90751  ? 852  LEU A C     1 
ATOM   2692 O  O     . LEU B 2 157 ? -12.74000 29.89500 62.92300  1.000 47.77043  ? 852  LEU A O     1 
ATOM   2693 C  CB    . LEU B 2 157 ? -11.61200 27.22100 64.39300  1.000 40.69663  ? 852  LEU A CB    1 
ATOM   2694 C  CG    . LEU B 2 157 ? -11.98200 25.77100 64.71700  1.000 35.95594  ? 852  LEU A CG    1 
ATOM   2695 C  CD1   . LEU B 2 157 ? -11.23300 25.27000 65.95100  1.000 34.07833  ? 852  LEU A CD1   1 
ATOM   2696 C  CD2   . LEU B 2 157 ? -13.45600 25.66900 64.92300  1.000 35.67219  ? 852  LEU A CD2   1 
ATOM   2697 N  N     . ASN B 2 158 ? -10.50900 29.72700 62.64600  1.000 45.98170  ? 853  ASN A N     1 
ATOM   2698 C  CA    . ASN B 2 158 ? -10.32200 31.16300 62.43900  1.000 47.00955  ? 853  ASN A CA    1 
ATOM   2699 C  C     . ASN B 2 158 ? -11.07600 31.64700 61.20300  1.000 50.97096  ? 853  ASN A C     1 
ATOM   2700 O  O     . ASN B 2 158 ? -11.76000 32.68100 61.23600  1.000 48.31681  ? 853  ASN A O     1 
ATOM   2701 C  CB    . ASN B 2 158 ? -8.82500  31.46700 62.30700  1.000 42.34031  ? 853  ASN A CB    1 
ATOM   2702 C  CG    . ASN B 2 158 ? -8.52500  32.95000 62.31600  1.000 52.93809  ? 853  ASN A CG    1 
ATOM   2703 O  OD1   . ASN B 2 158 ? -9.38300  33.77400 62.63200  1.000 61.43857  ? 853  ASN A OD1   1 
ATOM   2704 N  ND2   . ASN B 2 158 ? -7.29500  33.29700 61.99200  1.000 59.19737  ? 853  ASN A ND2   1 
ATOM   2705 N  N     . ASP B 2 159 ? -10.94800 30.90900 60.09400  1.000 49.21941  ? 854  ASP A N     1 
ATOM   2706 C  CA    . ASP B 2 159 ? -11.59700 31.31200 58.85300  1.000 50.80943  ? 854  ASP A CA    1 
ATOM   2707 C  C     . ASP B 2 159 ? -13.11100 31.21600 58.98100  1.000 49.95894  ? 854  ASP A C     1 
ATOM   2708 O  O     . ASP B 2 159 ? -13.84500 32.08600 58.48900  1.000 48.32737  ? 854  ASP A O     1 
ATOM   2709 C  CB    . ASP B 2 159 ? -11.10900 30.44400 57.68300  1.000 59.81472  ? 854  ASP A CB    1 
ATOM   2710 C  CG    . ASP B 2 159 ? -9.57800  30.30400 57.62500  1.000 61.69476  ? 854  ASP A CG    1 
ATOM   2711 O  OD1   . ASP B 2 159 ? -8.85700  31.31300 57.85400  1.000 63.90170  ? 854  ASP A OD1   1 
ATOM   2712 O  OD2   . ASP B 2 159 ? -9.10100  29.17200 57.34000  1.000 54.26595  ? 854  ASP A OD2   1 
ATOM   2713 N  N     . LEU B 2 160 ? -13.59600 30.16100 59.63400  1.000 44.94406  ? 855  LEU A N     1 
ATOM   2714 C  CA    . LEU B 2 160 ? -15.03600 30.00700 59.78200  1.000 46.67069  ? 855  LEU A CA    1 
ATOM   2715 C  C     . LEU B 2 160 ? -15.61800 31.14600 60.60300  1.000 44.77678  ? 855  LEU A C     1 
ATOM   2716 O  O     . LEU B 2 160 ? -16.66100 31.70500 60.24600  1.000 46.44384  ? 855  LEU A O     1 
ATOM   2717 C  CB    . LEU B 2 160 ? -15.34800 28.64200 60.38600  1.000 42.04094  ? 855  LEU A CB    1 
ATOM   2718 C  CG    . LEU B 2 160 ? -14.84000 27.58400 59.40400  1.000 37.26102  ? 855  LEU A CG    1 
ATOM   2719 C  CD1   . LEU B 2 160 ? -14.92900 26.16600 59.95100  1.000 33.45340  ? 855  LEU A CD1   1 
ATOM   2720 C  CD2   . LEU B 2 160 ? -15.62400 27.70200 58.11100  1.000 38.38837  ? 855  LEU A CD2   1 
ATOM   2721 N  N     . THR B 2 161 ? -14.93200 31.54200 61.67300  1.000 39.05612  ? 856  THR A N     1 
ATOM   2722 C  CA    . THR B 2 161 ? -15.41400 32.66700 62.46600  1.000 43.26253  ? 856  THR A CA    1 
ATOM   2723 C  C     . THR B 2 161 ? -15.30200 33.96900 61.68200  1.000 47.57278  ? 856  THR A C     1 
ATOM   2724 O  O     . THR B 2 161 ? -16.28500 34.70900 61.55200  1.000 43.91862  ? 856  THR A O     1 
ATOM   2725 C  CB    . THR B 2 161 ? -14.64400 32.75400 63.78700  1.000 42.62622  ? 856  THR A CB    1 
ATOM   2726 O  OG1   . THR B 2 161 ? -14.87200 31.56000 64.54100  1.000 42.70023  ? 856  THR A OG1   1 
ATOM   2727 C  CG2   . THR B 2 161 ? -15.10100 33.96700 64.60700  1.000 40.62283  ? 856  THR A CG2   1 
ATOM   2728 N  N     . ALA B 2 162 ? -14.10700 34.25600 61.14100  1.000 59.65321  ? 857  ALA A N     1 
ATOM   2729 C  CA    . ALA B 2 162 ? -13.89600 35.45300 60.32800  1.000 56.55167  ? 857  ALA A CA    1 
ATOM   2730 C  C     . ALA B 2 162 ? -14.91200 35.56800 59.19100  1.000 52.31465  ? 857  ALA A C     1 
ATOM   2731 O  O     . ALA B 2 162 ? -15.29000 36.68200 58.81100  1.000 51.72158  ? 857  ALA A O     1 
ATOM   2732 C  CB    . ALA B 2 162 ? -12.46800 35.44700 59.76900  1.000 58.07427  ? 857  ALA A CB    1 
ATOM   2733 N  N     . THR B 2 163 ? -15.37100 34.43000 58.64700  1.000 44.66504  ? 858  THR A N     1 
ATOM   2734 C  CA    . THR B 2 163 ? -16.47300 34.42900 57.68400  1.000 43.35811  ? 858  THR A CA    1 
ATOM   2735 C  C     . THR B 2 163 ? -17.79800 34.85500 58.32600  1.000 51.35260  ? 858  THR A C     1 
ATOM   2736 O  O     . THR B 2 163 ? -18.55000 35.64200 57.73400  1.000 50.53364  ? 858  THR A O     1 
ATOM   2737 C  CB    . THR B 2 163 ? -16.61300 33.04100 57.06100  1.000 41.30729  ? 858  THR A CB    1 
ATOM   2738 O  OG1   . THR B 2 163 ? -15.34700 32.62500 56.54000  1.000 45.65318  ? 858  THR A OG1   1 
ATOM   2739 C  CG2   . THR B 2 163 ? -17.61100 33.05900 55.94500  1.000 43.08757  ? 858  THR A CG2   1 
ATOM   2740 N  N     . ARG B 2 164 ? -18.11900 34.33700 59.52500  1.000 63.70355  ? 859  ARG A N     1 
ATOM   2741 C  CA    . ARG B 2 164 ? -19.36700 34.74700 60.17100  1.000 63.91850  ? 859  ARG A CA    1 
ATOM   2742 C  C     . ARG B 2 164 ? -19.31000 36.21400 60.57500  1.000 64.29985  ? 859  ARG A C     1 
ATOM   2743 O  O     . ARG B 2 164 ? -20.28300 36.95000 60.38800  1.000 74.71309  ? 859  ARG A O     1 
ATOM   2744 C  CB    . ARG B 2 164 ? -19.69000 33.88100 61.39300  1.000 67.21197  ? 859  ARG A CB    1 
ATOM   2745 C  CG    . ARG B 2 164 ? -21.00500 34.31300 62.09400  1.000 72.94611  ? 859  ARG A CG    1 
ATOM   2746 C  CD    . ARG B 2 164 ? -21.09800 33.98300 63.59400  1.000 73.08285  ? 859  ARG A CD    1 
ATOM   2747 N  NE    . ARG B 2 164 ? -19.79800 33.91400 64.26500  1.000 76.73933  ? 859  ARG A NE    1 
ATOM   2748 C  CZ    . ARG B 2 164 ? -19.37300 34.77900 65.18600  1.000 75.80162  ? 859  ARG A CZ    1 
ATOM   2749 N  NH1   . ARG B 2 164 ? -20.13600 35.80500 65.54400  1.000 76.90505  ? 859  ARG A NH1   1 
ATOM   2750 N  NH2   . ARG B 2 164 ? -18.17700 34.62000 65.74800  1.000 70.58244  ? 859  ARG A NH2   1 
ATOM   2751 N  N     . LYS B 2 165 ? -18.17700 36.66900 61.11400  1.000 57.84160  ? 860  LYS A N     1 
ATOM   2752 C  CA    . LYS B 2 165 ? -18.02900 38.10200 61.34400  1.000 65.80946  ? 860  LYS A CA    1 
ATOM   2753 C  C     . LYS B 2 165 ? -18.01500 38.90300 60.04100  1.000 78.83779  ? 860  LYS A C     1 
ATOM   2754 O  O     . LYS B 2 165 ? -17.96700 40.13700 60.10000  1.000 86.28096  ? 860  LYS A O     1 
ATOM   2755 C  CB    . LYS B 2 165 ? -16.76200 38.38500 62.15700  1.000 67.35309  ? 860  LYS A CB    1 
ATOM   2756 C  CG    . LYS B 2 165 ? -16.92100 38.11600 63.66200  1.000 71.99331  ? 860  LYS A CG    1 
ATOM   2757 C  CD    . LYS B 2 165 ? -15.72300 38.58700 64.50400  1.000 75.20097  ? 860  LYS A CD    1 
ATOM   2758 C  CE    . LYS B 2 165 ? -15.97000 38.33300 66.00100  1.000 77.46540  ? 860  LYS A CE    1 
ATOM   2759 N  NZ    . LYS B 2 165 ? -14.91300 38.91100 66.89000  1.000 79.43703  ? 860  LYS A NZ    1 
ATOM   2760 N  N     . GLY B 2 166 ? -18.07000 38.23600 58.88200  1.000 78.30420  ? 861  GLY A N     1 
ATOM   2761 C  CA    . GLY B 2 166 ? -18.18600 38.89700 57.59500  1.000 74.89418  ? 861  GLY A CA    1 
ATOM   2762 C  C     . GLY B 2 166 ? -16.96900 39.67500 57.15600  1.000 70.92311  ? 861  GLY A C     1 
ATOM   2763 O  O     . GLY B 2 166 ? -17.09900 40.58700 56.33900  1.000 69.86164  ? 861  GLY A O     1 
ATOM   2764 N  N     . GLU B 2 167 ? -15.78200 39.34200 57.67700  1.000 75.99960  ? 862  GLU A N     1 
ATOM   2765 C  CA    . GLU B 2 167 ? -14.55000 40.04100 57.32700  1.000 76.70871  ? 862  GLU A CA    1 
ATOM   2766 C  C     . GLU B 2 167 ? -13.66200 39.27200 56.35100  1.000 74.76805  ? 862  GLU A C     1 
ATOM   2767 O  O     . GLU B 2 167 ? -12.77400 39.88200 55.74100  1.000 81.22555  ? 862  GLU A O     1 
ATOM   2768 C  CB    . GLU B 2 167 ? -13.73800 40.36800 58.59300  1.000 81.78302  ? 862  GLU A CB    1 
ATOM   2769 C  CG    . GLU B 2 167 ? -13.69800 39.23900 59.63100  1.000 88.52092  ? 862  GLU A CG    1 
ATOM   2770 C  CD    . GLU B 2 167 ? -12.75200 39.50700 60.79800  1.000 91.91891  ? 862  GLU A CD    1 
ATOM   2771 O  OE1   . GLU B 2 167 ? -11.54500 39.17400 60.68400  1.000 96.06591  ? 862  GLU A OE1   1 
ATOM   2772 O  OE2   . GLU B 2 167 ? -13.22400 40.01500 61.83800  1.000 92.62658  ? 862  GLU A OE2   1 
ATOM   2773 N  N     . LEU B 2 168 ? -13.87900 37.96400 56.16600  1.000 57.78609  ? 863  LEU A N     1 
ATOM   2774 C  CA    . LEU B 2 168 ? -12.97300 37.19000 55.32000  1.000 56.07687  ? 863  LEU A CA    1 
ATOM   2775 C  C     . LEU B 2 168 ? -13.23500 37.42600 53.83000  1.000 60.84103  ? 863  LEU A C     1 
ATOM   2776 O  O     . LEU B 2 168 ? -12.28800 37.51500 53.04300  1.000 58.09933  ? 863  LEU A O     1 
ATOM   2777 C  CB    . LEU B 2 168 ? -13.07500 35.70600 55.66800  1.000 50.28969  ? 863  LEU A CB    1 
ATOM   2778 C  CG    . LEU B 2 168 ? -12.17700 34.77900 54.85300  1.000 53.93117  ? 863  LEU A CG    1 
ATOM   2779 C  CD1   . LEU B 2 168 ? -10.73500 35.28700 54.86200  1.000 55.25704  ? 863  LEU A CD1   1 
ATOM   2780 C  CD2   . LEU B 2 168 ? -12.25300 33.36300 55.39200  1.000 52.23575  ? 863  LEU A CD2   1 
ATOM   2781 N  N     . GLY B 2 169 ? -14.50100 37.52300 53.42500  1.000 64.63011  ? 864  GLY A N     1 
ATOM   2782 C  CA    . GLY B 2 169 ? -14.85500 37.97400 52.09600  1.000 64.51748  ? 864  GLY A CA    1 
ATOM   2783 C  C     . GLY B 2 169 ? -14.18900 39.28300 51.69100  1.000 71.54301  ? 864  GLY A C     1 
ATOM   2784 O  O     . GLY B 2 169 ? -13.56600 39.38700 50.62700  1.000 74.94267  ? 864  GLY A O     1 
ATOM   2785 N  N     . PRO B 2 170 ? -14.32600 40.31900 52.52600  1.000 77.53956  ? 865  PRO A N     1 
ATOM   2786 C  CA    . PRO B 2 170 ? -13.68000 41.60900 52.21000  1.000 79.25732  ? 865  PRO A CA    1 
ATOM   2787 C  C     . PRO B 2 170 ? -12.18900 41.53000 51.93900  1.000 80.91463  ? 865  PRO A C     1 
ATOM   2788 O  O     . PRO B 2 170 ? -11.71300 42.16200 50.98800  1.000 85.63419  ? 865  PRO A O     1 
ATOM   2789 C  CB    . PRO B 2 170 ? -13.96900 42.44600 53.46200  1.000 78.32205  ? 865  PRO A CB    1 
ATOM   2790 C  CG    . PRO B 2 170 ? -15.28400 41.93300 53.93600  1.000 77.35297  ? 865  PRO A CG    1 
ATOM   2791 C  CD    . PRO B 2 170 ? -15.32700 40.46100 53.60100  1.000 76.24733  ? 865  PRO A CD    1 
ATOM   2792 N  N     . ARG B 2 171 ? -11.43100 40.80400 52.76600  1.000 88.81470  ? 866  ARG A N     1 
ATOM   2793 C  CA    . ARG B 2 171 ? -10.00000 40.67500 52.51100  1.000 90.54628  ? 866  ARG A CA    1 
ATOM   2794 C  C     . ARG B 2 171 ? -9.73600  39.88300 51.24000  1.000 90.07018  ? 866  ARG A C     1 
ATOM   2795 O  O     . ARG B 2 171 ? -8.69900  40.07400 50.59600  1.000 92.28985  ? 866  ARG A O     1 
ATOM   2796 C  CB    . ARG B 2 171 ? -9.30500  40.01300 53.69700  1.000 90.59834  ? 866  ARG A CB    1 
ATOM   2797 C  CG    . ARG B 2 171 ? -9.43800  40.79300 54.97900  1.000 95.20894  ? 866  ARG A CG    1 
ATOM   2798 C  CD    . ARG B 2 171 ? -8.12300  40.84000 55.73200  1.000 97.06200  ? 866  ARG A CD    1 
ATOM   2799 N  NE    . ARG B 2 171 ? -7.43100  39.55300 55.72400  1.000 93.10984  ? 866  ARG A NE    1 
ATOM   2800 C  CZ    . ARG B 2 171 ? -7.70700  38.55000 56.55300  1.000 89.89882  ? 866  ARG A CZ    1 
ATOM   2801 N  NH1   . ARG B 2 171 ? -8.68000  38.67000 57.45900  1.000 88.35156  ? 866  ARG A NH1   1 
ATOM   2802 N  NH2   . ARG B 2 171 ? -7.01300  37.41900 56.47200  1.000 88.14800  ? 866  ARG A NH2   1 
ATOM   2803 N  N     . LEU B 2 172 ? -10.66200 39.00100 50.86200  1.000 74.34338  ? 867  LEU A N     1 
ATOM   2804 C  CA    . LEU B 2 172 ? -10.51900 38.20800 49.65200  1.000 66.25439  ? 867  LEU A CA    1 
ATOM   2805 C  C     . LEU B 2 172 ? -11.06500 38.91200 48.42300  1.000 68.34620  ? 867  LEU A C     1 
ATOM   2806 O  O     . LEU B 2 172 ? -10.50800 38.74200 47.33100  1.000 68.64711  ? 867  LEU A O     1 
ATOM   2807 C  CB    . LEU B 2 172 ? -11.21700 36.85900 49.81700  1.000 60.72773  ? 867  LEU A CB    1 
ATOM   2808 C  CG    . LEU B 2 172 ? -10.55300 35.93300 50.82300  1.000 60.58344  ? 867  LEU A CG    1 
ATOM   2809 C  CD1   . LEU B 2 172 ? -11.03300 34.50700 50.60700  1.000 63.86351  ? 867  LEU A CD1   1 
ATOM   2810 C  CD2   . LEU B 2 172 ? -9.03400  36.04700 50.71100  1.000 59.11405  ? 867  LEU A CD2   1 
ATOM   2811 N  N     . ALA B 2 173 ? -12.14700 39.68700 48.57200  1.000 68.58794  ? 868  ALA A N     1 
ATOM   2812 C  CA    . ALA B 2 173 ? -12.63100 40.50200 47.46300  1.000 70.38521  ? 868  ALA A CA    1 
ATOM   2813 C  C     . ALA B 2 173 ? -11.58100 41.52200 47.03100  1.000 68.85762  ? 868  ALA A C     1 
ATOM   2814 O  O     . ALA B 2 173 ? -11.40500 41.77400 45.83300  1.000 66.49709  ? 868  ALA A O     1 
ATOM   2815 C  CB    . ALA B 2 173 ? -13.93600 41.20100 47.85000  1.000 75.64926  ? 868  ALA A CB    1 
ATOM   2816 N  N     . GLU B 2 174 ? -10.86600 42.10800 47.99700  1.000 74.28979  ? 869  GLU A N     1 
ATOM   2817 C  CA    . GLU B 2 174 ? -9.76100  43.00600 47.68600  1.000 81.39001  ? 869  GLU A CA    1 
ATOM   2818 C  C     . GLU B 2 174 ? -8.71300  42.33500 46.79500  1.000 85.40360  ? 869  GLU A C     1 
ATOM   2819 O  O     . GLU B 2 174 ? -8.03300  43.01600 46.01300  1.000 88.99867  ? 869  GLU A O     1 
ATOM   2820 C  CB    . GLU B 2 174 ? -9.12400  43.50400 48.98800  1.000 86.50937  ? 869  GLU A CB    1 
ATOM   2821 C  CG    . GLU B 2 174 ? -8.54500  44.92100 48.91700  1.000 92.45563  ? 869  GLU A CG    1 
ATOM   2822 C  CD    . GLU B 2 174 ? -7.39900  45.15000 49.89400  1.000 92.51439  ? 869  GLU A CD    1 
ATOM   2823 O  OE1   . GLU B 2 174 ? -6.38100  44.43300 49.79700  1.000 92.32861  ? 869  GLU A OE1   1 
ATOM   2824 O  OE2   . GLU B 2 174 ? -7.51200  46.05000 50.75500  1.000 93.07844  ? 869  GLU A OE2   1 
ATOM   2825 N  N     . LEU B 2 175 ? -8.56900  41.00900 46.89200  1.000 66.44187  ? 870  LEU A N     1 
ATOM   2826 C  CA    . LEU B 2 175 ? -7.55600  40.29400 46.12300  1.000 53.94505  ? 870  LEU A CA    1 
ATOM   2827 C  C     . LEU B 2 175 ? -8.06800  39.78500 44.78200  1.000 56.31403  ? 870  LEU A C     1 
ATOM   2828 O  O     . LEU B 2 175 ? -7.29600  39.73900 43.82300  1.000 62.59653  ? 870  LEU A O     1 
ATOM   2829 C  CB    . LEU B 2 175 ? -7.00400  39.11600 46.93400  1.000 50.97593  ? 870  LEU A CB    1 
ATOM   2830 C  CG    . LEU B 2 175 ? -6.02700  39.42000 48.08500  1.000 53.85774  ? 870  LEU A CG    1 
ATOM   2831 C  CD1   . LEU B 2 175 ? -5.16100  38.20500 48.42400  1.000 52.53598  ? 870  LEU A CD1   1 
ATOM   2832 C  CD2   . LEU B 2 175 ? -5.15900  40.64500 47.81500  1.000 58.06204  ? 870  LEU A CD2   1 
ATOM   2833 N  N     . THR B 2 176 ? -9.33700  39.37200 44.68400  1.000 60.24063  ? 871  THR A N     1 
ATOM   2834 C  CA    . THR B 2 176 ? -9.88500  38.95200 43.39500  1.000 55.88864  ? 871  THR A CA    1 
ATOM   2835 C  C     . THR B 2 176 ? -10.15800 40.12500 42.46300  1.000 62.17617  ? 871  THR A C     1 
ATOM   2836 O  O     . THR B 2 176 ? -10.59700 39.90800 41.32700  1.000 57.49988  ? 871  THR A O     1 
ATOM   2837 C  CB    . THR B 2 176 ? -11.18200 38.16000 43.56600  1.000 58.53371  ? 871  THR A CB    1 
ATOM   2838 O  OG1   . THR B 2 176 ? -12.19700 39.00500 44.12500  1.000 60.36860  ? 871  THR A OG1   1 
ATOM   2839 C  CG2   . THR B 2 176 ? -10.94800 36.96600 44.46400  1.000 60.24001  ? 871  THR A CG2   1 
ATOM   2840 N  N     . ARG B 2 177 ? -9.95100  41.35700 42.93100  1.000 74.82815  ? 872  ARG A N     1 
ATOM   2841 C  CA    . ARG B 2 177 ? -10.00600 42.56100 42.11200  1.000 76.49279  ? 872  ARG A CA    1 
ATOM   2842 C  C     . ARG B 2 177 ? -8.63900  42.95300 41.59900  1.000 69.82107  ? 872  ARG A C     1 
ATOM   2843 O  O     . ARG B 2 177 ? -8.46500  43.12100 40.39900  1.000 67.64031  ? 872  ARG A O     1 
ATOM   2844 C  CB    . ARG B 2 177 ? -10.61000 43.73700 42.90600  1.000 82.00821  ? 872  ARG A CB    1 
ATOM   2845 C  CG    . ARG B 2 177 ? -12.11500 43.93800 42.72300  1.000 85.62811  ? 872  ARG A CG    1 
ATOM   2846 C  CD    . ARG B 2 177 ? -12.52900 45.34000 43.20900  1.000 87.76696  ? 872  ARG A CD    1 
ATOM   2847 N  NE    . ARG B 2 177 ? -12.12300 45.57700 44.59900  1.000 87.48341  ? 872  ARG A NE    1 
ATOM   2848 C  CZ    . ARG B 2 177 ? -12.86500 45.29700 45.66900  1.000 84.18668  ? 872  ARG A CZ    1 
ATOM   2849 N  NH1   . ARG B 2 177 ? -14.07800 44.78100 45.52700  1.000 86.83291  ? 872  ARG A NH1   1 
ATOM   2850 N  NH2   . ARG B 2 177 ? -12.38800 45.54300 46.88400  1.000 78.30753  ? 872  ARG A NH2   1 
ATOM   2851 N  N     . ALA B 2 178 ? -7.66600  43.11100 42.49000  1.000 76.59295  ? 873  ALA A N     1 
ATOM   2852 C  CA    . ALA B 2 178 ? -6.29100  43.33900 42.05600  1.000 77.40719  ? 873  ALA A CA    1 
ATOM   2853 C  C     . ALA B 2 178 ? -5.86900  42.31300 41.00800  1.000 82.09468  ? 873  ALA A C     1 
ATOM   2854 O  O     . ALA B 2 178 ? -5.20200  42.65400 40.02400  1.000 87.38350  ? 873  ALA A O     1 
ATOM   2855 C  CB    . ALA B 2 178 ? -5.33600  43.30600 43.26700  1.000 68.57041  ? 873  ALA A CB    1 
ATOM   2856 N  N     . GLY B 2 179 ? -6.27300  41.05600 41.19100  1.000 62.63040  ? 874  GLY A N     1 
ATOM   2857 C  CA    . GLY B 2 179 ? -5.93100  40.03800 40.21700  1.000 59.09882  ? 874  GLY A CA    1 
ATOM   2858 C  C     . GLY B 2 179 ? -6.69800  40.20500 38.91900  1.000 58.33921  ? 874  GLY A C     1 
ATOM   2859 O  O     . GLY B 2 179 ? -6.14100  40.04000 37.82700  1.000 60.65324  ? 874  GLY A O     1 
ATOM   2860 N  N     . ALA B 2 180 ? -7.98600  40.52700 39.01800  1.000 44.96101  ? 875  ALA A N     1 
ATOM   2861 C  CA    . ALA B 2 180 ? -8.79500  40.66200 37.81300  1.000 42.36978  ? 875  ALA A CA    1 
ATOM   2862 C  C     . ALA B 2 180 ? -8.33200  41.83000 36.94900  1.000 51.79950  ? 875  ALA A C     1 
ATOM   2863 O  O     . ALA B 2 180 ? -8.50000  41.79100 35.72100  1.000 50.26203  ? 875  ALA A O     1 
ATOM   2864 C  CB    . ALA B 2 180 ? -10.26800 40.82400 38.18600  1.000 34.78465  ? 875  ALA A CB    1 
ATOM   2865 N  N     . THR B 2 181 ? -7.75500  42.87600 37.55900  1.000 68.95428  ? 876  THR A N     1 
ATOM   2866 C  CA    . THR B 2 181 ? -7.26500  43.99100 36.75200  1.000 71.96592  ? 876  THR A CA    1 
ATOM   2867 C  C     . THR B 2 181 ? -5.87600  43.72000 36.19100  1.000 71.25428  ? 876  THR A C     1 
ATOM   2868 O  O     . THR B 2 181 ? -5.56100  44.21600 35.10800  1.000 73.13438  ? 876  THR A O     1 
ATOM   2869 C  CB    . THR B 2 181 ? -7.24200  45.31200 37.53700  1.000 72.25181  ? 876  THR A CB    1 
ATOM   2870 O  OG1   . THR B 2 181 ? -6.13800  45.30900 38.44900  1.000 70.81536  ? 876  THR A OG1   1 
ATOM   2871 C  CG2   . THR B 2 181 ? -8.56900  45.56300 38.27300  1.000 75.34814  ? 876  THR A CG2   1 
ATOM   2872 N  N     . HIS B 2 182 ? -5.03400  42.94500 36.88700  1.000 63.85241  ? 877  HIS A N     1 
ATOM   2873 C  CA    . HIS B 2 182 ? -3.76000  42.56500 36.28000  1.000 59.21846  ? 877  HIS A CA    1 
ATOM   2874 C  C     . HIS B 2 182 ? -3.97800  41.77400 34.99500  1.000 57.83407  ? 877  HIS A C     1 
ATOM   2875 O  O     . HIS B 2 182 ? -3.28500  41.99700 33.99700  1.000 56.11507  ? 877  HIS A O     1 
ATOM   2876 C  CB    . HIS B 2 182 ? -2.90700  41.74500 37.24100  1.000 55.33094  ? 877  HIS A CB    1 
ATOM   2877 C  CG    . HIS B 2 182 ? -1.68900  41.14900 36.58700  1.000 60.30110  ? 877  HIS A CG    1 
ATOM   2878 N  ND1   . HIS B 2 182 ? -0.45200  41.75600 36.61900  1.000 59.64361  ? 877  HIS A ND1   1 
ATOM   2879 C  CD2   . HIS B 2 182 ? -1.53400  40.01500 35.85800  1.000 60.42394  ? 877  HIS A CD2   1 
ATOM   2880 C  CE1   . HIS B 2 182 ? 0.41900   41.01500 35.95300  1.000 58.81531  ? 877  HIS A CE1   1 
ATOM   2881 N  NE2   . HIS B 2 182 ? -0.21100  39.95400 35.48600  1.000 59.15451  ? 877  HIS A NE2   1 
ATOM   2882 N  N     . VAL B 2 183 ? -4.93000  40.83800 35.00500  1.000 62.32398  ? 878  VAL A N     1 
ATOM   2883 C  CA    . VAL B 2 183 ? -5.20100  40.00900 33.83300  1.000 60.71255  ? 878  VAL A CA    1 
ATOM   2884 C  C     . VAL B 2 183 ? -5.82900  40.83300 32.71300  1.000 61.67368  ? 878  VAL A C     1 
ATOM   2885 O  O     . VAL B 2 183 ? -5.57300  40.58000 31.52500  1.000 59.46470  ? 878  VAL A O     1 
ATOM   2886 C  CB    . VAL B 2 183 ? -6.07800  38.81200 34.25300  1.000 58.95106  ? 878  VAL A CB    1 
ATOM   2887 C  CG1   . VAL B 2 183 ? -6.70400  38.10500 33.05100  1.000 55.89992  ? 878  VAL A CG1   1 
ATOM   2888 C  CG2   . VAL B 2 183 ? -5.25100  37.84100 35.07800  1.000 58.01938  ? 878  VAL A CG2   1 
ATOM   2889 N  N     . GLU B 2 184 ? -6.63800  41.83900 33.05800  1.000 66.44225  ? 879  GLU A N     1 
ATOM   2890 C  CA    . GLU B 2 184 ? -7.20100  42.69600 32.01900  1.000 74.43233  ? 879  GLU A CA    1 
ATOM   2891 C  C     . GLU B 2 184 ? -6.12200  43.52500 31.32900  1.000 77.03210  ? 879  GLU A C     1 
ATOM   2892 O  O     . GLU B 2 184 ? -6.23800  43.81800 30.13100  1.000 84.43621  ? 879  GLU A O     1 
ATOM   2893 C  CB    . GLU B 2 184 ? -8.28800  43.60600 32.60900  1.000 73.44443  ? 879  GLU A CB    1 
ATOM   2894 C  CG    . GLU B 2 184 ? -8.97800  44.52800 31.59600  1.000 78.59008  ? 879  GLU A CG    1 
ATOM   2895 C  CD    . GLU B 2 184 ? -9.94100  43.78800 30.66400  1.000 84.50406  ? 879  GLU A CD    1 
ATOM   2896 O  OE1   . GLU B 2 184 ? -10.76000 44.45700 29.98400  1.000 84.07777  ? 879  GLU A OE1   1 
ATOM   2897 O  OE2   . GLU B 2 184 ? -9.87700  42.53600 30.60600  1.000 86.40519  ? 879  GLU A OE2   1 
ATOM   2898 N  N     . ARG B 2 185 ? -5.05900  43.87700 32.05600  1.000 65.87792  ? 880  ARG A N     1 
ATOM   2899 C  CA    . ARG B 2 185 ? -4.04100  44.81400 31.59900  1.000 66.90830  ? 880  ARG A CA    1 
ATOM   2900 C  C     . ARG B 2 185 ? -2.71000  44.15700 31.22700  1.000 64.35031  ? 880  ARG A C     1 
ATOM   2901 O  O     . ARG B 2 185 ? -1.88900  44.80100 30.56700  1.000 60.51771  ? 880  ARG A O     1 
ATOM   2902 C  CB    . ARG B 2 185 ? -3.78000  45.88100 32.68000  1.000 69.26338  ? 880  ARG A CB    1 
ATOM   2903 C  CG    . ARG B 2 185 ? -2.98300  45.34600 33.90400  1.000 75.98402  ? 880  ARG A CG    1 
ATOM   2904 C  CD    . ARG B 2 185 ? -2.37800  46.44300 34.81000  1.000 81.10658  ? 880  ARG A CD    1 
ATOM   2905 N  NE    . ARG B 2 185 ? -3.26200  47.60000 34.98600  1.000 82.98853  ? 880  ARG A NE    1 
ATOM   2906 C  CZ    . ARG B 2 185 ? -3.52400  48.19200 36.15100  1.000 77.46378  ? 880  ARG A CZ    1 
ATOM   2907 N  NH1   . ARG B 2 185 ? -2.98400  47.73000 37.27600  1.000 75.46958  ? 880  ARG A NH1   1 
ATOM   2908 N  NH2   . ARG B 2 185 ? -4.34000  49.24200 36.18700  1.000 70.95963  ? 880  ARG A NH2   1 
ATOM   2909 N  N     . CYS B 2 186 ? -2.45900  42.92200 31.65500  1.000 61.27896  ? 881  CYS A N     1 
ATOM   2910 C  CA    . CYS B 2 186 ? -1.20400  42.21700 31.38600  1.000 63.83295  ? 881  CYS A CA    1 
ATOM   2911 C  C     . CYS B 2 186 ? -1.50700  41.03800 30.47400  1.000 70.74688  ? 881  CYS A C     1 
ATOM   2912 O  O     . CYS B 2 186 ? -2.16000  40.07400 30.88700  1.000 77.00198  ? 881  CYS A O     1 
ATOM   2913 C  CB    . CYS B 2 186 ? -0.53000  41.76100 32.68300  1.000 60.78302  ? 881  CYS A CB    1 
ATOM   2914 S  SG    . CYS B 2 186 ? 0.58600   40.31500 32.56100  1.000 57.39479  ? 881  CYS A SG    1 
ATOM   2915 N  N     . MET B 2 187 ? -1.03600  41.11300 29.23400  1.000 91.90071  ? 882  MET A N     1 
ATOM   2916 C  CA    . MET B 2 187 ? -1.43800  40.15200 28.22400  1.000 94.07611  ? 882  MET A CA    1 
ATOM   2917 C  C     . MET B 2 187 ? -0.39500  39.06500 28.00800  1.000 87.52643  ? 882  MET A C     1 
ATOM   2918 O  O     . MET B 2 187 ? -0.42000  38.38400 26.97900  1.000 91.39503  ? 882  MET A O     1 
ATOM   2919 C  CB    . MET B 2 187 ? -1.78600  40.88300 26.92900  1.000 104.05577 ? 882  MET A CB    1 
ATOM   2920 C  CG    . MET B 2 187 ? -2.80200  42.01100 27.17500  1.000 111.55259 ? 882  MET A CG    1 
ATOM   2921 S  SD    . MET B 2 187 ? -3.97900  42.33000 25.84300  1.000 116.55048 ? 882  MET A SD    1 
ATOM   2922 C  CE    . MET B 2 187 ? -5.43500  42.82300 26.78200  1.000 118.30602 ? 882  MET A CE    1 
ATOM   2923 N  N     . LEU B 2 188 ? 0.52800   38.90300 28.96100  1.000 57.62052  ? 883  LEU A N     1 
ATOM   2924 C  CA    . LEU B 2 188 ? 1.13400   37.59800 29.20700  1.000 49.63216  ? 883  LEU A CA    1 
ATOM   2925 C  C     . LEU B 2 188 ? 0.13600   36.67100 29.88700  1.000 56.26474  ? 883  LEU A C     1 
ATOM   2926 O  O     . LEU B 2 188 ? 0.18900   35.44600 29.71000  1.000 52.32880  ? 883  LEU A O     1 
ATOM   2927 C  CB    . LEU B 2 188 ? 2.36700   37.75300 30.09300  1.000 47.03823  ? 883  LEU A CB    1 
ATOM   2928 C  CG    . LEU B 2 188 ? 3.73400   37.87500 29.43400  1.000 46.51535  ? 883  LEU A CG    1 
ATOM   2929 C  CD1   . LEU B 2 188 ? 4.86600   37.68000 30.45900  1.000 38.86539  ? 883  LEU A CD1   1 
ATOM   2930 C  CD2   . LEU B 2 188 ? 3.81200   36.86100 28.31500  1.000 48.81181  ? 883  LEU A CD2   1 
ATOM   2931 N  N     . CYS B 2 189 ? -0.77300  37.25000 30.68100  1.000 64.92420  ? 884  CYS A N     1 
ATOM   2932 C  CA    . CYS B 2 189 ? -1.85100  36.48100 31.28500  1.000 58.89216  ? 884  CYS A CA    1 
ATOM   2933 C  C     . CYS B 2 189 ? -3.00700  36.31200 30.31000  1.000 55.22115  ? 884  CYS A C     1 
ATOM   2934 O  O     . CYS B 2 189 ? -3.63400  35.24900 30.26900  1.000 55.89691  ? 884  CYS A O     1 
ATOM   2935 C  CB    . CYS B 2 189 ? -2.29700  37.14700 32.59400  1.000 59.22055  ? 884  CYS A CB    1 
ATOM   2936 S  SG    . CYS B 2 189 ? -0.98400  37.27700 33.90500  1.000 59.43658  ? 884  CYS A SG    1 
ATOM   2937 N  N     . GLN B 2 190 ? -3.27600  37.32900 29.48300  1.000 51.12725  ? 885  GLN A N     1 
ATOM   2938 C  CA    . GLN B 2 190 ? -4.27300  37.17100 28.42600  1.000 50.75603  ? 885  GLN A CA    1 
ATOM   2939 C  C     . GLN B 2 190 ? -3.88300  36.07200 27.44600  1.000 49.31209  ? 885  GLN A C     1 
ATOM   2940 O  O     . GLN B 2 190 ? -4.75600  35.40100 26.89000  1.000 53.30066  ? 885  GLN A O     1 
ATOM   2941 C  CB    . GLN B 2 190 ? -4.48700  38.49200 27.67300  1.000 53.49330  ? 885  GLN A CB    1 
ATOM   2942 C  CG    . GLN B 2 190 ? -5.63100  39.38800 28.19600  1.000 59.14149  ? 885  GLN A CG    1 
ATOM   2943 C  CD    . GLN B 2 190 ? -6.97800  39.15800 27.49600  1.000 64.87595  ? 885  GLN A CD    1 
ATOM   2944 O  OE1   . GLN B 2 190 ? -7.11100  38.29200 26.62300  1.000 64.74876  ? 885  GLN A OE1   1 
ATOM   2945 N  NE2   . GLN B 2 190 ? -7.98000  39.95300 27.87300  1.000 67.74723  ? 885  GLN A NE2   1 
ATOM   2946 N  N     . ALA B 2 191 ? -2.58200  35.86700 27.22400  1.000 60.68208  ? 886  ALA A N     1 
ATOM   2947 C  CA    . ALA B 2 191 ? -2.12500  34.79900 26.33200  1.000 59.40121  ? 886  ALA A CA    1 
ATOM   2948 C  C     . ALA B 2 191 ? -2.44700  33.40700 26.87500  1.000 58.75836  ? 886  ALA A C     1 
ATOM   2949 O  O     . ALA B 2 191 ? -2.66500  32.47100 26.09400  1.000 55.94945  ? 886  ALA A O     1 
ATOM   2950 C  CB    . ALA B 2 191 ? -0.62500  34.93300 26.08600  1.000 56.65094  ? 886  ALA A CB    1 
ATOM   2951 N  N     . LYS B 2 192 ? -2.47800  33.24200 28.19400  1.000 62.89205  ? 887  LYS A N     1 
ATOM   2952 C  CA    . LYS B 2 192 ? -2.85800  31.97400 28.80200  1.000 59.34180  ? 887  LYS A CA    1 
ATOM   2953 C  C     . LYS B 2 192 ? -4.37100  31.84100 28.98800  1.000 55.63352  ? 887  LYS A C     1 
ATOM   2954 O  O     . LYS B 2 192 ? -4.82900  30.87300 29.60500  1.000 53.44137  ? 887  LYS A O     1 
ATOM   2955 C  CB    . LYS B 2 192 ? -2.13900  31.79900 30.14200  1.000 54.62920  ? 887  LYS A CB    1 
ATOM   2956 C  CG    . LYS B 2 192 ? -0.73000  32.33200 30.14100  1.000 52.76889  ? 887  LYS A CG    1 
ATOM   2957 C  CD    . LYS B 2 192 ? 0.13300   31.56200 31.11300  1.000 53.63417  ? 887  LYS A CD    1 
ATOM   2958 C  CE    . LYS B 2 192 ? 1.54500   32.03800 31.02000  1.000 51.46740  ? 887  LYS A CE    1 
ATOM   2959 N  NZ    . LYS B 2 192 ? 1.52600   33.49200 31.32400  1.000 54.57639  ? 887  LYS A NZ    1 
ATOM   2960 N  N     . GLY B 2 193 ? -5.15300  32.79000 28.47900  1.000 41.23967  ? 888  GLY A N     1 
ATOM   2961 C  CA    . GLY B 2 193 ? -6.59200  32.64700 28.46000  1.000 40.15174  ? 888  GLY A CA    1 
ATOM   2962 C  C     . GLY B 2 193 ? -7.03000  31.50400 27.57100  1.000 42.95685  ? 888  GLY A C     1 
ATOM   2963 O  O     . GLY B 2 193 ? -6.19400  30.79800 27.00500  1.000 44.12419  ? 888  GLY A O     1 
ATOM   2964 N  N     . PHE B 2 194 ? -8.33800  31.31000 27.43200  1.000 41.72329  ? 889  PHE A N     1 
ATOM   2965 C  CA    . PHE B 2 194 ? -8.88200  30.18600 26.68300  1.000 36.56628  ? 889  PHE A CA    1 
ATOM   2966 C  C     . PHE B 2 194 ? -9.72100  30.68700 25.52300  1.000 38.61100  ? 889  PHE A C     1 
ATOM   2967 O  O     . PHE B 2 194 ? -10.21200 31.81800 25.53000  1.000 42.96531  ? 889  PHE A O     1 
ATOM   2968 C  CB    . PHE B 2 194 ? -9.78100  29.29000 27.55000  1.000 34.16562  ? 889  PHE A CB    1 
ATOM   2969 C  CG    . PHE B 2 194 ? -9.04700  28.29200 28.38600  1.000 35.13904  ? 889  PHE A CG    1 
ATOM   2970 C  CD1   . PHE B 2 194 ? -8.49300  28.66100 29.60300  1.000 38.25547  ? 889  PHE A CD1   1 
ATOM   2971 C  CD2   . PHE B 2 194 ? -8.96000  26.96900 27.98500  1.000 35.38560  ? 889  PHE A CD2   1 
ATOM   2972 C  CE1   . PHE B 2 194 ? -7.83900  27.73200 30.39100  1.000 41.19348  ? 889  PHE A CE1   1 
ATOM   2973 C  CE2   . PHE B 2 194 ? -8.30600  26.02700 28.76700  1.000 33.83491  ? 889  PHE A CE2   1 
ATOM   2974 C  CZ    . PHE B 2 194 ? -7.74000  26.41200 29.97400  1.000 39.13380  ? 889  PHE A CZ    1 
ATOM   2975 N  N     . ILE B 2 195 ? -9.88300  29.81000 24.53500  1.000 37.96571  ? 890  ILE A N     1 
ATOM   2976 C  CA    . ILE B 2 195 ? -10.91100 29.91600 23.50900  1.000 41.43136  ? 890  ILE A CA    1 
ATOM   2977 C  C     . ILE B 2 195 ? -11.82400 28.69200 23.63200  1.000 44.95653  ? 890  ILE A C     1 
ATOM   2978 O  O     . ILE B 2 195 ? -11.34400 27.55300 23.66600  1.000 46.20735  ? 890  ILE A O     1 
ATOM   2979 C  CB    . ILE B 2 195 ? -10.28500 30.03200 22.10300  1.000 43.76864  ? 890  ILE A CB    1 
ATOM   2980 C  CG1   . ILE B 2 195 ? -9.22400  31.13800 22.08500  1.000 41.62176  ? 890  ILE A CG1   1 
ATOM   2981 C  CG2   . ILE B 2 195 ? -11.33700 30.33200 21.02000  1.000 41.13140  ? 890  ILE A CG2   1 
ATOM   2982 C  CD1   . ILE B 2 195 ? -9.79100  32.52500 21.93400  1.000 38.39989  ? 890  ILE A CD1   1 
ATOM   2983 N  N     . CYS B 2 196 ? -13.13700 28.93300 23.71600  1.000 44.36154  ? 891  CYS A N     1 
ATOM   2984 C  CA    . CYS B 2 196 ? -14.09900 27.84500 23.86500  1.000 46.29050  ? 891  CYS A CA    1 
ATOM   2985 C  C     . CYS B 2 196 ? -13.97100 26.86800 22.69100  1.000 43.22520  ? 891  CYS A C     1 
ATOM   2986 O  O     . CYS B 2 196 ? -14.15900 27.24800 21.53400  1.000 52.20437  ? 891  CYS A O     1 
ATOM   2987 C  CB    . CYS B 2 196 ? -15.51700 28.42300 23.98500  1.000 53.67999  ? 891  CYS A CB    1 
ATOM   2988 S  SG    . CYS B 2 196 ? -16.92400 27.24600 24.11200  1.000 52.54671  ? 891  CYS A SG    1 
ATOM   2989 N  N     . GLU B 2 197 ? -13.62300 25.60600 22.98800  1.000 48.13271  ? 892  GLU A N     1 
ATOM   2990 C  CA    . GLU B 2 197 ? -13.44600 24.60500 21.93000  1.000 54.68464  ? 892  GLU A CA    1 
ATOM   2991 C  C     . GLU B 2 197 ? -14.73600 24.38200 21.14000  1.000 60.94712  ? 892  GLU A C     1 
ATOM   2992 O  O     . GLU B 2 197 ? -14.68300 24.01800 19.96100  1.000 60.70866  ? 892  GLU A O     1 
ATOM   2993 C  CB    . GLU B 2 197 ? -12.93200 23.28700 22.53700  1.000 59.35172  ? 892  GLU A CB    1 
ATOM   2994 C  CG    . GLU B 2 197 ? -12.12400 22.37800 21.57900  1.000 59.88899  ? 892  GLU A CG    1 
ATOM   2995 C  CD    . GLU B 2 197 ? -11.25700 21.34100 22.30600  1.000 58.98771  ? 892  GLU A CD    1 
ATOM   2996 O  OE1   . GLU B 2 197 ? -10.63000 21.67700 23.34400  1.000 54.01090  ? 892  GLU A OE1   1 
ATOM   2997 O  OE2   . GLU B 2 197 ? -11.21600 20.17500 21.85000  1.000 61.55552  ? 892  GLU A OE2   1 
ATOM   2998 N  N     . PHE B 2 198 ? -15.89700 24.59900 21.76800  1.000 64.73985  ? 893  PHE A N     1 
ATOM   2999 C  CA    . PHE B 2 198 ? -17.18100 24.37600 21.10300  1.000 63.72418  ? 893  PHE A CA    1 
ATOM   3000 C  C     . PHE B 2 198 ? -17.43300 25.40900 20.00700  1.000 60.31727  ? 893  PHE A C     1 
ATOM   3001 O  O     . PHE B 2 198 ? -17.54700 25.06400 18.82100  1.000 57.65546  ? 893  PHE A O     1 
ATOM   3002 C  CB    . PHE B 2 198 ? -18.31600 24.41700 22.13400  1.000 62.61706  ? 893  PHE A CB    1 
ATOM   3003 C  CG    . PHE B 2 198 ? -18.36700 23.21600 23.03300  1.000 60.94897  ? 893  PHE A CG    1 
ATOM   3004 C  CD1   . PHE B 2 198 ? -18.63000 21.95600 22.50800  1.000 61.62394  ? 893  PHE A CD1   1 
ATOM   3005 C  CD2   . PHE B 2 198 ? -18.17000 23.34000 24.39700  1.000 59.99795  ? 893  PHE A CD2   1 
ATOM   3006 C  CE1   . PHE B 2 198 ? -18.67500 20.83700 23.32300  1.000 61.33267  ? 893  PHE A CE1   1 
ATOM   3007 C  CE2   . PHE B 2 198 ? -18.22200 22.22600 25.21900  1.000 61.97609  ? 893  PHE A CE2   1 
ATOM   3008 C  CZ    . PHE B 2 198 ? -18.47000 20.97300 24.68000  1.000 62.72195  ? 893  PHE A CZ    1 
ATOM   3009 N  N     . CYS B 2 199 ? -17.54800 26.68800 20.39900  1.000 57.37013  ? 894  CYS A N     1 
ATOM   3010 C  CA    . CYS B 2 199 ? -17.96300 27.75800 19.50200  1.000 59.13596  ? 894  CYS A CA    1 
ATOM   3011 C  C     . CYS B 2 199 ? -16.80500 28.37800 18.73800  1.000 57.85855  ? 894  CYS A C     1 
ATOM   3012 O  O     . CYS B 2 199 ? -17.01200 28.90500 17.63100  1.000 54.54099  ? 894  CYS A O     1 
ATOM   3013 C  CB    . CYS B 2 199 ? -18.68400 28.85300 20.29100  1.000 59.35018  ? 894  CYS A CB    1 
ATOM   3014 S  SG    . CYS B 2 199 ? -17.77000 29.47700 21.68500  1.000 63.79658  ? 894  CYS A SG    1 
ATOM   3015 N  N     . GLN B 2 200 ? -15.60400 28.32700 19.31100  1.000 53.38247  ? 895  GLN A N     1 
ATOM   3016 C  CA    . GLN B 2 200 ? -14.38100 28.80700 18.69000  1.000 52.06851  ? 895  GLN A CA    1 
ATOM   3017 C  C     . GLN B 2 200 ? -14.38000 30.31500 18.53600  1.000 54.11254  ? 895  GLN A C     1 
ATOM   3018 O  O     . GLN B 2 200 ? -13.64100 30.85500 17.71600  1.000 57.49974  ? 895  GLN A O     1 
ATOM   3019 C  CB    . GLN B 2 200 ? -14.14400 28.13800 17.33100  1.000 51.16264  ? 895  GLN A CB    1 
ATOM   3020 C  CG    . GLN B 2 200 ? -13.84800 26.68000 17.39500  1.000 49.63253  ? 895  GLN A CG    1 
ATOM   3021 C  CD    . GLN B 2 200 ? -12.39300 26.43100 17.53100  1.000 58.30085  ? 895  GLN A CD    1 
ATOM   3022 O  OE1   . GLN B 2 200 ? -11.59100 27.04600 16.83200  1.000 66.03431  ? 895  GLN A OE1   1 
ATOM   3023 N  NE2   . GLN B 2 200 ? -12.02400 25.52700 18.42700  1.000 61.24166  ? 895  GLN A NE2   1 
ATOM   3024 N  N     . ASN B 2 201 ? -15.20200 31.01700 19.30000  1.000 54.94896  ? 896  ASN A N     1 
ATOM   3025 C  CA    . ASN B 2 201 ? -15.24600 32.46500 19.16300  1.000 59.75579  ? 896  ASN A CA    1 
ATOM   3026 C  C     . ASN B 2 201 ? -13.91800 33.03500 19.64600  1.000 57.21497  ? 896  ASN A C     1 
ATOM   3027 O  O     . ASN B 2 201 ? -13.67500 33.15000 20.85000  1.000 58.84266  ? 896  ASN A O     1 
ATOM   3028 C  CB    . ASN B 2 201 ? -16.44600 33.03900 19.92500  1.000 64.66332  ? 896  ASN A CB    1 
ATOM   3029 C  CG    . ASN B 2 201 ? -16.50200 34.55900 19.88200  1.000 72.24116  ? 896  ASN A CG    1 
ATOM   3030 O  OD1   . ASN B 2 201 ? -16.50700 35.17300 18.80600  1.000 82.72754  ? 896  ASN A OD1   1 
ATOM   3031 N  ND2   . ASN B 2 201 ? -16.61800 35.16700 21.04200  1.000 72.65878  ? 896  ASN A ND2   1 
ATOM   3032 N  N     . GLU B 2 202 ? -13.04500 33.40300 18.71200  1.000 68.76378  ? 897  GLU A N     1 
ATOM   3033 C  CA    . GLU B 2 202 ? -11.74600 33.92500 19.11400  1.000 72.15566  ? 897  GLU A CA    1 
ATOM   3034 C  C     . GLU B 2 202 ? -11.81000 35.40400 19.50300  1.000 69.67832  ? 897  GLU A C     1 
ATOM   3035 O  O     . GLU B 2 202 ? -10.76600 36.04000 19.68100  1.000 72.08395  ? 897  GLU A O     1 
ATOM   3036 C  CB    . GLU B 2 202 ? -10.69600 33.67600 18.01300  1.000 77.66386  ? 897  GLU A CB    1 
ATOM   3037 C  CG    . GLU B 2 202 ? -11.21000 33.77500 16.57200  1.000 84.73708  ? 897  GLU A CG    1 
ATOM   3038 C  CD    . GLU B 2 202 ? -10.35300 32.98700 15.57700  1.000 87.11057  ? 897  GLU A CD    1 
ATOM   3039 O  OE1   . GLU B 2 202 ? -10.90700 32.06900 14.92800  1.000 88.85050  ? 897  GLU A OE1   1 
ATOM   3040 O  OE2   . GLU B 2 202 ? -9.13100  33.26500 15.45500  1.000 86.54282  ? 897  GLU A OE2   1 
ATOM   3041 N  N     . ASP B 2 203 ? -13.01000 35.95400 19.66900  1.000 65.58727  ? 898  ASP A N     1 
ATOM   3042 C  CA    . ASP B 2 203 ? -13.19700 37.34000 20.08700  1.000 73.37903  ? 898  ASP A CA    1 
ATOM   3043 C  C     . ASP B 2 203 ? -13.53100 37.46800 21.56900  1.000 75.07938  ? 898  ASP A C     1 
ATOM   3044 O  O     . ASP B 2 203 ? -13.62700 38.58900 22.07900  1.000 75.86033  ? 898  ASP A O     1 
ATOM   3045 C  CB    . ASP B 2 203 ? -14.30100 38.01200 19.24700  1.000 79.89845  ? 898  ASP A CB    1 
ATOM   3046 C  CG    . ASP B 2 203 ? -13.99200 38.01100 17.74200  1.000 87.82645  ? 898  ASP A CG    1 
ATOM   3047 O  OD1   . ASP B 2 203 ? -12.84500 38.35300 17.35300  1.000 90.05115  ? 898  ASP A OD1   1 
ATOM   3048 O  OD2   . ASP B 2 203 ? -14.90400 37.70100 16.94300  1.000 91.18575  ? 898  ASP A OD2   1 
ATOM   3049 N  N     . ASP B 2 204 ? -13.69500 36.34300 22.27400  1.000 76.35601  ? 899  ASP A N     1 
ATOM   3050 C  CA    . ASP B 2 204 ? -14.10400 36.30300 23.68100  1.000 73.37263  ? 899  ASP A CA    1 
ATOM   3051 C  C     . ASP B 2 204 ? -13.19300 35.31500 24.41300  1.000 68.62536  ? 899  ASP A C     1 
ATOM   3052 O  O     . ASP B 2 204 ? -13.53700 34.13600 24.57700  1.000 67.50193  ? 899  ASP A O     1 
ATOM   3053 C  CB    . ASP B 2 204 ? -15.57700 35.93000 23.79700  1.000 74.67986  ? 899  ASP A CB    1 
ATOM   3054 C  CG    . ASP B 2 204 ? -16.02300 35.74800 25.22500  1.000 72.71784  ? 899  ASP A CG    1 
ATOM   3055 O  OD1   . ASP B 2 204 ? -15.76100 36.66100 26.03600  1.000 73.41424  ? 899  ASP A OD1   1 
ATOM   3056 O  OD2   . ASP B 2 204 ? -16.62900 34.68700 25.52300  1.000 70.52617  ? 899  ASP A OD2   1 
ATOM   3057 N  N     . ILE B 2 205 ? -12.03200 35.80900 24.84100  1.000 59.74963  ? 900  ILE A N     1 
ATOM   3058 C  CA    . ILE B 2 205 ? -11.04800 34.97700 25.52400  1.000 61.58426  ? 900  ILE A CA    1 
ATOM   3059 C  C     . ILE B 2 205 ? -11.47400 34.88100 26.99000  1.000 61.52412  ? 900  ILE A C     1 
ATOM   3060 O  O     . ILE B 2 205 ? -11.46700 35.87200 27.71900  1.000 62.86300  ? 900  ILE A O     1 
ATOM   3061 C  CB    . ILE B 2 205 ? -9.62000  35.53300 25.37300  1.000 59.63228  ? 900  ILE A CB    1 
ATOM   3062 C  CG1   . ILE B 2 205 ? -9.13200  35.39200 23.92300  1.000 57.69969  ? 900  ILE A CG1   1 
ATOM   3063 C  CG2   . ILE B 2 205 ? -8.61700  34.80100 26.26900  1.000 50.62191  ? 900  ILE A CG2   1 
ATOM   3064 C  CD1   . ILE B 2 205 ? -9.70300  36.38700 22.92800  1.000 63.08283  ? 900  ILE A CD1   1 
ATOM   3065 N  N     . ILE B 2 206 ? -11.83900 33.68100 27.41500  1.000 57.54549  ? 901  ILE A N     1 
ATOM   3066 C  CA    . ILE B 2 206 ? -12.36200 33.42200 28.75400  1.000 54.22155  ? 901  ILE A CA    1 
ATOM   3067 C  C     . ILE B 2 206 ? -11.25700 32.87500 29.65500  1.000 56.08070  ? 901  ILE A C     1 
ATOM   3068 O  O     . ILE B 2 206 ? -10.35700 32.14100 29.21800  1.000 51.49114  ? 901  ILE A O     1 
ATOM   3069 C  CB    . ILE B 2 206 ? -13.54400 32.43700 28.66800  1.000 49.72054  ? 901  ILE A CB    1 
ATOM   3070 C  CG1   . ILE B 2 206 ? -13.08900 31.19200 27.93700  1.000 35.82866  ? 901  ILE A CG1   1 
ATOM   3071 C  CG2   . ILE B 2 206 ? -14.73300 33.08100 27.94200  1.000 58.02628  ? 901  ILE A CG2   1 
ATOM   3072 C  CD1   . ILE B 2 206 ? -14.16500 30.21100 27.75600  1.000 43.47708  ? 901  ILE A CD1   1 
ATOM   3073 N  N     . PHE B 2 207 ? -11.33700 33.21100 30.93500  1.000 69.48138  ? 902  PHE A N     1 
ATOM   3074 C  CA    . PHE B 2 207 ? -10.41900 32.70500 31.94300  1.000 66.60869  ? 902  PHE A CA    1 
ATOM   3075 C  C     . PHE B 2 207 ? -11.19700 31.88400 32.96000  1.000 64.45174  ? 902  PHE A C     1 
ATOM   3076 O  O     . PHE B 2 207 ? -12.41600 32.04100 33.08900  1.000 68.03803  ? 902  PHE A O     1 
ATOM   3077 C  CB    . PHE B 2 207 ? -9.68200  33.85900 32.63400  1.000 66.37898  ? 902  PHE A CB    1 
ATOM   3078 C  CG    . PHE B 2 207 ? -8.99900  34.78600 31.67500  1.000 70.43486  ? 902  PHE A CG    1 
ATOM   3079 C  CD1   . PHE B 2 207 ? -7.70800  34.53200 31.24300  1.000 70.58782  ? 902  PHE A CD1   1 
ATOM   3080 C  CD2   . PHE B 2 207 ? -9.65900  35.89900 31.18200  1.000 71.78848  ? 902  PHE A CD2   1 
ATOM   3081 C  CE1   . PHE B 2 207 ? -7.08900  35.38300 30.34900  1.000 69.04029  ? 902  PHE A CE1   1 
ATOM   3082 C  CE2   . PHE B 2 207 ? -9.04500  36.75000 30.29400  1.000 71.16162  ? 902  PHE A CE2   1 
ATOM   3083 C  CZ    . PHE B 2 207 ? -7.75800  36.49100 29.87400  1.000 69.45409  ? 902  PHE A CZ    1 
ATOM   3084 N  N     . PRO B 2 208 ? -10.53600 30.97100 33.67500  1.000 54.38290  ? 903  PRO A N     1 
ATOM   3085 C  CA    . PRO B 2 208 ? -11.28300 30.06800 34.58000  1.000 58.36972  ? 903  PRO A CA    1 
ATOM   3086 C  C     . PRO B 2 208 ? -11.89700 30.75500 35.81700  1.000 57.01249  ? 903  PRO A C     1 
ATOM   3087 O  O     . PRO B 2 208 ? -12.82500 30.19300 36.43000  1.000 49.11321  ? 903  PRO A O     1 
ATOM   3088 C  CB    . PRO B 2 208 ? -10.23100 29.01300 34.97300  1.000 53.60775  ? 903  PRO A CB    1 
ATOM   3089 C  CG    . PRO B 2 208 ? -8.89800  29.67000 34.71300  1.000 56.20729  ? 903  PRO A CG    1 
ATOM   3090 C  CD    . PRO B 2 208 ? -9.11900  30.59600 33.54300  1.000 52.69939  ? 903  PRO A CD    1 
ATOM   3091 N  N     . PHE B 2 209 ? -11.42900 31.94600 36.19600  1.000 53.16961  ? 904  PHE A N     1 
ATOM   3092 C  CA    . PHE B 2 209 ? -11.95200 32.59200 37.38800  1.000 50.89160  ? 904  PHE A CA    1 
ATOM   3093 C  C     . PHE B 2 209 ? -13.21500 33.38500 37.11100  1.000 63.52338  ? 904  PHE A C     1 
ATOM   3094 O  O     . PHE B 2 209 ? -13.83600 33.88900 38.05600  1.000 64.92212  ? 904  PHE A O     1 
ATOM   3095 C  CB    . PHE B 2 209 ? -10.90100 33.50900 38.00000  1.000 44.50969  ? 904  PHE A CB    1 
ATOM   3096 C  CG    . PHE B 2 209 ? -10.45200 34.60700 37.09000  1.000 53.60080  ? 904  PHE A CG    1 
ATOM   3097 C  CD1   . PHE B 2 209 ? -11.14100 35.81000 37.03500  1.000 58.14512  ? 904  PHE A CD1   1 
ATOM   3098 C  CD2   . PHE B 2 209 ? -9.31900  34.44700 36.29900  1.000 57.69489  ? 904  PHE A CD2   1 
ATOM   3099 C  CE1   . PHE B 2 209 ? -10.72200 36.82700 36.19800  1.000 59.81642  ? 904  PHE A CE1   1 
ATOM   3100 C  CE2   . PHE B 2 209 ? -8.89100  35.45700 35.47200  1.000 56.46768  ? 904  PHE A CE2   1 
ATOM   3101 C  CZ    . PHE B 2 209 ? -9.59800  36.64900 35.41600  1.000 60.22061  ? 904  PHE A CZ    1 
ATOM   3102 N  N     . GLU B 2 210 ? -13.59700 33.52100 35.84100  1.000 82.24899  ? 905  GLU A N     1 
ATOM   3103 C  CA    . GLU B 2 210 ? -14.83100 34.21100 35.46300  1.000 82.31502  ? 905  GLU A CA    1 
ATOM   3104 C  C     . GLU B 2 210 ? -15.96500 33.19500 35.48400  1.000 79.87058  ? 905  GLU A C     1 
ATOM   3105 O  O     . GLU B 2 210 ? -16.40700 32.68400 34.45400  1.000 75.46853  ? 905  GLU A O     1 
ATOM   3106 C  CB    . GLU B 2 210 ? -14.68700 34.85400 34.09100  1.000 86.74462  ? 905  GLU A CB    1 
ATOM   3107 C  CG    . GLU B 2 210 ? -13.70400 35.99600 34.02500  1.000 90.09581  ? 905  GLU A CG    1 
ATOM   3108 C  CD    . GLU B 2 210 ? -13.37200 36.35900 32.59600  1.000 91.15500  ? 905  GLU A CD    1 
ATOM   3109 O  OE1   . GLU B 2 210 ? -13.08500 37.54800 32.33700  1.000 94.23455  ? 905  GLU A OE1   1 
ATOM   3110 O  OE2   . GLU B 2 210 ? -13.40700 35.45200 31.73400  1.000 88.68027  ? 905  GLU A OE2   1 
ATOM   3111 N  N     . LEU B 2 211 ? -16.44800 32.90400 36.69100  1.000 76.60605  ? 906  LEU A N     1 
ATOM   3112 C  CA    . LEU B 2 211 ? -17.47100 31.87700 36.84600  1.000 74.63893  ? 906  LEU A CA    1 
ATOM   3113 C  C     . LEU B 2 211 ? -18.86600 32.36100 36.48100  1.000 72.02592  ? 906  LEU A C     1 
ATOM   3114 O  O     . LEU B 2 211 ? -19.77900 31.53400 36.39900  1.000 71.30234  ? 906  LEU A O     1 
ATOM   3115 C  CB    . LEU B 2 211 ? -17.48100 31.34700 38.27200  1.000 74.93422  ? 906  LEU A CB    1 
ATOM   3116 C  CG    . LEU B 2 211 ? -16.15800 30.75500 38.74000  1.000 71.10905  ? 906  LEU A CG    1 
ATOM   3117 C  CD1   . LEU B 2 211 ? -15.69400 31.53300 39.94700  1.000 67.58068  ? 906  LEU A CD1   1 
ATOM   3118 C  CD2   . LEU B 2 211 ? -16.32700 29.27900 39.06400  1.000 71.20638  ? 906  LEU A CD2   1 
ATOM   3119 N  N     . HIS B 2 212 ? -19.05100 33.66700 36.27000  1.000 74.91773  ? 907  HIS A N     1 
ATOM   3120 C  CA    . HIS B 2 212 ? -20.26000 34.16500 35.62000  1.000 82.74769  ? 907  HIS A CA    1 
ATOM   3121 C  C     . HIS B 2 212 ? -20.40400 33.59600 34.20700  1.000 85.46095  ? 907  HIS A C     1 
ATOM   3122 O  O     . HIS B 2 212 ? -21.47900 33.12300 33.81900  1.000 79.08713  ? 907  HIS A O     1 
ATOM   3123 C  CB    . HIS B 2 212 ? -20.21300 35.69400 35.57300  1.000 92.03426  ? 907  HIS A CB    1 
ATOM   3124 C  CG    . HIS B 2 212 ? -18.88100 36.24800 35.14500  1.000 98.82609  ? 907  HIS A CG    1 
ATOM   3125 N  ND1   . HIS B 2 212 ? -17.88700 36.57700 36.04200  1.000 99.74503  ? 907  HIS A ND1   1 
ATOM   3126 C  CD2   . HIS B 2 212 ? -18.38500 36.53700 33.91500  1.000 100.26983 ? 907  HIS A CD2   1 
ATOM   3127 C  CE1   . HIS B 2 212 ? -16.83700 37.04700 35.38600  1.000 98.43218  ? 907  HIS A CE1   1 
ATOM   3128 N  NE2   . HIS B 2 212 ? -17.11300 37.03000 34.09400  1.000 98.40999  ? 907  HIS A NE2   1 
ATOM   3129 N  N     . LYS B 2 213 ? -19.30600 33.61100 33.44100  1.000 87.76422  ? 908  LYS A N     1 
ATOM   3130 C  CA    . LYS B 2 213 ? -19.29600 33.43400 31.99000  1.000 86.69014  ? 908  LYS A CA    1 
ATOM   3131 C  C     . LYS B 2 213 ? -19.19800 31.97200 31.58200  1.000 83.74715  ? 908  LYS A C     1 
ATOM   3132 O  O     . LYS B 2 213 ? -19.86500 31.52600 30.63500  1.000 82.58111  ? 908  LYS A O     1 
ATOM   3133 C  CB    . LYS B 2 213 ? -18.10500 34.19800 31.40000  1.000 85.02719  ? 908  LYS A CB    1 
ATOM   3134 C  CG    . LYS B 2 213 ? -18.09100 34.31500 29.88900  1.000 88.45739  ? 908  LYS A CG    1 
ATOM   3135 C  CD    . LYS B 2 213 ? -17.62000 35.70300 29.49100  1.000 88.74666  ? 908  LYS A CD    1 
ATOM   3136 C  CE    . LYS B 2 213 ? -18.30600 36.18200 28.22600  1.000 89.70160  ? 908  LYS A CE    1 
ATOM   3137 N  NZ    . LYS B 2 213 ? -18.24400 37.66600 28.12500  1.000 85.98551  ? 908  LYS A NZ    1 
ATOM   3138 N  N     . CYS B 2 214 ? -18.34200 31.22900 32.27000  1.000 80.90193  ? 909  CYS A N     1 
ATOM   3139 C  CA    . CYS B 2 214 ? -17.84900 29.96000 31.77800  1.000 80.93410  ? 909  CYS A CA    1 
ATOM   3140 C  C     . CYS B 2 214 ? -17.85100 28.95600 32.91400  1.000 74.15059  ? 909  CYS A C     1 
ATOM   3141 O  O     . CYS B 2 214 ? -17.86800 29.32500 34.08700  1.000 73.20365  ? 909  CYS A O     1 
ATOM   3142 C  CB    . CYS B 2 214 ? -16.43100 30.10600 31.19500  1.000 86.60860  ? 909  CYS A CB    1 
ATOM   3143 S  SG    . CYS B 2 214 ? -15.26300 31.01600 32.21000  1.000 91.93913  ? 909  CYS A SG    1 
ATOM   3144 N  N     . ARG B 2 215 ? -17.85300 27.67700 32.55700  1.000 74.48659  ? 910  ARG A N     1 
ATOM   3145 C  CA    . ARG B 2 215 ? -17.68300 26.60800 33.52600  1.000 75.64309  ? 910  ARG A CA    1 
ATOM   3146 C  C     . ARG B 2 215 ? -16.45500 25.80600 33.12400  1.000 73.02844  ? 910  ARG A C     1 
ATOM   3147 O  O     . ARG B 2 215 ? -16.27200 25.48200 31.94200  1.000 71.44908  ? 910  ARG A O     1 
ATOM   3148 C  CB    . ARG B 2 215 ? -18.94900 25.73600 33.64400  1.000 78.94751  ? 910  ARG A CB    1 
ATOM   3149 C  CG    . ARG B 2 215 ? -19.12200 24.57700 32.67300  1.000 78.82187  ? 910  ARG A CG    1 
ATOM   3150 C  CD    . ARG B 2 215 ? -20.43300 23.85800 32.98400  1.000 83.62928  ? 910  ARG A CD    1 
ATOM   3151 N  NE    . ARG B 2 215 ? -20.54600 22.56300 32.31900  1.000 87.55122  ? 910  ARG A NE    1 
ATOM   3152 C  CZ    . ARG B 2 215 ? -20.18500 21.40700 32.86700  1.000 87.84932  ? 910  ARG A CZ    1 
ATOM   3153 N  NH1   . ARG B 2 215 ? -19.66700 21.38800 34.08400  1.000 85.39593  ? 910  ARG A NH1   1 
ATOM   3154 N  NH2   . ARG B 2 215 ? -20.32800 20.27100 32.19500  1.000 89.51620  ? 910  ARG A NH2   1 
ATOM   3155 N  N     . THR B 2 216 ? -15.58900 25.54300 34.09900  1.000 63.95750  ? 911  THR A N     1 
ATOM   3156 C  CA    . THR B 2 216 ? -14.33600 24.83900 33.86700  1.000 61.58950  ? 911  THR A CA    1 
ATOM   3157 C  C     . THR B 2 216 ? -14.56500 23.34900 34.08800  1.000 60.47545  ? 911  THR A C     1 
ATOM   3158 O  O     . THR B 2 216 ? -15.11600 22.95100 35.12200  1.000 66.93691  ? 911  THR A O     1 
ATOM   3159 C  CB    . THR B 2 216 ? -13.22800 25.35600 34.79900  1.000 55.16845  ? 911  THR A CB    1 
ATOM   3160 O  OG1   . THR B 2 216 ? -13.08100 26.77900 34.67500  1.000 56.64122  ? 911  THR A OG1   1 
ATOM   3161 C  CG2   . THR B 2 216 ? -11.92600 24.73800 34.45000  1.000 51.17759  ? 911  THR A CG2   1 
ATOM   3162 N  N     . CYS B 2 217 ? -14.17800 22.53200 33.10900  1.000 60.28071  ? 912  CYS A N     1 
ATOM   3163 C  CA    . CYS B 2 217 ? -14.01500 21.11200 33.37600  1.000 63.12271  ? 912  CYS A CA    1 
ATOM   3164 C  C     . CYS B 2 217 ? -13.04800 20.94500 34.54300  1.000 76.09144  ? 912  CYS A C     1 
ATOM   3165 O  O     . CYS B 2 217 ? -12.17200 21.78000 34.77000  1.000 79.98471  ? 912  CYS A O     1 
ATOM   3166 C  CB    . CYS B 2 217 ? -13.49600 20.39900 32.13000  1.000 59.51806  ? 912  CYS A CB    1 
ATOM   3167 S  SG    . CYS B 2 217 ? -13.15500 18.66400 32.35300  1.000 62.35932  ? 912  CYS A SG    1 
ATOM   3168 N  N     . GLU B 2 218 ? -13.22400 19.89600 35.33700  1.000 101.50352 ? 913  GLU A N     1 
ATOM   3169 C  CA    . GLU B 2 218 ? -12.27500 19.71200 36.42500  1.000 102.54972 ? 913  GLU A CA    1 
ATOM   3170 C  C     . GLU B 2 218 ? -11.64500 18.33000 36.39100  1.000 99.27839  ? 913  GLU A C     1 
ATOM   3171 O  O     . GLU B 2 218 ? -11.03800 17.89400 37.37100  1.000 103.40425 ? 913  GLU A O     1 
ATOM   3172 C  CB    . GLU B 2 218 ? -12.91700 20.02600 37.77600  1.000 107.14792 ? 913  GLU A CB    1 
ATOM   3173 C  CG    . GLU B 2 218 ? -12.34800 21.32800 38.36700  1.000 109.44448 ? 913  GLU A CG    1 
ATOM   3174 C  CD    . GLU B 2 218 ? -12.94800 21.71400 39.70900  1.000 109.28963 ? 913  GLU A CD    1 
ATOM   3175 O  OE1   . GLU B 2 218 ? -14.19200 21.79300 39.81000  1.000 107.89003 ? 913  GLU A OE1   1 
ATOM   3176 O  OE2   . GLU B 2 218 ? -12.17200 21.94800 40.66000  1.000 107.32952 ? 913  GLU A OE2   1 
ATOM   3177 N  N     . GLU B 2 219 ? -11.76700 17.65200 35.25800  1.000 89.24360  ? 914  GLU A N     1 
ATOM   3178 C  CA    . GLU B 2 219 ? -10.86200 16.58500 34.86200  1.000 97.40155  ? 914  GLU A CA    1 
ATOM   3179 C  C     . GLU B 2 219 ? -9.75800  17.08100 33.93000  1.000 100.02995 ? 914  GLU A C     1 
ATOM   3180 O  O     . GLU B 2 219 ? -8.58000  16.76900 34.14400  1.000 100.56133 ? 914  GLU A O     1 
ATOM   3181 C  CB    . GLU B 2 219 ? -11.65000 15.45600 34.18500  1.000 102.31322 ? 914  GLU A CB    1 
ATOM   3182 C  CG    . GLU B 2 219 ? -10.92300 14.11500 34.14700  1.000 109.12030 ? 914  GLU A CG    1 
ATOM   3183 C  CD    . GLU B 2 219 ? -10.37400 13.76400 32.76400  1.000 115.58668 ? 914  GLU A CD    1 
ATOM   3184 O  OE1   . GLU B 2 219 ? -10.19300 14.68000 31.92900  1.000 116.36028 ? 914  GLU A OE1   1 
ATOM   3185 O  OE2   . GLU B 2 219 ? -10.11200 12.56600 32.51700  1.000 118.62946 ? 914  GLU A OE2   1 
ATOM   3186 N  N     . CYS B 2 220 ? -10.12500 17.85900 32.90500  1.000 86.62044  ? 915  CYS A N     1 
ATOM   3187 C  CA    . CYS B 2 220 ? -9.19400  18.47200 31.96800  1.000 74.27158  ? 915  CYS A CA    1 
ATOM   3188 C  C     . CYS B 2 220 ? -8.81300  19.89100 32.35600  1.000 68.81342  ? 915  CYS A C     1 
ATOM   3189 O  O     . CYS B 2 220 ? -7.77500  20.38200 31.90400  1.000 70.77868  ? 915  CYS A O     1 
ATOM   3190 C  CB    . CYS B 2 220 ? -9.81000  18.52000 30.56900  1.000 75.55108  ? 915  CYS A CB    1 
ATOM   3191 S  SG    . CYS B 2 220 ? -10.91100 17.16300 30.27600  1.000 82.96661  ? 915  CYS A SG    1 
ATOM   3192 N  N     . LYS B 2 221 ? -9.63400  20.55900 33.16200  1.000 64.39830  ? 916  LYS A N     1 
ATOM   3193 C  CA    . LYS B 2 221 ? -9.50800  21.96600 33.52700  1.000 61.02185  ? 916  LYS A CA    1 
ATOM   3194 C  C     . LYS B 2 221 ? -9.53000  22.89000 32.31400  1.000 58.50979  ? 916  LYS A C     1 
ATOM   3195 O  O     . LYS B 2 221 ? -9.32100  24.10900 32.46900  1.000 55.61242  ? 916  LYS A O     1 
ATOM   3196 C  CB    . LYS B 2 221 ? -8.28200  22.21100 34.40500  1.000 64.11291  ? 916  LYS A CB    1 
ATOM   3197 C  CG    . LYS B 2 221 ? -8.34600  21.47300 35.75600  1.000 71.93356  ? 916  LYS A CG    1 
ATOM   3198 C  CD    . LYS B 2 221 ? -7.86600  20.02300 35.65600  1.000 76.69669  ? 916  LYS A CD    1 
ATOM   3199 C  CE    . LYS B 2 221 ? -8.02000  19.26100 36.96300  1.000 76.08730  ? 916  LYS A CE    1 
ATOM   3200 N  NZ    . LYS B 2 221 ? -6.91900  18.27100 37.14800  1.000 73.74597  ? 916  LYS A NZ    1 
ATOM   3201 N  N     . ALA B 2 222 ? -9.81100  22.33800 31.12000  1.000 40.32169  ? 917  ALA A N     1 
ATOM   3202 C  CA    . ALA B 2 222 ? -10.22800 23.14500 29.97900  1.000 41.07127  ? 917  ALA A CA    1 
ATOM   3203 C  C     . ALA B 2 222 ? -11.41300 24.03500 30.34900  1.000 44.97120  ? 917  ALA A C     1 
ATOM   3204 O  O     . ALA B 2 222 ? -12.25600 23.69600 31.19100  1.000 43.13938  ? 917  ALA A O     1 
ATOM   3205 C  CB    . ALA B 2 222 ? -10.60800 22.25100 28.80400  1.000 40.33411  ? 917  ALA A CB    1 
ATOM   3206 N  N     . CYS B 2 223 ? -11.47600 25.18600 29.70300  1.000 47.72105  ? 918  CYS A N     1 
ATOM   3207 C  CA    . CYS B 2 223 ? -12.46200 26.19700 30.02500  1.000 50.39008  ? 918  CYS A CA    1 
ATOM   3208 C  C     . CYS B 2 223 ? -13.38900 26.38400 28.82900  1.000 65.56086  ? 918  CYS A C     1 
ATOM   3209 O  O     . CYS B 2 223 ? -12.92400 26.58000 27.70000  1.000 70.93812  ? 918  CYS A O     1 
ATOM   3210 C  CB    . CYS B 2 223 ? -11.77700 27.50300 30.40200  1.000 50.41269  ? 918  CYS A CB    1 
ATOM   3211 S  SG    . CYS B 2 223 ? -12.79000 28.58500 31.42000  1.000 54.50774  ? 918  CYS A SG    1 
ATOM   3212 N  N     . TYR B 2 224 ? -14.69500 26.30500 29.07900  1.000 67.36030  ? 919  TYR A N     1 
ATOM   3213 C  CA    . TYR B 2 224 ? -15.70600 26.46400 28.05000  1.000 62.29830  ? 919  TYR A CA    1 
ATOM   3214 C  C     . TYR B 2 224 ? -16.73600 27.47800 28.53200  1.000 65.72776  ? 919  TYR A C     1 
ATOM   3215 O  O     . TYR B 2 224 ? -16.85700 27.71000 29.73100  1.000 70.42787  ? 919  TYR A O     1 
ATOM   3216 C  CB    . TYR B 2 224 ? -16.39900 25.13600 27.75300  1.000 60.48796  ? 919  TYR A CB    1 
ATOM   3217 C  CG    . TYR B 2 224 ? -15.48000 23.98500 27.45400  1.000 56.55162  ? 919  TYR A CG    1 
ATOM   3218 C  CD1   . TYR B 2 224 ? -15.01200 23.17100 28.46800  1.000 62.31134  ? 919  TYR A CD1   1 
ATOM   3219 C  CD2   . TYR B 2 224 ? -15.10700 23.68900 26.15400  1.000 59.96111  ? 919  TYR A CD2   1 
ATOM   3220 C  CE1   . TYR B 2 224 ? -14.17200 22.10100 28.19800  1.000 67.25031  ? 919  TYR A CE1   1 
ATOM   3221 C  CE2   . TYR B 2 224 ? -14.27700 22.62200 25.87000  1.000 64.01478  ? 919  TYR A CE2   1 
ATOM   3222 C  CZ    . TYR B 2 224 ? -13.80900 21.83200 26.89100  1.000 68.74522  ? 919  TYR A CZ    1 
ATOM   3223 O  OH    . TYR B 2 224 ? -12.97700 20.77600 26.58500  1.000 70.81422  ? 919  TYR A OH    1 
ATOM   3224 N  N     . HIS B 2 225 ? -17.50000 28.07000 27.60200  1.000 59.77500  ? 920  HIS A N     1 
ATOM   3225 C  CA    . HIS B 2 225 ? -18.65700 28.86900 28.00600  1.000 61.39754  ? 920  HIS A CA    1 
ATOM   3226 C  C     . HIS B 2 225 ? -19.67000 27.98600 28.72700  1.000 61.18703  ? 920  HIS A C     1 
ATOM   3227 O  O     . HIS B 2 225 ? -19.78900 26.78700 28.44300  1.000 59.72367  ? 920  HIS A O     1 
ATOM   3228 C  CB    . HIS B 2 225 ? -19.35000 29.52400 26.80600  1.000 56.79688  ? 920  HIS A CB    1 
ATOM   3229 C  CG    . HIS B 2 225 ? -18.52500 30.55400 26.10000  1.000 56.47428  ? 920  HIS A CG    1 
ATOM   3230 N  ND1   . HIS B 2 225 ? -18.03800 30.37500 24.81300  1.000 53.34274  ? 920  HIS A ND1   1 
ATOM   3231 C  CD2   . HIS B 2 225 ? -18.11600 31.78600 26.48900  1.000 52.28904  ? 920  HIS A CD2   1 
ATOM   3232 C  CE1   . HIS B 2 225 ? -17.36100 31.44600 24.45500  1.000 49.76809  ? 920  HIS A CE1   1 
ATOM   3233 N  NE2   . HIS B 2 225 ? -17.38800 32.31900 25.45300  1.000 50.63851  ? 920  HIS A NE2   1 
ATOM   3234 N  N     . LYS B 2 226 ? -20.40400 28.58600 29.67500  1.000 60.37093  ? 921  LYS A N     1 
ATOM   3235 C  CA    . LYS B 2 226 ? -21.54600 27.88400 30.26700  1.000 64.68683  ? 921  LYS A CA    1 
ATOM   3236 C  C     . LYS B 2 226 ? -22.52100 27.43200 29.19600  1.000 67.49432  ? 921  LYS A C     1 
ATOM   3237 O  O     . LYS B 2 226 ? -22.90300 26.25500 29.14500  1.000 64.82375  ? 921  LYS A O     1 
ATOM   3238 C  CB    . LYS B 2 226 ? -22.26500 28.77000 31.27800  1.000 57.86609  ? 921  LYS A CB    1 
ATOM   3239 C  CG    . LYS B 2 226 ? -22.06600 28.32400 32.70300  1.000 56.38969  ? 921  LYS A CG    1 
ATOM   3240 C  CD    . LYS B 2 226 ? -22.04200 29.54300 33.60600  1.000 63.12825  ? 921  LYS A CD    1 
ATOM   3241 C  CE    . LYS B 2 226 ? -21.49700 29.22300 34.98600  1.000 64.95193  ? 921  LYS A CE    1 
ATOM   3242 N  NZ    . LYS B 2 226 ? -21.41300 30.49300 35.73500  1.000 65.58058  ? 921  LYS A NZ    1 
ATOM   3243 N  N     . ALA B 2 227 ? -22.92300 28.36600 28.32700  1.000 64.39981  ? 922  ALA A N     1 
ATOM   3244 C  CA    . ALA B 2 227 ? -23.85000 28.07700 27.23700  1.000 63.68641  ? 922  ALA A CA    1 
ATOM   3245 C  C     . ALA B 2 227 ? -23.43400 26.85700 26.42100  1.000 66.65381  ? 922  ALA A C     1 
ATOM   3246 O  O     . ALA B 2 227 ? -24.28000 26.03100 26.04900  1.000 71.99502  ? 922  ALA A O     1 
ATOM   3247 C  CB    . ALA B 2 227 ? -23.95100 29.30000 26.33200  1.000 64.13035  ? 922  ALA A CB    1 
ATOM   3248 N  N     . CYS B 2 228 ? -22.12800 26.72900 26.13700  1.000 67.28435  ? 923  CYS A N     1 
ATOM   3249 C  CA    . CYS B 2 228 ? -21.60000 25.72900 25.21000  1.000 72.74156  ? 923  CYS A CA    1 
ATOM   3250 C  C     . CYS B 2 228 ? -21.37500 24.35300 25.84900  1.000 71.38954  ? 923  CYS A C     1 
ATOM   3251 O  O     . CYS B 2 228 ? -21.38200 23.33600 25.12900  1.000 65.22243  ? 923  CYS A O     1 
ATOM   3252 C  CB    . CYS B 2 228 ? -20.26800 26.19500 24.58900  1.000 75.09994  ? 923  CYS A CB    1 
ATOM   3253 S  SG    . CYS B 2 228 ? -20.06400 27.95000 23.86800  1.000 67.49172  ? 923  CYS A SG    1 
ATOM   3254 N  N     . PHE B 2 229 ? -21.21600 24.27900 27.18000  1.000 80.55434  ? 924  PHE A N     1 
ATOM   3255 C  CA    . PHE B 2 229 ? -20.82800 23.02200 27.81200  1.000 84.09535  ? 924  PHE A CA    1 
ATOM   3256 C  C     . PHE B 2 229 ? -22.01300 22.24200 28.35800  1.000 92.58315  ? 924  PHE A C     1 
ATOM   3257 O  O     . PHE B 2 229 ? -22.60500 21.42900 27.64700  1.000 89.87441  ? 924  PHE A O     1 
ATOM   3258 C  CB    . PHE B 2 229 ? -19.83600 23.27200 28.94600  1.000 77.27233  ? 924  PHE A CB    1 
ATOM   3259 C  CG    . PHE B 2 229 ? -18.95500 22.08200 29.25100  1.000 71.54832  ? 924  PHE A CG    1 
ATOM   3260 C  CD1   . PHE B 2 229 ? -18.96400 20.97600 28.41700  1.000 67.63356  ? 924  PHE A CD1   1 
ATOM   3261 C  CD2   . PHE B 2 229 ? -18.13600 22.06000 30.37300  1.000 69.41375  ? 924  PHE A CD2   1 
ATOM   3262 C  CE1   . PHE B 2 229 ? -18.17800 19.87700 28.68200  1.000 63.59173  ? 924  PHE A CE1   1 
ATOM   3263 C  CE2   . PHE B 2 229 ? -17.35400 20.96700 30.64400  1.000 67.25274  ? 924  PHE A CE2   1 
ATOM   3264 C  CZ    . PHE B 2 229 ? -17.37100 19.87200 29.79600  1.000 65.26002  ? 924  PHE A CZ    1 
ATOM   3265 N  N     . LYS B 2 230 ? -22.33800 22.49600 29.63000  1.000 120.16588 ? 925  LYS A N     1 
ATOM   3266 C  CA    . LYS B 2 230 ? -23.25400 21.75200 30.50700  1.000 125.28393 ? 925  LYS A CA    1 
ATOM   3267 C  C     . LYS B 2 230 ? -23.83600 20.45400 29.93900  1.000 128.74984 ? 925  LYS A C     1 
ATOM   3268 O  O     . LYS B 2 230 ? -23.83600 19.42600 30.63600  1.000 129.55480 ? 925  LYS A O     1 
ATOM   3269 C  CB    . LYS B 2 230 ? -24.38500 22.68400 30.97000  1.000 122.22823 ? 925  LYS A CB    1 
ATOM   3270 C  CG    . LYS B 2 230 ? -25.42500 22.07000 31.88800  1.000 122.20761 ? 925  LYS A CG    1 
ATOM   3271 C  CD    . LYS B 2 230 ? -26.69300 21.63500 31.16500  1.000 124.60600 ? 925  LYS A CD    1 
ATOM   3272 C  CE    . LYS B 2 230 ? -27.51400 20.67900 32.00300  1.000 117.09861 ? 925  LYS A CE    1 
ATOM   3273 N  NZ    . LYS B 2 230 ? -26.94700 19.31900 31.90600  1.000 112.43513 ? 925  LYS A NZ    1 
ATOM   3274 N  N     . SER B 2 231 ? -24.29700 20.47500 28.68200  1.000 134.01721 ? 926  SER A N     1 
ATOM   3275 C  CA    . SER B 2 231 ? -24.78400 19.26700 28.02500  1.000 132.34342 ? 926  SER A CA    1 
ATOM   3276 C  C     . SER B 2 231 ? -23.62700 18.45400 27.44600  1.000 131.51581 ? 926  SER A C     1 
ATOM   3277 O  O     . SER B 2 231 ? -22.79400 18.98000 26.70200  1.000 135.17750 ? 926  SER A O     1 
ATOM   3278 C  CB    . SER B 2 231 ? -25.78000 19.62900 26.92300  1.000 130.82533 ? 926  SER A CB    1 
ATOM   3279 O  OG    . SER B 2 231 ? -25.79800 18.67400 25.85700  1.000 128.74051 ? 926  SER A OG    1 
ATOM   3280 N  N     . GLY B 2 232 ? -23.55700 17.17900 27.81000  1.000 105.52806 ? 927  GLY A N     1 
ATOM   3281 C  CA    . GLY B 2 232 ? -22.56600 16.30100 27.22000  1.000 97.25521  ? 927  GLY A CA    1 
ATOM   3282 C  C     . GLY B 2 232 ? -21.22000 16.36100 27.91400  1.000 87.31564  ? 927  GLY A C     1 
ATOM   3283 O  O     . GLY B 2 232 ? -21.04900 16.91600 29.00700  1.000 75.65663  ? 927  GLY A O     1 
ATOM   3284 N  N     . SER B 2 233 ? -20.24400 15.77600 27.23000  1.000 106.17615 ? 928  SER A N     1 
ATOM   3285 C  CA    . SER B 2 233 ? -18.90500 15.57000 27.74500  1.000 105.25496 ? 928  SER A CA    1 
ATOM   3286 C  C     . SER B 2 233 ? -17.97900 16.69600 27.28700  1.000 104.63065 ? 928  SER A C     1 
ATOM   3287 O  O     . SER B 2 233 ? -18.37100 17.60700 26.55600  1.000 105.20781 ? 928  SER A O     1 
ATOM   3288 C  CB    . SER B 2 233 ? -18.37800 14.20500 27.29300  1.000 106.23915 ? 928  SER A CB    1 
ATOM   3289 O  OG    . SER B 2 233 ? -17.99600 14.23200 25.92900  1.000 105.14094 ? 928  SER A OG    1 
ATOM   3290 N  N     . CYS B 2 234 ? -16.70400 16.61800 27.73200  1.000 98.11065  ? 929  CYS A N     1 
ATOM   3291 C  CA    . CYS B 2 234 ? -15.63100 17.55200 27.42000  1.000 94.99758  ? 929  CYS A CA    1 
ATOM   3292 C  C     . CYS B 2 234 ? -14.85200 17.03800 26.22100  1.000 92.51002  ? 929  CYS A C     1 
ATOM   3293 O  O     . CYS B 2 234 ? -14.39200 15.88700 26.23900  1.000 92.67719  ? 929  CYS A O     1 
ATOM   3294 C  CB    . CYS B 2 234 ? -14.70300 17.71500 28.62600  1.000 96.85888  ? 929  CYS A CB    1 
ATOM   3295 S  SG    . CYS B 2 234 ? -13.08900 18.51500 28.35600  1.000 94.21961  ? 929  CYS A SG    1 
ATOM   3296 N  N     . PRO B 2 235 ? -14.71200 17.83800 25.15700  1.000 82.43647  ? 930  PRO A N     1 
ATOM   3297 C  CA    . PRO B 2 235 ? -14.02300 17.34400 23.95200  1.000 77.23297  ? 930  PRO A CA    1 
ATOM   3298 C  C     . PRO B 2 235 ? -12.54700 17.05300 24.17100  1.000 76.10183  ? 930  PRO A C     1 
ATOM   3299 O  O     . PRO B 2 235 ? -11.99700 16.17200 23.49200  1.000 75.53212  ? 930  PRO A O     1 
ATOM   3300 C  CB    . PRO B 2 235 ? -14.23800 18.48000 22.94400  1.000 72.09574  ? 930  PRO A CB    1 
ATOM   3301 C  CG    . PRO B 2 235 ? -14.49800 19.70100 23.79300  1.000 72.93697  ? 930  PRO A CG    1 
ATOM   3302 C  CD    . PRO B 2 235 ? -15.24700 19.19900 24.97500  1.000 80.56782  ? 930  PRO A CD    1 
ATOM   3303 N  N     . ARG B 2 236 ? -11.90200 17.75100 25.11400  1.000 68.64408  ? 931  ARG A N     1 
ATOM   3304 C  CA    . ARG B 2 236 ? -10.46500 17.59400 25.31900  1.000 68.12838  ? 931  ARG A CA    1 
ATOM   3305 C  C     . ARG B 2 236 ? -10.10900 16.15600 25.68100  1.000 75.27040  ? 931  ARG A C     1 
ATOM   3306 O  O     . ARG B 2 236 ? -9.18800  15.56800 25.10100  1.000 72.84506  ? 931  ARG A O     1 
ATOM   3307 C  CB    . ARG B 2 236 ? -9.98800  18.56500 26.40000  1.000 64.24912  ? 931  ARG A CB    1 
ATOM   3308 C  CG    . ARG B 2 236 ? -8.49200  18.51900 26.67300  1.000 60.58500  ? 931  ARG A CG    1 
ATOM   3309 C  CD    . ARG B 2 236 ? -7.78400  19.80200 26.23500  1.000 56.48897  ? 931  ARG A CD    1 
ATOM   3310 N  NE    . ARG B 2 236 ? -7.86300  20.87600 27.22800  1.000 52.99213  ? 931  ARG A NE    1 
ATOM   3311 C  CZ    . ARG B 2 236 ? -6.94700  21.10500 28.17100  1.000 62.75412  ? 931  ARG A CZ    1 
ATOM   3312 N  NH1   . ARG B 2 236 ? -5.87700  20.31800 28.27500  1.000 66.72467  ? 931  ARG A NH1   1 
ATOM   3313 N  NH2   . ARG B 2 236 ? -7.09700  22.11200 29.02700  1.000 63.52807  ? 931  ARG A NH2   1 
ATOM   3314 N  N     . CYS B 2 237 ? -10.84100 15.56400 26.63000  1.000 108.75917 ? 932  CYS A N     1 
ATOM   3315 C  CA    . CYS B 2 237 ? -10.54400 14.20000 27.06100  1.000 111.79068 ? 932  CYS A CA    1 
ATOM   3316 C  C     . CYS B 2 237 ? -11.02600 13.15200 26.06300  1.000 107.14064 ? 932  CYS A C     1 
ATOM   3317 O  O     . CYS B 2 237 ? -10.47000 12.04700 26.02000  1.000 103.86198 ? 932  CYS A O     1 
ATOM   3318 C  CB    . CYS B 2 237 ? -11.14600 13.95900 28.44300  1.000 117.91306 ? 932  CYS A CB    1 
ATOM   3319 S  SG    . CYS B 2 237 ? -12.70800 14.81000 28.69100  1.000 124.55536 ? 932  CYS A SG    1 
ATOM   3320 N  N     . GLU B 2 238 ? -12.03700 13.47900 25.25300  1.000 92.01234  ? 933  GLU A N     1 
ATOM   3321 C  CA    . GLU B 2 238 ? -12.46000 12.57800 24.18500  1.000 96.54930  ? 933  GLU A CA    1 
ATOM   3322 C  C     . GLU B 2 238 ? -11.29200 12.21400 23.27300  1.000 101.57482 ? 933  GLU A C     1 
ATOM   3323 O  O     . GLU B 2 238 ? -11.19500 11.07300 22.80200  1.000 103.25175 ? 933  GLU A O     1 
ATOM   3324 C  CB    . GLU B 2 238 ? -13.59700 13.21500 23.38400  1.000 99.62460  ? 933  GLU A CB    1 
ATOM   3325 C  CG    . GLU B 2 238 ? -14.56200 12.21600 22.73800  1.000 107.24669 ? 933  GLU A CG    1 
ATOM   3326 C  CD    . GLU B 2 238 ? -14.45300 12.20500 21.21000  1.000 114.65299 ? 933  GLU A CD    1 
ATOM   3327 O  OE1   . GLU B 2 238 ? -13.61700 12.96700 20.66800  1.000 119.19860 ? 933  GLU A OE1   1 
ATOM   3328 O  OE2   . GLU B 2 238 ? -15.19000 11.43100 20.55400  1.000 115.47077 ? 933  GLU A OE2   1 
ATOM   3329 N  N     . ARG B 2 239 ? -10.38400 13.16700 23.02800  1.000 103.88275 ? 934  ARG A N     1 
ATOM   3330 C  CA    . ARG B 2 239 ? -9.19000  12.90100 22.22500  1.000 100.06213 ? 934  ARG A CA    1 
ATOM   3331 C  C     . ARG B 2 239 ? -8.06300  12.29600 23.05600  1.000 97.65493  ? 934  ARG A C     1 
ATOM   3332 O  O     . ARG B 2 239 ? -7.45300  11.30100 22.64800  1.000 99.29644  ? 934  ARG A O     1 
ATOM   3333 C  CB    . ARG B 2 239 ? -8.68100  14.18500 21.57700  1.000 95.66997  ? 934  ARG A CB    1 
ATOM   3334 C  CG    . ARG B 2 239 ? -9.54100  14.74200 20.49700  1.000 94.64651  ? 934  ARG A CG    1 
ATOM   3335 C  CD    . ARG B 2 239 ? -8.89700  16.00800 19.97200  1.000 92.53271  ? 934  ARG A CD    1 
ATOM   3336 N  NE    . ARG B 2 239 ? -8.41400  16.89500 21.03900  1.000 88.24441  ? 934  ARG A NE    1 
ATOM   3337 C  CZ    . ARG B 2 239 ? -9.09400  17.93800 21.51900  1.000 81.05316  ? 934  ARG A CZ    1 
ATOM   3338 N  NH1   . ARG B 2 239 ? -10.29400 18.22100 21.03300  1.000 78.32221  ? 934  ARG A NH1   1 
ATOM   3339 N  NH2   . ARG B 2 239 ? -8.58400  18.69900 22.48600  1.000 75.72071  ? 934  ARG A NH2   1 
ATOM   3340 N  N     . LEU B 2 240 ? -7.75100  12.91300 24.20800  1.000 98.00549  ? 935  LEU A N     1 
ATOM   3341 C  CA    . LEU B 2 240 ? -6.59300  12.51800 25.01300  1.000 100.41962 ? 935  LEU A CA    1 
ATOM   3342 C  C     . LEU B 2 240 ? -6.61100  11.04300 25.38100  1.000 107.35682 ? 935  LEU A C     1 
ATOM   3343 O  O     . LEU B 2 240 ? -5.54700  10.42200 25.53700  1.000 107.56821 ? 935  LEU A O     1 
ATOM   3344 C  CB    . LEU B 2 240 ? -6.53200  13.34800 26.29200  1.000 95.13969  ? 935  LEU A CB    1 
ATOM   3345 C  CG    . LEU B 2 240 ? -5.91400  14.73600 26.25900  1.000 88.48906  ? 935  LEU A CG    1 
ATOM   3346 C  CD1   . LEU B 2 240 ? -6.20000  15.44500 27.58600  1.000 85.45753  ? 935  LEU A CD1   1 
ATOM   3347 C  CD2   . LEU B 2 240 ? -4.42100  14.64100 25.98800  1.000 83.64295  ? 935  LEU A CD2   1 
ATOM   3348 N  N     . GLN B 2 241 ? -7.80100  10.47700 25.56400  1.000 111.07432 ? 936  GLN A N     1 
ATOM   3349 C  CA    . GLN B 2 241 ? -7.94000  9.07300  25.90000  1.000 111.52534 ? 936  GLN A CA    1 
ATOM   3350 C  C     . GLN B 2 241 ? -8.50000  8.24800  24.74500  1.000 109.69262 ? 936  GLN A C     1 
ATOM   3351 O  O     . GLN B 2 241 ? -8.67600  7.03400  24.89300  1.000 111.85358 ? 936  GLN A O     1 
ATOM   3352 C  CB    . GLN B 2 241 ? -8.78800  8.91800  27.16800  1.000 110.97776 ? 936  GLN A CB    1 
ATOM   3353 C  CG    . GLN B 2 241 ? -7.94000  8.92600  28.47000  1.000 108.27550 ? 936  GLN A CG    1 
ATOM   3354 C  CD    . GLN B 2 241 ? -6.77200  9.93400  28.44600  1.000 105.60778 ? 936  GLN A CD    1 
ATOM   3355 O  OE1   . GLN B 2 241 ? -6.97600  11.14500 28.56500  1.000 105.11816 ? 936  GLN A OE1   1 
ATOM   3356 N  NE2   . GLN B 2 241 ? -5.55000  9.42900  28.27200  1.000 101.79020 ? 936  GLN A NE2   1 
ATOM   3357 N  N     . ALA B 2 242 ? -8.76300  8.86900  23.59200  1.000 99.21263  ? 937  ALA A N     1 
ATOM   3358 C  CA    . ALA B 2 242 ? -8.72000  8.15500  22.32000  1.000 101.26502 ? 937  ALA A CA    1 
ATOM   3359 C  C     . ALA B 2 242 ? -7.31500  8.15700  21.72100  1.000 103.46780 ? 937  ALA A C     1 
ATOM   3360 O  O     . ALA B 2 242 ? -7.10600  7.57000  20.65100  1.000 101.63556 ? 937  ALA A O     1 
ATOM   3361 C  CB    . ALA B 2 242 ? -9.71700  8.75100  21.32300  1.000 99.64773  ? 937  ALA A CB    1 
ATOM   3362 N  N     . ARG B 2 243 ? -6.35800  8.80100  22.40000  1.000 124.47230 ? 938  ARG A N     1 
ATOM   3363 C  CA    . ARG B 2 243 ? -4.95200  8.81500  21.98800  1.000 126.56268 ? 938  ARG A CA    1 
ATOM   3364 C  C     . ARG B 2 243 ? -4.25700  7.52600  22.40500  1.000 129.64722 ? 938  ARG A C     1 
ATOM   3365 O  O     . ARG B 2 243 ? -3.85600  6.71300  21.56500  1.000 130.16902 ? 938  ARG A O     1 
ATOM   3366 C  CB    . ARG B 2 243 ? -4.24400  10.01900 22.61700  1.000 122.23877 ? 938  ARG A CB    1 
ATOM   3367 C  CG    . ARG B 2 243 ? -4.38700  11.29400 21.83400  1.000 117.42856 ? 938  ARG A CG    1 
ATOM   3368 C  CD    . ARG B 2 243 ? -3.24800  11.48000 20.86000  1.000 113.75784 ? 938  ARG A CD    1 
ATOM   3369 N  NE    . ARG B 2 243 ? -3.58000  12.46000 19.83200  1.000 112.66191 ? 938  ARG A NE    1 
ATOM   3370 C  CZ    . ARG B 2 243 ? -3.70500  13.76600 20.04900  1.000 113.07463 ? 938  ARG A CZ    1 
ATOM   3371 N  NH1   . ARG B 2 243 ? -3.53300  14.26900 21.26600  1.000 110.98273 ? 938  ARG A NH1   1 
ATOM   3372 N  NH2   . ARG B 2 243 ? -4.00900  14.57300 19.04400  1.000 115.29849 ? 938  ARG A NH2   1 
ATOM   3373 N  N     . ARG B 2 244 ? -4.09100  7.34400  23.71600  1.000 132.80503 ? 939  ARG A N     1 
ATOM   3374 C  CA    . ARG B 2 244 ? -3.62400  6.07600  24.25900  1.000 134.82678 ? 939  ARG A CA    1 
ATOM   3375 C  C     . ARG B 2 244 ? -4.48000  4.90700  23.77500  1.000 142.51358 ? 939  ARG A C     1 
ATOM   3376 O  O     . ARG B 2 244 ? -4.01200  3.75600  23.77100  1.000 143.15207 ? 939  ARG A O     1 
ATOM   3377 C  CB    . ARG B 2 244 ? -3.62100  6.15600  25.78500  1.000 129.62492 ? 939  ARG A CB    1 
ATOM   3378 C  CG    . ARG B 2 244 ? -2.87600  5.03900  26.48600  1.000 128.66765 ? 939  ARG A CG    1 
ATOM   3379 C  CD    . ARG B 2 244 ? -1.56700  4.70000  25.78700  1.000 126.58485 ? 939  ARG A CD    1 
ATOM   3380 N  NE    . ARG B 2 244 ? -0.64700  4.00500  26.68600  1.000 125.11263 ? 939  ARG A NE    1 
ATOM   3381 C  CZ    . ARG B 2 244 ? 0.59400   4.40600  26.95200  1.000 120.05675 ? 939  ARG A CZ    1 
ATOM   3382 N  NH1   . ARG B 2 244 ? 1.35900   3.71300  27.78700  1.000 112.57473 ? 939  ARG A NH1   1 
ATOM   3383 N  NH2   . ARG B 2 244 ? 1.07800   5.49000  26.36700  1.000 122.27094 ? 939  ARG A NH2   1 
ATOM   3384 N  N     . GLU B 2 245 ? -5.72900  5.19000  23.36100  1.000 155.47683 ? 940  GLU A N     1 
ATOM   3385 C  CA    . GLU B 2 245 ? -6.63200  4.18400  22.80000  1.000 159.66038 ? 940  GLU A CA    1 
ATOM   3386 C  C     . GLU B 2 245 ? -6.06100  3.53300  21.54200  1.000 160.35403 ? 940  GLU A C     1 
ATOM   3387 O  O     . GLU B 2 245 ? -6.16900  2.31500  21.36800  1.000 163.31377 ? 940  GLU A O     1 
ATOM   3388 C  CB    . GLU B 2 245 ? -7.98300  4.83300  22.46000  1.000 160.13724 ? 940  GLU A CB    1 
ATOM   3389 C  CG    . GLU B 2 245 ? -9.17100  3.88700  22.30600  1.000 158.70882 ? 940  GLU A CG    1 
ATOM   3390 C  CD    . GLU B 2 245 ? -10.00100 3.73700  23.57500  1.000 155.39489 ? 940  GLU A CD    1 
ATOM   3391 O  OE1   . GLU B 2 245 ? -11.23900 3.62400  23.45600  1.000 155.12384 ? 940  GLU A OE1   1 
ATOM   3392 O  OE2   . GLU B 2 245 ? -9.43300  3.72600  24.68600  1.000 154.45444 ? 940  GLU A OE2   1 
ATOM   3393 N  N     . ALA B 2 246 ? -5.54700  4.33000  20.60800  1.000 157.23088 ? 941  ALA A N     1 
ATOM   3394 C  CA    . ALA B 2 246 ? -4.97500  3.79600  19.37700  1.000 153.48944 ? 941  ALA A CA    1 
ATOM   3395 C  C     . ALA B 2 246 ? -3.48500  3.49300  19.49000  1.000 150.26699 ? 941  ALA A C     1 
ATOM   3396 O  O     . ALA B 2 246 ? -2.91700  2.89100  18.56500  1.000 151.84943 ? 941  ALA A O     1 
ATOM   3397 C  CB    . ALA B 2 246 ? -5.21700  4.76100  18.20500  1.000 150.52146 ? 941  ALA A CB    1 
ATOM   3398 N  N     . LEU B 2 247 ? -2.85100  3.90500  20.59000  1.000 126.50508 ? 942  LEU A N     1 
ATOM   3399 C  CA    . LEU B 2 247 ? -1.48200  3.53000  20.92300  1.000 119.95745 ? 942  LEU A CA    1 
ATOM   3400 C  C     . LEU B 2 247 ? -1.38100  2.12600  21.51600  1.000 122.01087 ? 942  LEU A C     1 
ATOM   3401 O  O     . LEU B 2 247 ? -0.39000  1.43100  21.26800  1.000 120.19684 ? 942  LEU A O     1 
ATOM   3402 C  CB    . LEU B 2 247 ? -0.89500  4.55900  21.91300  1.000 109.87741 ? 942  LEU A CB    1 
ATOM   3403 C  CG    . LEU B 2 247 ? 0.57800   4.46200  22.32400  1.000 100.91883 ? 942  LEU A CG    1 
ATOM   3404 C  CD1   . LEU B 2 247 ? 1.52900   4.24700  21.14200  1.000 101.69042 ? 942  LEU A CD1   1 
ATOM   3405 C  CD2   . LEU B 2 247 ? 0.95400   5.68900  23.14900  1.000 93.80816  ? 942  LEU A CD2   1 
ATOM   3406 N  N     . ALA B 2 248 ? -2.35700  1.70900  22.32400  1.000 116.48885 ? 943  ALA A N     1 
ATOM   3407 C  CA    . ALA B 2 248 ? -2.30100  0.44000  23.07500  1.000 117.40338 ? 943  ALA A CA    1 
ATOM   3408 C  C     . ALA B 2 248 ? -2.42300  -0.80200 22.18400  1.000 116.59992 ? 943  ALA A C     1 
ATOM   3409 O  O     . ALA B 2 248 ? -2.05400  -1.90600 22.60100  1.000 114.29505 ? 943  ALA A O     1 
ATOM   3410 C  CB    . ALA B 2 248 ? -3.38300  0.42700  24.14100  1.000 117.73637 ? 943  ALA A CB    1 
HETATM 3411 P  PG    . GTP C 3 .   ? 11.12500  23.32600 28.32100  1.000 50.85150  ? 1401 GTP B PG    1 
HETATM 3412 O  O1G   . GTP C 3 .   ? 11.80500  24.67700 28.61000  1.000 50.89364  ? 1401 GTP B O1G   1 
HETATM 3413 O  O2G   . GTP C 3 .   ? 9.80200   23.50500 27.60300  1.000 50.13726  ? 1401 GTP B O2G   1 
HETATM 3414 O  O3G   . GTP C 3 .   ? 10.84100  22.52700 29.56400  1.000 51.39083  ? 1401 GTP B O3G   1 
HETATM 3415 O  O3B   . GTP C 3 .   ? 12.08300  22.42600 27.40200  1.000 48.33766  ? 1401 GTP B O3B   1 
HETATM 3416 P  PB    . GTP C 3 .   ? 13.08800  23.18400 26.41100  1.000 42.07881  ? 1401 GTP B PB    1 
HETATM 3417 O  O1B   . GTP C 3 .   ? 13.01000  22.42700 25.10400  1.000 34.78067  ? 1401 GTP B O1B   1 
HETATM 3418 O  O2B   . GTP C 3 .   ? 12.73500  24.65700 26.30000  1.000 42.04069  ? 1401 GTP B O2B   1 
HETATM 3419 O  O3A   . GTP C 3 .   ? 14.46200  22.93500 27.18400  1.000 45.05826  ? 1401 GTP B O3A   1 
HETATM 3420 P  PA    . GTP C 3 .   ? 15.89500  23.45900 26.68900  1.000 47.16632  ? 1401 GTP B PA    1 
HETATM 3421 O  O1A   . GTP C 3 .   ? 15.75300  24.30400 25.45200  1.000 42.16198  ? 1401 GTP B O1A   1 
HETATM 3422 O  O2A   . GTP C 3 .   ? 16.45400  24.29900 27.82800  1.000 43.45214  ? 1401 GTP B O2A   1 
HETATM 3423 O  "O5'" . GTP C 3 .   ? 16.73900  22.10000 26.39500  1.000 47.55714  ? 1401 GTP B "O5'" 1 
HETATM 3424 C  "C5'" . GTP C 3 .   ? 17.07400  21.13400 27.39700  1.000 46.84981  ? 1401 GTP B "C5'" 1 
HETATM 3425 C  "C4'" . GTP C 3 .   ? 18.58900  20.91300 27.57300  1.000 41.49845  ? 1401 GTP B "C4'" 1 
HETATM 3426 O  "O4'" . GTP C 3 .   ? 19.15800  20.42800 26.36500  1.000 42.70017  ? 1401 GTP B "O4'" 1 
HETATM 3427 C  "C3'" . GTP C 3 .   ? 19.32700  22.19800 27.92400  1.000 44.15004  ? 1401 GTP B "C3'" 1 
HETATM 3428 O  "O3'" . GTP C 3 .   ? 20.32500  21.92400 28.87500  1.000 47.36401  ? 1401 GTP B "O3'" 1 
HETATM 3429 C  "C2'" . GTP C 3 .   ? 20.01800  22.58500 26.64300  1.000 45.19083  ? 1401 GTP B "C2'" 1 
HETATM 3430 O  "O2'" . GTP C 3 .   ? 21.17200  23.33800 26.92300  1.000 45.71648  ? 1401 GTP B "O2'" 1 
HETATM 3431 C  "C1'" . GTP C 3 .   ? 20.26400  21.23500 25.97300  1.000 45.80659  ? 1401 GTP B "C1'" 1 
HETATM 3432 N  N9    . GTP C 3 .   ? 20.26800  21.42000 24.51800  1.000 42.91053  ? 1401 GTP B N9    1 
HETATM 3433 C  C8    . GTP C 3 .   ? 19.31600  22.11100 23.82200  1.000 43.50370  ? 1401 GTP B C8    1 
HETATM 3434 N  N7    . GTP C 3 .   ? 19.62300  22.09500 22.51100  1.000 43.24139  ? 1401 GTP B N7    1 
HETATM 3435 C  C5    . GTP C 3 .   ? 20.77500  21.39000 22.35400  1.000 49.67497  ? 1401 GTP B C5    1 
HETATM 3436 C  C6    . GTP C 3 .   ? 21.54000  21.06100 21.22800  1.000 53.33959  ? 1401 GTP B C6    1 
HETATM 3437 O  O6    . GTP C 3 .   ? 21.20900  21.42000 20.09700  1.000 56.43244  ? 1401 GTP B O6    1 
HETATM 3438 N  N1    . GTP C 3 .   ? 22.68800  20.32000 21.36900  1.000 52.33351  ? 1401 GTP B N1    1 
HETATM 3439 C  C2    . GTP C 3 .   ? 23.08200  19.90400 22.61900  1.000 50.82721  ? 1401 GTP B C2    1 
HETATM 3440 N  N2    . GTP C 3 .   ? 24.19600  19.18800 22.72900  1.000 48.68555  ? 1401 GTP B N2    1 
HETATM 3441 N  N3    . GTP C 3 .   ? 22.32600  20.22800 23.73500  1.000 52.04759  ? 1401 GTP B N3    1 
HETATM 3442 C  C4    . GTP C 3 .   ? 21.19100  20.96200 23.61200  1.000 48.15252  ? 1401 GTP B C4    1 
HETATM 3443 MG MG    . MG  D 4 .   ? 11.42300  26.08400 27.45600  1.000 77.99258  ? 1402 MG  B MG    1 
HETATM 3444 ZN ZN    . ZN  E 5 .   ? -10.44400 13.11100 85.34100  1.000 122.93764 ? 1001 ZN  A ZN    1 
HETATM 3445 ZN ZN    . ZN  F 5 .   ? 0.49300   38.79400 34.25500  1.000 173.99183 ? 1002 ZN  A ZN    1 
HETATM 3446 ZN ZN    . ZN  G 5 .   ? -18.24800 28.85700 23.77100  1.000 178.06369 ? 1003 ZN  A ZN    1 
HETATM 3447 ZN ZN    . ZN  H 5 .   ? -13.24100 17.29900 30.46100  1.000 199.17558 ? 1004 ZN  A ZN    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . VAL A 9   ? 0.84278 0.72023 0.73968 0.16816  0.12029  0.08993  7    VAL B N     
2    C  CA    . VAL A 9   ? 0.81687 0.73218 0.74511 0.15759  0.10282  0.09089  7    VAL B CA    
3    C  C     . VAL A 9   ? 0.83376 0.74669 0.76843 0.14168  0.09482  0.08392  7    VAL B C     
4    O  O     . VAL A 9   ? 0.83078 0.71986 0.75749 0.12931  0.09443  0.07350  7    VAL B O     
5    C  CB    . VAL A 9   ? 0.74727 0.67315 0.69226 0.14877  0.09250  0.08634  7    VAL B CB    
6    C  CG1   . VAL A 9   ? 0.61096 0.57733 0.58365 0.14240  0.07840  0.09079  7    VAL B CG1   
7    C  CG2   . VAL A 9   ? 0.79514 0.71130 0.72784 0.16246  0.10239  0.08982  7    VAL B CG2   
8    N  N     . LEU A 10  ? 0.88221 0.82214 0.83135 0.14154  0.08829  0.08981  8    LEU B N     
9    C  CA    . LEU A 10  ? 0.86227 0.80270 0.81802 0.12842  0.08104  0.08470  8    LEU B CA    
10   C  C     . LEU A 10  ? 0.77981 0.75481 0.76159 0.12058  0.06683  0.08726  8    LEU B C     
11   O  O     . LEU A 10  ? 0.70446 0.70628 0.69398 0.12851  0.06611  0.09657  8    LEU B O     
12   C  CB    . LEU A 10  ? 0.88784 0.81735 0.82733 0.13640  0.09104  0.08883  8    LEU B CB    
13   C  CG    . LEU A 10  ? 0.85252 0.78366 0.79778 0.12436  0.08459  0.08463  8    LEU B CG    
14   C  CD1   . LEU A 10  ? 0.90396 0.80285 0.82341 0.12526  0.09702  0.08144  8    LEU B CD1   
15   C  CD2   . LEU A 10  ? 0.76148 0.72519 0.72334 0.12745  0.07793  0.09281  8    LEU B CD2   
16   N  N     . LEU A 11  ? 0.69894 0.67325 0.69208 0.10493  0.05654  0.07935  9    LEU B N     
17   C  CA    . LEU A 11  ? 0.61987 0.61990 0.63353 0.09584  0.04453  0.08053  9    LEU B CA    
18   C  C     . LEU A 11  ? 0.56457 0.56720 0.58085 0.08986  0.04113  0.07958  9    LEU B C     
19   O  O     . LEU A 11  ? 0.63977 0.62290 0.64716 0.08529  0.04335  0.07370  9    LEU B O     
20   C  CB    . LEU A 11  ? 0.53087 0.52765 0.55421 0.08413  0.03638  0.07359  9    LEU B CB    
21   C  CG    . LEU A 11  ? 0.49204 0.48238 0.51189 0.08889  0.03972  0.07307  9    LEU B CG    
22   C  CD1   . LEU A 11  ? 0.50936 0.49901 0.54016 0.07727  0.03109  0.06709  9    LEU B CD1   
23   C  CD2   . LEU A 11  ? 0.52754 0.54119 0.55093 0.09955  0.04225  0.08286  9    LEU B CD2   
24   N  N     . LYS A 12  ? 0.47156 0.49924 0.49949 0.08861  0.03573  0.08507  10   LYS B N     
25   C  CA    . LYS A 12  ? 0.47660 0.50865 0.50873 0.08219  0.03146  0.08425  10   LYS B CA    
26   C  C     . LYS A 12  ? 0.49124 0.53325 0.53718 0.06948  0.02126  0.08118  10   LYS B C     
27   O  O     . LYS A 12  ? 0.47027 0.53098 0.52454 0.06705  0.01749  0.08470  10   LYS B O     
28   C  CB    . LYS A 12  ? 0.46005 0.51061 0.49173 0.09038  0.03446  0.09278  10   LYS B CB    
29   C  CG    . LYS A 12  ? 0.43650 0.49203 0.47245 0.08392  0.03011  0.09211  10   LYS B CG    
30   C  CD    . LYS A 12  ? 0.40615 0.48451 0.44341 0.09107  0.03199  0.10091  10   LYS B CD    
31   C  CE    . LYS A 12  ? 0.46148 0.52705 0.48422 0.10334  0.04219  0.10441  10   LYS B CE    
32   N  NZ    . LYS A 12  ? 0.47490 0.56405 0.49843 0.11203  0.04464  0.11400  10   LYS B NZ    
33   N  N     . VAL A 13  ? 0.35502 0.38456 0.40152 0.06137  0.01778  0.07502  11   VAL B N     
34   C  CA    . VAL A 13  ? 0.30940 0.34339 0.36548 0.05100  0.01005  0.07245  11   VAL B CA    
35   C  C     . VAL A 13  ? 0.31097 0.34853 0.36851 0.04748  0.00776  0.07286  11   VAL B C     
36   O  O     . VAL A 13  ? 0.27139 0.30034 0.32255 0.04969  0.01087  0.07138  11   VAL B O     
37   C  CB    . VAL A 13  ? 0.31060 0.32896 0.36594 0.04610  0.00830  0.06584  11   VAL B CB    
38   C  CG1   . VAL A 13  ? 0.25737 0.27861 0.32041 0.03766  0.00195  0.06447  11   VAL B CG1   
39   C  CG2   . VAL A 13  ? 0.27956 0.29212 0.33207 0.05001  0.01124  0.06495  11   VAL B CG2   
40   N  N     . ILE A 14  ? 0.37999 0.42860 0.44423 0.04113  0.00297  0.07456  12   ILE B N     
41   C  CA    . ILE A 14  ? 0.37070 0.42330 0.43597 0.03783  0.00100  0.07541  12   ILE B CA    
42   C  C     . ILE A 14  ? 0.40633 0.45326 0.47431 0.02993  -0.00310 0.07270  12   ILE B C     
43   O  O     . ILE A 14  ? 0.45672 0.50636 0.52668 0.02470  -0.00488 0.07326  12   ILE B O     
44   C  CB    . ILE A 14  ? 0.39437 0.46619 0.46143 0.03820  0.00104  0.08111  12   ILE B CB    
45   C  CG1   . ILE A 14  ? 0.40150 0.47798 0.46415 0.04861  0.00633  0.08501  12   ILE B CG1   
46   C  CG2   . ILE A 14  ? 0.38538 0.46003 0.45336 0.03239  -0.00162 0.08122  12   ILE B CG2   
47   C  CD1   . ILE A 14  ? 0.44768 0.54701 0.51247 0.05082  0.00690  0.09149  12   ILE B CD1   
48   N  N     . ILE A 15  ? 0.46848 0.50801 0.53513 0.02923  -0.00376 0.07040  13   ILE B N     
49   C  CA    . ILE A 15  ? 0.49471 0.52827 0.56215 0.02474  -0.00619 0.06894  13   ILE B CA    
50   C  C     . ILE A 15  ? 0.47434 0.51211 0.54098 0.02210  -0.00691 0.07130  13   ILE B C     
51   O  O     . ILE A 15  ? 0.46530 0.50562 0.53124 0.02431  -0.00645 0.07169  13   ILE B O     
52   C  CB    . ILE A 15  ? 0.50097 0.52722 0.56702 0.02611  -0.00614 0.06550  13   ILE B CB    
53   C  CG1   . ILE A 15  ? 0.48132 0.50229 0.54553 0.02807  -0.00439 0.06250  13   ILE B CG1   
54   C  CG2   . ILE A 15  ? 0.46139 0.48349 0.52798 0.02394  -0.00784 0.06548  13   ILE B CG2   
55   C  CD1   . ILE A 15  ? 0.55518 0.57116 0.61778 0.02661  -0.00487 0.05889  13   ILE B CD1   
56   N  N     . LEU A 16  ? 0.40414 0.44049 0.46909 0.01670  -0.00734 0.07253  14   LEU B N     
57   C  CA    . LEU A 16  ? 0.44660 0.48386 0.50775 0.01270  -0.00695 0.07438  14   LEU B CA    
58   C  C     . LEU A 16  ? 0.52607 0.54993 0.58215 0.01134  -0.00578 0.07414  14   LEU B C     
59   O  O     . LEU A 16  ? 0.55085 0.56703 0.60704 0.01278  -0.00558 0.07307  14   LEU B O     
60   C  CB    . LEU A 16  ? 0.51425 0.56078 0.57312 0.00579  -0.00649 0.07634  14   LEU B CB    
61   C  CG    . LEU A 16  ? 0.46920 0.53356 0.53218 0.00814  -0.00680 0.07862  14   LEU B CG    
62   C  CD1   . LEU A 16  ? 0.47161 0.54869 0.53204 -0.00046 -0.00651 0.08069  14   LEU B CD1   
63   C  CD2   . LEU A 16  ? 0.29637 0.36774 0.36027 0.01247  -0.00668 0.08020  14   LEU B CD2   
64   N  N     . GLY A 17  ? 0.63858 0.65918 0.68904 0.00931  -0.00427 0.07562  15   GLY B N     
65   C  CA    . GLY A 17  ? 0.64358 0.64975 0.68584 0.00942  -0.00115 0.07672  15   GLY B CA    
66   C  C     . GLY A 17  ? 0.64703 0.65278 0.68732 0.01385  -0.00035 0.07825  15   GLY B C     
67   O  O     . GLY A 17  ? 0.59796 0.61420 0.64486 0.01728  -0.00290 0.07777  15   GLY B O     
68   N  N     . ASP A 18  ? 0.73828 0.73026 0.76774 0.01410  0.00417  0.08038  16   ASP B N     
69   C  CA    . ASP A 18  ? 0.76581 0.75590 0.79087 0.01816  0.00613  0.08255  16   ASP B CA    
70   C  C     . ASP A 18  ? 0.68389 0.68523 0.71782 0.02670  0.00333  0.08324  16   ASP B C     
71   O  O     . ASP A 18  ? 0.65646 0.66306 0.69668 0.02955  0.00121  0.08227  16   ASP B O     
72   C  CB    . ASP A 18  ? 0.84539 0.81500 0.85420 0.01888  0.01347  0.08542  16   ASP B CB    
73   C  CG    . ASP A 18  ? 0.90700 0.86533 0.90233 0.00814  0.01763  0.08448  16   ASP B CG    
74   O  OD1   . ASP A 18  ? 0.89460 0.86556 0.89508 0.00100  0.01398  0.08228  16   ASP B OD1   
75   O  OD2   . ASP A 18  ? 0.92438 0.86102 0.90214 0.00667  0.02540  0.08621  16   ASP B OD2   
76   N  N     . SER A 19  ? 0.59269 0.59853 0.62618 0.02965  0.00351  0.08471  17   SER B N     
77   C  CA    . SER A 19  ? 0.62777 0.64727 0.66885 0.03532  0.00088  0.08510  17   SER B CA    
78   C  C     . SER A 19  ? 0.68466 0.70385 0.72319 0.04265  0.00324  0.08844  17   SER B C     
79   O  O     . SER A 19  ? 0.68607 0.69227 0.71431 0.04652  0.00855  0.09220  17   SER B O     
80   C  CB    . SER A 19  ? 0.58272 0.60764 0.62351 0.03650  0.00077  0.08624  17   SER B CB    
81   O  OG    . SER A 19  ? 0.56303 0.59892 0.60636 0.04271  0.00050  0.08850  17   SER B OG    
82   N  N     . GLY A 20  ? 0.84781 0.88099 0.89395 0.04435  0.00014  0.08727  18   GLY B N     
83   C  CA    . GLY A 20  ? 0.86894 0.90871 0.91400 0.05140  0.00174  0.09094  18   GLY B CA    
84   C  C     . GLY A 20  ? 0.85845 0.88811 0.90043 0.05287  0.00368  0.09165  18   GLY B C     
85   O  O     . GLY A 20  ? 0.87152 0.90556 0.91085 0.06039  0.00616  0.09611  18   GLY B O     
86   N  N     . VAL A 21  ? 0.60069 0.61869 0.64282 0.04633  0.00284  0.08793  19   VAL B N     
87   C  CA    . VAL A 21  ? 0.56881 0.57734 0.60846 0.04681  0.00441  0.08813  19   VAL B CA    
88   C  C     . VAL A 21  ? 0.52375 0.54464 0.57196 0.04610  0.00033  0.08503  19   VAL B C     
89   O  O     . VAL A 21  ? 0.45443 0.47084 0.50135 0.04816  0.00141  0.08584  19   VAL B O     
90   C  CB    . VAL A 21  ? 0.51962 0.51211 0.55482 0.03917  0.00562  0.08574  19   VAL B CB    
91   C  CG1   . VAL A 21  ? 0.53166 0.51115 0.55551 0.03757  0.01045  0.08808  19   VAL B CG1   
92   C  CG2   . VAL A 21  ? 0.42508 0.42589 0.46925 0.03232  0.00062  0.08067  19   VAL B CG2   
93   N  N     . GLY A 22  ? 0.48057 0.51497 0.53551 0.04272  -0.00352 0.08135  20   GLY B N     
94   C  CA    . GLY A 22  ? 0.40002 0.44363 0.45962 0.04030  -0.00618 0.07760  20   GLY B CA    
95   C  C     . GLY A 22  ? 0.44301 0.48236 0.50552 0.03387  -0.00817 0.07179  20   GLY B C     
96   O  O     . GLY A 22  ? 0.41873 0.45870 0.48252 0.03186  -0.00911 0.06856  20   GLY B O     
97   N  N     . LYS A 23  ? 0.46145 0.49708 0.52412 0.03140  -0.00824 0.07086  21   LYS B N     
98   C  CA    . LYS A 23  ? 0.46559 0.49794 0.52962 0.02788  -0.00878 0.06697  21   LYS B CA    
99   C  C     . LYS A 23  ? 0.49978 0.53793 0.56255 0.02560  -0.00867 0.06305  21   LYS B C     
100  O  O     . LYS A 23  ? 0.41834 0.45276 0.47988 0.02371  -0.00821 0.05952  21   LYS B O     
101  C  CB    . LYS A 23  ? 0.44249 0.47316 0.50638 0.02691  -0.00837 0.06818  21   LYS B CB    
102  C  CG    . LYS A 23  ? 0.44203 0.46620 0.50405 0.02594  -0.00761 0.07104  21   LYS B CG    
103  C  CD    . LYS A 23  ? 0.48450 0.51154 0.54575 0.02411  -0.00737 0.07235  21   LYS B CD    
104  C  CE    . LYS A 23  ? 0.49463 0.52434 0.55410 0.02613  -0.00695 0.07420  21   LYS B CE    
105  N  NZ    . LYS A 23  ? 0.54344 0.58099 0.60535 0.02700  -0.00779 0.07266  21   LYS B NZ    
106  N  N     . THR A 24  ? 0.50911 0.55543 0.57043 0.02486  -0.00843 0.06339  22   THR B N     
107  C  CA    . THR A 24  ? 0.40167 0.45241 0.45843 0.02024  -0.00714 0.05931  22   THR B CA    
108  C  C     . THR A 24  ? 0.48945 0.54706 0.54490 0.01765  -0.00767 0.05717  22   THR B C     
109  O  O     . THR A 24  ? 0.47440 0.52968 0.52377 0.01210  -0.00579 0.05219  22   THR B O     
110  C  CB    . THR A 24  ? 0.37279 0.43250 0.42819 0.01908  -0.00687 0.06061  22   THR B CB    
111  O  OG1   . THR A 24  ? 0.46495 0.51998 0.52256 0.02218  -0.00695 0.06346  22   THR B OG1   
112  C  CG2   . THR A 24  ? 0.26880 0.32818 0.31619 0.01241  -0.00399 0.05587  22   THR B CG2   
113  N  N     . SER A 25  ? 0.59572 0.66061 0.65506 0.02178  -0.00936 0.06106  23   SER B N     
114  C  CA    . SER A 25  ? 0.55407 0.62920 0.61279 0.02036  -0.01002 0.06020  23   SER B CA    
115  C  C     . SER A 25  ? 0.49626 0.55974 0.55532 0.01981  -0.01015 0.05729  23   SER B C     
116  O  O     . SER A 25  ? 0.50586 0.57314 0.56158 0.01483  -0.00994 0.05313  23   SER B O     
117  C  CB    . SER A 25  ? 0.52520 0.61308 0.58672 0.02738  -0.01058 0.06696  23   SER B CB    
118  O  OG    . SER A 25  ? 0.48227 0.58063 0.54363 0.02899  -0.01026 0.07022  23   SER B OG    
119  N  N     . LEU A 26  ? 0.40586 0.45591 0.46800 0.02385  -0.01029 0.05926  24   LEU B N     
120  C  CA    . LEU A 26  ? 0.32369 0.36309 0.38635 0.02295  -0.01040 0.05650  24   LEU B CA    
121  C  C     . LEU A 26  ? 0.34388 0.37641 0.40206 0.01822  -0.00873 0.05074  24   LEU B C     
122  O  O     . LEU A 26  ? 0.39578 0.42369 0.45169 0.01579  -0.00825 0.04692  24   LEU B O     
123  C  CB    . LEU A 26  ? 0.25392 0.28167 0.31921 0.02605  -0.01035 0.05948  24   LEU B CB    
124  C  CG    . LEU A 26  ? 0.34436 0.37156 0.40979 0.03066  -0.00990 0.06460  24   LEU B CG    
125  C  CD1   . LEU A 26  ? 0.31874 0.33288 0.38304 0.03074  -0.00860 0.06691  24   LEU B CD1   
126  C  CD2   . LEU A 26  ? 0.33992 0.36892 0.40576 0.03154  -0.01039 0.06387  24   LEU B CD2   
127  N  N     . MET A 27  ? 0.36112 0.39149 0.41647 0.01745  -0.00697 0.05032  25   MET B N     
128  C  CA    . MET A 27  ? 0.40505 0.42567 0.45286 0.01477  -0.00327 0.04591  25   MET B CA    
129  C  C     . MET A 27  ? 0.45857 0.48232 0.49678 0.00748  -0.00077 0.04092  25   MET B C     
130  O  O     . MET A 27  ? 0.37939 0.39250 0.40852 0.00387  0.00298  0.03600  25   MET B O     
131  C  CB    . MET A 27  ? 0.44732 0.46450 0.49462 0.01774  -0.00152 0.04837  25   MET B CB    
132  C  CG    . MET A 27  ? 0.53642 0.54373 0.57289 0.01649  0.00411  0.04530  25   MET B CG    
133  S  SD    . MET A 27  ? 0.54340 0.55269 0.58127 0.02079  0.00513  0.04987  25   MET B SD    
134  C  CE    . MET A 27  ? 0.54674 0.55589 0.59229 0.02693  0.00357  0.05403  25   MET B CE    
135  N  N     . ASN A 28  ? 0.53008 0.56873 0.56866 0.00454  -0.00220 0.04211  26   ASN B N     
136  C  CA    . ASN A 28  ? 0.43409 0.48091 0.46324 -0.00481 -0.00021 0.03747  26   ASN B CA    
137  C  C     . ASN A 28  ? 0.46417 0.51628 0.49344 -0.00763 -0.00172 0.03508  26   ASN B C     
138  O  O     . ASN A 28  ? 0.40308 0.44989 0.42116 -0.01591 0.00166  0.02884  26   ASN B O     
139  C  CB    . ASN A 28  ? 0.40082 0.46740 0.43222 -0.00649 -0.00202 0.04061  26   ASN B CB    
140  C  CG    . ASN A 28  ? 0.55123 0.62811 0.57078 -0.01867 0.00081  0.03568  26   ASN B CG    
141  O  OD1   . ASN A 28  ? 0.60485 0.66695 0.61069 -0.02646 0.00610  0.02940  26   ASN B OD1   
142  N  ND2   . ASN A 28  ? 0.53987 0.64245 0.56282 -0.02072 -0.00183 0.03877  26   ASN B ND2   
143  N  N     . GLN A 29  ? 0.35574 0.41652 0.39580 -0.00095 -0.00596 0.03999  27   GLN B N     
144  C  CA    . GLN A 29  ? 0.33698 0.40209 0.37819 -0.00194 -0.00747 0.03863  27   GLN B CA    
145  C  C     . GLN A 29  ? 0.38747 0.43222 0.42422 -0.00361 -0.00532 0.03339  27   GLN B C     
146  O  O     . GLN A 29  ? 0.43667 0.48175 0.46686 -0.01011 -0.00418 0.02833  27   GLN B O     
147  C  CB    . GLN A 29  ? 0.41570 0.48734 0.46732 0.00752  -0.01073 0.04575  27   GLN B CB    
148  C  CG    . GLN A 29  ? 0.48720 0.56021 0.54042 0.00807  -0.01199 0.04501  27   GLN B CG    
149  C  CD    . GLN A 29  ? 0.44185 0.53610 0.49019 0.00088  -0.01223 0.04256  27   GLN B CD    
150  O  OE1   . GLN A 29  ? 0.43497 0.55099 0.48310 0.00019  -0.01266 0.04585  27   GLN B OE1   
151  N  NE2   . GLN A 29  ? 0.39648 0.48602 0.44007 -0.00531 -0.01173 0.03667  27   GLN B NE2   
152  N  N     . TYR A 30  ? 0.40221 0.43066 0.44190 0.00208  -0.00450 0.03475  28   TYR B N     
153  C  CA    . TYR A 30  ? 0.36635 0.37772 0.40227 0.00218  -0.00219 0.03095  28   TYR B CA    
154  C  C     . TYR A 30  ? 0.43234 0.43179 0.45264 -0.00421 0.00413  0.02470  28   TYR B C     
155  O  O     . TYR A 30  ? 0.50395 0.49446 0.51583 -0.00866 0.00684  0.01937  28   TYR B O     
156  C  CB    . TYR A 30  ? 0.33397 0.33592 0.37685 0.00973  -0.00276 0.03495  28   TYR B CB    
157  C  CG    . TYR A 30  ? 0.45558 0.44249 0.49426 0.01096  0.00021  0.03195  28   TYR B CG    
158  C  CD1   . TYR A 30  ? 0.46820 0.45158 0.50735 0.00927  -0.00088 0.02899  28   TYR B CD1   
159  C  CD2   . TYR A 30  ? 0.54769 0.52484 0.58152 0.01479  0.00452  0.03269  28   TYR B CD2   
160  C  CE1   . TYR A 30  ? 0.48903 0.45862 0.52397 0.01096  0.00214  0.02642  28   TYR B CE1   
161  C  CE2   . TYR A 30  ? 0.62533 0.58993 0.65448 0.01772  0.00810  0.03099  28   TYR B CE2   
162  C  CZ    . TYR A 30  ? 0.59751 0.55795 0.62729 0.01557  0.00682  0.02764  28   TYR B CZ    
163  O  OH    . TYR A 30  ? 0.65980 0.60787 0.68469 0.01894  0.01061  0.02611  28   TYR B OH    
164  N  N     . VAL A 31  ? 0.41360 0.41043 0.42782 -0.00491 0.00747  0.02517  29   VAL B N     
165  C  CA    . VAL A 31  ? 0.47221 0.45180 0.46802 -0.00992 0.01565  0.01976  29   VAL B CA    
166  C  C     . VAL A 31  ? 0.44857 0.43351 0.43122 -0.02314 0.01814  0.01345  29   VAL B C     
167  O  O     . VAL A 31  ? 0.43863 0.40730 0.40400 -0.02980 0.02490  0.00708  29   VAL B O     
168  C  CB    . VAL A 31  ? 0.39144 0.36438 0.38331 -0.00576 0.01954  0.02275  29   VAL B CB    
169  C  CG1   . VAL A 31  ? 0.37383 0.32636 0.34299 -0.01085 0.02983  0.01764  29   VAL B CG1   
170  C  CG2   . VAL A 31  ? 0.31636 0.28509 0.31817 0.00571  0.01823  0.02828  29   VAL B CG2   
171  N  N     . ASN A 32  ? 0.42874 0.43718 0.41782 -0.02751 0.01340  0.01527  30   ASN B N     
172  C  CA    . ASN A 32  ? 0.47383 0.49307 0.44971 -0.04168 0.01596  0.01001  30   ASN B CA    
173  C  C     . ASN A 32  ? 0.48948 0.53518 0.47348 -0.04528 0.01002  0.01084  30   ASN B C     
174  O  O     . ASN A 32  ? 0.46536 0.52688 0.43942 -0.05798 0.01141  0.00712  30   ASN B O     
175  C  CB    . ASN A 32  ? 0.43857 0.46558 0.41039 -0.04558 0.01761  0.01149  30   ASN B CB    
176  C  CG    . ASN A 32  ? 0.46290 0.46326 0.42214 -0.04350 0.02536  0.01020  30   ASN B CG    
177  O  OD1   . ASN A 32  ? 0.45031 0.42825 0.38896 -0.05003 0.03413  0.00408  30   ASN B OD1   
178  N  ND2   . ASN A 32  ? 0.50864 0.51053 0.47834 -0.03412 0.02309  0.01623  30   ASN B ND2   
179  N  N     . LYS A 33  ? 0.48218 0.53371 0.48243 -0.03491 0.00414  0.01587  31   LYS B N     
180  C  CA    . LYS A 33  ? 0.40911 0.48508 0.41713 -0.03529 -0.00081 0.01827  31   LYS B CA    
181  C  C     . LYS A 33  ? 0.43748 0.54388 0.44682 -0.03923 -0.00269 0.02181  31   LYS B C     
182  O  O     . LYS A 33  ? 0.46610 0.59731 0.47370 -0.04563 -0.00419 0.02151  31   LYS B O     
183  C  CB    . LYS A 33  ? 0.31674 0.38904 0.31449 -0.04470 0.00123  0.01109  31   LYS B CB    
184  C  CG    . LYS A 33  ? 0.31626 0.36074 0.31448 -0.03884 0.00269  0.00876  31   LYS B CG    
185  C  CD    . LYS A 33  ? 0.39096 0.43220 0.38096 -0.04659 0.00395  0.00229  31   LYS B CD    
186  C  CE    . LYS A 33  ? 0.39143 0.40431 0.38056 -0.04065 0.00624  -0.00004 31   LYS B CE    
187  N  NZ    . LYS A 33  ? 0.41918 0.43288 0.42723 -0.02746 0.00049  0.00695  31   LYS B NZ    
188  N  N     . LYS A 34  ? 0.52843 0.63472 0.54095 -0.03508 -0.00256 0.02562  32   LYS B N     
189  C  CA    . LYS A 34  ? 0.50406 0.63654 0.51780 -0.03762 -0.00377 0.02946  32   LYS B CA    
190  C  C     . LYS A 34  ? 0.41940 0.55836 0.44814 -0.02266 -0.00757 0.03895  32   LYS B C     
191  O  O     . LYS A 34  ? 0.50554 0.62439 0.54096 -0.01306 -0.00824 0.04129  32   LYS B O     
192  C  CB    . LYS A 34  ? 0.57306 0.69648 0.57398 -0.04736 0.00111  0.02486  32   LYS B CB    
193  C  CG    . LYS A 34  ? 0.62983 0.75157 0.61023 -0.06589 0.00680  0.01563  32   LYS B CG    
194  C  CD    . LYS A 34  ? 0.69397 0.79958 0.66017 -0.07339 0.01310  0.01200  32   LYS B CD    
195  C  CE    . LYS A 34  ? 0.79638 0.90227 0.73850 -0.09443 0.02008  0.00317  32   LYS B CE    
196  N  NZ    . LYS A 34  ? 0.81936 0.90112 0.74423 -0.10084 0.02824  -0.00054 32   LYS B NZ    
197  N  N     . PHE A 35  ? 0.34444 0.51238 0.37692 -0.02118 -0.00939 0.04460  33   PHE B N     
198  C  CA    . PHE A 35  ? 0.41500 0.58752 0.45818 -0.00705 -0.01137 0.05375  33   PHE B CA    
199  C  C     . PHE A 35  ? 0.44831 0.65170 0.49129 -0.00864 -0.01172 0.05824  33   PHE B C     
200  O  O     . PHE A 35  ? 0.55277 0.78577 0.59391 -0.01315 -0.01241 0.05956  33   PHE B O     
201  C  CB    . PHE A 35  ? 0.37492 0.54864 0.42587 0.00509  -0.01304 0.05996  33   PHE B CB    
202  C  CG    . PHE A 35  ? 0.45720 0.63502 0.51444 0.01906  -0.01300 0.06968  33   PHE B CG    
203  C  CD1   . PHE A 35  ? 0.52253 0.67396 0.58257 0.02628  -0.01225 0.07136  33   PHE B CD1   
204  C  CD2   . PHE A 35  ? 0.37169 0.58033 0.43017 0.02433  -0.01290 0.07719  33   PHE B CD2   
205  C  CE1   . PHE A 35  ? 0.51258 0.66415 0.57474 0.03764  -0.01084 0.07951  33   PHE B CE1   
206  C  CE2   . PHE A 35  ? 0.43923 0.64834 0.50057 0.03796  -0.01130 0.08626  33   PHE B CE2   
207  C  CZ    . PHE A 35  ? 0.48025 0.65874 0.54250 0.04416  -0.00997 0.08700  33   PHE B CZ    
208  N  N     . SER A 36  ? 0.52751 0.72658 0.57254 -0.00484 -0.01131 0.06104  34   SER B N     
209  C  CA    . SER A 36  ? 0.58889 0.81707 0.63527 -0.00362 -0.01171 0.06678  34   SER B CA    
210  C  C     . SER A 36  ? 0.62815 0.85139 0.68227 0.01276  -0.01192 0.07570  34   SER B C     
211  O  O     . SER A 36  ? 0.62981 0.82466 0.68587 0.01758  -0.01147 0.07494  34   SER B O     
212  C  CB    . SER A 36  ? 0.64740 0.87672 0.68598 -0.01666 -0.01002 0.06131  34   SER B CB    
213  O  OG    . SER A 36  ? 0.75488 1.00060 0.79762 -0.01098 -0.01057 0.06782  34   SER B OG    
214  N  N     . ASN A 37  ? 0.84333 1.09522 0.90028 0.02119  -0.01188 0.08447  35   ASN B N     
215  C  CA    . ASN A 37  ? 0.86982 1.11675 0.93055 0.03802  -0.01024 0.09391  35   ASN B CA    
216  C  C     . ASN A 37  ? 0.91212 1.15596 0.97299 0.03889  -0.00966 0.09523  35   ASN B C     
217  O  O     . ASN A 37  ? 0.91909 1.15064 0.98078 0.05112  -0.00754 0.10137  35   ASN B O     
218  C  CB    . ASN A 37  ? 0.89273 1.17155 0.95449 0.04927  -0.00888 0.10419  35   ASN B CB    
219  C  CG    . ASN A 37  ? 0.97675 1.24326 1.03820 0.06836  -0.00483 0.11433  35   ASN B CG    
220  O  OD1   . ASN A 37  ? 1.06389 1.29784 1.12406 0.07353  -0.00311 0.11366  35   ASN B OD1   
221  N  ND2   . ASN A 37  ? 0.95034 1.24237 1.01112 0.07848  -0.00242 0.12386  35   ASN B ND2   
222  N  N     . GLN A 38  ? 0.86743 1.11987 0.92572 0.02554  -0.01076 0.08932  36   GLN B N     
223  C  CA    . GLN A 38  ? 0.83114 1.07913 0.88943 0.02498  -0.01037 0.08963  36   GLN B CA    
224  C  C     . GLN A 38  ? 0.79287 1.00302 0.85162 0.02624  -0.01005 0.08560  36   GLN B C     
225  O  O     . GLN A 38  ? 0.81914 1.01120 0.87533 0.01794  -0.01026 0.07814  36   GLN B O     
226  C  CB    . GLN A 38  ? 0.85370 1.11939 0.90684 0.00879  -0.01074 0.08392  36   GLN B CB    
227  C  CG    . GLN A 38  ? 0.91247 1.22119 0.96596 0.00863  -0.01099 0.09019  36   GLN B CG    
228  C  CD    . GLN A 38  ? 0.96687 1.28276 1.02381 0.01832  -0.01037 0.09733  36   GLN B CD    
229  O  OE1   . GLN A 38  ? 0.95733 1.24933 1.01416 0.01752  -0.01011 0.09440  36   GLN B OE1   
230  N  NE2   . GLN A 38  ? 0.93149 1.28113 0.99095 0.02829  -0.00973 0.10724  36   GLN B NE2   
231  N  N     . TYR A 39  ? 0.80168 1.00085 0.86246 0.03663  -0.00896 0.09083  37   TYR B N     
232  C  CA    . TYR A 39  ? 0.83026 0.99819 0.89120 0.03743  -0.00865 0.08785  37   TYR B CA    
233  C  C     . TYR A 39  ? 0.81130 0.97433 0.87104 0.02920  -0.00917 0.08318  37   TYR B C     
234  O  O     . TYR A 39  ? 0.83009 1.00777 0.88976 0.02895  -0.00908 0.08564  37   TYR B O     
235  C  CB    . TYR A 39  ? 0.85433 1.01084 0.91481 0.04994  -0.00627 0.09475  37   TYR B CB    
236  C  CG    . TYR A 39  ? 0.82899 0.95963 0.88871 0.04876  -0.00597 0.09206  37   TYR B CG    
237  C  CD1   . TYR A 39  ? 0.81139 0.92187 0.87116 0.04564  -0.00640 0.08791  37   TYR B CD1   
238  C  CD2   . TYR A 39  ? 0.85848 0.98735 0.91735 0.05042  -0.00527 0.09389  37   TYR B CD2   
239  C  CE1   . TYR A 39  ? 0.83687 0.92894 0.89584 0.04398  -0.00616 0.08609  37   TYR B CE1   
240  C  CE2   . TYR A 39  ? 0.89856 1.00688 0.95640 0.04853  -0.00508 0.09156  37   TYR B CE2   
241  C  CZ    . TYR A 39  ? 0.86380 0.95528 0.92168 0.04517  -0.00554 0.08787  37   TYR B CZ    
242  O  OH    . TYR A 39  ? 0.82837 0.90478 0.88510 0.04285  -0.00535 0.08627  37   TYR B OH    
243  N  N     . LYS A 40  ? 0.79560 0.93793 0.85389 0.02357  -0.00917 0.07718  38   LYS B N     
244  C  CA    . LYS A 40  ? 0.74713 0.88115 0.80254 0.01684  -0.00848 0.07301  38   LYS B CA    
245  C  C     . LYS A 40  ? 0.72960 0.84037 0.78644 0.02038  -0.00823 0.07233  38   LYS B C     
246  O  O     . LYS A 40  ? 0.84870 0.94675 0.90408 0.01828  -0.00762 0.06879  38   LYS B O     
247  C  CB    . LYS A 40  ? 0.79700 0.93236 0.84526 0.00523  -0.00688 0.06642  38   LYS B CB    
248  C  CG    . LYS A 40  ? 0.85443 0.97862 0.89622 -0.00149 -0.00426 0.06242  38   LYS B CG    
249  C  CD    . LYS A 40  ? 0.86216 1.00070 0.90448 -0.00294 -0.00466 0.06497  38   LYS B CD    
250  C  CE    . LYS A 40  ? 0.85137 0.97422 0.88864 -0.00622 -0.00205 0.06247  38   LYS B CE    
251  N  NZ    . LYS A 40  ? 0.83570 0.97189 0.87421 -0.00741 -0.00273 0.06502  38   LYS B NZ    
252  N  N     . ALA A 41  ? 0.54440 0.65115 0.60339 0.02546  -0.00845 0.07587  39   ALA B N     
253  C  CA    . ALA A 41  ? 0.50249 0.59173 0.56232 0.02770  -0.00828 0.07576  39   ALA B CA    
254  C  C     . ALA A 41  ? 0.56037 0.64066 0.61782 0.02272  -0.00725 0.07139  39   ALA B C     
255  O  O     . ALA A 41  ? 0.55667 0.63945 0.61101 0.01879  -0.00606 0.06970  39   ALA B O     
256  C  CB    . ALA A 41  ? 0.32589 0.41349 0.38614 0.03167  -0.00814 0.07947  39   ALA B CB    
257  N  N     . THR A 42  ? 0.51651 0.58610 0.57415 0.02337  -0.00688 0.07004  40   THR B N     
258  C  CA    . THR A 42  ? 0.53564 0.59654 0.58970 0.02141  -0.00461 0.06740  40   THR B CA    
259  C  C     . THR A 42  ? 0.47784 0.53635 0.53337 0.02380  -0.00465 0.06993  40   THR B C     
260  O  O     . THR A 42  ? 0.40635 0.46488 0.46531 0.02610  -0.00637 0.07265  40   THR B O     
261  C  CB    . THR A 42  ? 0.52821 0.58130 0.58183 0.02211  -0.00388 0.06572  40   THR B CB    
262  O  OG1   . THR A 42  ? 0.58338 0.63544 0.64193 0.02509  -0.00609 0.06831  40   THR B OG1   
263  C  CG2   . THR A 42  ? 0.37311 0.42766 0.42287 0.01809  -0.00296 0.06200  40   THR B CG2   
264  N  N     . ILE A 43  ? 0.58630 0.64237 0.63750 0.02257  -0.00208 0.06902  41   ILE B N     
265  C  CA    . ILE A 43  ? 0.66855 0.72523 0.72106 0.02466  -0.00220 0.07166  41   ILE B CA    
266  C  C     . ILE A 43  ? 0.68787 0.73972 0.73863 0.02794  0.00022  0.07292  41   ILE B C     
267  O  O     . ILE A 43  ? 0.70126 0.75707 0.75497 0.03002  -0.00088 0.07592  41   ILE B O     
268  C  CB    . ILE A 43  ? 0.64056 0.69925 0.68939 0.02199  -0.00071 0.07097  41   ILE B CB    
269  C  CG1   . ILE A 43  ? 0.62159 0.67160 0.66047 0.01907  0.00464  0.06789  41   ILE B CG1   
270  C  CG2   . ILE A 43  ? 0.57282 0.64139 0.62389 0.01955  -0.00309 0.07089  41   ILE B CG2   
271  C  CD1   . ILE A 43  ? 0.68476 0.72551 0.71899 0.02375  0.00885  0.06948  41   ILE B CD1   
272  N  N     . GLY A 44  ? 0.75686 0.80120 0.80161 0.02846  0.00410  0.07098  42   GLY B N     
273  C  CA    . GLY A 44  ? 0.78022 0.82107 0.82211 0.03370  0.00757  0.07325  42   GLY B CA    
274  C  C     . GLY A 44  ? 0.73961 0.77552 0.78011 0.03460  0.00874  0.07162  42   GLY B C     
275  O  O     . GLY A 44  ? 0.80162 0.83307 0.83973 0.03060  0.00872  0.06774  42   GLY B O     
276  N  N     . ALA A 45  ? 0.57668 0.61563 0.61871 0.03975  0.00974  0.07492  43   ALA B N     
277  C  CA    . ALA A 45  ? 0.47316 0.50806 0.51407 0.04152  0.01109  0.07398  43   ALA B CA    
278  C  C     . ALA A 45  ? 0.46499 0.48471 0.49289 0.04378  0.01869  0.07171  43   ALA B C     
279  O  O     . ALA A 45  ? 0.54963 0.56323 0.56854 0.04826  0.02483  0.07383  43   ALA B O     
280  C  CB    . ALA A 45  ? 0.49305 0.53891 0.53863 0.04616  0.01045  0.07886  43   ALA B CB    
281  N  N     . ASP A 46  ? 0.53876 0.55082 0.56380 0.04035  0.01907  0.06735  44   ASP B N     
282  C  CA    . ASP A 46  ? 0.58616 0.58095 0.59603 0.04030  0.02698  0.06395  44   ASP B CA    
283  C  C     . ASP A 46  ? 0.55462 0.54652 0.56611 0.03990  0.02591  0.06156  44   ASP B C     
284  O  O     . ASP A 46  ? 0.51297 0.51597 0.53712 0.03922  0.01914  0.06258  44   ASP B O     
285  C  CB    . ASP A 46  ? 0.63420 0.62236 0.63540 0.03142  0.02884  0.05893  44   ASP B CB    
286  C  CG    . ASP A 46  ? 0.69417 0.66097 0.67389 0.03080  0.04000  0.05633  44   ASP B CG    
287  O  OD1   . ASP A 46  ? 0.68642 0.64143 0.65714 0.03884  0.04697  0.05854  44   ASP B OD1   
288  O  OD2   . ASP A 46  ? 0.75042 0.71192 0.72054 0.02188  0.04260  0.05221  44   ASP B OD2   
289  N  N     . PHE A 47  ? 0.42549 0.40040 0.42231 0.03969  0.03337  0.05812  45   PHE B N     
290  C  CA    . PHE A 47  ? 0.46083 0.43164 0.45810 0.04035  0.03320  0.05607  45   PHE B CA    
291  C  C     . PHE A 47  ? 0.53747 0.49260 0.52030 0.03244  0.03800  0.04884  45   PHE B C     
292  O  O     . PHE A 47  ? 0.61110 0.55423 0.57856 0.02754  0.04453  0.04580  45   PHE B O     
293  C  CB    . PHE A 47  ? 0.40441 0.37189 0.39802 0.05173  0.03864  0.06119  45   PHE B CB    
294  C  CG    . PHE A 47  ? 0.39061 0.33739 0.36288 0.05720  0.05109  0.06154  45   PHE B CG    
295  C  CD1   . PHE A 47  ? 0.45507 0.40118 0.42155 0.06329  0.05601  0.06644  45   PHE B CD1   
296  C  CD2   . PHE A 47  ? 0.36933 0.29537 0.32533 0.05668  0.05896  0.05724  45   PHE B CD2   
297  C  CE1   . PHE A 47  ? 0.45726 0.38094 0.40104 0.06959  0.06936  0.06759  45   PHE B CE1   
298  C  CE2   . PHE A 47  ? 0.52461 0.42680 0.45662 0.06224  0.07269  0.05783  45   PHE B CE2   
299  C  CZ    . PHE A 47  ? 0.55950 0.45981 0.48486 0.06918  0.07833  0.06333  45   PHE B CZ    
300  N  N     . LEU A 48  ? 0.61206 0.56768 0.59904 0.03007  0.03491  0.04592  46   LEU B N     
301  C  CA    . LEU A 48  ? 0.60535 0.54570 0.57778 0.02365  0.04015  0.03927  46   LEU B CA    
302  C  C     . LEU A 48  ? 0.64469 0.57486 0.61378 0.03132  0.04400  0.04020  46   LEU B C     
303  O  O     . LEU A 48  ? 0.65614 0.59651 0.63773 0.03986  0.04041  0.04582  46   LEU B O     
304  C  CB    . LEU A 48  ? 0.45238 0.40473 0.43276 0.01362  0.03279  0.03489  46   LEU B CB    
305  C  CG    . LEU A 48  ? 0.44390 0.40641 0.42366 0.00508  0.03068  0.03332  46   LEU B CG    
306  C  CD1   . LEU A 48  ? 0.44138 0.42021 0.43057 -0.00154 0.02345  0.03118  46   LEU B CD1   
307  C  CD2   . LEU A 48  ? 0.57610 0.52075 0.53203 -0.00236 0.04099  0.02839  46   LEU B CD2   
308  N  N     . THR A 49  ? 0.70965 0.62011 0.66049 0.02730  0.05177  0.03450  47   THR B N     
309  C  CA    . THR A 49  ? 0.69425 0.59274 0.63951 0.03421  0.05641  0.03466  47   THR B CA    
310  C  C     . THR A 49  ? 0.63354 0.52767 0.57608 0.02444  0.05440  0.02721  47   THR B C     
311  O  O     . THR A 49  ? 0.62559 0.51267 0.55510 0.01254  0.05728  0.02060  47   THR B O     
312  C  CB    . THR A 49  ? 0.76294 0.63590 0.68337 0.04201  0.07122  0.03598  47   THR B CB    
313  O  OG1   . THR A 49  ? 0.87572 0.72599 0.77156 0.03089  0.08014  0.02806  47   THR B OG1   
314  C  CG2   . THR A 49  ? 0.72020 0.59803 0.64124 0.05041  0.07380  0.04309  47   THR B CG2   
315  N  N     . LYS A 50  ? 0.63565 0.53589 0.59034 0.02855  0.04936  0.02833  48   LYS B N     
316  C  CA    . LYS A 50  ? 0.65500 0.54822 0.60544 0.02174  0.04896  0.02186  48   LYS B CA    
317  C  C     . LYS A 50  ? 0.66242 0.54073 0.60543 0.03139  0.05547  0.02325  48   LYS B C     
318  O  O     . LYS A 50  ? 0.57448 0.46228 0.52914 0.04234  0.05333  0.03027  48   LYS B O     
319  C  CB    . LYS A 50  ? 0.63357 0.54787 0.60559 0.01738  0.03666  0.02184  48   LYS B CB    
320  C  CG    . LYS A 50  ? 0.60077 0.51109 0.56809 0.00840  0.03570  0.01478  48   LYS B CG    
321  C  CD    . LYS A 50  ? 0.58764 0.52011 0.57247 0.00325  0.02509  0.01531  48   LYS B CD    
322  C  CE    . LYS A 50  ? 0.64086 0.57324 0.62164 -0.00534 0.02384  0.00903  48   LYS B CE    
323  N  NZ    . LYS A 50  ? 0.61076 0.54364 0.57568 -0.01824 0.02767  0.00273  48   LYS B NZ    
324  N  N     . GLU A 51  ? 1.00565 0.86150 0.92795 0.02700  0.06401  0.01675  49   GLU B N     
325  C  CA    . GLU A 51  ? 1.03039 0.87271 0.94652 0.03538  0.06933  0.01727  49   GLU B CA    
326  C  C     . GLU A 51  ? 0.95820 0.81051 0.88876 0.02951  0.06007  0.01355  49   GLU B C     
327  O  O     . GLU A 51  ? 0.92509 0.78068 0.85507 0.01671  0.05613  0.00705  49   GLU B O     
328  C  CB    . GLU A 51  ? 1.12299 0.93134 1.00586 0.03474  0.08524  0.01237  49   GLU B CB    
329  C  CG    . GLU A 51  ? 1.22736 1.02100 1.09229 0.04295  0.09692  0.01701  49   GLU B CG    
330  C  CD    . GLU A 51  ? 1.37748 1.14150 1.20933 0.03158  0.10986  0.00914  49   GLU B CD    
331  O  OE1   . GLU A 51  ? 1.40857 1.17153 1.23546 0.01475  0.10712  0.00008  49   GLU B OE1   
332  O  OE2   . GLU A 51  ? 1.45982 1.20213 1.26930 0.03895  0.12334  0.01222  49   GLU B OE2   
333  N  N     . VAL A 52  ? 0.81986 0.67969 0.76381 0.03886  0.05650  0.01835  50   VAL B N     
334  C  CA    . VAL A 52  ? 0.77711 0.64136 0.73171 0.03540  0.04997  0.01533  50   VAL B CA    
335  C  C     . VAL A 52  ? 0.77565 0.62629 0.72224 0.04575  0.05707  0.01709  50   VAL B C     
336  O  O     . VAL A 52  ? 0.79371 0.63535 0.72873 0.05690  0.06632  0.02200  50   VAL B O     
337  C  CB    . VAL A 52  ? 0.74104 0.63126 0.72250 0.03465  0.03700  0.01976  50   VAL B CB    
338  C  CG1   . VAL A 52  ? 0.76341 0.66618 0.75096 0.02622  0.03123  0.01872  50   VAL B CG1   
339  C  CG2   . VAL A 52  ? 0.70647 0.60926 0.69878 0.04543  0.03587  0.02863  50   VAL B CG2   
340  N  N     . MET A 53  ? 0.85922 0.70857 0.81121 0.04288  0.05329  0.01353  51   MET B N     
341  C  CA    . MET A 53  ? 0.90813 0.74758 0.85513 0.05289  0.05887  0.01560  51   MET B CA    
342  C  C     . MET A 53  ? 0.83679 0.69508 0.80695 0.05373  0.04845  0.01857  51   MET B C     
343  O  O     . MET A 53  ? 0.72027 0.58614 0.70204 0.04400  0.03963  0.01460  51   MET B O     
344  C  CB    . MET A 53  ? 1.00089 0.81139 0.92355 0.04882  0.06859  0.00723  51   MET B CB    
345  C  CG    . MET A 53  ? 1.16261 0.95004 1.05740 0.04855  0.08181  0.00496  51   MET B CG    
346  S  SD    . MET A 53  ? 1.30211 1.04950 1.16165 0.05506  0.10026  0.00114  51   MET B SD    
347  C  CE    . MET A 53  ? 1.27701 1.01017 1.12455 0.03471  0.09912  -0.01285 51   MET B CE    
348  N  N     . VAL A 54  ? 0.85108 0.71809 0.82678 0.06550  0.05018  0.02624  52   VAL B N     
349  C  CA    . VAL A 54  ? 0.91619 0.79912 0.90978 0.06676  0.04283  0.02953  52   VAL B CA    
350  C  C     . VAL A 54  ? 1.10130 0.97255 1.08412 0.07711  0.05119  0.03089  52   VAL B C     
351  O  O     . VAL A 54  ? 1.14862 1.02111 1.12310 0.09011  0.05946  0.03787  52   VAL B O     
352  C  CB    . VAL A 54  ? 0.82199 0.73236 0.83262 0.06976  0.03685  0.03831  52   VAL B CB    
353  C  CG1   . VAL A 54  ? 0.77670 0.70238 0.80448 0.06621  0.02873  0.04014  52   VAL B CG1   
354  C  CG2   . VAL A 54  ? 0.74974 0.66842 0.76570 0.06314  0.03208  0.03836  52   VAL B CG2   
355  N  N     . ASP A 55  ? 1.44515 1.30596 1.42785 0.07237  0.04944  0.02490  53   ASP B N     
356  C  CA    . ASP A 55  ? 1.56800 1.42024 1.54397 0.08155  0.05560  0.02624  53   ASP B CA    
357  C  C     . ASP A 55  ? 1.59625 1.42374 1.54484 0.09260  0.07126  0.02662  53   ASP B C     
358  O  O     . ASP A 55  ? 1.67892 1.51175 1.62267 0.10779  0.07868  0.03535  53   ASP B O     
359  C  CB    . ASP A 55  ? 1.62138 1.50077 1.61402 0.08944  0.05166  0.03602  53   ASP B CB    
360  C  CG    . ASP A 55  ? 1.63692 1.54041 1.65273 0.07897  0.03855  0.03750  53   ASP B CG    
361  O  OD1   . ASP A 55  ? 1.63506 1.56215 1.66040 0.08227  0.03626  0.04551  53   ASP B OD1   
362  O  OD2   . ASP A 55  ? 1.64195 1.54057 1.66482 0.06770  0.03143  0.03105  53   ASP B OD2   
363  N  N     . ASP A 56  ? 1.53800 1.33862 1.46669 0.08471  0.07722  0.01749  54   ASP B N     
364  C  CA    . ASP A 56  ? 1.53555 1.30466 1.43222 0.09260  0.09421  0.01608  54   ASP B CA    
365  C  C     . ASP A 56  ? 1.46846 1.23962 1.35644 0.10210  0.10158  0.02358  54   ASP B C     
366  O  O     . ASP A 56  ? 1.45448 1.19713 1.31355 0.10558  0.11596  0.02170  54   ASP B O     
367  C  CB    . ASP A 56  ? 1.58557 1.34349 1.47317 0.10570  0.10241  0.01892  54   ASP B CB    
368  C  CG    . ASP A 56  ? 1.63751 1.35704 1.48753 0.11505  0.12236  0.01746  54   ASP B CG    
369  O  OD1   . ASP A 56  ? 1.64775 1.37111 1.49088 0.13154  0.13055  0.02691  54   ASP B OD1   
370  O  OD2   . ASP A 56  ? 1.65414 1.34560 1.48185 0.10296  0.12857  0.00726  54   ASP B OD2   
371  N  N     . ARG A 57  ? 1.18904 0.99253 1.10040 0.10507  0.09220  0.03169  55   ARG B N     
372  C  CA    . ARG A 57  ? 1.04768 0.85986 0.95537 0.11561  0.09755  0.04051  55   ARG B CA    
373  C  C     . ARG A 57  ? 1.07195 0.88370 0.97964 0.10389  0.09387  0.03640  55   ARG B C     
374  O  O     . ARG A 57  ? 1.00490 0.83487 0.93309 0.09144  0.08048  0.03337  55   ARG B O     
375  C  CB    . ARG A 57  ? 0.95725 0.80737 0.88980 0.12332  0.08917  0.05121  55   ARG B CB    
376  C  CG    . ARG A 57  ? 1.03488 0.90044 0.96642 0.13473  0.09355  0.06152  55   ARG B CG    
377  C  CD    . ARG A 57  ? 1.00236 0.89851 0.94534 0.14902  0.09342  0.07379  55   ARG B CD    
378  N  NE    . ARG A 57  ? 1.02273 0.95372 0.99422 0.13882  0.07796  0.07553  55   ARG B NE    
379  C  CZ    . ARG A 57  ? 1.11672 1.05470 1.10260 0.12923  0.06878  0.07129  55   ARG B CZ    
380  N  NH1   . ARG A 57  ? 1.18045 1.09590 1.15758 0.12872  0.07218  0.06502  55   ARG B NH1   
381  N  NH2   . ARG A 57  ? 1.10409 1.07043 1.11168 0.11964  0.05682  0.07326  55   ARG B NH2   
382  N  N     . LEU A 58  ? 1.22884 1.01940 1.11241 0.10855  0.10655  0.03691  56   LEU B N     
383  C  CA    . LEU A 58  ? 1.19142 0.98169 1.07326 0.09812  0.10427  0.03365  56   LEU B CA    
384  C  C     . LEU A 58  ? 1.17493 0.99531 1.07607 0.10462  0.09766  0.04333  56   LEU B C     
385  O  O     . LEU A 58  ? 1.27216 1.10002 1.17076 0.12088  0.10411  0.05328  56   LEU B O     
386  C  CB    . LEU A 58  ? 1.16693 0.92032 1.01282 0.09888  0.12144  0.02995  56   LEU B CB    
387  C  CG    . LEU A 58  ? 1.18494 0.93294 1.02370 0.08499  0.12086  0.02443  56   LEU B CG    
388  C  CD1   . LEU A 58  ? 1.26293 1.02605 1.10807 0.09355  0.12092  0.03346  56   LEU B CD1   
389  C  CD2   . LEU A 58  ? 1.15153 0.91815 1.01115 0.06649  0.10513  0.01684  56   LEU B CD2   
390  N  N     . VAL A 59  ? 0.86763 0.70624 0.78712 0.09226  0.08531  0.04081  57   VAL B N     
391  C  CA    . VAL A 59  ? 0.81869 0.68485 0.75590 0.09563  0.07842  0.04863  57   VAL B CA    
392  C  C     . VAL A 59  ? 0.74895 0.61451 0.68643 0.08393  0.07459  0.04415  57   VAL B C     
393  O  O     . VAL A 59  ? 0.72256 0.57976 0.65806 0.07052  0.07108  0.03548  57   VAL B O     
394  C  CB    . VAL A 59  ? 0.83955 0.73579 0.80429 0.09350  0.06520  0.05213  57   VAL B CB    
395  C  CG1   . VAL A 59  ? 0.86055 0.75967 0.82554 0.10376  0.06855  0.05630  57   VAL B CG1   
396  C  CG2   . VAL A 59  ? 0.82014 0.71910 0.79749 0.07763  0.05407  0.04419  57   VAL B CG2   
397  N  N     . THR A 60  ? 0.66267 0.53963 0.60284 0.08922  0.07524  0.05057  58   THR B N     
398  C  CA    . THR A 60  ? 0.63539 0.51103 0.57347 0.08033  0.07350  0.04754  58   THR B CA    
399  C  C     . THR A 60  ? 0.56702 0.47262 0.52866 0.07904  0.06212  0.05285  58   THR B C     
400  O  O     . THR A 60  ? 0.59243 0.51346 0.55974 0.08938  0.06294  0.06144  58   THR B O     
401  C  CB    . THR A 60  ? 0.69774 0.55133 0.61038 0.08751  0.08799  0.04948  58   THR B CB    
402  O  OG1   . THR A 60  ? 0.87126 0.69690 0.76017 0.09371  0.10103  0.04750  58   THR B OG1   
403  C  CG2   . THR A 60  ? 0.67521 0.51907 0.57904 0.07445  0.08835  0.04303  58   THR B CG2   
404  N  N     . MET A 61  ? 0.56057 0.47490 0.53442 0.06656  0.05228  0.04811  59   MET B N     
405  C  CA    . MET A 61  ? 0.56290 0.50116 0.55574 0.06424  0.04268  0.05230  59   MET B CA    
406  C  C     . MET A 61  ? 0.56499 0.50195 0.55202 0.06278  0.04498  0.05296  59   MET B C     
407  O  O     . MET A 61  ? 0.55796 0.47916 0.53151 0.05644  0.04933  0.04727  59   MET B O     
408  C  CB    . MET A 61  ? 0.57695 0.52438 0.58456 0.05352  0.03205  0.04813  59   MET B CB    
409  C  CG    . MET A 61  ? 0.56376 0.51302 0.57880 0.05305  0.02848  0.04709  59   MET B CG    
410  S  SD    . MET A 61  ? 0.70783 0.66621 0.73758 0.04198  0.01765  0.04361  59   MET B SD    
411  C  CE    . MET A 61  ? 0.69766 0.67692 0.74229 0.04304  0.01163  0.05089  59   MET B CE    
412  N  N     . GLN A 62  ? 0.62503 0.57973 0.62183 0.06734  0.04196  0.05968  60   GLN B N     
413  C  CA    . GLN A 62  ? 0.60817 0.56468 0.60255 0.06585  0.04263  0.06084  60   GLN B CA    
414  C  C     . GLN A 62  ? 0.61107 0.58842 0.62432 0.05958  0.03158  0.06217  60   GLN B C     
415  O  O     . GLN A 62  ? 0.53075 0.52560 0.55473 0.06299  0.02785  0.06774  60   GLN B O     
416  C  CB    . GLN A 62  ? 0.58035 0.53671 0.56557 0.07837  0.05115  0.06820  60   GLN B CB    
417  C  CG    . GLN A 62  ? 0.62605 0.58153 0.60663 0.07771  0.05320  0.06954  60   GLN B CG    
418  C  CD    . GLN A 62  ? 0.64968 0.60436 0.61964 0.09202  0.06288  0.07780  60   GLN B CD    
419  O  OE1   . GLN A 62  ? 0.58364 0.56136 0.56474 0.09811  0.05951  0.08528  60   GLN B OE1   
420  N  NE2   . GLN A 62  ? 0.70829 0.63625 0.65476 0.09709  0.07580  0.07667  60   GLN B NE2   
421  N  N     . ILE A 63  ? 0.60538 0.58109 0.62105 0.05005  0.02708  0.05715  61   ILE B N     
422  C  CA    . ILE A 63  ? 0.56907 0.55940 0.59964 0.04417  0.01784  0.05763  61   ILE B CA    
423  C  C     . ILE A 63  ? 0.61335 0.60983 0.64496 0.04280  0.01677  0.05947  61   ILE B C     
424  O  O     . ILE A 63  ? 0.62989 0.61903 0.65362 0.03904  0.01925  0.05611  61   ILE B O     
425  C  CB    . ILE A 63  ? 0.57719 0.56401 0.61008 0.03656  0.01387  0.05209  61   ILE B CB    
426  C  CG1   . ILE A 63  ? 0.62989 0.60877 0.66059 0.03779  0.01543  0.04974  61   ILE B CG1   
427  C  CG2   . ILE A 63  ? 0.57228 0.57134 0.61793 0.03308  0.00635  0.05401  61   ILE B CG2   
428  C  CD1   . ILE A 63  ? 0.55917 0.53663 0.59303 0.03108  0.01129  0.04501  61   ILE B CD1   
429  N  N     . TRP A 64  ? 0.51041 0.52095 0.55090 0.04464  0.01323  0.06452  62   TRP B N     
430  C  CA    . TRP A 64  ? 0.49221 0.50941 0.53430 0.04384  0.01202  0.06673  62   TRP B CA    
431  C  C     . TRP A 64  ? 0.49479 0.51858 0.54561 0.03737  0.00530  0.06582  62   TRP B C     
432  O  O     . TRP A 64  ? 0.52480 0.55463 0.58228 0.03558  0.00168  0.06737  62   TRP B O     
433  C  CB    . TRP A 64  ? 0.53981 0.56923 0.58408 0.04988  0.01329  0.07319  62   TRP B CB    
434  C  CG    . TRP A 64  ? 0.54266 0.56651 0.57644 0.05945  0.02165  0.07627  62   TRP B CG    
435  C  CD1   . TRP A 64  ? 0.48381 0.50498 0.51335 0.06599  0.02606  0.07801  62   TRP B CD1   
436  C  CD2   . TRP A 64  ? 0.53857 0.55732 0.56303 0.06456  0.02770  0.07858  62   TRP B CD2   
437  N  NE1   . TRP A 64  ? 0.49676 0.51051 0.51368 0.07593  0.03529  0.08169  62   TRP B NE1   
438  C  CE2   . TRP A 64  ? 0.52068 0.53212 0.53397 0.07501  0.03659  0.08205  62   TRP B CE2   
439  C  CE3   . TRP A 64  ? 0.48753 0.50628 0.51108 0.06174  0.02707  0.07831  62   TRP B CE3   
440  C  CZ2   . TRP A 64  ? 0.55005 0.55235 0.54994 0.08304  0.04560  0.08550  62   TRP B CZ2   
441  C  CZ3   . TRP A 64  ? 0.45077 0.46148 0.46247 0.06840  0.03503  0.08112  62   TRP B CZ3   
442  C  CH2   . TRP A 64  ? 0.53006 0.53180 0.52942 0.07912  0.04456  0.08482  62   TRP B CH2   
443  N  N     . ASP A 65  ? 0.65279 0.67502 0.70199 0.03393  0.00450  0.06369  63   ASP B N     
444  C  CA    . ASP A 65  ? 0.68063 0.70978 0.73646 0.03061  -0.00035 0.06481  63   ASP B CA    
445  C  C     . ASP A 65  ? 0.65883 0.69393 0.71521 0.03140  -0.00046 0.06773  63   ASP B C     
446  O  O     . ASP A 65  ? 0.60987 0.64327 0.66122 0.03378  0.00303  0.06817  63   ASP B O     
447  C  CB    . ASP A 65  ? 0.59427 0.62258 0.64981 0.02700  -0.00203 0.06181  63   ASP B CB    
448  C  CG    . ASP A 65  ? 0.59772 0.62580 0.64728 0.02482  0.00023  0.05963  63   ASP B CG    
449  O  OD1   . ASP A 65  ? 0.66730 0.68831 0.70935 0.02588  0.00488  0.05849  63   ASP B OD1   
450  O  OD2   . ASP A 65  ? 0.60474 0.63949 0.65566 0.02220  -0.00181 0.05937  63   ASP B OD2   
451  N  N     . THR A 66  ? 0.44032 0.48052 0.50121 0.02937  -0.00369 0.06978  64   THR B N     
452  C  CA    . THR A 66  ? 0.38059 0.42716 0.44241 0.02931  -0.00422 0.07281  64   THR B CA    
453  C  C     . THR A 66  ? 0.51389 0.56053 0.57586 0.02761  -0.00574 0.07266  64   THR B C     
454  O  O     . THR A 66  ? 0.54391 0.58826 0.60574 0.02704  -0.00642 0.07102  64   THR B O     
455  C  CB    . THR A 66  ? 0.44463 0.49658 0.50852 0.02698  -0.00546 0.07533  64   THR B CB    
456  O  OG1   . THR A 66  ? 0.48631 0.53255 0.55019 0.02337  -0.00692 0.07448  64   THR B OG1   
457  C  CG2   . THR A 66  ? 0.41944 0.47519 0.48366 0.02970  -0.00380 0.07636  64   THR B CG2   
458  N  N     . ALA A 67  ? 0.59451 0.64560 0.65648 0.02729  -0.00603 0.07484  65   ALA B N     
459  C  CA    . ALA A 67  ? 0.57922 0.63069 0.64077 0.02651  -0.00699 0.07538  65   ALA B CA    
460  C  C     . ALA A 67  ? 0.66170 0.71073 0.72167 0.02405  -0.00747 0.07720  65   ALA B C     
461  O  O     . ALA A 67  ? 0.74401 0.79605 0.80255 0.02160  -0.00738 0.07871  65   ALA B O     
462  C  CB    . ALA A 67  ? 0.53907 0.59453 0.59994 0.02735  -0.00631 0.07617  65   ALA B CB    
463  N  N     . GLY A 68  ? 0.77522 0.81808 0.83353 0.02433  -0.00715 0.07716  66   GLY B N     
464  C  CA    . GLY A 68  ? 0.82582 0.86092 0.87840 0.02159  -0.00553 0.07873  66   GLY B CA    
465  C  C     . GLY A 68  ? 0.88857 0.92017 0.93573 0.02190  -0.00386 0.08064  66   GLY B C     
466  O  O     . GLY A 68  ? 0.90224 0.92444 0.94092 0.01827  -0.00103 0.08165  66   GLY B O     
467  N  N     . LEU A 69  ? 0.98907 1.02687 1.03920 0.02542  -0.00485 0.08099  67   LEU B N     
468  C  CA    . LEU A 69  ? 0.98968 1.02521 1.03522 0.02694  -0.00326 0.08300  67   LEU B CA    
469  C  C     . LEU A 69  ? 0.99893 1.03336 1.04071 0.02157  -0.00283 0.08289  67   LEU B C     
470  O  O     . LEU A 69  ? 1.06740 1.09306 1.10104 0.01667  -0.00027 0.08308  67   LEU B O     
471  C  CB    . LEU A 69  ? 0.95083 0.99646 1.00149 0.03067  -0.00491 0.08308  67   LEU B CB    
472  C  CG    . LEU A 69  ? 0.84100 0.88758 0.88829 0.03516  -0.00321 0.08601  67   LEU B CG    
473  C  CD1   . LEU A 69  ? 0.81568 0.85351 0.85566 0.04014  0.00069  0.08935  67   LEU B CD1   
474  C  CD2   . LEU A 69  ? 0.70608 0.76666 0.75916 0.03675  -0.00525 0.08553  67   LEU B CD2   
475  N  N     . GLU A 70  ? 0.95198 0.99523 0.99814 0.02153  -0.00479 0.08256  68   GLU B N     
476  C  CA    . GLU A 70  ? 0.99363 1.04000 1.03728 0.01631  -0.00485 0.08266  68   GLU B CA    
477  C  C     . GLU A 70  ? 0.96605 1.02368 1.01634 0.01813  -0.00701 0.08266  68   GLU B C     
478  O  O     . GLU A 70  ? 0.84581 0.90669 0.89490 0.01676  -0.00719 0.08333  68   GLU B O     
479  C  CB    . GLU A 70  ? 1.07128 1.10834 1.10517 0.01395  -0.00197 0.08351  68   GLU B CB    
480  C  CG    . GLU A 70  ? 1.17506 1.21149 1.20115 0.00462  -0.00053 0.08293  68   GLU B CG    
481  C  CD    . GLU A 70  ? 1.25153 1.27734 1.26860 -0.00104 0.00270  0.08234  68   GLU B CD    
482  O  OE1   . GLU A 70  ? 1.31241 1.34355 1.32524 -0.01029 0.00304  0.08156  68   GLU B OE1   
483  O  OE2   . GLU A 70  ? 1.22021 1.23366 1.23378 0.00345  0.00520  0.08297  68   GLU B OE2   
484  N  N     . ARG A 71  ? 1.24199 1.30364 1.29754 0.02123  -0.00778 0.08193  69   ARG B N     
485  C  CA    . ARG A 71  ? 1.25703 1.32581 1.31559 0.02350  -0.00780 0.08238  69   ARG B CA    
486  C  C     . ARG A 71  ? 1.22978 1.30587 1.28911 0.02325  -0.00733 0.08389  69   ARG B C     
487  O  O     . ARG A 71  ? 1.22250 1.30045 1.28283 0.02746  -0.00578 0.08438  69   ARG B O     
488  C  CB    . ARG A 71  ? 1.26362 1.32963 1.32332 0.02659  -0.00702 0.08065  69   ARG B CB    
489  C  CG    . ARG A 71  ? 1.27632 1.34020 1.33574 0.02659  -0.00768 0.07984  69   ARG B CG    
490  C  CD    . ARG A 71  ? 1.33296 1.39961 1.39203 0.02657  -0.00791 0.08066  69   ARG B CD    
491  N  NE    . ARG A 71  ? 1.38431 1.45064 1.44173 0.02511  -0.00835 0.08230  69   ARG B NE    
492  C  CZ    . ARG A 71  ? 1.38838 1.45014 1.44225 0.02475  -0.00791 0.08319  69   ARG B CZ    
493  N  NH1   . ARG A 71  ? 1.40379 1.46312 1.45668 0.02762  -0.00719 0.08369  69   ARG B NH1   
494  N  NH2   . ARG A 71  ? 1.36439 1.42403 1.41403 0.02166  -0.00736 0.08391  69   ARG B NH2   
495  N  N     . PHE A 72  ? 1.07217 1.15249 1.12922 0.01796  -0.00782 0.08485  70   PHE B N     
496  C  CA    . PHE A 72  ? 1.12285 1.21627 1.18059 0.01663  -0.00757 0.08720  70   PHE B CA    
497  C  C     . PHE A 72  ? 1.20411 1.31124 1.26236 0.01790  -0.00739 0.09030  70   PHE B C     
498  O  O     . PHE A 72  ? 1.18421 1.30112 1.24446 0.02407  -0.00586 0.09343  70   PHE B O     
499  C  CB    . PHE A 72  ? 1.09337 1.18767 1.14639 0.00769  -0.00768 0.08672  70   PHE B CB    
500  C  CG    . PHE A 72  ? 1.07987 1.15740 1.12931 0.00556  -0.00698 0.08410  70   PHE B CG    
501  C  CD1   . PHE A 72  ? 1.09641 1.16618 1.13658 -0.00294 -0.00519 0.08321  70   PHE B CD1   
502  C  CD2   . PHE A 72  ? 1.08323 1.15254 1.13640 0.01145  -0.00718 0.08276  70   PHE B CD2   
503  C  CE1   . PHE A 72  ? 1.12851 1.18115 1.16319 -0.00350 -0.00310 0.08183  70   PHE B CE1   
504  C  CE2   . PHE A 72  ? 1.11334 1.16952 1.16301 0.01049  -0.00621 0.08136  70   PHE B CE2   
505  C  CZ    . PHE A 72  ? 1.13141 1.17867 1.17184 0.00399  -0.00392 0.08130  70   PHE B CZ    
506  N  N     . GLN A 73  ? 1.37224 1.47946 1.42741 0.01275  -0.00820 0.08983  71   GLN B N     
507  C  CA    . GLN A 73  ? 1.36780 1.49125 1.42217 0.01052  -0.00844 0.09270  71   GLN B CA    
508  C  C     . GLN A 73  ? 1.37858 1.50807 1.43664 0.01998  -0.00725 0.09578  71   GLN B C     
509  O  O     . GLN A 73  ? 1.37064 1.48751 1.42975 0.02553  -0.00623 0.09434  71   GLN B O     
510  C  CB    . GLN A 73  ? 1.35924 1.47651 1.40792 0.00320  -0.00892 0.09064  71   GLN B CB    
511  C  CG    . GLN A 73  ? 1.39044 1.50286 1.43033 -0.00792 -0.00792 0.08853  71   GLN B CG    
512  C  CD    . GLN A 73  ? 1.41268 1.50174 1.44782 -0.00773 -0.00635 0.08556  71   GLN B CD    
513  O  OE1   . GLN A 73  ? 1.45304 1.53226 1.49018 -0.00169 -0.00647 0.08497  71   GLN B OE1   
514  N  NE2   . GLN A 73  ? 1.40819 1.48961 1.43642 -0.01404 -0.00440 0.08426  71   GLN B NE2   
515  N  N     . SER A 74  ? 1.54949 1.69932 1.60800 0.02143  -0.00662 0.10043  72   SER B N     
516  C  CA    . SER A 74  ? 1.53207 1.68929 1.59168 0.03178  -0.00383 0.10510  72   SER B CA    
517  C  C     . SER A 74  ? 1.47363 1.62566 1.53300 0.04130  -0.00007 0.10691  72   SER B C     
518  O  O     . SER A 74  ? 1.54199 1.70088 1.59939 0.05125  0.00423  0.11222  72   SER B O     
519  C  CB    . SER A 74  ? 1.53364 1.67799 1.59254 0.03388  -0.00354 0.10337  72   SER B CB    
520  O  OG    . SER A 74  ? 1.52149 1.66941 1.57889 0.04377  0.00050  0.10799  72   SER B OG    
521  N  N     . LEU A 75  ? 0.79962 0.93861 0.85944 0.03895  -0.00078 0.10288  73   LEU B N     
522  C  CA    . LEU A 75  ? 0.67202 0.80280 0.73009 0.04667  0.00303  0.10343  73   LEU B CA    
523  C  C     . LEU A 75  ? 0.57204 0.71462 0.63198 0.04552  0.00246  0.10514  73   LEU B C     
524  O  O     . LEU A 75  ? 0.51041 0.65346 0.57221 0.03625  -0.00122 0.10206  73   LEU B O     
525  C  CB    . LEU A 75  ? 0.64101 0.74908 0.69764 0.04511  0.00307  0.09757  73   LEU B CB    
526  C  CG    . LEU A 75  ? 0.56967 0.66639 0.62266 0.04733  0.00533  0.09638  73   LEU B CG    
527  C  CD1   . LEU A 75  ? 0.61738 0.69589 0.66576 0.04766  0.00807  0.09213  73   LEU B CD1   
528  C  CD2   . LEU A 75  ? 0.49557 0.59928 0.54455 0.05555  0.01005  0.10208  73   LEU B CD2   
529  N  N     . GLY A 76  ? 0.54989 0.70059 0.60780 0.05540  0.00701  0.11034  74   GLY B N     
530  C  CA    . GLY A 76  ? 0.59950 0.76659 0.65939 0.05549  0.00686  0.11341  74   GLY B CA    
531  C  C     . GLY A 76  ? 0.64092 0.79188 0.70052 0.05541  0.00730  0.10933  74   GLY B C     
532  O  O     . GLY A 76  ? 0.68904 0.81749 0.74717 0.05371  0.00709  0.10367  74   GLY B O     
533  N  N     . VAL A 77  ? 0.59203 0.75750 0.65298 0.05726  0.00803  0.11270  75   VAL B N     
534  C  CA    . VAL A 77  ? 0.51954 0.67395 0.58153 0.05434  0.00706  0.10870  75   VAL B CA    
535  C  C     . VAL A 77  ? 0.56277 0.73021 0.62348 0.06404  0.01139  0.11455  75   VAL B C     
536  O  O     . VAL A 77  ? 0.51557 0.68467 0.57839 0.06107  0.01015  0.11332  75   VAL B O     
537  C  CB    . VAL A 77  ? 0.45517 0.61276 0.52055 0.03979  0.00130  0.10475  75   VAL B CB    
538  C  CG1   . VAL A 77  ? 0.44603 0.63161 0.51299 0.03403  0.00005  0.10904  75   VAL B CG1   
539  C  CG2   . VAL A 77  ? 0.46991 0.60423 0.53542 0.03587  -0.00022 0.09825  75   VAL B CG2   
540  N  N     . ALA A 78  ? 0.50655 0.68228 0.56273 0.07689  0.01735  0.12146  76   ALA B N     
541  C  CA    . ALA A 78  ? 0.40147 0.58934 0.45441 0.08938  0.02324  0.12856  76   ALA B CA    
542  C  C     . ALA A 78  ? 0.45349 0.61958 0.50317 0.09175  0.02568  0.12429  76   ALA B C     
543  O  O     . ALA A 78  ? 0.53052 0.70853 0.57967 0.09849  0.02860  0.12893  76   ALA B O     
544  C  CB    . ALA A 78  ? 0.31771 0.50640 0.36205 0.10546  0.03181  0.13614  76   ALA B CB    
545  N  N     . PHE A 79  ? 0.55759 0.69428 0.60504 0.08608  0.02450  0.11577  77   PHE B N     
546  C  CA    . PHE A 79  ? 0.57579 0.69200 0.61892 0.08786  0.02719  0.11145  77   PHE B CA    
547  C  C     . PHE A 79  ? 0.51323 0.63797 0.56456 0.07949  0.02135  0.10899  77   PHE B C     
548  O  O     . PHE A 79  ? 0.53480 0.64579 0.58327 0.08148  0.02342  0.10611  77   PHE B O     
549  C  CB    . PHE A 79  ? 0.56711 0.65361 0.60473 0.08316  0.02778  0.10335  77   PHE B CB    
550  C  CG    . PHE A 79  ? 0.60007 0.68454 0.64613 0.06960  0.01928  0.09706  77   PHE B CG    
551  C  CD1   . PHE A 79  ? 0.59488 0.68522 0.64425 0.06480  0.01584  0.09713  77   PHE B CD1   
552  C  CD2   . PHE A 79  ? 0.61501 0.69114 0.66463 0.06267  0.01549  0.09162  77   PHE B CD2   
553  C  CE1   . PHE A 79  ? 0.54644 0.63337 0.60136 0.05423  0.00955  0.09223  77   PHE B CE1   
554  C  CE2   . PHE A 79  ? 0.57674 0.65029 0.63211 0.05247  0.00922  0.08717  77   PHE B CE2   
555  C  CZ    . PHE A 79  ? 0.56733 0.64578 0.62476 0.04870  0.00665  0.08766  77   PHE B CZ    
556  N  N     . TYR A 80  ? 0.36654 0.51200 0.42601 0.06965  0.01499  0.10989  78   TYR B N     
557  C  CA    . TYR A 80  ? 0.30927 0.46311 0.37396 0.06158  0.01101  0.10843  78   TYR B CA    
558  C  C     . TYR A 80  ? 0.43975 0.61153 0.50386 0.07070  0.01496  0.11503  78   TYR B C     
559  O  O     . TYR A 80  ? 0.48279 0.65312 0.54909 0.06751  0.01365  0.11307  78   TYR B O     
560  C  CB    . TYR A 80  ? 0.30909 0.48014 0.37832 0.04776  0.00529  0.10819  78   TYR B CB    
561  C  CG    . TYR A 80  ? 0.36253 0.51465 0.43171 0.03788  0.00151  0.10156  78   TYR B CG    
562  C  CD1   . TYR A 80  ? 0.35702 0.48382 0.42419 0.04149  0.00238  0.09679  78   TYR B CD1   
563  C  CD2   . TYR A 80  ? 0.34150 0.50158 0.41078 0.02475  -0.00206 0.10038  78   TYR B CD2   
564  C  CE1   . TYR A 80  ? 0.31272 0.42578 0.37988 0.03424  -0.00061 0.09204  78   TYR B CE1   
565  C  CE2   . TYR A 80  ? 0.33368 0.47518 0.40104 0.01792  -0.00411 0.09530  78   TYR B CE2   
566  C  CZ    . TYR A 80  ? 0.35235 0.47195 0.41962 0.02367  -0.00360 0.09165  78   TYR B CZ    
567  O  OH    . TYR A 80  ? 0.36167 0.46644 0.42719 0.01859  -0.00524 0.08787  78   TYR B OH    
568  N  N     . ARG A 81  ? 0.68308 0.87328 0.74409 0.08257  0.02005  0.12352  79   ARG B N     
569  C  CA    . ARG A 81  ? 0.66453 0.87748 0.72485 0.09287  0.02436  0.13172  79   ARG B CA    
570  C  C     . ARG A 81  ? 0.63141 0.82067 0.68558 0.10209  0.02981  0.12966  79   ARG B C     
571  O  O     . ARG A 81  ? 0.68758 0.84627 0.73304 0.10791  0.03472  0.12579  79   ARG B O     
572  C  CB    . ARG A 81  ? 0.63154 0.86611 0.68762 0.10711  0.03045  0.14222  79   ARG B CB    
573  C  CG    . ARG A 81  ? 0.72090 0.98343 0.78260 0.09804  0.02534  0.14495  79   ARG B CG    
574  C  CD    . ARG A 81  ? 0.82534 1.12801 0.89323 0.09058  0.02175  0.15001  79   ARG B CD    
575  N  NE    . ARG A 81  ? 0.87117 1.19410 0.94281 0.07495  0.01569  0.14893  79   ARG B NE    
576  C  CZ    . ARG A 81  ? 0.82987 1.19452 0.90443 0.06701  0.01336  0.15456  79   ARG B CZ    
577  N  NH1   . ARG A 81  ? 0.78431 1.17852 0.86013 0.07437  0.01615  0.16262  79   ARG B NH1   
578  N  NH2   . ARG A 81  ? 0.83907 1.21663 0.91414 0.05108  0.00864  0.15215  79   ARG B NH2   
579  N  N     . GLY A 82  ? 0.39027 0.59444 0.44780 0.10241  0.02935  0.13216  80   GLY B N     
580  C  CA    . GLY A 82  ? 0.46436 0.64754 0.51659 0.10941  0.03383  0.12973  80   GLY B CA    
581  C  C     . GLY A 82  ? 0.42455 0.58070 0.47964 0.09643  0.02831  0.11853  80   GLY B C     
582  O  O     . GLY A 82  ? 0.40066 0.53495 0.45025 0.10089  0.03192  0.11493  80   GLY B O     
583  N  N     . ALA A 83  ? 0.44508 0.60162 0.50714 0.08114  0.02048  0.11330  81   ALA B N     
584  C  CA    . ALA A 83  ? 0.43828 0.57262 0.50303 0.06982  0.01554  0.10414  81   ALA B CA    
585  C  C     . ALA A 83  ? 0.48231 0.62230 0.55058 0.06699  0.01414  0.10384  81   ALA B C     
586  O  O     . ALA A 83  ? 0.46770 0.63404 0.54082 0.06181  0.01175  0.10815  81   ALA B O     
587  C  CB    . ALA A 83  ? 0.38446 0.52071 0.45408 0.05570  0.00899  0.10060  81   ALA B CB    
588  N  N     . ASP A 84  ? 0.50213 0.61830 0.56705 0.06965  0.01594  0.09870  82   ASP B N     
589  C  CA    . ASP A 84  ? 0.44473 0.56231 0.51275 0.06711  0.01464  0.09755  82   ASP B CA    
590  C  C     . ASP A 84  ? 0.45792 0.56563 0.53132 0.05211  0.00786  0.09082  82   ASP B C     
591  O  O     . ASP A 84  ? 0.45047 0.56566 0.52767 0.04612  0.00555  0.09079  82   ASP B O     
592  C  CB    . ASP A 84  ? 0.39596 0.49325 0.45566 0.07864  0.02125  0.09604  82   ASP B CB    
593  C  CG    . ASP A 84  ? 0.51477 0.61710 0.56498 0.09527  0.03040  0.10355  82   ASP B CG    
594  O  OD1   . ASP A 84  ? 0.57541 0.70701 0.62842 0.10124  0.03183  0.11239  82   ASP B OD1   
595  O  OD2   . ASP A 84  ? 0.54833 0.62630 0.58688 0.10227  0.03690  0.10112  82   ASP B OD2   
596  N  N     . CYS A 85  ? 0.46893 0.56179 0.54192 0.04618  0.00520  0.08608  83   CYS B N     
597  C  CA    . CYS A 85  ? 0.40687 0.49005 0.48279 0.03395  0.00024  0.08120  83   CYS B CA    
598  C  C     . CYS A 85  ? 0.37563 0.45353 0.45050 0.02998  -0.00145 0.07976  83   CYS B C     
599  O  O     . CYS A 85  ? 0.38790 0.46066 0.45995 0.03645  0.00070  0.07970  83   CYS B O     
600  C  CB    . CYS A 85  ? 0.44051 0.50189 0.51574 0.03401  -0.00015 0.07529  83   CYS B CB    
601  S  SG    . CYS A 85  ? 0.48007 0.52920 0.55723 0.02161  -0.00471 0.07096  83   CYS B SG    
602  N  N     . CYS A 86  ? 0.36891 0.44579 0.44429 0.01921  -0.00446 0.07851  84   CYS B N     
603  C  CA    . CYS A 86  ? 0.42468 0.49625 0.49801 0.01508  -0.00561 0.07756  84   CYS B CA    
604  C  C     . CYS A 86  ? 0.43363 0.48614 0.50509 0.00971  -0.00695 0.07353  84   CYS B C     
605  O  O     . CYS A 86  ? 0.45352 0.50226 0.52362 0.00299  -0.00726 0.07283  84   CYS B O     
606  C  CB    . CYS A 86  ? 0.50955 0.59915 0.58132 0.00746  -0.00598 0.08126  84   CYS B CB    
607  S  SG    . CYS A 86  ? 0.51574 0.59546 0.58205 -0.00071 -0.00661 0.07969  84   CYS B SG    
608  N  N     . VAL A 87  ? 0.33156 0.37312 0.40208 0.01291  -0.00717 0.07149  85   VAL B N     
609  C  CA    . VAL A 87  ? 0.32875 0.35483 0.39737 0.01110  -0.00771 0.06895  85   VAL B CA    
610  C  C     . VAL A 87  ? 0.37969 0.40227 0.44371 0.00759  -0.00715 0.07028  85   VAL B C     
611  O  O     . VAL A 87  ? 0.36267 0.39035 0.42696 0.01015  -0.00725 0.07117  85   VAL B O     
612  C  CB    . VAL A 87  ? 0.31484 0.33405 0.38497 0.01742  -0.00794 0.06595  85   VAL B CB    
613  C  CG1   . VAL A 87  ? 0.34808 0.35604 0.41722 0.01638  -0.00850 0.06422  85   VAL B CG1   
614  C  CG2   . VAL A 87  ? 0.33202 0.35359 0.40352 0.02180  -0.00684 0.06475  85   VAL B CG2   
615  N  N     . LEU A 88  ? 0.52471 0.53646 0.58292 0.00212  -0.00569 0.07048  86   LEU B N     
616  C  CA    . LEU A 88  ? 0.52341 0.52714 0.57369 -0.00074 -0.00336 0.07193  86   LEU B CA    
617  C  C     . LEU A 88  ? 0.52575 0.51553 0.57325 0.00453  -0.00195 0.07195  86   LEU B C     
618  O  O     . LEU A 88  ? 0.65497 0.63480 0.70015 0.00398  -0.00072 0.07156  86   LEU B O     
619  C  CB    . LEU A 88  ? 0.52115 0.52116 0.56189 -0.01188 -0.00043 0.07281  86   LEU B CB    
620  C  CG    . LEU A 88  ? 0.45229 0.47134 0.49516 -0.01868 -0.00166 0.07364  86   LEU B CG    
621  C  CD1   . LEU A 88  ? 0.45479 0.46830 0.48479 -0.03256 0.00213  0.07382  86   LEU B CD1   
622  C  CD2   . LEU A 88  ? 0.41673 0.45160 0.46396 -0.01528 -0.00334 0.07517  86   LEU B CD2   
623  N  N     . VAL A 89  ? 0.38695 0.37783 0.43460 0.01001  -0.00194 0.07295  87   VAL B N     
624  C  CA    . VAL A 89  ? 0.45611 0.44031 0.50193 0.01661  -0.00063 0.07422  87   VAL B CA    
625  C  C     . VAL A 89  ? 0.52852 0.50141 0.56303 0.01710  0.00422  0.07766  87   VAL B C     
626  O  O     . VAL A 89  ? 0.54594 0.52244 0.57857 0.01608  0.00455  0.07842  87   VAL B O     
627  C  CB    . VAL A 89  ? 0.48584 0.48231 0.53928 0.02245  -0.00369 0.07309  87   VAL B CB    
628  C  CG1   . VAL A 89  ? 0.45895 0.45470 0.51157 0.02865  -0.00285 0.07469  87   VAL B CG1   
629  C  CG2   . VAL A 89  ? 0.43616 0.44031 0.49667 0.02132  -0.00661 0.06952  87   VAL B CG2   
630  N  N     . PHE A 90  ? 0.62563 0.58357 0.65131 0.01946  0.00879  0.08004  88   PHE B N     
631  C  CA    . PHE A 90  ? 0.68180 0.62638 0.69426 0.02339  0.01522  0.08429  88   PHE B CA    
632  C  C     . PHE A 90  ? 0.70480 0.65004 0.71716 0.03520  0.01703  0.08826  88   PHE B C     
633  O  O     . PHE A 90  ? 0.72701 0.68065 0.74790 0.03827  0.01365  0.08724  88   PHE B O     
634  C  CB    . PHE A 90  ? 0.67603 0.59795 0.67109 0.01514  0.02239  0.08492  88   PHE B CB    
635  C  CG    . PHE A 90  ? 0.71751 0.62438 0.70615 0.01523  0.02611  0.08573  88   PHE B CG    
636  C  CD1   . PHE A 90  ? 0.73033 0.64207 0.72663 0.00852  0.02206  0.08213  88   PHE B CD1   
637  C  CD2   . PHE A 90  ? 0.75120 0.63787 0.72454 0.02254  0.03460  0.09065  88   PHE B CD2   
638  C  CE1   . PHE A 90  ? 0.75458 0.65174 0.74480 0.00813  0.02550  0.08274  88   PHE B CE1   
639  C  CE2   . PHE A 90  ? 0.76871 0.63990 0.73488 0.02301  0.03878  0.09181  88   PHE B CE2   
640  C  CZ    . PHE A 90  ? 0.77948 0.65589 0.75459 0.01512  0.03383  0.08749  88   PHE B CZ    
641  N  N     . ASP A 91  ? 0.69631 0.63482 0.69857 0.04210  0.02259  0.09315  89   ASP B N     
642  C  CA    . ASP A 91  ? 0.69863 0.63982 0.69816 0.05504  0.02596  0.09902  89   ASP B CA    
643  C  C     . ASP A 91  ? 0.71519 0.63008 0.69652 0.05865  0.03571  0.10355  89   ASP B C     
644  O  O     . ASP A 91  ? 0.72961 0.62220 0.69376 0.05542  0.04335  0.10491  89   ASP B O     
645  C  CB    . ASP A 91  ? 0.73889 0.68920 0.73709 0.06190  0.02721  0.10268  89   ASP B CB    
646  C  CG    . ASP A 91  ? 0.79320 0.75711 0.79226 0.07567  0.02908  0.10923  89   ASP B CG    
647  O  OD1   . ASP A 91  ? 0.86152 0.81658 0.85290 0.08309  0.03440  0.11390  89   ASP B OD1   
648  O  OD2   . ASP A 91  ? 0.78931 0.77437 0.79633 0.07898  0.02548  0.11010  89   ASP B OD2   
649  N  N     . VAL A 92  ? 0.71225 0.62813 0.69519 0.06497  0.03639  0.10591  90   VAL B N     
650  C  CA    . VAL A 92  ? 0.71420 0.60225 0.67810 0.06867  0.04673  0.11050  90   VAL B CA    
651  C  C     . VAL A 92  ? 0.73867 0.61515 0.68533 0.08221  0.05723  0.11927  90   VAL B C     
652  O  O     . VAL A 92  ? 0.79551 0.64151 0.71988 0.08489  0.06885  0.12345  90   VAL B O     
653  C  CB    . VAL A 92  ? 0.71338 0.60503 0.68299 0.07260  0.04512  0.11121  90   VAL B CB    
654  C  CG1   . VAL A 92  ? 0.71578 0.60759 0.69514 0.05879  0.03841  0.10319  90   VAL B CG1   
655  C  CG2   . VAL A 92  ? 0.75176 0.67396 0.73566 0.08321  0.03965  0.11405  90   VAL B CG2   
656  N  N     . THR A 93  ? 0.68834 0.58722 0.64299 0.09059  0.05432  0.12230  91   THR B N     
657  C  CA    . THR A 93  ? 0.74449 0.63730 0.68435 0.10546  0.06396  0.13152  91   THR B CA    
658  C  C     . THR A 93  ? 0.86884 0.74635 0.79666 0.10110  0.06850  0.13063  91   THR B C     
659  O  O     . THR A 93  ? 0.94739 0.80767 0.85563 0.11213  0.07986  0.13803  91   THR B O     
660  C  CB    . THR A 93  ? 0.74744 0.67733 0.70252 0.11715  0.05846  0.13608  91   THR B CB    
661  O  OG1   . THR A 93  ? 0.77240 0.72154 0.73974 0.11112  0.05091  0.13176  91   THR B OG1   
662  C  CG2   . THR A 93  ? 0.69643 0.64764 0.66809 0.11503  0.05022  0.13316  91   THR B CG2   
663  N  N     . ALA A 94  ? 0.92622 0.80973 0.86419 0.08617  0.06057  0.12228  92   ALA B N     
664  C  CA    . ALA A 94  ? 0.90904 0.77863 0.83579 0.07953  0.06422  0.12043  92   ALA B CA    
665  C  C     . ALA A 94  ? 0.93637 0.78147 0.85112 0.06282  0.06716  0.11453  92   ALA B C     
666  O  O     . ALA A 94  ? 0.95118 0.80953 0.88018 0.04989  0.05806  0.10748  92   ALA B O     
667  C  CB    . ALA A 94  ? 0.85757 0.75558 0.80408 0.07552  0.05348  0.11628  92   ALA B CB    
668  N  N     . PRO A 95  ? 0.97264 0.78221 0.85949 0.06204  0.08056  0.11739  93   PRO B N     
669  C  CA    . PRO A 95  ? 0.98194 0.76992 0.85605 0.04408  0.08378  0.11169  93   PRO B CA    
670  C  C     . PRO A 95  ? 0.93313 0.72601 0.80832 0.02719  0.07959  0.10497  93   PRO B C     
671  O  O     . PRO A 95  ? 0.90697 0.69314 0.77714 0.01057  0.07934  0.09974  93   PRO B O     
672  C  CB    . PRO A 95  ? 1.01398 0.76006 0.85345 0.04849  0.10144  0.11717  93   PRO B CB    
673  C  CG    . PRO A 95  ? 1.04090 0.78546 0.87253 0.06413  0.10738  0.12387  93   PRO B CG    
674  C  CD    . PRO A 95  ? 1.00508 0.79157 0.86792 0.07639  0.09455  0.12589  93   PRO B CD    
675  N  N     . ASN A 96  ? 1.08710 0.89345 0.96861 0.03069  0.07634  0.10528  94   ASN B N     
676  C  CA    . ASN A 96  ? 1.12809 0.94174 1.01136 0.01542  0.07212  0.09941  94   ASN B CA    
677  C  C     . ASN A 96  ? 1.05306 0.89784 0.96295 0.00762  0.05841  0.09413  94   ASN B C     
678  O  O     . ASN A 96  ? 1.08213 0.93069 0.99085 -0.00800 0.05619  0.08938  94   ASN B O     
679  C  CB    . ASN A 96  ? 1.17167 0.99065 1.05448 0.02233  0.07258  0.10151  94   ASN B CB    
680  C  CG    . ASN A 96  ? 1.22783 1.07038 1.13004 0.04022  0.06661  0.10613  94   ASN B CG    
681  O  OD1   . ASN A 96  ? 1.24585 1.08500 1.14595 0.05357  0.07052  0.11176  94   ASN B OD1   
682  N  ND2   . ASN A 96  ? 1.22437 1.09209 1.14452 0.03992  0.05753  0.10398  94   ASN B ND2   
683  N  N     . THR A 97  ? 0.81059 0.67821 0.74286 0.01810  0.04997  0.09515  95   THR B N     
684  C  CA    . THR A 97  ? 0.72586 0.61960 0.68040 0.01218  0.03870  0.09052  95   THR B CA    
685  C  C     . THR A 97  ? 0.72531 0.61381 0.67839 0.00225  0.03850  0.08764  95   THR B C     
686  O  O     . THR A 97  ? 0.68101 0.58590 0.64488 -0.00676 0.03214  0.08385  95   THR B O     
687  C  CB    . THR A 97  ? 0.66875 0.58486 0.64356 0.02423  0.03127  0.09173  95   THR B CB    
688  O  OG1   . THR A 97  ? 0.61999 0.52979 0.59348 0.03211  0.03375  0.09458  95   THR B OG1   
689  C  CG2   . THR A 97  ? 0.59947 0.52287 0.57545 0.03359  0.03165  0.09498  95   THR B CG2   
690  N  N     . PHE A 98  ? 0.71746 0.58374 0.65663 0.00425  0.04594  0.08994  96   PHE B N     
691  C  CA    . PHE A 98  ? 0.66184 0.51983 0.59573 -0.00775 0.04719  0.08702  96   PHE B CA    
692  C  C     . PHE A 98  ? 0.69863 0.54710 0.61588 -0.02542 0.05183  0.08401  96   PHE B C     
693  O  O     . PHE A 98  ? 0.63937 0.49543 0.55879 -0.03850 0.04917  0.08058  96   PHE B O     
694  C  CB    . PHE A 98  ? 0.64454 0.47807 0.56477 -0.00182 0.05532  0.09044  96   PHE B CB    
695  C  CG    . PHE A 98  ? 0.66479 0.48421 0.57447 -0.01586 0.05879  0.08757  96   PHE B CG    
696  C  CD1   . PHE A 98  ? 0.65150 0.48939 0.57915 -0.02025 0.05023  0.08423  96   PHE B CD1   
697  C  CD2   . PHE A 98  ? 0.74396 0.53030 0.62373 -0.02520 0.07156  0.08819  96   PHE B CD2   
698  C  CE1   . PHE A 98  ? 0.69221 0.51890 0.61038 -0.03358 0.05338  0.08181  96   PHE B CE1   
699  C  CE2   . PHE A 98  ? 0.74444 0.51770 0.61281 -0.04008 0.07533  0.08532  96   PHE B CE2   
700  C  CZ    . PHE A 98  ? 0.66987 0.46506 0.55868 -0.04423 0.06569  0.08225  96   PHE B CZ    
701  N  N     . LYS A 99  ? 0.83778 0.67127 0.73768 -0.02654 0.05898  0.08532  97   LYS B N     
702  C  CA    . LYS A 99  ? 0.82849 0.65339 0.71011 -0.04511 0.06400  0.08200  97   LYS B CA    
703  C  C     . LYS A 99  ? 0.77538 0.63431 0.67580 -0.05287 0.05347  0.07871  97   LYS B C     
704  O  O     . LYS A 99  ? 0.86204 0.72913 0.75778 -0.06975 0.05301  0.07554  97   LYS B O     
705  C  CB    . LYS A 99  ? 0.84485 0.64246 0.70115 -0.04346 0.07530  0.08418  97   LYS B CB    
706  C  CG    . LYS A 99  ? 0.89093 0.65207 0.72437 -0.03345 0.08830  0.08899  97   LYS B CG    
707  C  CD    . LYS A 99  ? 0.95462 0.67648 0.74907 -0.04573 0.10426  0.08834  97   LYS B CD    
708  C  CE    . LYS A 99  ? 0.99474 0.69336 0.77096 -0.03134 0.11469  0.09364  97   LYS B CE    
709  N  NZ    . LYS A 99  ? 0.99886 0.66894 0.74145 -0.04704 0.12691  0.09072  97   LYS B NZ    
710  N  N     . THR A 100 ? 0.63184 0.51213 0.55280 -0.04082 0.04545  0.07986  98   THR B N     
711  C  CA    . THR A 100 ? 0.66398 0.57489 0.60175 -0.04536 0.03658  0.07782  98   THR B CA    
712  C  C     . THR A 100 ? 0.67119 0.60499 0.62820 -0.04578 0.02857  0.07661  98   THR B C     
713  O  O     . THR A 100 ? 0.67904 0.63884 0.65251 -0.04400 0.02126  0.07625  98   THR B O     
714  C  CB    . THR A 100 ? 0.58343 0.50526 0.53317 -0.03281 0.03236  0.07951  98   THR B CB    
715  O  OG1   . THR A 100 ? 0.49608 0.43074 0.46550 -0.01961 0.02591  0.08061  98   THR B OG1   
716  C  CG2   . THR A 100 ? 0.64377 0.54041 0.57541 -0.02727 0.04101  0.08201  98   THR B CG2   
717  N  N     . LEU A 101 ? 0.72982 0.65316 0.68367 -0.04757 0.03062  0.07629  99   LEU B N     
718  C  CA    . LEU A 101 ? 0.73332 0.67675 0.70380 -0.04793 0.02381  0.07518  99   LEU B CA    
719  C  C     . LEU A 101 ? 0.71771 0.68145 0.68769 -0.06257 0.02197  0.07381  99   LEU B C     
720  O  O     . LEU A 101 ? 0.62892 0.61968 0.61557 -0.05923 0.01520  0.07428  99   LEU B O     
721  C  CB    . LEU A 101 ? 0.70974 0.63632 0.67596 -0.04707 0.02676  0.07512  99   LEU B CB    
722  C  CG    . LEU A 101 ? 0.58820 0.51131 0.56562 -0.03065 0.02427  0.07667  99   LEU B CG    
723  C  CD1   . LEU A 101 ? 0.55177 0.46551 0.52888 -0.03127 0.02524  0.07614  99   LEU B CD1   
724  C  CD2   . LEU A 101 ? 0.46182 0.41013 0.46046 -0.02168 0.01570  0.07622  99   LEU B CD2   
725  N  N     . ASP A 102 ? 0.98622 0.93747 0.93528 -0.07904 0.02888  0.07249  100  ASP B N     
726  C  CA    . ASP A 102 ? 0.99123 0.96505 0.93692 -0.09551 0.02789  0.07146  100  ASP B CA    
727  C  C     . ASP A 102 ? 0.89655 0.89764 0.85476 -0.09136 0.02214  0.07277  100  ASP B C     
728  O  O     . ASP A 102 ? 0.86624 0.89902 0.83659 -0.09347 0.01684  0.07404  100  ASP B O     
729  C  CB    . ASP A 102 ? 1.09963 1.05137 1.01578 -0.11486 0.03792  0.06927  100  ASP B CB    
730  C  CG    . ASP A 102 ? 1.13879 1.06834 1.04018 -0.12407 0.04427  0.06791  100  ASP B CG    
731  O  OD1   . ASP A 102 ? 1.11916 1.06822 1.02833 -0.13127 0.04060  0.06749  100  ASP B OD1   
732  O  OD2   . ASP A 102 ? 1.15557 1.04762 1.03622 -0.12376 0.05373  0.06772  100  ASP B OD2   
733  N  N     . SER A 103 ? 0.71024 0.69978 0.66537 -0.08426 0.02356  0.07311  101  SER B N     
734  C  CA    . SER A 103 ? 0.72288 0.73514 0.68785 -0.08092 0.01892  0.07427  101  SER B CA    
735  C  C     . SER A 103 ? 0.71234 0.74944 0.70147 -0.06709 0.01091  0.07641  101  SER B C     
736  O  O     . SER A 103 ? 0.69571 0.75949 0.69324 -0.06702 0.00718  0.07820  101  SER B O     
737  C  CB    . SER A 103 ? 0.78130 0.77349 0.73885 -0.07423 0.02216  0.07429  101  SER B CB    
738  O  OG    . SER A 103 ? 0.80806 0.81805 0.78231 -0.06259 0.01608  0.07588  101  SER B OG    
739  N  N     . TRP A 104 ? 0.71194 0.74000 0.71055 -0.05534 0.00909  0.07646  102  TRP B N     
740  C  CA    . TRP A 104 ? 0.68467 0.73007 0.70216 -0.04223 0.00327  0.07789  102  TRP B CA    
741  C  C     . TRP A 104 ? 0.62950 0.69655 0.65414 -0.04506 0.00089  0.07911  102  TRP B C     
742  O  O     . TRP A 104 ? 0.63625 0.72661 0.67072 -0.03955 -0.00208 0.08168  102  TRP B O     
743  C  CB    . TRP A 104 ? 0.65502 0.68346 0.67812 -0.02993 0.00265  0.07707  102  TRP B CB    
744  C  CG    . TRP A 104 ? 0.58863 0.60646 0.61059 -0.02236 0.00335  0.07733  102  TRP B CG    
745  C  CD1   . TRP A 104 ? 0.54529 0.54122 0.55701 -0.02068 0.00766  0.07742  102  TRP B CD1   
746  C  CD2   . TRP A 104 ? 0.61446 0.64374 0.64508 -0.01483 0.00030  0.07814  102  TRP B CD2   
747  N  NE1   . TRP A 104 ? 0.51448 0.51025 0.52905 -0.01267 0.00693  0.07836  102  TRP B NE1   
748  C  CE2   . TRP A 104 ? 0.58070 0.59607 0.60687 -0.00985 0.00224  0.07838  102  TRP B CE2   
749  C  CE3   . TRP A 104 ? 0.62993 0.67926 0.67031 -0.01119 -0.00301 0.07924  102  TRP B CE3   
750  C  CZ2   . TRP A 104 ? 0.64040 0.66225 0.67241 -0.00317 0.00021  0.07898  102  TRP B CZ2   
751  C  CZ3   . TRP A 104 ? 0.62904 0.68159 0.67387 -0.00422 -0.00432 0.07978  102  TRP B CZ3   
752  C  CH2   . TRP A 104 ? 0.63996 0.67932 0.68103 -0.00118 -0.00309 0.07930  102  TRP B CH2   
753  N  N     . ARG A 105 ? 0.46656 0.52587 0.48566 -0.05255 0.00281  0.07787  103  ARG B N     
754  C  CA    . ARG A 105 ? 0.49911 0.58077 0.52292 -0.05749 0.00120  0.07937  103  ARG B CA    
755  C  C     . ARG A 105 ? 0.53348 0.64411 0.55489 -0.06690 0.00086  0.08193  103  ARG B C     
756  O  O     . ARG A 105 ? 0.54363 0.68175 0.57585 -0.06001 -0.00202 0.08570  103  ARG B O     
757  C  CB    . ARG A 105 ? 0.49538 0.56183 0.50952 -0.06811 0.00438  0.07721  103  ARG B CB    
758  C  CG    . ARG A 105 ? 0.51942 0.60740 0.53885 -0.07290 0.00273  0.07862  103  ARG B CG    
759  C  CD    . ARG A 105 ? 0.58146 0.64966 0.58908 -0.08468 0.00662  0.07597  103  ARG B CD    
760  N  NE    . ARG A 105 ? 0.61487 0.70493 0.62563 -0.09222 0.00545  0.07724  103  ARG B NE    
761  C  CZ    . ARG A 105 ? 0.61771 0.72751 0.61905 -0.10988 0.00735  0.07801  103  ARG B CZ    
762  N  NH1   . ARG A 105 ? 0.59932 0.70733 0.58630 -0.12253 0.01081  0.07702  103  ARG B NH1   
763  N  NH2   . ARG A 105 ? 0.65703 0.78929 0.66247 -0.11555 0.00607  0.07972  103  ARG B NH2   
764  N  N     . ASP A 106 ? 0.56497 0.66950 0.57052 -0.08238 0.00464  0.08026  104  ASP B N     
765  C  CA    . ASP A 106 ? 0.51593 0.65022 0.51699 -0.09468 0.00462  0.08230  104  ASP B CA    
766  C  C     . ASP A 106 ? 0.50312 0.66098 0.51699 -0.08224 0.00075  0.08621  104  ASP B C     
767  O  O     . ASP A 106 ? 0.44661 0.63990 0.46647 -0.08286 -0.00119 0.09063  104  ASP B O     
768  C  CB    . ASP A 106 ? 0.53474 0.65215 0.51387 -0.11278 0.01032  0.07889  104  ASP B CB    
769  C  CG    . ASP A 106 ? 0.65508 0.76235 0.61728 -0.13175 0.01547  0.07619  104  ASP B CG    
770  O  OD1   . ASP A 106 ? 0.77205 0.89353 0.74214 -0.13172 0.01330  0.07754  104  ASP B OD1   
771  O  OD2   . ASP A 106 ? 0.64137 0.72545 0.58096 -0.14688 0.02240  0.07276  104  ASP B OD2   
772  N  N     . GLU A 107 ? 0.61593 0.75590 0.63368 -0.07025 0.00004  0.08529  105  GLU B N     
773  C  CA    . GLU A 107 ? 0.59367 0.75311 0.62178 -0.05890 -0.00276 0.08892  105  GLU B CA    
774  C  C     . GLU A 107 ? 0.52838 0.70192 0.57072 -0.04331 -0.00504 0.09262  105  GLU B C     
775  O  O     . GLU A 107 ? 0.44602 0.64466 0.49466 -0.03597 -0.00596 0.09753  105  GLU B O     
776  C  CB    . GLU A 107 ? 0.57673 0.71375 0.60416 -0.05155 -0.00256 0.08684  105  GLU B CB    
777  C  CG    . GLU A 107 ? 0.64596 0.80186 0.67999 -0.04409 -0.00446 0.09018  105  GLU B CG    
778  C  CD    . GLU A 107 ? 0.73358 0.90962 0.75907 -0.05791 -0.00365 0.09129  105  GLU B CD    
779  O  OE1   . GLU A 107 ? 0.74663 0.91699 0.75838 -0.07479 -0.00087 0.08844  105  GLU B OE1   
780  O  OE2   . GLU A 107 ? 0.72943 0.92713 0.76053 -0.05243 -0.00519 0.09509  105  GLU B OE2   
781  N  N     . PHE A 108 ? 0.49655 0.65299 0.54250 -0.03748 -0.00514 0.09061  106  PHE B N     
782  C  CA    . PHE A 108 ? 0.47023 0.63447 0.52669 -0.02267 -0.00602 0.09339  106  PHE B CA    
783  C  C     . PHE A 108 ? 0.43789 0.63414 0.49700 -0.02447 -0.00590 0.09845  106  PHE B C     
784  O  O     . PHE A 108 ? 0.37346 0.58926 0.43854 -0.01230 -0.00532 0.10387  106  PHE B O     
785  C  CB    . PHE A 108 ? 0.41954 0.55747 0.47786 -0.01776 -0.00606 0.08938  106  PHE B CB    
786  C  CG    . PHE A 108 ? 0.34555 0.48924 0.41121 -0.00574 -0.00589 0.09139  106  PHE B CG    
787  C  CD1   . PHE A 108 ? 0.29094 0.43094 0.36035 0.00817  -0.00492 0.09253  106  PHE B CD1   
788  C  CD2   . PHE A 108 ? 0.32835 0.47987 0.39516 -0.00886 -0.00580 0.09214  106  PHE B CD2   
789  C  CE1   . PHE A 108 ? 0.25150 0.39296 0.32384 0.01912  -0.00299 0.09426  106  PHE B CE1   
790  C  CE2   . PHE A 108 ? 0.38463 0.54007 0.45658 0.00288  -0.00478 0.09415  106  PHE B CE2   
791  C  CZ    . PHE A 108 ? 0.31460 0.46359 0.38842 0.01708  -0.00295 0.09513  106  PHE B CZ    
792  N  N     . LEU A 109 ? 0.39758 0.59944 0.45087 -0.03938 -0.00559 0.09722  107  LEU B N     
793  C  CA    . LEU A 109 ? 0.37601 0.61365 0.43077 -0.04417 -0.00555 0.10234  107  LEU B CA    
794  C  C     . LEU A 109 ? 0.42283 0.69485 0.47785 -0.04478 -0.00566 0.10809  107  LEU B C     
795  O  O     . LEU A 109 ? 0.42440 0.73179 0.48401 -0.04038 -0.00541 0.11497  107  LEU B O     
796  C  CB    . LEU A 109 ? 0.36823 0.60365 0.41330 -0.06431 -0.00461 0.09899  107  LEU B CB    
797  C  CG    . LEU A 109 ? 0.46149 0.66734 0.50595 -0.06424 -0.00413 0.09440  107  LEU B CG    
798  C  CD1   . LEU A 109 ? 0.56993 0.76766 0.60019 -0.08599 -0.00160 0.09072  107  LEU B CD1   
799  C  CD2   . LEU A 109 ? 0.44868 0.66779 0.50358 -0.05251 -0.00512 0.09778  107  LEU B CD2   
800  N  N     . ILE A 110 ? 0.53609 0.79982 0.58628 -0.04890 -0.00575 0.10605  108  ILE B N     
801  C  CA    . ILE A 110 ? 0.52048 0.81658 0.57097 -0.04924 -0.00597 0.11142  108  ILE B CA    
802  C  C     . ILE A 110 ? 0.53144 0.83102 0.59090 -0.02736 -0.00563 0.11637  108  ILE B C     
803  O  O     . ILE A 110 ? 0.60000 0.93324 0.66224 -0.02148 -0.00499 0.12376  108  ILE B O     
804  C  CB    . ILE A 110 ? 0.52035 0.80656 0.55935 -0.06573 -0.00560 0.10678  108  ILE B CB    
805  C  CG1   . ILE A 110 ? 0.62370 0.91083 0.64961 -0.08905 -0.00390 0.10303  108  ILE B CG1   
806  C  CG2   . ILE A 110 ? 0.43360 0.74975 0.47329 -0.06500 -0.00617 0.11167  108  ILE B CG2   
807  C  CD1   . ILE A 110 ? 0.69428 0.96505 0.70418 -0.10640 -0.00152 0.09777  108  ILE B CD1   
808  N  N     . GLN A 111 ? 0.38343 0.65002 0.44613 -0.01520 -0.00528 0.11294  109  GLN B N     
809  C  CA    . GLN A 111 ? 0.41193 0.67870 0.47936 0.00327  -0.00356 0.11710  109  GLN B CA    
810  C  C     . GLN A 111 ? 0.45545 0.72531 0.52705 0.01946  -0.00060 0.12148  109  GLN B C     
811  O  O     . GLN A 111 ? 0.49381 0.77612 0.56642 0.03440  0.00281  0.12811  109  GLN B O     
812  C  CB    . GLN A 111 ? 0.50938 0.74121 0.57579 0.00646  -0.00400 0.11122  109  GLN B CB    
813  C  CG    . GLN A 111 ? 0.56244 0.78624 0.62320 -0.00748 -0.00584 0.10690  109  GLN B CG    
814  C  CD    . GLN A 111 ? 0.58048 0.83211 0.63966 -0.01099 -0.00601 0.11139  109  GLN B CD    
815  O  OE1   . GLN A 111 ? 0.61294 0.87326 0.67565 0.00140  -0.00489 0.11589  109  GLN B OE1   
816  N  NE2   . GLN A 111 ? 0.52048 0.78503 0.57258 -0.02867 -0.00676 0.11004  109  GLN B NE2   
817  N  N     . ALA A 112 ? 0.43343 0.69061 0.50590 0.01739  -0.00095 0.11818  110  ALA B N     
818  C  CA    . ALA A 112 ? 0.42360 0.68182 0.49838 0.03173  0.00238  0.12179  110  ALA B CA    
819  C  C     . ALA A 112 ? 0.49356 0.79003 0.57019 0.03117  0.00320  0.12918  110  ALA B C     
820  O  O     . ALA A 112 ? 0.49542 0.80505 0.57283 0.04720  0.00760  0.13627  110  ALA B O     
821  C  CB    . ALA A 112 ? 0.49563 0.72135 0.57055 0.03010  0.00151  0.11443  110  ALA B CB    
822  N  N     . SER A 113 ? 0.55708 0.87103 0.63265 0.01258  -0.00011 0.12775  111  SER B N     
823  C  CA    . SER A 113 ? 0.57552 0.93429 0.65193 0.00742  0.00005  0.13504  111  SER B CA    
824  C  C     . SER A 113 ? 0.56087 0.93065 0.64073 0.01699  0.00228  0.13940  111  SER B C     
825  O  O     . SER A 113 ? 0.54895 0.95160 0.63083 0.03024  0.00560  0.14942  111  SER B O     
826  C  CB    . SER A 113 ? 0.62264 1.01515 0.69970 0.01627  0.00195  0.14406  111  SER B CB    
827  O  OG    . SER A 113 ? 0.70963 1.14742 0.78554 0.00265  0.00052  0.14899  111  SER B OG    
828  N  N     . PRO A 114 ? 0.51199 0.85648 0.59211 0.01207  0.00113  0.13299  112  PRO B N     
829  C  CA    . PRO A 114 ? 0.48498 0.83974 0.56815 0.02135  0.00337  0.13707  112  PRO B CA    
830  C  C     . PRO A 114 ? 0.52091 0.91643 0.60457 0.00743  0.00187  0.14130  112  PRO B C     
831  O  O     . PRO A 114 ? 0.59829 1.00072 0.67779 -0.01444 -0.00114 0.13734  112  PRO B O     
832  C  CB    . PRO A 114 ? 0.47466 0.78526 0.55755 0.01923  0.00215  0.12760  112  PRO B CB    
833  C  CG    . PRO A 114 ? 0.41314 0.70428 0.49221 0.00052  -0.00154 0.11961  112  PRO B CG    
834  C  CD    . PRO A 114 ? 0.43735 0.74264 0.51445 -0.00075 -0.00168 0.12235  112  PRO B CD    
835  N  N     . ARG A 115 ? 0.48236 0.90492 0.56934 0.02000  0.00488  0.14962  113  ARG B N     
836  C  CA    . ARG A 115 ? 0.43520 0.89335 0.52305 0.00644  0.00341  0.15274  113  ARG B CA    
837  C  C     . ARG A 115 ? 0.59219 1.01842 0.67779 -0.01127 0.00031  0.14212  113  ARG B C     
838  O  O     . ARG A 115 ? 0.68602 1.07099 0.77264 -0.00367 0.00058  0.13597  113  ARG B O     
839  C  CB    . ARG A 115 ? 0.44437 0.93049 0.53620 0.02542  0.00767  0.16302  113  ARG B CB    
840  C  CG    . ARG A 115 ? 0.49960 0.99204 0.59129 0.05294  0.01379  0.17233  113  ARG B CG    
841  C  CD    . ARG A 115 ? 0.44885 0.95766 0.54163 0.07257  0.01945  0.18124  113  ARG B CD    
842  N  NE    . ARG A 115 ? 0.53008 1.09105 0.62634 0.06259  0.01779  0.18814  113  ARG B NE    
843  C  CZ    . ARG A 115 ? 0.65771 1.26523 0.75423 0.07867  0.02282  0.20229  113  ARG B CZ    
844  N  NH1   . ARG A 115 ? 0.54923 1.14690 0.63708 0.10499  0.03115  0.20981  113  ARG B NH1   
845  N  NH2   . ARG A 115 ? 0.75381 1.39531 0.84430 0.06533  0.02049  0.20552  113  ARG B NH2   
846  N  N     . ASP A 116 ? 0.60764 1.05309 0.68854 -0.03554 -0.00196 0.14010  114  ASP B N     
847  C  CA    . ASP A 116 ? 0.64290 1.05986 0.71859 -0.05434 -0.00360 0.13088  114  ASP B CA    
848  C  C     . ASP A 116 ? 0.66637 1.03026 0.73816 -0.05537 -0.00433 0.12135  114  ASP B C     
849  O  O     . ASP A 116 ? 0.67004 0.99874 0.74473 -0.04605 -0.00436 0.11675  114  ASP B O     
850  C  CB    . ASP A 116 ? 0.61898 1.03358 0.70002 -0.04654 -0.00300 0.13187  114  ASP B CB    
851  C  CG    . ASP A 116 ? 0.69711 1.09950 0.77200 -0.06901 -0.00415 0.12524  114  ASP B CG    
852  O  OD1   . ASP A 116 ? 0.74288 1.14449 0.80740 -0.09159 -0.00437 0.12110  114  ASP B OD1   
853  O  OD2   . ASP A 116 ? 0.69811 1.09015 0.77687 -0.06431 -0.00407 0.12414  114  ASP B OD2   
854  N  N     . PRO A 117 ? 0.61286 0.97119 0.67766 -0.06624 -0.00469 0.11850  115  PRO B N     
855  C  CA    . PRO A 117 ? 0.64198 0.95402 0.70390 -0.06341 -0.00493 0.11118  115  PRO B CA    
856  C  C     . PRO A 117 ? 0.67747 0.95227 0.73206 -0.07602 -0.00453 0.10307  115  PRO B C     
857  O  O     . PRO A 117 ? 0.71726 0.95423 0.77154 -0.06930 -0.00456 0.09801  115  PRO B O     
858  C  CB    . PRO A 117 ? 0.67055 0.99271 0.72585 -0.07262 -0.00483 0.11144  115  PRO B CB    
859  C  CG    . PRO A 117 ? 0.64495 1.00582 0.69359 -0.09245 -0.00437 0.11441  115  PRO B CG    
860  C  CD    . PRO A 117 ? 0.61320 1.00730 0.67123 -0.08272 -0.00461 0.12160  115  PRO B CD    
861  N  N     . GLU A 118 ? 0.79352 1.07823 0.84127 -0.09402 -0.00364 0.10204  116  GLU B N     
862  C  CA    . GLU A 118 ? 0.83714 1.08423 0.87520 -0.10624 -0.00190 0.09484  116  GLU B CA    
863  C  C     . GLU A 118 ? 0.85968 1.09551 0.90548 -0.09756 -0.00282 0.09403  116  GLU B C     
864  O  O     . GLU A 118 ? 0.93502 1.14099 0.97367 -0.10608 -0.00125 0.08881  116  GLU B O     
865  C  CB    . GLU A 118 ? 0.85954 1.11515 0.88054 -0.13410 0.00123  0.09277  116  GLU B CB    
866  C  CG    . GLU A 118 ? 0.96557 1.23685 0.97747 -0.14473 0.00243  0.09359  116  GLU B CG    
867  C  CD    . GLU A 118 ? 0.99015 1.22116 0.99438 -0.14185 0.00430  0.08872  116  GLU B CD    
868  O  OE1   . GLU A 118 ? 0.97787 1.18979 0.96269 -0.16073 0.00902  0.08431  116  GLU B OE1   
869  O  OE2   . GLU A 118 ? 0.99142 1.20990 1.00749 -0.12097 0.00180  0.08947  116  GLU B OE2   
870  N  N     . ASN A 119 ? 0.82171 1.07928 0.88055 -0.08008 -0.00452 0.09934  117  ASN B N     
871  C  CA    . ASN A 119 ? 0.79779 1.03927 0.86448 -0.06699 -0.00517 0.09816  117  ASN B CA    
872  C  C     . ASN A 119 ? 0.72601 0.95153 0.80037 -0.04442 -0.00552 0.09842  117  ASN B C     
873  O  O     . ASN A 119 ? 0.78334 1.00524 0.86414 -0.03029 -0.00520 0.09943  117  ASN B O     
874  C  CB    . ASN A 119 ? 0.85517 1.13176 0.92729 -0.06607 -0.00519 0.10388  117  ASN B CB    
875  C  CG    . ASN A 119 ? 0.93171 1.21219 0.99604 -0.08860 -0.00466 0.10134  117  ASN B CG    
876  O  OD1   . ASN A 119 ? 0.98147 1.24281 1.03346 -0.10704 -0.00321 0.09619  117  ASN B OD1   
877  N  ND2   . ASN A 119 ? 0.91922 1.22286 0.98906 -0.08692 -0.00491 0.10509  117  ASN B ND2   
878  N  N     . PHE A 120 ? 0.51446 0.72968 0.58661 -0.04175 -0.00554 0.09730  118  PHE B N     
879  C  CA    . PHE A 120 ? 0.43526 0.63391 0.51176 -0.02404 -0.00533 0.09681  118  PHE B CA    
880  C  C     . PHE A 120 ? 0.46055 0.61877 0.53504 -0.02386 -0.00598 0.08954  118  PHE B C     
881  O  O     . PHE A 120 ? 0.43175 0.57375 0.49913 -0.03653 -0.00597 0.08578  118  PHE B O     
882  C  CB    . PHE A 120 ? 0.37558 0.58634 0.45045 -0.02277 -0.00511 0.09957  118  PHE B CB    
883  C  CG    . PHE A 120 ? 0.41085 0.60566 0.48869 -0.00597 -0.00425 0.09925  118  PHE B CG    
884  C  CD1   . PHE A 120 ? 0.43716 0.64685 0.51847 0.01062  -0.00163 0.10503  118  PHE B CD1   
885  C  CD2   . PHE A 120 ? 0.41156 0.57645 0.48689 -0.00675 -0.00507 0.09361  118  PHE B CD2   
886  C  CE1   . PHE A 120 ? 0.42185 0.61396 0.50265 0.02426  0.00046  0.10428  118  PHE B CE1   
887  C  CE2   . PHE A 120 ? 0.41290 0.56471 0.48980 0.00641  -0.00406 0.09301  118  PHE B CE2   
888  C  CZ    . PHE A 120 ? 0.39605 0.56006 0.47496 0.02100  -0.00114 0.09790  118  PHE B CZ    
889  N  N     . PRO A 121 ? 0.40922 0.55138 0.48814 -0.00945 -0.00566 0.08792  119  PRO B N     
890  C  CA    . PRO A 121 ? 0.41876 0.52798 0.49654 -0.00903 -0.00643 0.08165  119  PRO B CA    
891  C  C     . PRO A 121 ? 0.50873 0.60241 0.58284 -0.01034 -0.00675 0.07928  119  PRO B C     
892  O  O     . PRO A 121 ? 0.56346 0.66146 0.63876 -0.00259 -0.00634 0.08083  119  PRO B O     
893  C  CB    . PRO A 121 ? 0.36532 0.46700 0.44706 0.00582  -0.00531 0.08099  119  PRO B CB    
894  C  CG    . PRO A 121 ? 0.35251 0.47661 0.43541 0.01583  -0.00289 0.08702  119  PRO B CG    
895  C  CD    . PRO A 121 ? 0.39290 0.54700 0.47600 0.00663  -0.00353 0.09212  119  PRO B CD    
896  N  N     . PHE A 122 ? 0.46824 0.54328 0.53679 -0.01964 -0.00672 0.07599  120  PHE B N     
897  C  CA    . PHE A 122 ? 0.40536 0.46172 0.47008 -0.01860 -0.00641 0.07376  120  PHE B CA    
898  C  C     . PHE A 122 ? 0.46274 0.49574 0.52721 -0.01574 -0.00648 0.07015  120  PHE B C     
899  O  O     . PHE A 122 ? 0.42746 0.45547 0.49190 -0.01919 -0.00638 0.06899  120  PHE B O     
900  C  CB    . PHE A 122 ? 0.44652 0.50143 0.50140 -0.03108 -0.00449 0.07435  120  PHE B CB    
901  C  CG    . PHE A 122 ? 0.52156 0.59935 0.57651 -0.03318 -0.00472 0.07763  120  PHE B CG    
902  C  CD1   . PHE A 122 ? 0.50819 0.58540 0.56466 -0.02615 -0.00520 0.07817  120  PHE B CD1   
903  C  CD2   . PHE A 122 ? 0.55029 0.65259 0.60379 -0.04239 -0.00445 0.08050  120  PHE B CD2   
904  C  CE1   . PHE A 122 ? 0.52128 0.61958 0.57783 -0.02763 -0.00535 0.08140  120  PHE B CE1   
905  C  CE2   . PHE A 122 ? 0.55671 0.68347 0.61033 -0.04408 -0.00467 0.08412  120  PHE B CE2   
906  C  CZ    . PHE A 122 ? 0.55983 0.68357 0.61503 -0.03632 -0.00511 0.08454  120  PHE B CZ    
907  N  N     . VAL A 123 ? 0.48574 0.50706 0.55045 -0.00904 -0.00673 0.06872  121  VAL B N     
908  C  CA    . VAL A 123 ? 0.45053 0.45363 0.51467 -0.00560 -0.00672 0.06616  121  VAL B CA    
909  C  C     . VAL A 123 ? 0.53089 0.52406 0.58943 -0.00489 -0.00524 0.06687  121  VAL B C     
910  O  O     . VAL A 123 ? 0.50584 0.50542 0.56607 -0.00077 -0.00591 0.06754  121  VAL B O     
911  C  CB    . VAL A 123 ? 0.37790 0.38136 0.44849 0.00369  -0.00835 0.06379  121  VAL B CB    
912  C  CG1   . VAL A 123 ? 0.31545 0.30479 0.38506 0.00681  -0.00857 0.06160  121  VAL B CG1   
913  C  CG2   . VAL A 123 ? 0.30240 0.31210 0.37671 0.00431  -0.00869 0.06330  121  VAL B CG2   
914  N  N     . VAL A 124 ? 0.78321 0.76008 0.83400 -0.00817 -0.00249 0.06720  122  VAL B N     
915  C  CA    . VAL A 124 ? 0.82983 0.79559 0.87227 -0.00691 0.00067  0.06907  122  VAL B CA    
916  C  C     . VAL A 124 ? 0.73764 0.69597 0.78204 0.00229  0.00052  0.06912  122  VAL B C     
917  O  O     . VAL A 124 ? 0.78240 0.73334 0.82729 0.00328  0.00070  0.06830  122  VAL B O     
918  C  CB    . VAL A 124 ? 0.87803 0.82869 0.90572 -0.01683 0.00625  0.07040  122  VAL B CB    
919  C  CG1   . VAL A 124 ? 0.90115 0.83850 0.91754 -0.01445 0.01104  0.07285  122  VAL B CG1   
920  C  CG2   . VAL A 124 ? 0.86144 0.82496 0.88753 -0.02814 0.00590  0.07007  122  VAL B CG2   
921  N  N     . LEU A 125 ? 0.37908 0.34167 0.42468 0.00866  0.00012  0.07029  123  LEU B N     
922  C  CA    . LEU A 125 ? 0.35534 0.31732 0.40273 0.01700  -0.00010 0.07111  123  LEU B CA    
923  C  C     . LEU A 125 ? 0.45739 0.40999 0.49471 0.02103  0.00480  0.07564  123  LEU B C     
924  O  O     . LEU A 125 ? 0.35612 0.31245 0.39135 0.02145  0.00546  0.07696  123  LEU B O     
925  C  CB    . LEU A 125 ? 0.27124 0.24878 0.32750 0.02108  -0.00415 0.06887  123  LEU B CB    
926  C  CG    . LEU A 125 ? 0.26089 0.24546 0.32430 0.01960  -0.00731 0.06464  123  LEU B CG    
927  C  CD1   . LEU A 125 ? 0.25599 0.24962 0.32262 0.02319  -0.00899 0.06246  123  LEU B CD1   
928  C  CD2   . LEU A 125 ? 0.25995 0.23727 0.32415 0.01779  -0.00749 0.06303  123  LEU B CD2   
929  N  N     . GLY A 126 ? 0.66786 0.60780 0.69808 0.02500  0.00888  0.07848  124  GLY B N     
930  C  CA    . GLY A 126 ? 0.67658 0.60887 0.69676 0.03288  0.01453  0.08404  124  GLY B CA    
931  C  C     . GLY A 126 ? 0.67175 0.62114 0.69946 0.04281  0.01192  0.08599  124  GLY B C     
932  O  O     . GLY A 126 ? 0.72918 0.68073 0.75871 0.04765  0.01183  0.08716  124  GLY B O     
933  N  N     . ASN A 127 ? 0.52875 0.49187 0.56036 0.04510  0.00989  0.08642  125  ASN B N     
934  C  CA    . ASN A 127 ? 0.52647 0.51045 0.56539 0.05145  0.00683  0.08744  125  ASN B CA    
935  C  C     . ASN A 127 ? 0.62207 0.60729 0.65308 0.06284  0.01232  0.09532  125  ASN B C     
936  O  O     . ASN A 127 ? 0.59881 0.56741 0.61755 0.06638  0.01902  0.09988  125  ASN B O     
937  C  CB    . ASN A 127 ? 0.45776 0.45640 0.50350 0.04811  0.00265  0.08440  125  ASN B CB    
938  C  CG    . ASN A 127 ? 0.43691 0.45628 0.49057 0.04843  -0.00161 0.08195  125  ASN B CG    
939  O  OD1   . ASN A 127 ? 0.52822 0.55003 0.58530 0.04651  -0.00364 0.07896  125  ASN B OD1   
940  N  ND2   . ASN A 127 ? 0.43918 0.47334 0.49453 0.04970  -0.00263 0.08285  125  ASN B ND2   
941  N  N     . LYS A 128 ? 0.70696 0.71330 0.74384 0.06843  0.01001  0.09707  126  LYS B N     
942  C  CA    . LYS A 128 ? 0.63086 0.65015 0.66337 0.08068  0.01398  0.10536  126  LYS B CA    
943  C  C     . LYS A 128 ? 0.63685 0.64348 0.65978 0.09012  0.02064  0.11193  126  LYS B C     
944  O  O     . LYS A 128 ? 0.62166 0.62574 0.63421 0.10225  0.02792  0.12072  126  LYS B O     
945  C  CB    . LYS A 128 ? 0.57275 0.58993 0.59889 0.08508  0.01776  0.10958  126  LYS B CB    
946  C  CG    . LYS A 128 ? 0.58515 0.61835 0.62057 0.07762  0.01161  0.10438  126  LYS B CG    
947  C  CD    . LYS A 128 ? 0.56545 0.60155 0.59586 0.08311  0.01483  0.10910  126  LYS B CD    
948  C  CE    . LYS A 128 ? 0.57839 0.62767 0.61756 0.07458  0.00886  0.10339  126  LYS B CE    
949  N  NZ    . LYS A 128 ? 0.53773 0.58253 0.57193 0.07681  0.01153  0.10598  126  LYS B NZ    
950  N  N     . ILE A 129 ? 0.61085 0.60885 0.63603 0.08566  0.01902  0.10831  127  ILE B N     
951  C  CA    . ILE A 129 ? 0.59758 0.58266 0.61326 0.09451  0.02560  0.11452  127  ILE B CA    
952  C  C     . ILE A 129 ? 0.61750 0.62883 0.63502 0.10698  0.02652  0.12193  127  ILE B C     
953  O  O     . ILE A 129 ? 0.63204 0.63495 0.64057 0.11738  0.03311  0.12904  127  ILE B O     
954  C  CB    . ILE A 129 ? 0.52645 0.49788 0.54500 0.08647  0.02318  0.10877  127  ILE B CB    
955  C  CG1   . ILE A 129 ? 0.47449 0.46721 0.50868 0.07779  0.01347  0.10066  127  ILE B CG1   
956  C  CG2   . ILE A 129 ? 0.51666 0.45842 0.52726 0.07720  0.02613  0.10515  127  ILE B CG2   
957  C  CD1   . ILE A 129 ? 0.40482 0.38747 0.44178 0.07260  0.01151  0.09624  127  ILE B CD1   
958  N  N     . ASP A 130 ? 0.65144 0.69545 0.67931 0.10583  0.02058  0.12077  128  ASP B N     
959  C  CA    . ASP A 130 ? 0.65575 0.73175 0.68556 0.11624  0.02107  0.12813  128  ASP B CA    
960  C  C     . ASP A 130 ? 0.65976 0.74135 0.67957 0.13228  0.02911  0.14000  128  ASP B C     
961  O  O     . ASP A 130 ? 0.65433 0.75928 0.67227 0.14506  0.03227  0.14924  128  ASP B O     
962  C  CB    . ASP A 130 ? 0.63401 0.74402 0.67635 0.10628  0.01233  0.12186  128  ASP B CB    
963  C  CG    . ASP A 130 ? 0.62937 0.74424 0.67436 0.10031  0.00987  0.11858  128  ASP B CG    
964  O  OD1   . ASP A 130 ? 0.58706 0.68322 0.63464 0.08928  0.00678  0.11019  128  ASP B OD1   
965  O  OD2   . ASP A 130 ? 0.59063 0.72901 0.63483 0.10740  0.01140  0.12508  128  ASP B OD2   
966  N  N     . LEU A 131 ? 0.70185 0.76419 0.71470 0.13230  0.03277  0.14034  129  LEU B N     
967  C  CA    . LEU A 131 ? 0.73085 0.79179 0.73124 0.14796  0.04195  0.15145  129  LEU B CA    
968  C  C     . LEU A 131 ? 0.83408 0.86071 0.81529 0.15958  0.05410  0.15905  129  LEU B C     
969  O  O     . LEU A 131 ? 0.88722 0.88819 0.86512 0.15255  0.05474  0.15428  129  LEU B O     
970  C  CB    . LEU A 131 ? 0.60846 0.66025 0.60759 0.14218  0.04140  0.14802  129  LEU B CB    
971  C  CG    . LEU A 131 ? 0.64880 0.72883 0.66450 0.12967  0.03052  0.14000  129  LEU B CG    
972  C  CD1   . LEU A 131 ? 0.63710 0.70943 0.65103 0.12593  0.03061  0.13795  129  LEU B CD1   
973  C  CD2   . LEU A 131 ? 0.68453 0.80845 0.70810 0.13520  0.02736  0.14486  129  LEU B CD2   
974  N  N     . GLU A 132 ? 1.02810 1.05377 0.99496 0.17782  0.06473  0.17138  130  GLU B N     
975  C  CA    . GLU A 132 ? 1.12345 1.11774 1.06859 0.19191  0.07861  0.18064  130  GLU B CA    
976  C  C     . GLU A 132 ? 1.08041 1.03027 1.00257 0.19331  0.09036  0.18225  130  GLU B C     
977  O  O     . GLU A 132 ? 1.11282 1.02822 1.01483 0.19712  0.10222  0.18402  130  GLU B O     
978  C  CB    . GLU A 132 ? 1.22916 1.25228 1.17063 0.21266  0.08505  0.19347  130  GLU B CB    
979  C  CG    . GLU A 132 ? 1.27188 1.31686 1.22250 0.21425  0.08123  0.19412  130  GLU B CG    
980  C  CD    . GLU A 132 ? 1.26627 1.36505 1.23965 0.21016  0.06768  0.19337  130  GLU B CD    
981  O  OE1   . GLU A 132 ? 1.29844 1.41898 1.28055 0.20445  0.06194  0.19042  130  GLU B OE1   
982  O  OE2   . GLU A 132 ? 1.21540 1.33353 1.19704 0.20887  0.06317  0.19276  130  GLU B OE2   
983  N  N     . ASN A 133 ? 0.81876 0.76884 0.74337 0.18596  0.08736  0.17773  131  ASN B N     
984  C  CA    . ASN A 133 ? 0.86891 0.77537 0.77110 0.18308  0.09782  0.17708  131  ASN B CA    
985  C  C     . ASN A 133 ? 0.84072 0.72348 0.74563 0.16007  0.09219  0.16386  131  ASN B C     
986  O  O     . ASN A 133 ? 0.81881 0.69206 0.72290 0.14842  0.09003  0.15749  131  ASN B O     
987  C  CB    . ASN A 133 ? 0.90597 0.82208 0.80584 0.18865  0.09952  0.18036  131  ASN B CB    
988  C  CG    . ASN A 133 ? 0.91598 0.86928 0.84242 0.17652  0.08376  0.17206  131  ASN B CG    
989  O  OD1   . ASN A 133 ? 0.92280 0.90316 0.86945 0.16884  0.07243  0.16665  131  ASN B OD1   
990  N  ND2   . ASN A 133 ? 0.91738 0.87031 0.84179 0.17491  0.08403  0.17118  131  ASN B ND2   
991  N  N     . ARG A 134 ? 0.98337 0.85756 0.89087 0.15393  0.09025  0.16033  132  ARG B N     
992  C  CA    . ARG A 134 ? 0.94799 0.80274 0.85764 0.13327  0.08554  0.14908  132  ARG B CA    
993  C  C     . ARG A 134 ? 0.97900 0.78623 0.85896 0.12888  0.09953  0.14990  132  ARG B C     
994  O  O     . ARG A 134 ? 0.98738 0.76781 0.84555 0.13881  0.11255  0.15719  132  ARG B O     
995  C  CB    . ARG A 134 ? 0.90348 0.76605 0.82549 0.12864  0.07908  0.14536  132  ARG B CB    
996  C  CG    . ARG A 134 ? 0.89296 0.73692 0.81619 0.10888  0.07522  0.13512  132  ARG B CG    
997  C  CD    . ARG A 134 ? 0.93596 0.76635 0.85585 0.10788  0.07739  0.13504  132  ARG B CD    
998  N  NE    . ARG A 134 ? 1.01043 0.82640 0.93174 0.08850  0.07359  0.12557  132  ARG B NE    
999  C  CZ    . ARG A 134 ? 0.99792 0.83276 0.93997 0.07841  0.06172  0.11776  132  ARG B CZ    
1000 N  NH1   . ARG A 134 ? 0.91869 0.78465 0.88040 0.08429  0.05275  0.11730  132  ARG B NH1   
1001 N  NH2   . ARG A 134 ? 1.06382 0.88640 1.00508 0.06204  0.05967  0.11062  132  ARG B NH2   
1002 N  N     . GLN A 135 ? 0.95392 0.75030 0.83136 0.11318  0.09751  0.14237  133  GLN B N     
1003 C  CA    . GLN A 135 ? 0.99017 0.74348 0.83756 0.10559  0.11081  0.14199  133  GLN B CA    
1004 C  C     . GLN A 135 ? 0.99876 0.73458 0.84307 0.08457  0.10896  0.13311  133  GLN B C     
1005 O  O     . GLN A 135 ? 1.09380 0.79199 0.91140 0.08062  0.12177  0.13457  133  GLN B O     
1006 C  CB    . GLN A 135 ? 0.95571 0.70891 0.79864 0.10174  0.11139  0.14028  133  GLN B CB    
1007 C  CG    . GLN A 135 ? 0.92237 0.69481 0.76855 0.12103  0.11287  0.14867  133  GLN B CG    
1008 C  CD    . GLN A 135 ? 0.97355 0.72077 0.79580 0.12200  0.12403  0.15092  133  GLN B CD    
1009 O  OE1   . GLN A 135 ? 0.97615 0.68104 0.76775 0.11706  0.13809  0.15138  133  GLN B OE1   
1010 N  NE2   . GLN A 135 ? 1.01701 0.78869 0.85153 0.12707  0.11833  0.15184  133  GLN B NE2   
1011 N  N     . VAL A 136 ? 0.81275 0.57473 0.68211 0.07099  0.09421  0.12434  134  VAL B N     
1012 C  CA    . VAL A 136 ? 0.82531 0.57646 0.69313 0.05090  0.09185  0.11637  134  VAL B CA    
1013 C  C     . VAL A 136 ? 0.78849 0.53715 0.66094 0.05243  0.09079  0.11665  134  VAL B C     
1014 O  O     . VAL A 136 ? 0.72388 0.49971 0.61861 0.06089  0.08150  0.11717  134  VAL B O     
1015 C  CB    . VAL A 136 ? 0.80618 0.58712 0.69790 0.03822  0.07762  0.10827  134  VAL B CB    
1016 C  CG1   . VAL A 136 ? 0.80448 0.57311 0.68816 0.01684  0.07816  0.10150  134  VAL B CG1   
1017 C  CG2   . VAL A 136 ? 0.77752 0.57070 0.67228 0.04205  0.07586  0.10916  134  VAL B CG2   
1018 N  N     . ALA A 137 ? 0.89512 0.61100 0.74555 0.04270  0.10048  0.11578  135  ALA B N     
1019 C  CA    . ALA A 137 ? 0.96290 0.67197 0.81461 0.04460  0.10114  0.11664  135  ALA B CA    
1020 C  C     . ALA A 137 ? 0.86369 0.59639 0.73980 0.03087  0.08721  0.10816  135  ALA B C     
1021 O  O     . ALA A 137 ? 0.83317 0.57407 0.71420 0.01514  0.08193  0.10171  135  ALA B O     
1022 C  CB    . ALA A 137 ? 1.09052 0.75617 0.90870 0.03864  0.11701  0.11782  135  ALA B CB    
1023 N  N     . THR A 138 ? 0.82965 0.57407 0.72027 0.03765  0.08179  0.10873  136  THR B N     
1024 C  CA    . THR A 138 ? 0.78630 0.55164 0.69895 0.02681  0.06953  0.10126  136  THR B CA    
1025 C  C     . THR A 138 ? 0.86715 0.61326 0.76728 0.00745  0.07314  0.09637  136  THR B C     
1026 O  O     . THR A 138 ? 0.84536 0.60940 0.75839 -0.00546 0.06476  0.09016  136  THR B O     
1027 C  CB    . THR A 138 ? 0.71955 0.49701 0.64628 0.03732  0.06471  0.10283  136  THR B CB    
1028 O  OG1   . THR A 138 ? 0.81578 0.61351 0.75167 0.05381  0.06230  0.10786  136  THR B OG1   
1029 C  CG2   . THR A 138 ? 0.66514 0.46546 0.61491 0.02802  0.05207  0.09514  136  THR B CG2   
1030 N  N     . LYS A 139 ? 1.10390 0.81417 0.97754 0.00505  0.08629  0.09950  137  LYS B N     
1031 C  CA    . LYS A 139 ? 1.12388 0.81573 0.98275 -0.01578 0.09073  0.09471  137  LYS B CA    
1032 C  C     . LYS A 139 ? 1.12466 0.81213 0.96993 -0.03100 0.09420  0.09162  137  LYS B C     
1033 O  O     . LYS A 139 ? 1.11337 0.79812 0.95160 -0.05127 0.09469  0.08653  137  LYS B O     
1034 C  CB    . LYS A 139 ? 1.18534 0.84978 1.02290 -0.01447 0.10128  0.09520  137  LYS B CB    
1035 C  CG    . LYS A 139 ? 1.27701 0.93995 1.11356 -0.03263 0.09919  0.08797  137  LYS B CG    
1036 C  CD    . LYS A 139 ? 1.27336 0.91904 1.09425 -0.02965 0.10682  0.08595  137  LYS B CD    
1037 C  CE    . LYS A 139 ? 1.23385 0.88066 1.05467 -0.04715 0.10433  0.07906  137  LYS B CE    
1038 N  NZ    . LYS A 139 ? 1.21684 0.88087 1.04866 -0.06565 0.09672  0.07531  137  LYS B NZ    
1039 N  N     . ARG A 140 ? 0.94165 0.63183 0.78402 -0.02245 0.09601  0.09447  138  ARG B N     
1040 C  CA    . ARG A 140 ? 0.91825 0.60964 0.75135 -0.03694 0.09732  0.09093  138  ARG B CA    
1041 C  C     . ARG A 140 ? 0.87152 0.60508 0.73475 -0.04214 0.08154  0.08589  138  ARG B C     
1042 O  O     . ARG A 140 ? 0.92493 0.66734 0.78622 -0.06023 0.07949  0.08123  138  ARG B O     
1043 C  CB    . ARG A 140 ? 0.93912 0.61533 0.75604 -0.02597 0.10603  0.09591  138  ARG B CB    
1044 C  CG    . ARG A 140 ? 0.90254 0.58106 0.71034 -0.04092 0.10696  0.09196  138  ARG B CG    
1045 C  CD    . ARG A 140 ? 1.03949 0.67643 0.80887 -0.04221 0.12480  0.09522  138  ARG B CD    
1046 N  NE    . ARG A 140 ? 1.11673 0.75181 0.88630 -0.01959 0.12793  0.10215  138  ARG B NE    
1047 C  CZ    . ARG A 140 ? 1.08477 0.73366 0.85975 -0.01656 0.12470  0.10208  138  ARG B CZ    
1048 N  NH1   . ARG A 140 ? 1.04596 0.71130 0.82663 -0.03423 0.11824  0.09553  138  ARG B NH1   
1049 N  NH2   . ARG A 140 ? 1.07131 0.71961 0.84613 0.00444  0.12798  0.10902  138  ARG B NH2   
1050 N  N     . ALA A 141 ? 0.78290 0.54320 0.67236 -0.02663 0.07116  0.08712  139  ALA B N     
1051 C  CA    . ALA A 141 ? 0.71736 0.51401 0.63290 -0.02996 0.05781  0.08286  139  ALA B CA    
1052 C  C     . ALA A 141 ? 0.68588 0.49521 0.61369 -0.03933 0.05136  0.07876  139  ALA B C     
1053 O  O     . ALA A 141 ? 0.67372 0.50521 0.61197 -0.04925 0.04488  0.07528  139  ALA B O     
1054 C  CB    . ALA A 141 ? 0.64837 0.46651 0.58442 -0.01240 0.05021  0.08495  139  ALA B CB    
1055 N  N     . GLN A 142 ? 0.89634 0.69294 0.82276 -0.03562 0.05339  0.07967  140  GLN B N     
1056 C  CA    . GLN A 142 ? 0.91045 0.71639 0.84620 -0.04517 0.04836  0.07590  140  GLN B CA    
1057 C  C     . GLN A 142 ? 0.96924 0.77032 0.88991 -0.06643 0.05268  0.07313  140  GLN B C     
1058 O  O     . GLN A 142 ? 0.95326 0.77768 0.88626 -0.07580 0.04586  0.07000  140  GLN B O     
1059 C  CB    . GLN A 142 ? 0.92888 0.71689 0.86130 -0.03894 0.05166  0.07755  140  GLN B CB    
1060 C  CG    . GLN A 142 ? 0.98313 0.79059 0.93907 -0.02418 0.04249  0.07751  140  GLN B CG    
1061 C  CD    . GLN A 142 ? 1.01621 0.80800 0.96921 -0.01862 0.04542  0.07912  140  GLN B CD    
1062 O  OE1   . GLN A 142 ? 1.11600 0.88016 1.04888 -0.02503 0.05484  0.08063  140  GLN B OE1   
1063 N  NE2   . GLN A 142 ? 0.92748 0.73613 0.89898 -0.00732 0.03795  0.07869  140  GLN B NE2   
1064 N  N     . ALA A 143 ? 0.95549 0.72720 0.84782 -0.07452 0.06476  0.07452  141  ALA B N     
1065 C  CA    . ALA A 143 ? 0.99697 0.76335 0.87103 -0.09773 0.07011  0.07143  141  ALA B CA    
1066 C  C     . ALA A 143 ? 1.04552 0.84268 0.92937 -0.10542 0.06348  0.06936  141  ALA B C     
1067 O  O     . ALA A 143 ? 1.07421 0.89251 0.96170 -0.12098 0.05981  0.06661  141  ALA B O     
1068 C  CB    . ALA A 143 ? 1.00121 0.72386 0.83826 -0.10464 0.08655  0.07317  141  ALA B CB    
1069 N  N     . TRP A 144 ? 1.05304 0.85532 0.94154 -0.09423 0.06190  0.07117  142  TRP B N     
1070 C  CA    . TRP A 144 ? 0.99762 0.82840 0.89520 -0.10014 0.05592  0.06969  142  TRP B CA    
1071 C  C     . TRP A 144 ? 0.98129 0.85088 0.90668 -0.09853 0.04363  0.06836  142  TRP B C     
1072 O  O     . TRP A 144 ? 1.07056 0.96491 0.99893 -0.11054 0.04043  0.06711  142  TRP B O     
1073 C  CB    . TRP A 144 ? 0.95835 0.78868 0.85949 -0.08570 0.05532  0.07207  142  TRP B CB    
1074 C  CG    . TRP A 144 ? 0.99087 0.84840 0.90009 -0.09159 0.04982  0.07076  142  TRP B CG    
1075 C  CD1   . TRP A 144 ? 1.08088 0.93423 0.97130 -0.10684 0.05553  0.06944  142  TRP B CD1   
1076 C  CD2   . TRP A 144 ? 0.97972 0.87219 0.91595 -0.08283 0.03839  0.07077  142  TRP B CD2   
1077 N  NE1   . TRP A 144 ? 1.06542 0.95148 0.97137 -0.10736 0.04759  0.06903  142  TRP B NE1   
1078 C  CE2   . TRP A 144 ? 1.00998 0.91929 0.94356 -0.09218 0.03746  0.07010  142  TRP B CE2   
1079 C  CE3   . TRP A 144 ? 0.91803 0.82754 0.87817 -0.06847 0.02984  0.07121  142  TRP B CE3   
1080 C  CZ2   . TRP A 144 ? 0.93411 0.87616 0.88850 -0.08598 0.02856  0.07065  142  TRP B CZ2   
1081 C  CZ3   . TRP A 144 ? 0.89906 0.83827 0.87775 -0.06329 0.02182  0.07123  142  TRP B CZ3   
1082 C  CH2   . TRP A 144 ? 0.90848 0.86351 0.88438 -0.07127 0.02135  0.07133  142  TRP B CH2   
1083 N  N     . CYS A 145 ? 0.80376 0.67970 0.74839 -0.08331 0.03734  0.06901  143  CYS B N     
1084 C  CA    . CYS A 145 ? 0.79392 0.70180 0.76187 -0.08023 0.02747  0.06798  143  CYS B CA    
1085 C  C     . CYS A 145 ? 0.84045 0.75463 0.80601 -0.09421 0.02772  0.06643  143  CYS B C     
1086 O  O     . CYS A 145 ? 0.86186 0.80628 0.84002 -0.09766 0.02192  0.06630  143  CYS B O     
1087 C  CB    . CYS A 145 ? 0.73100 0.64091 0.71663 -0.06166 0.02192  0.06841  143  CYS B CB    
1088 S  SG    . CYS A 145 ? 0.65880 0.56314 0.64675 -0.04576 0.02192  0.07059  143  CYS B SG    
1089 N  N     . TYR A 146 ? 0.98350 0.87001 0.93245 -0.10156 0.03490  0.06582  144  TYR B N     
1090 C  CA    . TYR A 146 ? 0.97606 0.86674 0.91871 -0.11831 0.03650  0.06418  144  TYR B CA    
1091 C  C     . TYR A 146 ? 1.03105 0.93800 0.96182 -0.13816 0.03895  0.06344  144  TYR B C     
1092 O  O     . TYR A 146 ? 1.08842 1.02102 1.02415 -0.14974 0.03585  0.06294  144  TYR B O     
1093 C  CB    . TYR A 146 ? 0.99173 0.84438 0.91474 -0.12280 0.04557  0.06383  144  TYR B CB    
1094 C  CG    . TYR A 146 ? 1.06378 0.91750 0.98129 -0.13875 0.04712  0.06194  144  TYR B CG    
1095 C  CD1   . TYR A 146 ? 1.07441 0.93952 1.01056 -0.13141 0.04042  0.06146  144  TYR B CD1   
1096 C  CD2   . TYR A 146 ? 1.10431 0.94667 0.99611 -0.16238 0.05596  0.06036  144  TYR B CD2   
1097 C  CE1   . TYR A 146 ? 1.10681 0.97350 1.03811 -0.14603 0.04184  0.05989  144  TYR B CE1   
1098 C  CE2   . TYR A 146 ? 1.10936 0.95374 0.99511 -0.17860 0.05770  0.05858  144  TYR B CE2   
1099 C  CZ    . TYR A 146 ? 1.13685 0.99402 1.04334 -0.16977 0.05033  0.05857  144  TYR B CZ    
1100 O  OH    . TYR A 146 ? 1.18037 1.04190 1.08223 -0.18412 0.05150  0.05644  144  TYR B OH    
1101 N  N     . SER A 147 ? 0.93941 0.83459 0.85468 -0.14217 0.04442  0.06363  145  SER B N     
1102 C  CA    . SER A 147 ? 0.94186 0.85406 0.84475 -0.16219 0.04682  0.06260  145  SER B CA    
1103 C  C     . SER A 147 ? 0.92938 0.88980 0.85610 -0.15867 0.03643  0.06420  145  SER B C     
1104 O  O     . SER A 147 ? 0.98165 0.96915 0.90560 -0.17525 0.03576  0.06415  145  SER B O     
1105 C  CB    . SER A 147 ? 0.94480 0.83336 0.82638 -0.16545 0.05483  0.06234  145  SER B CB    
1106 O  OG    . SER A 147 ? 0.91276 0.81353 0.81104 -0.14757 0.04875  0.06427  145  SER B OG    
1107 N  N     . LYS A 148 ? 0.88256 0.85494 0.83112 -0.13753 0.02911  0.06607  146  LYS B N     
1108 C  CA    . LYS A 148 ? 0.78698 0.80051 0.75412 -0.13231 0.02142  0.06841  146  LYS B CA    
1109 C  C     . LYS A 148 ? 0.76071 0.79684 0.74808 -0.12305 0.01488  0.06989  146  LYS B C     
1110 O  O     . LYS A 148 ? 0.70588 0.75180 0.71102 -0.10494 0.00945  0.07135  146  LYS B O     
1111 C  CB    . LYS A 148 ? 0.74106 0.75384 0.71673 -0.11646 0.01867  0.06957  146  LYS B CB    
1112 C  CG    . LYS A 148 ? 0.72691 0.70957 0.68264 -0.12104 0.02586  0.06827  146  LYS B CG    
1113 C  CD    . LYS A 148 ? 0.77533 0.77627 0.72490 -0.13051 0.02634  0.06877  146  LYS B CD    
1114 C  CE    . LYS A 148 ? 0.80220 0.77047 0.72741 -0.13787 0.03523  0.06711  146  LYS B CE    
1115 N  NZ    . LYS A 148 ? 0.85451 0.81288 0.75336 -0.16313 0.04364  0.06463  146  LYS B NZ    
1116 N  N     . ASN A 149 ? 1.09186 1.13702 1.07465 -0.13679 0.01615  0.06951  147  ASN B N     
1117 C  CA    . ASN A 149 ? 1.14399 1.21339 1.14395 -0.12973 0.01080  0.07139  147  ASN B CA    
1118 C  C     . ASN A 149 ? 1.10853 1.15639 1.12019 -0.11108 0.00820  0.07006  147  ASN B C     
1119 O  O     . ASN A 149 ? 1.08506 1.14901 1.11363 -0.09610 0.00323  0.07172  147  ASN B O     
1120 C  CB    . ASN A 149 ? 1.19217 1.30473 1.20624 -0.12295 0.00588  0.07596  147  ASN B CB    
1121 C  CG    . ASN A 149 ? 1.18143 1.31877 1.18425 -0.14087 0.00807  0.07756  147  ASN B CG    
1122 O  OD1   . ASN A 149 ? 1.13855 1.27549 1.13793 -0.13955 0.00859  0.07784  147  ASN B OD1   
1123 N  ND2   . ASN A 149 ? 1.20365 1.36456 1.20047 -0.15841 0.00934  0.07860  147  ASN B ND2   
1124 N  N     . ASN A 150 ? 1.04535 1.05597 1.04591 -0.11177 0.01252  0.06734  148  ASN B N     
1125 C  CA    . ASN A 150 ? 0.99251 0.98277 1.00023 -0.09957 0.01118  0.06584  148  ASN B CA    
1126 C  C     . ASN A 150 ? 0.92209 0.91785 0.94663 -0.07898 0.00583  0.06637  148  ASN B C     
1127 O  O     . ASN A 150 ? 0.96904 0.97542 1.00713 -0.06934 0.00164  0.06629  148  ASN B O     
1128 C  CB    . ASN A 150 ? 1.02536 1.02606 1.03795 -0.10522 0.00962  0.06545  148  ASN B CB    
1129 C  CG    . ASN A 150 ? 1.08171 1.05402 1.09336 -0.10049 0.01089  0.06320  148  ASN B CG    
1130 O  OD1   . ASN A 150 ? 1.15022 1.09206 1.14628 -0.10558 0.01694  0.06216  148  ASN B OD1   
1131 N  ND2   . ASN A 150 ? 1.03544 1.01704 1.06232 -0.09040 0.00601  0.06277  148  ASN B ND2   
1132 N  N     . ILE A 151 ? 0.70872 0.69618 0.73057 -0.07297 0.00670  0.06676  149  ILE B N     
1133 C  CA    . ILE A 151 ? 0.69481 0.68996 0.73073 -0.05610 0.00215  0.06711  149  ILE B CA    
1134 C  C     . ILE A 151 ? 0.67124 0.64267 0.70772 -0.04562 0.00257  0.06559  149  ILE B C     
1135 O  O     . ILE A 151 ? 0.75441 0.70337 0.77856 -0.04878 0.00730  0.06572  149  ILE B O     
1136 C  CB    . ILE A 151 ? 0.73466 0.74354 0.77068 -0.05475 0.00162  0.06895  149  ILE B CB    
1137 C  CG1   . ILE A 151 ? 0.67263 0.66201 0.69331 -0.06137 0.00661  0.06881  149  ILE B CG1   
1138 C  CG2   . ILE A 151 ? 0.80900 0.84913 0.84790 -0.06192 0.00024  0.07144  149  ILE B CG2   
1139 C  CD1   . ILE A 151 ? 0.63659 0.64115 0.65585 -0.06344 0.00631  0.07041  149  ILE B CD1   
1140 N  N     . PRO A 152 ? 0.54995 0.52614 0.59877 -0.03320 -0.00144 0.06448  150  PRO B N     
1141 C  CA    . PRO A 152 ? 0.48873 0.44751 0.53865 -0.02473 -0.00148 0.06300  150  PRO B CA    
1142 C  C     . PRO A 152 ? 0.53100 0.47927 0.57515 -0.01988 0.00072  0.06440  150  PRO B C     
1143 O  O     . PRO A 152 ? 0.64058 0.59765 0.68517 -0.01834 0.00025  0.06550  150  PRO B O     
1144 C  CB    . PRO A 152 ? 0.49441 0.46449 0.55661 -0.01502 -0.00571 0.06110  150  PRO B CB    
1145 C  CG    . PRO A 152 ? 0.57129 0.55875 0.63755 -0.01878 -0.00679 0.06187  150  PRO B CG    
1146 C  CD    . PRO A 152 ? 0.60807 0.60525 0.66818 -0.02772 -0.00502 0.06460  150  PRO B CD    
1147 N  N     . TYR A 153 ? 0.51273 0.44298 0.55137 -0.01645 0.00341  0.06490  151  TYR B N     
1148 C  CA    . TYR A 153 ? 0.60577 0.52619 0.63753 -0.01034 0.00663  0.06750  151  TYR B CA    
1149 C  C     . TYR A 153 ? 0.62899 0.54896 0.66695 0.00059  0.00471  0.06742  151  TYR B C     
1150 O  O     . TYR A 153 ? 0.66843 0.58110 0.70716 0.00139  0.00477  0.06659  151  TYR B O     
1151 C  CB    . TYR A 153 ? 0.60053 0.49824 0.61396 -0.01645 0.01458  0.07010  151  TYR B CB    
1152 C  CG    . TYR A 153 ? 0.58277 0.46886 0.58772 -0.00733 0.01922  0.07393  151  TYR B CG    
1153 C  CD1   . TYR A 153 ? 0.62338 0.51765 0.62872 -0.00411 0.01877  0.07519  151  TYR B CD1   
1154 C  CD2   . TYR A 153 ? 0.64359 0.51182 0.64005 -0.00075 0.02438  0.07698  151  TYR B CD2   
1155 C  CE1   . TYR A 153 ? 0.71135 0.59705 0.70896 0.00530  0.02329  0.07940  151  TYR B CE1   
1156 C  CE2   . TYR A 153 ? 0.69202 0.55230 0.68019 0.00977  0.02941  0.08192  151  TYR B CE2   
1157 C  CZ    . TYR A 153 ? 0.75388 0.62340 0.74277 0.01272  0.02880  0.08311  151  TYR B CZ    
1158 O  OH    . TYR A 153 ? 0.81034 0.67401 0.79100 0.02395  0.03405  0.08863  151  TYR B OH    
1159 N  N     . PHE A 154 ? 0.45862 0.38785 0.50052 0.00813  0.00309  0.06831  152  PHE B N     
1160 C  CA    . PHE A 154 ? 0.42260 0.35662 0.46952 0.01701  0.00130  0.06843  152  PHE B CA    
1161 C  C     . PHE A 154 ? 0.56775 0.50137 0.60875 0.02417  0.00453  0.07305  152  PHE B C     
1162 O  O     . PHE A 154 ? 0.52075 0.46043 0.56123 0.02402  0.00446  0.07383  152  PHE B O     
1163 C  CB    . PHE A 154 ? 0.30894 0.25948 0.36711 0.01836  -0.00424 0.06412  152  PHE B CB    
1164 C  CG    . PHE A 154 ? 0.33848 0.28947 0.40177 0.01407  -0.00661 0.06021  152  PHE B CG    
1165 C  CD1   . PHE A 154 ? 0.40743 0.36252 0.47191 0.00864  -0.00704 0.05955  152  PHE B CD1   
1166 C  CD2   . PHE A 154 ? 0.37576 0.32509 0.44239 0.01585  -0.00818 0.05761  152  PHE B CD2   
1167 C  CE1   . PHE A 154 ? 0.44261 0.40030 0.51151 0.00629  -0.00865 0.05697  152  PHE B CE1   
1168 C  CE2   . PHE A 154 ? 0.44009 0.38889 0.51066 0.01266  -0.00983 0.05419  152  PHE B CE2   
1169 C  CZ    . PHE A 154 ? 0.48765 0.44069 0.55936 0.00845  -0.00989 0.05415  152  PHE B CZ    
1170 N  N     . GLU A 155 ? 0.74366 0.67107 0.77995 0.03124  0.00770  0.07670  153  GLU B N     
1171 C  CA    . GLU A 155 ? 0.66986 0.60213 0.70188 0.04094  0.01067  0.08213  153  GLU B CA    
1172 C  C     . GLU A 155 ? 0.59473 0.55035 0.63794 0.04512  0.00508  0.08031  153  GLU B C     
1173 O  O     . GLU A 155 ? 0.57718 0.53745 0.62489 0.04606  0.00285  0.07858  153  GLU B O     
1174 C  CB    . GLU A 155 ? 0.67483 0.58999 0.69415 0.04794  0.01829  0.08838  153  GLU B CB    
1175 C  CG    . GLU A 155 ? 0.77035 0.65994 0.77356 0.04293  0.02594  0.09036  153  GLU B CG    
1176 C  CD    . GLU A 155 ? 0.94140 0.80957 0.92775 0.05115  0.03586  0.09733  153  GLU B CD    
1177 O  OE1   . GLU A 155 ? 0.99194 0.86530 0.98130 0.05985  0.03582  0.10022  153  GLU B OE1   
1178 O  OE2   . GLU A 155 ? 0.99472 0.83995 0.96305 0.04866  0.04450  0.10002  153  GLU B OE2   
1179 N  N     . THR A 156 ? 0.51691 0.48687 0.56340 0.04630  0.00313  0.08032  154  THR B N     
1180 C  CA    . THR A 156 ? 0.48761 0.47900 0.54273 0.04601  -0.00189 0.07694  154  THR B CA    
1181 C  C     . THR A 156 ? 0.45095 0.45891 0.50478 0.05307  -0.00075 0.08192  154  THR B C     
1182 O  O     . THR A 156 ? 0.41933 0.42188 0.46638 0.05872  0.00366  0.08768  154  THR B O     
1183 C  CB    . THR A 156 ? 0.55049 0.54517 0.61100 0.03836  -0.00563 0.07080  154  THR B CB    
1184 O  OG1   . THR A 156 ? 0.55869 0.55064 0.61644 0.03775  -0.00414 0.07274  154  THR B OG1   
1185 C  CG2   . THR A 156 ? 0.53959 0.52312 0.60217 0.03257  -0.00683 0.06651  154  THR B CG2   
1186 N  N     . SER A 157 ? 0.33670 0.36552 0.39587 0.05194  -0.00432 0.07946  155  SER B N     
1187 C  CA    . SER A 157 ? 0.37454 0.42531 0.43383 0.05610  -0.00430 0.08315  155  SER B CA    
1188 C  C     . SER A 157 ? 0.36072 0.42586 0.42439 0.04701  -0.00858 0.07606  155  SER B C     
1189 O  O     . SER A 157 ? 0.33371 0.40490 0.39894 0.04191  -0.01076 0.07129  155  SER B O     
1190 C  CB    . SER A 157 ? 0.38373 0.44975 0.44116 0.06504  -0.00227 0.08978  155  SER B CB    
1191 O  OG    . SER A 157 ? 0.34172 0.43323 0.39946 0.06892  -0.00223 0.09403  155  SER B OG    
1192 N  N     . ALA A 158 ? 0.40695 0.47519 0.47074 0.04442  -0.00900 0.07506  156  ALA B N     
1193 C  CA    . ALA A 158 ? 0.44925 0.53022 0.51372 0.03595  -0.01132 0.06906  156  ALA B CA    
1194 C  C     . ALA A 158 ? 0.50157 0.60976 0.56537 0.03570  -0.01197 0.07087  156  ALA B C     
1195 O  O     . ALA A 158 ? 0.47375 0.59141 0.53557 0.02657  -0.01328 0.06482  156  ALA B O     
1196 C  CB    . ALA A 158 ? 0.48576 0.56477 0.54972 0.03380  -0.01109 0.06837  156  ALA B CB    
1197 N  N     . LYS A 159 ? 0.62873 0.74977 0.69244 0.04561  -0.01021 0.07949  157  LYS B N     
1198 C  CA    . LYS A 159 ? 0.59399 0.74704 0.65745 0.04730  -0.01052 0.08343  157  LYS B CA    
1199 C  C     . LYS A 159 ? 0.63526 0.79672 0.69887 0.04315  -0.01206 0.08029  157  LYS B C     
1200 O  O     . LYS A 159 ? 0.61521 0.79795 0.67717 0.03345  -0.01386 0.07590  157  LYS B O     
1201 C  CB    . LYS A 159 ? 0.59937 0.76020 0.66140 0.06234  -0.00680 0.09491  157  LYS B CB    
1202 C  CG    . LYS A 159 ? 0.63101 0.82884 0.69305 0.06524  -0.00668 0.10070  157  LYS B CG    
1203 C  CD    . LYS A 159 ? 0.68975 0.89587 0.74872 0.08309  -0.00162 0.11342  157  LYS B CD    
1204 C  CE    . LYS A 159 ? 0.74097 0.99235 0.80080 0.08676  -0.00184 0.12008  157  LYS B CE    
1205 N  NZ    . LYS A 159 ? 0.74599 1.01086 0.80618 0.08932  -0.00204 0.12216  157  LYS B NZ    
1206 N  N     . GLU A 160 ? 0.90367 1.04812 0.96788 0.04926  -0.01095 0.08216  158  GLU B N     
1207 C  CA    . GLU A 160 ? 0.85452 1.00831 0.91908 0.04831  -0.01197 0.08128  158  GLU B CA    
1208 C  C     . GLU A 160 ? 0.85374 0.98578 0.91863 0.03895  -0.01390 0.07173  158  GLU B C     
1209 O  O     . GLU A 160 ? 0.92287 1.05718 0.98804 0.03830  -0.01467 0.07048  158  GLU B O     
1210 C  CB    . GLU A 160 ? 0.82380 0.97549 0.88731 0.06326  -0.00834 0.09140  158  GLU B CB    
1211 C  CG    . GLU A 160 ? 0.90360 1.07863 0.96508 0.07506  -0.00511 0.10226  158  GLU B CG    
1212 C  CD    . GLU A 160 ? 1.06062 1.27917 1.12352 0.07187  -0.00737 0.10388  158  GLU B CD    
1213 O  OE1   . GLU A 160 ? 1.08213 1.31078 1.14610 0.06138  -0.01070 0.09717  158  GLU B OE1   
1214 O  OE2   . GLU A 160 ? 1.13091 1.37460 1.19294 0.07923  -0.00550 0.11188  158  GLU B OE2   
1215 N  N     . ALA A 161 ? 0.60972 0.72211 0.67419 0.03248  -0.01433 0.06553  159  ALA B N     
1216 C  CA    . ALA A 161 ? 0.53017 0.62080 0.59421 0.02569  -0.01513 0.05761  159  ALA B CA    
1217 C  C     . ALA A 161 ? 0.55001 0.62419 0.61647 0.03171  -0.01468 0.06005  159  ALA B C     
1218 O  O     . ALA A 161 ? 0.66324 0.73412 0.72974 0.02839  -0.01572 0.05607  159  ALA B O     
1219 C  CB    . ALA A 161 ? 0.46272 0.56315 0.52202 0.01431  -0.01604 0.04962  159  ALA B CB    
1220 N  N     . ILE A 162 ? 0.34485 0.40713 0.41174 0.03977  -0.01248 0.06641  160  ILE B N     
1221 C  CA    . ILE A 162 ? 0.43322 0.47712 0.49966 0.04459  -0.01067 0.06923  160  ILE B CA    
1222 C  C     . ILE A 162 ? 0.42294 0.44409 0.48987 0.04004  -0.01063 0.06547  160  ILE B C     
1223 O  O     . ILE A 162 ? 0.31755 0.33247 0.38296 0.04093  -0.00912 0.06770  160  ILE B O     
1224 C  CB    . ILE A 162 ? 0.48656 0.53049 0.54876 0.05611  -0.00622 0.07927  160  ILE B CB    
1225 C  CG1   . ILE A 162 ? 0.46674 0.54018 0.52907 0.06165  -0.00628 0.08416  160  ILE B CG1   
1226 C  CG2   . ILE A 162 ? 0.49775 0.51934 0.55642 0.05963  -0.00308 0.08168  160  ILE B CG2   
1227 C  CD1   . ILE A 162 ? 0.43417 0.50905 0.49100 0.07580  -0.00075 0.09519  160  ILE B CD1   
1228 N  N     . ASN A 163 ? 0.53331 0.54404 0.60208 0.03516  -0.01215 0.06006  161  ASN B N     
1229 C  CA    . ASN A 163 ? 0.55869 0.55198 0.62831 0.03117  -0.01208 0.05719  161  ASN B CA    
1230 C  C     . ASN A 163 ? 0.58461 0.58023 0.65485 0.02726  -0.01283 0.05389  161  ASN B C     
1231 O  O     . ASN A 163 ? 0.57908 0.56526 0.64979 0.02540  -0.01230 0.05365  161  ASN B O     
1232 C  CB    . ASN A 163 ? 0.52156 0.50001 0.58767 0.03386  -0.00885 0.06254  161  ASN B CB    
1233 C  CG    . ASN A 163 ? 0.54973 0.51707 0.61364 0.03582  -0.00712 0.06442  161  ASN B CG    
1234 O  OD1   . ASN A 163 ? 0.60439 0.57353 0.67156 0.03419  -0.00935 0.06072  161  ASN B OD1   
1235 N  ND2   . ASN A 163 ? 0.54700 0.50038 0.60354 0.03884  -0.00231 0.07001  161  ASN B ND2   
1236 N  N     . VAL A 164 ? 0.50679 0.51588 0.57603 0.02567  -0.01355 0.05176  162  VAL B N     
1237 C  CA    . VAL A 164 ? 0.46322 0.47207 0.53116 0.02239  -0.01317 0.04877  162  VAL B CA    
1238 C  C     . VAL A 164 ? 0.49446 0.49381 0.56078 0.01858  -0.01268 0.04284  162  VAL B C     
1239 O  O     . VAL A 164 ? 0.55550 0.54728 0.62209 0.01883  -0.01165 0.04266  162  VAL B O     
1240 C  CB    . VAL A 164 ? 0.41919 0.44354 0.48433 0.02063  -0.01311 0.04821  162  VAL B CB    
1241 C  CG1   . VAL A 164 ? 0.43411 0.45462 0.49543 0.01668  -0.01160 0.04424  162  VAL B CG1   
1242 C  CG2   . VAL A 164 ? 0.42539 0.45815 0.49189 0.02603  -0.01286 0.05499  162  VAL B CG2   
1243 N  N     . GLU A 165 ? 0.52488 0.52535 0.58853 0.01540  -0.01287 0.03831  163  GLU B N     
1244 C  CA    . GLU A 165 ? 0.52222 0.51090 0.58215 0.01271  -0.01119 0.03283  163  GLU B CA    
1245 C  C     . GLU A 165 ? 0.54916 0.52729 0.61421 0.01554  -0.01182 0.03468  163  GLU B C     
1246 O  O     . GLU A 165 ? 0.49962 0.46975 0.56295 0.01599  -0.00992 0.03296  163  GLU B O     
1247 C  CB    . GLU A 165 ? 0.47197 0.46273 0.52644 0.00757  -0.01090 0.02720  163  GLU B CB    
1248 C  CG    . GLU A 165 ? 0.64111 0.61787 0.68651 0.00420  -0.00700 0.02078  163  GLU B CG    
1249 C  CD    . GLU A 165 ? 0.76530 0.74004 0.80020 0.00102  -0.00258 0.01823  163  GLU B CD    
1250 O  OE1   . GLU A 165 ? 0.76980 0.72978 0.79716 0.00247  0.00220  0.01605  163  GLU B OE1   
1251 O  OE2   . GLU A 165 ? 0.80616 0.79413 0.83939 -0.00246 -0.00324 0.01887  163  GLU B OE2   
1252 N  N     . GLN A 166 ? 0.65406 0.63228 0.72396 0.01762  -0.01363 0.03875  164  GLN B N     
1253 C  CA    . GLN A 166 ? 0.62390 0.59243 0.69710 0.01813  -0.01378 0.04051  164  GLN B CA    
1254 C  C     . GLN A 166 ? 0.52998 0.49842 0.60394 0.01836  -0.01278 0.04323  164  GLN B C     
1255 O  O     . GLN A 166 ? 0.56640 0.53159 0.64126 0.01780  -0.01212 0.04251  164  GLN B O     
1256 C  CB    . GLN A 166 ? 0.67187 0.63758 0.74635 0.01983  -0.01414 0.04478  164  GLN B CB    
1257 C  CG    . GLN A 166 ? 0.66103 0.62540 0.73587 0.02006  -0.01511 0.04285  164  GLN B CG    
1258 C  CD    . GLN A 166 ? 0.71626 0.69435 0.78954 0.02145  -0.01575 0.04282  164  GLN B CD    
1259 O  OE1   . GLN A 166 ? 0.74892 0.73671 0.82009 0.01959  -0.01578 0.04069  164  GLN B OE1   
1260 N  NE2   . GLN A 166 ? 0.77263 0.75290 0.84609 0.02460  -0.01580 0.04570  164  GLN B NE2   
1261 N  N     . ALA A 167 ? 0.44919 0.42327 0.52251 0.01944  -0.01249 0.04670  165  ALA B N     
1262 C  CA    . ALA A 167 ? 0.39273 0.36849 0.46634 0.01893  -0.01167 0.04972  165  ALA B CA    
1263 C  C     . ALA A 167 ? 0.36600 0.34502 0.43883 0.01986  -0.01048 0.04777  165  ALA B C     
1264 O  O     . ALA A 167 ? 0.37115 0.35165 0.44523 0.01970  -0.00979 0.04934  165  ALA B O     
1265 C  CB    . ALA A 167 ? 0.25198 0.23219 0.32397 0.02021  -0.01127 0.05332  165  ALA B CB    
1266 N  N     . PHE A 168 ? 0.41546 0.39610 0.48463 0.02081  -0.00940 0.04476  166  PHE B N     
1267 C  CA    . PHE A 168 ? 0.42136 0.40128 0.48631 0.02286  -0.00629 0.04359  166  PHE B CA    
1268 C  C     . PHE A 168 ? 0.40325 0.37571 0.46567 0.02440  -0.00406 0.04097  166  PHE B C     
1269 O  O     . PHE A 168 ? 0.44901 0.41990 0.50675 0.02826  -0.00015 0.04154  166  PHE B O     
1270 C  CB    . PHE A 168 ? 0.36597 0.34665 0.42437 0.02189  -0.00434 0.04085  166  PHE B CB    
1271 C  CG    . PHE A 168 ? 0.41909 0.40772 0.47893 0.02233  -0.00506 0.04429  166  PHE B CG    
1272 C  CD1   . PHE A 168 ? 0.41226 0.40748 0.47530 0.02109  -0.00779 0.04614  166  PHE B CD1   
1273 C  CD2   . PHE A 168 ? 0.46970 0.45950 0.52709 0.02500  -0.00247 0.04630  166  PHE B CD2   
1274 C  CE1   . PHE A 168 ? 0.37140 0.37317 0.43517 0.02185  -0.00812 0.04931  166  PHE B CE1   
1275 C  CE2   . PHE A 168 ? 0.42929 0.42617 0.48805 0.02510  -0.00328 0.04922  166  PHE B CE2   
1276 C  CZ    . PHE A 168 ? 0.35967 0.36203 0.42165 0.02318  -0.00624 0.05043  166  PHE B CZ    
1277 N  N     . GLN A 169 ? 0.40001 0.36747 0.46444 0.02246  -0.00576 0.03858  167  GLN B N     
1278 C  CA    . GLN A 169 ? 0.34731 0.30793 0.41022 0.02424  -0.00384 0.03671  167  GLN B CA    
1279 C  C     . GLN A 169 ? 0.36941 0.33593 0.43879 0.02511  -0.00508 0.04137  167  GLN B C     
1280 O  O     . GLN A 169 ? 0.37186 0.33960 0.43991 0.02900  -0.00239 0.04268  167  GLN B O     
1281 C  CB    . GLN A 169 ? 0.40871 0.36226 0.47116 0.02116  -0.00530 0.03209  167  GLN B CB    
1282 C  CG    . GLN A 169 ? 0.50459 0.45381 0.55791 0.01845  -0.00303 0.02655  167  GLN B CG    
1283 C  CD    . GLN A 169 ? 0.50315 0.44779 0.55544 0.01476  -0.00443 0.02187  167  GLN B CD    
1284 O  OE1   . GLN A 169 ? 0.47728 0.42418 0.52397 0.01020  -0.00418 0.01803  167  GLN B OE1   
1285 N  NE2   . GLN A 169 ? 0.49750 0.43728 0.55473 0.01599  -0.00581 0.02219  167  GLN B NE2   
1286 N  N     . THR A 170 ? 0.40549 0.37602 0.48010 0.02129  -0.00828 0.04423  168  THR B N     
1287 C  CA    . THR A 170 ? 0.45443 0.43226 0.53259 0.01907  -0.00885 0.04853  168  THR B CA    
1288 C  C     . THR A 170 ? 0.53127 0.52096 0.60864 0.02192  -0.00703 0.05231  168  THR B C     
1289 O  O     . THR A 170 ? 0.53075 0.53037 0.60959 0.02289  -0.00599 0.05545  168  THR B O     
1290 C  CB    . THR A 170 ? 0.46447 0.43949 0.54357 0.01348  -0.01069 0.05036  168  THR B CB    
1291 O  OG1   . THR A 170 ? 0.53221 0.49691 0.61171 0.01220  -0.01169 0.04783  168  THR B OG1   
1292 C  CG2   . THR A 170 ? 0.45020 0.43229 0.52969 0.00797  -0.01042 0.05415  168  THR B CG2   
1293 N  N     . ILE A 171 ? 0.44837 0.43924 0.52343 0.02350  -0.00652 0.05254  169  ILE B N     
1294 C  CA    . ILE A 171 ? 0.35990 0.36140 0.43370 0.02693  -0.00451 0.05621  169  ILE B CA    
1295 C  C     . ILE A 171 ? 0.37031 0.37199 0.43998 0.03452  -0.00008 0.05659  169  ILE B C     
1296 O  O     . ILE A 171 ? 0.44711 0.46157 0.51748 0.03827  0.00179  0.06143  169  ILE B O     
1297 C  CB    . ILE A 171 ? 0.29646 0.29679 0.36792 0.02716  -0.00457 0.05570  169  ILE B CB    
1298 C  CG1   . ILE A 171 ? 0.28980 0.29160 0.36370 0.02166  -0.00743 0.05736  169  ILE B CG1   
1299 C  CG2   . ILE A 171 ? 0.25414 0.26215 0.32270 0.03217  -0.00153 0.05872  169  ILE B CG2   
1300 C  CD1   . ILE A 171 ? 0.28993 0.28780 0.36211 0.02191  -0.00805 0.05581  169  ILE B CD1   
1301 N  N     . ALA A 172 ? 0.36909 0.35692 0.43279 0.03693  0.00247  0.05184  170  ALA B N     
1302 C  CA    . ALA A 172 ? 0.36065 0.34282 0.41647 0.04465  0.00863  0.05186  170  ALA B CA    
1303 C  C     . ALA A 172 ? 0.42015 0.40981 0.48021 0.04717  0.00864  0.05488  170  ALA B C     
1304 O  O     . ALA A 172 ? 0.43640 0.43578 0.49428 0.05490  0.01275  0.06017  170  ALA B O     
1305 C  CB    . ALA A 172 ? 0.34289 0.30632 0.38933 0.04350  0.01154  0.04491  170  ALA B CB    
1306 N  N     . ARG A 173 ? 0.49364 0.48013 0.55937 0.04113  0.00445  0.05215  171  ARG B N     
1307 C  CA    . ARG A 173 ? 0.45694 0.45101 0.52695 0.04175  0.00405  0.05462  171  ARG B CA    
1308 C  C     . ARG A 173 ? 0.47455 0.49174 0.54957 0.04141  0.00326  0.06179  171  ARG B C     
1309 O  O     . ARG A 173 ? 0.43196 0.46185 0.50653 0.04786  0.00641  0.06652  171  ARG B O     
1310 C  CB    . ARG A 173 ? 0.42839 0.41522 0.50366 0.03349  -0.00071 0.05084  171  ARG B CB    
1311 C  CG    . ARG A 173 ? 0.44576 0.43226 0.52300 0.03412  -0.00041 0.05058  171  ARG B CG    
1312 C  CD    . ARG A 173 ? 0.49309 0.46268 0.57049 0.02987  -0.00268 0.04431  171  ARG B CD    
1313 N  NE    . ARG A 173 ? 0.54693 0.50470 0.61746 0.03597  0.00153  0.04063  171  ARG B NE    
1314 C  CZ    . ARG A 173 ? 0.55401 0.49631 0.62079 0.03371  0.00127  0.03425  171  ARG B CZ    
1315 N  NH1   . ARG A 173 ? 0.61159 0.55110 0.68230 0.02701  -0.00327 0.03188  171  ARG B NH1   
1316 N  NH2   . ARG A 173 ? 0.62863 0.55863 0.68635 0.03843  0.00627  0.03066  171  ARG B NH2   
1317 N  N     . ASN A 174 ? 0.54690 0.57089 0.62552 0.03392  -0.00038 0.06298  172  ASN B N     
1318 C  CA    . ASN A 174 ? 0.54323 0.58978 0.62524 0.03006  -0.00140 0.06890  172  ASN B CA    
1319 C  C     . ASN A 174 ? 0.62387 0.68524 0.70328 0.03931  0.00245  0.07439  172  ASN B C     
1320 O  O     . ASN A 174 ? 0.67301 0.75748 0.75426 0.04137  0.00367  0.08058  172  ASN B O     
1321 C  CB    . ASN A 174 ? 0.53107 0.57585 0.61408 0.01932  -0.00490 0.06796  172  ASN B CB    
1322 C  CG    . ASN A 174 ? 0.61116 0.64450 0.69502 0.01018  -0.00730 0.06480  172  ASN B CG    
1323 O  OD1   . ASN A 174 ? 0.67918 0.70312 0.76414 0.01192  -0.00740 0.06199  172  ASN B OD1   
1324 N  ND2   . ASN A 174 ? 0.65304 0.68492 0.73464 0.00050  -0.00842 0.06527  172  ASN B ND2   
1325 N  N     . ALA A 175 ? 0.44281 0.49291 0.51739 0.04460  0.00466  0.07271  173  ALA B N     
1326 C  CA    . ALA A 175 ? 0.39369 0.45281 0.46337 0.05525  0.00989  0.07787  173  ALA B CA    
1327 C  C     . ALA A 175 ? 0.43106 0.49304 0.49605 0.06693  0.01597  0.08147  173  ALA B C     
1328 O  O     . ALA A 175 ? 0.43988 0.52435 0.50524 0.07393  0.01882  0.08929  173  ALA B O     
1329 C  CB    . ALA A 175 ? 0.35157 0.39258 0.41438 0.05798  0.01227  0.07417  173  ALA B CB    
1330 N  N     . LEU A 176 ? 0.49416 0.53453 0.55389 0.06945  0.01845  0.07621  174  LEU B N     
1331 C  CA    . LEU A 176 ? 0.46544 0.50414 0.51852 0.08105  0.02527  0.07916  174  LEU B CA    
1332 C  C     . LEU A 176 ? 0.50676 0.57434 0.56782 0.08215  0.02369  0.08632  174  LEU B C     
1333 O  O     . LEU A 176 ? 0.51919 0.60206 0.57614 0.09478  0.02986  0.09425  174  LEU B O     
1334 C  CB    . LEU A 176 ? 0.41699 0.42996 0.46526 0.07894  0.02608  0.07124  174  LEU B CB    
1335 C  CG    . LEU A 176 ? 0.43618 0.44075 0.47309 0.09228  0.03530  0.07363  174  LEU B CG    
1336 C  CD1   . LEU A 176 ? 0.51384 0.50969 0.53588 0.10407  0.04505  0.07714  174  LEU B CD1   
1337 C  CD2   . LEU A 176 ? 0.47648 0.45537 0.50741 0.08898  0.03629  0.06524  174  LEU B CD2   
1338 N  N     . LYS A 177 ? 0.58262 0.65839 0.65370 0.06902  0.01625  0.08406  175  LYS B N     
1339 C  CA    . LYS A 177 ? 0.51405 0.62046 0.59192 0.06634  0.01443  0.09060  175  LYS B CA    
1340 C  C     . LYS A 177 ? 0.59768 0.73314 0.67637 0.06959  0.01568  0.09892  175  LYS B C     
1341 O  O     . LYS A 177 ? 0.61047 0.76960 0.68799 0.08033  0.02021  0.10738  175  LYS B O     
1342 C  CB    . LYS A 177 ? 0.50843 0.61475 0.59358 0.04915  0.00723  0.08616  175  LYS B CB    
1343 C  CG    . LYS A 177 ? 0.68183 0.75784 0.76600 0.04649  0.00584  0.07776  175  LYS B CG    
1344 C  CD    . LYS A 177 ? 0.74684 0.82414 0.83638 0.03507  0.00167  0.07555  175  LYS B CD    
1345 C  CE    . LYS A 177 ? 0.71826 0.76833 0.80781 0.02704  -0.00182 0.06761  175  LYS B CE    
1346 N  NZ    . LYS A 177 ? 0.71632 0.76680 0.80642 0.01596  -0.00502 0.06719  175  LYS B NZ    
1347 N  N     . GLN A 178 ? 0.52840 0.66224 0.60804 0.06229  0.01253  0.09715  176  GLN B N     
1348 C  CA    . GLN A 178 ? 0.42907 0.59184 0.50987 0.06327  0.01296  0.10459  176  GLN B CA    
1349 C  C     . GLN A 178 ? 0.43999 0.61054 0.51409 0.08266  0.02106  0.11219  176  GLN B C     
1350 O  O     . GLN A 178 ? 0.49161 0.69580 0.56711 0.08854  0.02326  0.12161  176  GLN B O     
1351 C  CB    . GLN A 178 ? 0.40635 0.56067 0.48772 0.05340  0.00901  0.10065  176  GLN B CB    
1352 C  CG    . GLN A 178 ? 0.40295 0.58090 0.48352 0.05773  0.01073  0.10764  176  GLN B CG    
1353 C  CD    . GLN A 178 ? 0.43459 0.64853 0.51960 0.04696  0.00767  0.11280  176  GLN B CD    
1354 O  OE1   . GLN A 178 ? 0.38309 0.60020 0.47072 0.03416  0.00424  0.11013  176  GLN B OE1   
1355 N  NE2   . GLN A 178 ? 0.46284 0.70459 0.54752 0.05111  0.00930  0.12021  176  GLN B NE2   
1356 N  N     . GLU A 179 ? 0.58468 0.72472 0.64969 0.09272  0.02651  0.10860  177  GLU B N     
1357 C  CA    . GLU A 179 ? 0.62672 0.76590 0.68076 0.11168  0.03650  0.11541  177  GLU B CA    
1358 C  C     . GLU A 179 ? 0.79674 0.95386 0.84818 0.12521  0.04261  0.12374  177  GLU B C     
1359 O  O     . GLU A 179 ? 0.94047 1.11921 0.98744 0.13965  0.04919  0.13428  177  GLU B O     
1360 C  CB    . GLU A 179 ? 0.61285 0.71106 0.65420 0.11639  0.04211  0.10828  177  GLU B CB    
1361 C  CG    . GLU A 179 ? 0.72291 0.81201 0.74824 0.13466  0.05426  0.11440  177  GLU B CG    
1362 C  CD    . GLU A 179 ? 0.89401 0.96626 0.90556 0.14895  0.06473  0.11619  177  GLU B CD    
1363 O  OE1   . GLU A 179 ? 0.95683 1.02331 0.95294 0.16633  0.07673  0.12333  177  GLU B OE1   
1364 O  OE2   . GLU A 179 ? 0.96108 1.02463 0.97586 0.14339  0.06176  0.11080  177  GLU B OE2   
1365 N  N     . THR A 180 ? 0.97249 1.12154 1.02609 0.12205  0.04115  0.11984  178  THR B N     
1366 C  CA    . THR A 180 ? 1.05969 1.22448 1.10984 0.13633  0.04776  0.12796  178  THR B CA    
1367 C  C     . THR A 180 ? 1.14468 1.36005 1.20526 0.13462  0.04446  0.13810  178  THR B C     
1368 O  O     . THR A 180 ? 1.15799 1.39291 1.21647 0.14746  0.05001  0.14647  178  THR B O     
1369 C  CB    . THR A 180 ? 1.09723 1.23919 1.14656 0.13327  0.04718  0.12077  178  THR B CB    
1370 O  OG1   . THR A 180 ? 1.08621 1.23823 1.14935 0.11394  0.03635  0.11558  178  THR B OG1   
1371 C  CG2   . THR A 180 ? 1.12147 1.21627 1.15875 0.13373  0.05099  0.11065  178  THR B CG2   
1372 N  N     . GLU A 181 ? 1.48463 1.72316 1.55459 0.11964  0.03662  0.13821  179  GLU B N     
1373 C  CA    . GLU A 181 ? 1.50874 1.79672 1.58725 0.11343  0.03312  0.14653  179  GLU B CA    
1374 C  C     . GLU A 181 ? 1.48819 1.81133 1.56539 0.12297  0.03667  0.15780  179  GLU B C     
1375 O  O     . GLU A 181 ? 1.52212 1.88555 1.60028 0.13293  0.04038  0.16944  179  GLU B O     
1376 C  CB    . GLU A 181 ? 1.53488 1.82712 1.62213 0.08715  0.02280  0.13900  179  GLU B CB    
1377 C  CG    . GLU A 181 ? 1.57127 1.82149 1.65904 0.07632  0.01866  0.12646  179  GLU B CG    
1378 C  CD    . GLU A 181 ? 1.63262 1.87105 1.71890 0.08446  0.02177  0.12560  179  GLU B CD    
1379 O  OE1   . GLU A 181 ? 1.68222 1.94706 1.76764 0.09728  0.02684  0.13493  179  GLU B OE1   
1380 O  OE2   . GLU A 181 ? 1.66193 1.86368 1.74700 0.07961  0.01983  0.11584  179  GLU B OE2   
1381 N  N     . VAL A 182 ? 1.51639 1.82692 1.59118 0.12120  0.03598  0.15531  180  VAL B N     
1382 C  CA    . VAL A 182 ? 1.50856 1.85364 1.58227 0.13014  0.03921  0.16625  180  VAL B CA    
1383 C  C     . VAL A 182 ? 1.52842 1.86741 1.59023 0.15817  0.05174  0.17548  180  VAL B C     
1384 O  O     . VAL A 182 ? 1.57115 1.93367 1.62935 0.17069  0.05681  0.18572  180  VAL B O     
1385 C  CB    . VAL A 182 ? 1.44418 1.77985 1.51993 0.11646  0.03352  0.16021  180  VAL B CB    
1386 C  CG1   . VAL A 182 ? 1.39935 1.76047 1.48393 0.09142  0.02401  0.15702  180  VAL B CG1   
1387 C  CG2   . VAL A 182 ? 1.41247 1.69468 1.48403 0.11291  0.03265  0.14795  180  VAL B CG2   
1388 N  N     . GLU A 183 ? 1.29038 1.59863 1.34441 0.16867  0.05777  0.17265  181  GLU B N     
1389 C  CA    . GLU A 183 ? 1.29369 1.60415 1.33541 0.19496  0.07081  0.18336  181  GLU B CA    
1390 C  C     . GLU A 183 ? 1.33594 1.69143 1.38429 0.19964  0.07094  0.19334  181  GLU B C     
1391 O  O     . GLU A 183 ? 1.39383 1.75472 1.42698 0.21715  0.08236  0.20211  181  GLU B O     
1392 C  CB    . GLU A 183 ? 1.28306 1.53879 1.31079 0.20266  0.07813  0.17523  181  GLU B CB    
1393 C  CG    . GLU A 183 ? 1.32182 1.53155 1.34580 0.19005  0.07477  0.16134  181  GLU B CG    
1394 C  CD    . GLU A 183 ? 1.35348 1.56091 1.37264 0.19301  0.07704  0.16363  181  GLU B CD    
1395 O  OE1   . GLU A 183 ? 1.41559 1.63445 1.42408 0.21313  0.08767  0.17529  181  GLU B OE1   
1396 O  OE2   . GLU A 183 ? 1.28063 1.47426 1.30598 0.17600  0.06872  0.15415  181  GLU B OE2   
1397 N  N     . LEU A 184 ? 1.20679 1.58363 1.26928 0.17787  0.05979  0.18852  182  LEU B N     
1398 C  CA    . LEU A 184 ? 1.12692 1.55150 1.19656 0.17821  0.05878  0.19756  182  LEU B CA    
1399 C  C     . LEU A 184 ? 1.17076 1.64597 1.24263 0.16905  0.05566  0.20541  182  LEU B C     
1400 O  O     . LEU A 184 ? 1.20685 1.72011 1.28067 0.15956  0.05280  0.20994  182  LEU B O     
1401 C  CB    . LEU A 184 ? 1.03215 1.44854 1.11098 0.15598  0.04949  0.18697  182  LEU B CB    
1402 C  CG    . LEU A 184 ? 0.97523 1.33437 1.05051 0.15165  0.04855  0.17323  182  LEU B CG    
1403 C  CD1   . LEU A 184 ? 0.89337 1.25943 0.97750 0.13500  0.04154  0.16804  182  LEU B CD1   
1404 C  CD2   . LEU A 184 ? 0.98316 1.30935 1.04373 0.17670  0.06078  0.17548  182  LEU B CD2   
1405 O  OXT   . LEU A 184 ? 1.17951 1.65871 1.24997 0.16955  0.05569  0.20716  182  LEU B OXT   
1406 N  N     . ASN B 2   ? 1.22127 1.11565 1.29039 -0.05826 -0.03107 0.05904  697  ASN A N     
1407 C  CA    . ASN B 2   ? 1.24516 1.14048 1.31887 -0.05410 -0.03350 0.06815  697  ASN A CA    
1408 C  C     . ASN B 2   ? 1.23085 1.13640 1.31422 -0.05651 -0.04058 0.06845  697  ASN A C     
1409 O  O     . ASN B 2   ? 1.23871 1.14435 1.32005 -0.05521 -0.03749 0.07320  697  ASN A O     
1410 C  CB    . ASN B 2   ? 1.28365 1.16472 1.34516 -0.05130 -0.02261 0.07551  697  ASN A CB    
1411 C  CG    . ASN B 2   ? 1.33609 1.20784 1.38665 -0.05844 -0.01441 0.07067  697  ASN A CG    
1412 O  OD1   . ASN B 2   ? 1.35587 1.23607 1.41208 -0.06425 -0.01797 0.06721  697  ASN A OD1   
1413 N  ND2   . ASN B 2   ? 1.34711 1.20084 1.38047 -0.05846 -0.00271 0.07095  697  ASN A ND2   
1414 N  N     . ALA B 3   ? 1.19752 1.11234 1.28782 -0.05827 -0.04826 0.06201  698  ALA A N     
1415 C  CA    . ALA B 3   ? 1.13817 1.06276 1.23372 -0.05881 -0.05336 0.06030  698  ALA A CA    
1416 C  C     . ALA B 3   ? 1.16304 1.09883 1.25610 -0.05190 -0.05381 0.06270  698  ALA A C     
1417 O  O     . ALA B 3   ? 1.19342 1.13276 1.28505 -0.04842 -0.05446 0.06485  698  ALA A O     
1418 C  CB    . ALA B 3   ? 1.04443 0.97234 1.14373 -0.06092 -0.05943 0.05311  698  ALA A CB    
1419 N  N     . GLN B 4   ? 1.04252 0.98606 1.13495 -0.05007 -0.05337 0.06273  699  GLN A N     
1420 C  CA    . GLN B 4   ? 1.00935 0.96594 1.09964 -0.04504 -0.05471 0.06388  699  GLN A CA    
1421 C  C     . GLN B 4   ? 0.97546 0.93854 1.06581 -0.04744 -0.06084 0.05728  699  GLN A C     
1422 O  O     . GLN B 4   ? 1.04423 1.00090 1.13601 -0.05128 -0.06348 0.05190  699  GLN A O     
1423 C  CB    . GLN B 4   ? 0.99918 0.96057 1.08807 -0.04281 -0.05201 0.06577  699  GLN A CB    
1424 C  CG    . GLN B 4   ? 1.01590 0.99132 1.10202 -0.03762 -0.05214 0.06835  699  GLN A CG    
1425 C  CD    . GLN B 4   ? 1.02519 1.00192 1.10755 -0.03092 -0.04627 0.07672  699  GLN A CD    
1426 O  OE1   . GLN B 4   ? 1.08084 1.04386 1.16035 -0.03030 -0.04045 0.08061  699  GLN A OE1   
1427 N  NE2   . GLN B 4   ? 0.95294 0.94611 1.03344 -0.02594 -0.04685 0.07986  699  GLN A NE2   
1428 N  N     . ILE B 5   ? 0.65134 0.62731 0.73834 -0.04550 -0.06229 0.05792  700  ILE A N     
1429 C  CA    . ILE B 5   ? 0.61475 0.59622 0.69743 -0.04976 -0.06661 0.05138  700  ILE A CA    
1430 C  C     . ILE B 5   ? 0.56001 0.54902 0.63844 -0.04921 -0.06595 0.05036  700  ILE A C     
1431 O  O     . ILE B 5   ? 0.59727 0.59899 0.67488 -0.04580 -0.06435 0.05520  700  ILE A O     
1432 C  CB    . ILE B 5   ? 0.66465 0.65756 0.74502 -0.05077 -0.06872 0.05233  700  ILE A CB    
1433 C  CG1   . ILE B 5   ? 0.73096 0.71363 0.81490 -0.05198 -0.06970 0.05203  700  ILE A CG1   
1434 C  CG2   . ILE B 5   ? 0.55489 0.55743 0.62684 -0.05717 -0.07183 0.04601  700  ILE A CG2   
1435 C  CD1   . ILE B 5   ? 0.75342 0.71847 0.83977 -0.05571 -0.07076 0.04646  700  ILE A CD1   
1436 N  N     . ILE B 6   ? 0.47164 0.45251 0.54668 -0.05160 -0.06642 0.04477  701  ILE A N     
1437 C  CA    . ILE B 6   ? 0.52465 0.50966 0.59523 -0.05044 -0.06483 0.04430  701  ILE A CA    
1438 C  C     . ILE B 6   ? 0.49930 0.47869 0.55833 -0.05518 -0.06523 0.03702  701  ILE A C     
1439 O  O     . ILE B 6   ? 0.57287 0.55864 0.62405 -0.05720 -0.06424 0.03583  701  ILE A O     
1440 C  CB    . ILE B 6   ? 0.58379 0.56388 0.65969 -0.04644 -0.06229 0.04703  701  ILE A CB    
1441 C  CG1   . ILE B 6   ? 0.62462 0.60730 0.70714 -0.04341 -0.05999 0.05384  701  ILE A CG1   
1442 C  CG2   . ILE B 6   ? 0.52843 0.51214 0.59943 -0.04476 -0.06059 0.04646  701  ILE A CG2   
1443 C  CD1   . ILE B 6   ? 0.63492 0.61843 0.71941 -0.04075 -0.05678 0.05708  701  ILE A CD1   
1444 N  N     . PHE B 7   ? 0.28979 0.25579 0.34571 -0.05724 -0.06573 0.03216  702  PHE A N     
1445 C  CA    . PHE B 7   ? 0.39740 0.35369 0.43801 -0.06214 -0.06440 0.02500  702  PHE A CA    
1446 C  C     . PHE B 7   ? 0.45139 0.41880 0.48353 -0.06991 -0.06582 0.02261  702  PHE A C     
1447 O  O     . PHE B 7   ? 0.47653 0.45603 0.51495 -0.07140 -0.06886 0.02513  702  PHE A O     
1448 C  CB    . PHE B 7   ? 0.35425 0.29459 0.39192 -0.06297 -0.06446 0.02049  702  PHE A CB    
1449 C  CG    . PHE B 7   ? 0.35383 0.27969 0.37151 -0.06857 -0.06144 0.01269  702  PHE A CG    
1450 C  CD1   . PHE B 7   ? 0.40485 0.33294 0.41281 -0.07812 -0.06291 0.00780  702  PHE A CD1   
1451 C  CD2   . PHE B 7   ? 0.37884 0.28857 0.38542 -0.06441 -0.05616 0.01055  702  PHE A CD2   
1452 C  CE1   . PHE B 7   ? 0.41520 0.32726 0.40124 -0.08528 -0.05883 -0.00003 702  PHE A CE1   
1453 C  CE2   . PHE B 7   ? 0.43856 0.33007 0.42270 -0.06946 -0.05131 0.00346  702  PHE A CE2   
1454 C  CZ    . PHE B 7   ? 0.46809 0.35976 0.44126 -0.08090 -0.05252 -0.00230 702  PHE A CZ    
1455 N  N     . ASN B 8   ? 0.56058 0.52472 0.57704 -0.07520 -0.06296 0.01804  703  ASN A N     
1456 C  CA    . ASN B 8   ? 0.46458 0.44350 0.47141 -0.08464 -0.06384 0.01585  703  ASN A CA    
1457 C  C     . ASN B 8   ? 0.53291 0.49627 0.51637 -0.09331 -0.05901 0.00775  703  ASN A C     
1458 O  O     . ASN B 8   ? 0.55529 0.50880 0.53191 -0.09030 -0.05467 0.00759  703  ASN A O     
1459 C  CB    . ASN B 8   ? 0.46704 0.46814 0.48205 -0.08131 -0.06470 0.02274  703  ASN A CB    
1460 C  CG    . ASN B 8   ? 0.49081 0.51693 0.50329 -0.08824 -0.06717 0.02398  703  ASN A CG    
1461 O  OD1   . ASN B 8   ? 0.41764 0.44503 0.41604 -0.09963 -0.06722 0.01763  703  ASN A OD1   
1462 N  ND2   . ASN B 8   ? 0.58712 0.63424 0.61175 -0.08143 -0.06852 0.03255  703  ASN A ND2   
1463 N  N     . VAL B 9   ? 0.65822 0.61763 0.62788 -0.10419 -0.05895 0.00106  704  VAL A N     
1464 C  CA    . VAL B 9   ? 0.70467 0.64753 0.64696 -0.11545 -0.05290 -0.00742 704  VAL A CA    
1465 C  C     . VAL B 9   ? 0.64167 0.60274 0.57554 -0.12371 -0.05178 -0.00705 704  VAL A C     
1466 O  O     . VAL B 9   ? 0.63423 0.57997 0.54709 -0.12983 -0.04521 -0.01179 704  VAL A O     
1467 C  CB    . VAL B 9   ? 0.69695 0.63196 0.62582 -0.12666 -0.05305 -0.01497 704  VAL A CB    
1468 C  CG1   . VAL B 9   ? 0.78842 0.70388 0.68447 -0.14071 -0.04527 -0.02443 704  VAL A CG1   
1469 C  CG2   . VAL B 9   ? 0.70049 0.61630 0.63722 -0.11796 -0.05370 -0.01530 704  VAL A CG2   
1470 N  N     . HIS B 10  ? 0.54811 0.54180 0.49723 -0.12335 -0.05739 -0.00081 705  HIS A N     
1471 C  CA    . HIS B 10  ? 0.54540 0.56327 0.48891 -0.13094 -0.05718 0.00076  705  HIS A CA    
1472 C  C     . HIS B 10  ? 0.53992 0.57450 0.50459 -0.11738 -0.05961 0.01078  705  HIS A C     
1473 O  O     . HIS B 10  ? 0.67690 0.74005 0.65507 -0.11400 -0.06372 0.01778  705  HIS A O     
1474 C  CB    . HIS B 10  ? 0.54663 0.59392 0.48628 -0.14322 -0.06079 -0.00005 705  HIS A CB    
1475 C  CG    . HIS B 10  ? 0.59302 0.62596 0.51115 -0.15837 -0.05859 -0.01023 705  HIS A CG    
1476 N  ND1   . HIS B 10  ? 0.65722 0.66274 0.54724 -0.17011 -0.05108 -0.01972 705  HIS A ND1   
1477 C  CD2   . HIS B 10  ? 0.62569 0.66606 0.54441 -0.16384 -0.06206 -0.01248 705  HIS A CD2   
1478 C  CE1   . HIS B 10  ? 0.69026 0.68562 0.56361 -0.18259 -0.04973 -0.02777 705  HIS A CE1   
1479 N  NE2   . HIS B 10  ? 0.68714 0.70467 0.57846 -0.17927 -0.05691 -0.02368 705  HIS A NE2   
1480 N  N     . PRO B 11  ? 0.57968 0.59765 0.54611 -0.10916 -0.05639 0.01211  706  PRO A N     
1481 C  CA    . PRO B 11  ? 0.54878 0.58209 0.53172 -0.09851 -0.05782 0.02069  706  PRO A CA    
1482 C  C     . PRO B 11  ? 0.58474 0.64316 0.56171 -0.10572 -0.05766 0.02234  706  PRO A C     
1483 O  O     . PRO B 11  ? 0.63703 0.69931 0.59540 -0.12025 -0.05582 0.01623  706  PRO A O     
1484 C  CB    . PRO B 11  ? 0.45776 0.46678 0.43971 -0.09076 -0.05386 0.02011  706  PRO A CB    
1485 C  CG    . PRO B 11  ? 0.49525 0.48091 0.45365 -0.09975 -0.04856 0.01140  706  PRO A CG    
1486 C  CD    . PRO B 11  ? 0.59723 0.58239 0.54878 -0.10877 -0.05037 0.00635  706  PRO A CD    
1487 N  N     . ALA B 12  ? 0.43167 0.50763 0.42341 -0.09610 -0.05909 0.03074  707  ALA A N     
1488 C  CA    . ALA B 12  ? 0.38231 0.48518 0.37054 -0.10095 -0.05900 0.03375  707  ALA A CA    
1489 C  C     . ALA B 12  ? 0.48200 0.57071 0.45192 -0.11022 -0.05439 0.02724  707  ALA A C     
1490 O  O     . ALA B 12  ? 0.43559 0.50044 0.40547 -0.10355 -0.05140 0.02631  707  ALA A O     
1491 C  CB    . ALA B 12  ? 0.28589 0.40416 0.29184 -0.08685 -0.05995 0.04406  707  ALA A CB    
1492 N  N     . PRO B 13  ? 0.59556 0.69798 0.54809 -0.12612 -0.05304 0.02268  708  PRO A N     
1493 C  CA    . PRO B 13  ? 0.59260 0.67411 0.52214 -0.13713 -0.04682 0.01506  708  PRO A CA    
1494 C  C     . PRO B 13  ? 0.59663 0.67618 0.53029 -0.12990 -0.04461 0.01894  708  PRO A C     
1495 O  O     . PRO B 13  ? 0.61696 0.66857 0.53602 -0.13164 -0.03875 0.01422  708  PRO A O     
1496 C  CB    . PRO B 13  ? 0.53983 0.64359 0.45093 -0.15750 -0.04628 0.01035  708  PRO A CB    
1497 C  CG    . PRO B 13  ? 0.51059 0.63759 0.43276 -0.15706 -0.05198 0.01324  708  PRO A CG    
1498 C  CD    . PRO B 13  ? 0.51165 0.64761 0.46188 -0.13614 -0.05628 0.02370  708  PRO A CD    
1499 N  N     . THR B 14  ? 0.42990 0.53708 0.38200 -0.12087 -0.04839 0.02780  709  THR A N     
1500 C  CA    . THR B 14  ? 0.43519 0.54127 0.39196 -0.11383 -0.04655 0.03157  709  THR A CA    
1501 C  C     . THR B 14  ? 0.54416 0.62311 0.51128 -0.09921 -0.04543 0.03314  709  THR A C     
1502 O  O     . THR B 14  ? 0.61644 0.67892 0.57801 -0.09685 -0.04161 0.03193  709  THR A O     
1503 C  CB    . THR B 14  ? 0.41551 0.55852 0.38765 -0.10761 -0.05013 0.04096  709  THR A CB    
1504 O  OG1   . THR B 14  ? 0.50393 0.67680 0.46537 -0.12200 -0.05088 0.03993  709  THR A OG1   
1505 C  CG2   . THR B 14  ? 0.29393 0.43649 0.27267 -0.09919 -0.04858 0.04536  709  THR A CG2   
1506 N  N     . ARG B 15  ? 0.49273 0.56814 0.47414 -0.08991 -0.04845 0.03603  710  ARG A N     
1507 C  CA    . ARG B 15  ? 0.44089 0.49377 0.43101 -0.07833 -0.04745 0.03716  710  ARG A CA    
1508 C  C     . ARG B 15  ? 0.42669 0.44956 0.40065 -0.08200 -0.04296 0.02986  710  ARG A C     
1509 O  O     . ARG B 15  ? 0.47558 0.48143 0.44904 -0.07472 -0.03973 0.03031  710  ARG A O     
1510 C  CB    . ARG B 15  ? 0.44347 0.50098 0.45051 -0.06992 -0.05118 0.04179  710  ARG A CB    
1511 C  CG    . ARG B 15  ? 0.43017 0.46991 0.44712 -0.05947 -0.05042 0.04364  710  ARG A CG    
1512 C  CD    . ARG B 15  ? 0.29164 0.33417 0.32162 -0.05426 -0.05325 0.04723  710  ARG A CD    
1513 N  NE    . ARG B 15  ? 0.25152 0.31007 0.29298 -0.04731 -0.05384 0.05504  710  ARG A NE    
1514 C  CZ    . ARG B 15  ? 0.30042 0.35330 0.35244 -0.03945 -0.05317 0.05948  710  ARG A CZ    
1515 N  NH1   . ARG B 15  ? 0.34496 0.38111 0.39947 -0.03820 -0.05295 0.05704  710  ARG A NH1   
1516 N  NH2   . ARG B 15  ? 0.25188 0.31579 0.31027 -0.03320 -0.05193 0.06651  710  ARG A NH2   
1517 N  N     . LYS B 16  ? 0.36847 0.38454 0.32809 -0.09251 -0.04204 0.02356  711  LYS A N     
1518 C  CA    . LYS B 16  ? 0.39087 0.37534 0.33124 -0.09530 -0.03593 0.01686  711  LYS A CA    
1519 C  C     . LYS B 16  ? 0.47568 0.44665 0.39820 -0.09864 -0.02911 0.01452  711  LYS A C     
1520 O  O     . LYS B 16  ? 0.53098 0.47593 0.44380 -0.09237 -0.02315 0.01323  711  LYS A O     
1521 C  CB    . LYS B 16  ? 0.34507 0.32362 0.26915 -0.10833 -0.03508 0.00967  711  LYS A CB    
1522 C  CG    . LYS B 16  ? 0.37099 0.31248 0.26908 -0.11185 -0.02641 0.00230  711  LYS A CG    
1523 C  CD    . LYS B 16  ? 0.46216 0.39165 0.34886 -0.11954 -0.02582 -0.00398 711  LYS A CD    
1524 C  CE    . LYS B 16  ? 0.59948 0.52301 0.50444 -0.10641 -0.02955 -0.00087 711  LYS A CE    
1525 N  NZ    . LYS B 16  ? 0.63110 0.54062 0.54481 -0.09013 -0.02707 0.00384  711  LYS A NZ    
1526 N  N     . ILE B 17  ? 0.51679 0.50643 0.43485 -0.10758 -0.02953 0.01476  712  ILE A N     
1527 C  CA    . ILE B 17  ? 0.59102 0.56890 0.49197 -0.11186 -0.02300 0.01272  712  ILE A CA    
1528 C  C     . ILE B 17  ? 0.52138 0.49554 0.43694 -0.09617 -0.02287 0.01890  712  ILE A C     
1529 O  O     . ILE B 17  ? 0.45960 0.41014 0.36157 -0.09273 -0.01590 0.01754  712  ILE A O     
1530 C  CB    . ILE B 17  ? 0.56005 0.56417 0.45447 -0.12635 -0.02434 0.01190  712  ILE A CB    
1531 C  CG1   . ILE B 17  ? 0.61794 0.61706 0.48707 -0.14575 -0.02092 0.00343  712  ILE A CG1   
1532 C  CG2   . ILE B 17  ? 0.50815 0.50886 0.39488 -0.12713 -0.01997 0.01282  712  ILE A CG2   
1533 C  CD1   . ILE B 17  ? 0.55310 0.58727 0.41775 -0.16188 -0.02370 0.00303  712  ILE A CD1   
1534 N  N     . ALA B 18  ? 0.43835 0.43449 0.38002 -0.08628 -0.02969 0.02592  713  ALA A N     
1535 C  CA    . ALA B 18  ? 0.41021 0.40596 0.36568 -0.07329 -0.02988 0.03157  713  ALA A CA    
1536 C  C     . ALA B 18  ? 0.47730 0.45317 0.43616 -0.06233 -0.02787 0.03230  713  ALA A C     
1537 O  O     . ALA B 18  ? 0.53665 0.49879 0.49033 -0.05566 -0.02319 0.03335  713  ALA A O     
1538 C  CB    . ALA B 18  ? 0.33278 0.35555 0.31096 -0.06752 -0.03622 0.03842  713  ALA A CB    
1539 N  N     . VAL B 19  ? 0.43687 0.41319 0.40484 -0.05983 -0.03126 0.03247  714  VAL A N     
1540 C  CA    . VAL B 19  ? 0.50391 0.46496 0.47500 -0.05004 -0.02935 0.03354  714  VAL A CA    
1541 C  C     . VAL B 19  ? 0.57262 0.50688 0.51976 -0.05039 -0.02085 0.02929  714  VAL A C     
1542 O  O     . VAL B 19  ? 0.56980 0.49364 0.51574 -0.04000 -0.01670 0.03216  714  VAL A O     
1543 C  CB    . VAL B 19  ? 0.46893 0.43314 0.45070 -0.04943 -0.03382 0.03347  714  VAL A CB    
1544 C  CG1   . VAL B 19  ? 0.40670 0.35911 0.39229 -0.03972 -0.03198 0.03515  714  VAL A CG1   
1545 C  CG2   . VAL B 19  ? 0.41427 0.40077 0.41613 -0.04787 -0.04005 0.03841  714  VAL A CG2   
1546 N  N     . ALA B 20  ? 0.50838 0.43115 0.43408 -0.06238 -0.01714 0.02277  715  ALA A N     
1547 C  CA    . ALA B 20  ? 0.51783 0.40938 0.41610 -0.06265 -0.00686 0.01859  715  ALA A CA    
1548 C  C     . ALA B 20  ? 0.54529 0.42775 0.43158 -0.06026 -0.00032 0.02002  715  ALA A C     
1549 O  O     . ALA B 20  ? 0.56992 0.42686 0.43808 -0.05327 0.00901  0.02003  715  ALA A O     
1550 C  CB    . ALA B 20  ? 0.43779 0.31642 0.31230 -0.07833 -0.00327 0.01037  715  ALA A CB    
1551 N  N     . LYS B 21  ? 0.52925 0.43195 0.42485 -0.06478 -0.00447 0.02186  716  LYS A N     
1552 C  CA    . LYS B 21  ? 0.52528 0.42135 0.41222 -0.06213 0.00090  0.02365  716  LYS A CA    
1553 C  C     . LYS B 21  ? 0.55820 0.45254 0.45771 -0.04449 0.00182  0.03033  716  LYS A C     
1554 O  O     . LYS B 21  ? 0.65527 0.53433 0.54148 -0.03886 0.00938  0.03184  716  LYS A O     
1555 C  CB    . LYS B 21  ? 0.44504 0.36727 0.34278 -0.06985 -0.00489 0.02489  716  LYS A CB    
1556 C  CG    . LYS B 21  ? 0.49216 0.41067 0.38227 -0.06924 -0.00043 0.02635  716  LYS A CG    
1557 C  CD    . LYS B 21  ? 0.51945 0.46162 0.41209 -0.08171 -0.00460 0.02550  716  LYS A CD    
1558 C  CE    . LYS B 21  ? 0.53141 0.47413 0.42053 -0.08095 -0.00157 0.02755  716  LYS A CE    
1559 N  NZ    . LYS B 21  ? 0.54924 0.51517 0.46623 -0.06983 -0.00868 0.03457  716  LYS A NZ    
1560 N  N     . GLN B 22  ? 0.39670 0.30695 0.32027 -0.03622 -0.00518 0.03454  717  GLN A N     
1561 C  CA    . GLN B 22  ? 0.36436 0.27757 0.29997 -0.02135 -0.00469 0.04081  717  GLN A CA    
1562 C  C     . GLN B 22  ? 0.36905 0.27048 0.30134 -0.01380 -0.00189 0.04129  717  GLN A C     
1563 O  O     . GLN B 22  ? 0.35314 0.26763 0.30321 -0.00526 -0.00569 0.04598  717  GLN A O     
1564 C  CB    . GLN B 22  ? 0.33719 0.27765 0.30044 -0.01844 -0.01337 0.04565  717  GLN A CB    
1565 C  CG    . GLN B 22  ? 0.32058 0.27543 0.29786 -0.02462 -0.02083 0.04463  717  GLN A CG    
1566 C  CD    . GLN B 22  ? 0.30083 0.27769 0.29845 -0.02328 -0.02675 0.04905  717  GLN A CD    
1567 O  OE1   . GLN B 22  ? 0.29904 0.28548 0.29716 -0.02851 -0.02832 0.04897  717  GLN A OE1   
1568 N  NE2   . GLN B 22  ? 0.28749 0.27251 0.30046 -0.01688 -0.02943 0.05298  717  GLN A NE2   
1569 N  N     . ASN B 23  ? 0.52836 0.40439 0.43569 -0.01757 0.00565  0.03635  718  ASN A N     
1570 C  CA    . ASN B 23  ? 0.60286 0.46201 0.50055 -0.00949 0.01099  0.03660  718  ASN A CA    
1571 C  C     . ASN B 23  ? 0.52710 0.40541 0.44938 -0.00605 0.00237  0.03910  718  ASN A C     
1572 O  O     . ASN B 23  ? 0.60562 0.48423 0.53212 0.00555  0.00429  0.04345  718  ASN A O     
1573 C  CB    . ASN B 23  ? 0.66174 0.50715 0.54679 0.00552  0.02086  0.04202  718  ASN A CB    
1574 C  CG    . ASN B 23  ? 0.77946 0.59447 0.63116 0.00142  0.03276  0.03827  718  ASN A CG    
1575 O  OD1   . ASN B 23  ? 0.87437 0.65931 0.69891 0.00400  0.04363  0.03599  718  ASN A OD1   
1576 N  ND2   . ASN B 23  ? 0.71390 0.53498 0.56547 -0.00614 0.03146  0.03725  718  ASN A ND2   
1577 N  N     . TYR B 24  ? 0.57237 0.46736 0.50974 -0.01626 -0.00655 0.03673  719  TYR A N     
1578 C  CA    . TYR B 24  ? 0.54626 0.45645 0.50424 -0.01578 -0.01422 0.03816  719  TYR A CA    
1579 C  C     . TYR B 24  ? 0.51554 0.44233 0.49250 -0.00515 -0.01672 0.04524  719  TYR A C     
1580 O  O     . TYR B 24  ? 0.61707 0.55089 0.60557 -0.00215 -0.01982 0.04705  719  TYR A O     
1581 C  CB    . TYR B 24  ? 0.53461 0.42831 0.48163 -0.01696 -0.01176 0.03415  719  TYR A CB    
1582 C  CG    . TYR B 24  ? 0.59619 0.48162 0.52995 -0.03122 -0.01222 0.02677  719  TYR A CG    
1583 C  CD1   . TYR B 24  ? 0.62928 0.53163 0.57797 -0.03927 -0.02066 0.02545  719  TYR A CD1   
1584 C  CD2   . TYR B 24  ? 0.62197 0.48317 0.52656 -0.03716 -0.00346 0.02136  719  TYR A CD2   
1585 C  CE1   . TYR B 24  ? 0.63215 0.53229 0.56923 -0.05263 -0.02138 0.01935  719  TYR A CE1   
1586 C  CE2   . TYR B 24  ? 0.67476 0.53143 0.56585 -0.05266 -0.00378 0.01422  719  TYR A CE2   
1587 C  CZ    . TYR B 24  ? 0.67835 0.55704 0.58696 -0.06023 -0.01333 0.01344  719  TYR A CZ    
1588 O  OH    . TYR B 24  ? 0.74270 0.62232 0.63877 -0.07572 -0.01404 0.00708  719  TYR A OH    
1589 N  N     . ARG B 25  ? 0.37330 0.30766 0.35314 -0.00067 -0.01538 0.04908  720  ARG A N     
1590 C  CA    . ARG B 25  ? 0.31164 0.26300 0.30650 0.00832  -0.01672 0.05569  720  ARG A CA    
1591 C  C     . ARG B 25  ? 0.29318 0.26413 0.30589 0.00324  -0.02332 0.05739  720  ARG A C     
1592 O  O     . ARG B 25  ? 0.30451 0.27560 0.31454 -0.00169 -0.02390 0.05583  720  ARG A O     
1593 C  CB    . ARG B 25  ? 0.32688 0.27186 0.30990 0.01901  -0.00899 0.05961  720  ARG A CB    
1594 C  CG    . ARG B 25  ? 0.34695 0.27358 0.31206 0.02876  -0.00041 0.06063  720  ARG A CG    
1595 C  CD    . ARG B 25  ? 0.50228 0.41495 0.44845 0.03822  0.00953  0.06368  720  ARG A CD    
1596 N  NE    . ARG B 25  ? 0.63773 0.52507 0.55986 0.04715  0.02029  0.06402  720  ARG A NE    
1597 C  CZ    . ARG B 25  ? 0.69649 0.58908 0.61908 0.06119  0.02427  0.07037  720  ARG A CZ    
1598 N  NH1   . ARG B 25  ? 0.66451 0.58880 0.61074 0.06570  0.01775  0.07632  720  ARG A NH1   
1599 N  NH2   . ARG B 25  ? 0.76436 0.63090 0.66229 0.07034  0.03547  0.07094  720  ARG A NH2   
1600 N  N     . CYS B 26  ? 0.38225 0.36882 0.41137 0.00381  -0.02755 0.06052  721  CYS A N     
1601 C  CA    . CYS B 26  ? 0.37471 0.37630 0.41737 -0.00022 -0.03172 0.06255  721  CYS A CA    
1602 C  C     . CYS B 26  ? 0.43469 0.44120 0.47559 0.00380  -0.02924 0.06527  721  CYS A C     
1603 O  O     . CYS B 26  ? 0.51734 0.52511 0.55406 0.01168  -0.02531 0.06833  721  CYS A O     
1604 C  CB    . CYS B 26  ? 0.39447 0.40921 0.45039 -0.00084 -0.03439 0.06548  721  CYS A CB    
1605 S  SG    . CYS B 26  ? 0.33088 0.36147 0.39838 -0.00449 -0.03621 0.06886  721  CYS A SG    
1606 N  N     . ALA B 27  ? 0.48092 0.49066 0.52426 -0.00077 -0.03108 0.06461  722  ALA A N     
1607 C  CA    . ALA B 27  ? 0.45685 0.46976 0.49783 0.00225  -0.02888 0.06656  722  ALA A CA    
1608 C  C     . ALA B 27  ? 0.52049 0.54844 0.57143 0.00582  -0.02912 0.07113  722  ALA A C     
1609 O  O     . ALA B 27  ? 0.59116 0.62254 0.63999 0.00970  -0.02689 0.07324  722  ALA A O     
1610 C  CB    . ALA B 27  ? 0.50054 0.51520 0.54201 -0.00350 -0.03083 0.06508  722  ALA A CB    
1611 N  N     . GLY B 28  ? 0.46977 0.50707 0.53028 0.00356  -0.03140 0.07255  723  GLY A N     
1612 C  CA    . GLY B 28  ? 0.45121 0.50452 0.51935 0.00377  -0.03134 0.07628  723  GLY A CA    
1613 C  C     . GLY B 28  ? 0.49953 0.56480 0.56927 0.00868  -0.02979 0.07975  723  GLY A C     
1614 O  O     . GLY B 28  ? 0.65532 0.73604 0.72776 0.01110  -0.02850 0.08347  723  GLY A O     
1615 N  N     . CYS B 29  ? 0.26025 0.32060 0.32831 0.01013  -0.02985 0.07889  724  CYS A N     
1616 C  CA    . CYS B 29  ? 0.25991 0.33331 0.32955 0.01538  -0.02831 0.08273  724  CYS A CA    
1617 C  C     . CYS B 29  ? 0.30164 0.36245 0.35980 0.02572  -0.02402 0.08324  724  CYS A C     
1618 O  O     . CYS B 29  ? 0.31340 0.38581 0.37072 0.03381  -0.02120 0.08798  724  CYS A O     
1619 C  CB    . CYS B 29  ? 0.31353 0.39363 0.39132 0.00724  -0.03150 0.08184  724  CYS A CB    
1620 S  SG    . CYS B 29  ? 0.37929 0.43688 0.45522 0.00171  -0.03428 0.07586  724  CYS A SG    
1621 N  N     . GLY B 30  ? 0.26909 0.30707 0.31661 0.02551  -0.02257 0.07884  725  GLY A N     
1622 C  CA    . GLY B 30  ? 0.28535 0.30386 0.31696 0.03276  -0.01706 0.07773  725  GLY A CA    
1623 C  C     . GLY B 30  ? 0.28601 0.29798 0.31618 0.03262  -0.01739 0.07599  725  GLY A C     
1624 O  O     . GLY B 30  ? 0.30200 0.29787 0.31714 0.04025  -0.01131 0.07597  725  GLY A O     
1625 N  N     . ILE B 31  ? 0.27125 0.29291 0.31468 0.02437  -0.02336 0.07457  726  ILE A N     
1626 C  CA    . ILE B 31  ? 0.27137 0.28670 0.31386 0.02396  -0.02392 0.07278  726  ILE A CA    
1627 C  C     . ILE B 31  ? 0.31875 0.30820 0.34743 0.02096  -0.02234 0.06652  726  ILE A C     
1628 O  O     . ILE B 31  ? 0.36588 0.34853 0.39301 0.01342  -0.02451 0.06258  726  ILE A O     
1629 C  CB    . ILE B 31  ? 0.25466 0.28374 0.31286 0.01453  -0.03009 0.07238  726  ILE A CB    
1630 C  CG1   . ILE B 31  ? 0.25382 0.28181 0.31280 0.01564  -0.03037 0.07213  726  ILE A CG1   
1631 C  CG2   . ILE B 31  ? 0.24834 0.26888 0.30999 0.00420  -0.03436 0.06765  726  ILE A CG2   
1632 C  CD1   . ILE B 31  ? 0.23976 0.27969 0.31213 0.00571  -0.03536 0.07189  726  ILE A CD1   
1633 N  N     . ARG B 32  ? 0.40935 0.38528 0.42640 0.02684  -0.01784 0.06584  727  ARG A N     
1634 C  CA    . ARG B 32  ? 0.44299 0.39310 0.44336 0.02296  -0.01505 0.05943  727  ARG A CA    
1635 C  C     . ARG B 32  ? 0.44862 0.39873 0.45762 0.01354  -0.02132 0.05512  727  ARG A C     
1636 O  O     . ARG B 32  ? 0.56234 0.51963 0.57921 0.01586  -0.02296 0.05698  727  ARG A O     
1637 C  CB    . ARG B 32  ? 0.52475 0.45633 0.50474 0.03438  -0.00538 0.06083  727  ARG A CB    
1638 C  CG    . ARG B 32  ? 0.50801 0.44075 0.47914 0.04654  0.00200  0.06691  727  ARG A CG    
1639 C  CD    . ARG B 32  ? 0.52502 0.43892 0.47453 0.06053  0.01322  0.06993  727  ARG A CD    
1640 N  NE    . ARG B 32  ? 0.60298 0.53831 0.56338 0.07165  0.01318  0.07743  727  ARG A NE    
1641 C  CZ    . ARG B 32  ? 0.63929 0.56501 0.58437 0.08656  0.02263  0.08223  727  ARG A CZ    
1642 N  NH1   . ARG B 32  ? 0.68963 0.57982 0.60576 0.09147  0.03366  0.07959  727  ARG A NH1   
1643 N  NH2   . ARG B 32  ? 0.63014 0.58170 0.58702 0.09632  0.02195  0.08991  727  ARG A NH2   
1644 N  N     . THR B 33  ? 0.43487 0.37888 0.44232 0.00312  -0.02463 0.04990  728  THR A N     
1645 C  CA    . THR B 33  ? 0.45502 0.40266 0.47246 -0.00574 -0.03102 0.04685  728  THR A CA    
1646 C  C     . THR B 33  ? 0.43452 0.36280 0.43695 -0.01057 -0.02921 0.04052  728  THR A C     
1647 O  O     . THR B 33  ? 0.45825 0.36991 0.44119 -0.01179 -0.02367 0.03698  728  THR A O     
1648 C  CB    . THR B 33  ? 0.42081 0.37952 0.44768 -0.01318 -0.03588 0.04672  728  THR A CB    
1649 O  OG1   . THR B 33  ? 0.55746 0.50655 0.57022 -0.01801 -0.03375 0.04269  728  THR A OG1   
1650 C  CG2   . THR B 33  ? 0.26640 0.24055 0.30391 -0.00928 -0.03632 0.05212  728  THR A CG2   
1651 N  N     . ASP B 34  ? 0.41272 0.34245 0.42295 -0.01426 -0.03337 0.03891  729  ASP A N     
1652 C  CA    . ASP B 34  ? 0.48003 0.39380 0.47790 -0.02047 -0.03274 0.03257  729  ASP A CA    
1653 C  C     . ASP B 34  ? 0.47107 0.38373 0.46094 -0.03062 -0.03384 0.02828  729  ASP A C     
1654 O  O     . ASP B 34  ? 0.43983 0.36906 0.44317 -0.03497 -0.03937 0.03010  729  ASP A O     
1655 C  CB    . ASP B 34  ? 0.50610 0.42576 0.51749 -0.02359 -0.03841 0.03222  729  ASP A CB    
1656 C  CG    . ASP B 34  ? 0.50612 0.40754 0.50419 -0.02620 -0.03632 0.02658  729  ASP A CG    
1657 O  OD1   . ASP B 34  ? 0.52401 0.41089 0.50357 -0.03216 -0.03296 0.02097  729  ASP A OD1   
1658 O  OD2   . ASP B 34  ? 0.53895 0.44058 0.54406 -0.02334 -0.03776 0.02749  729  ASP A OD2   
1659 N  N     . PRO B 35  ? 0.44453 0.33853 0.41118 -0.03480 -0.02789 0.02295  730  PRO A N     
1660 C  CA    . PRO B 35  ? 0.49090 0.38743 0.44873 -0.04706 -0.02907 0.01845  730  PRO A CA    
1661 C  C     . PRO B 35  ? 0.53108 0.43963 0.49837 -0.05576 -0.03607 0.01629  730  PRO A C     
1662 O  O     . PRO B 35  ? 0.54667 0.46984 0.51565 -0.06361 -0.03926 0.01584  730  PRO A O     
1663 C  CB    . PRO B 35  ? 0.51606 0.38530 0.44319 -0.05108 -0.01974 0.01229  730  PRO A CB    
1664 C  CG    . PRO B 35  ? 0.50956 0.36525 0.43113 -0.03697 -0.01273 0.01634  730  PRO A CG    
1665 C  CD    . PRO B 35  ? 0.41738 0.28745 0.36251 -0.02826 -0.01844 0.02155  730  PRO A CD    
1666 N  N     . ASP B 36  ? 0.60385 0.50829 0.57725 -0.05403 -0.03831 0.01558  731  ASP A N     
1667 C  CA    . ASP B 36  ? 0.52152 0.43693 0.50429 -0.06088 -0.04460 0.01431  731  ASP A CA    
1668 C  C     . ASP B 36  ? 0.51493 0.45099 0.52181 -0.05670 -0.05059 0.02110  731  ASP A C     
1669 O  O     . ASP B 36  ? 0.46465 0.40932 0.48003 -0.06023 -0.05510 0.02149  731  ASP A O     
1670 C  CB    . ASP B 36  ? 0.55330 0.45384 0.53157 -0.06118 -0.04413 0.01045  731  ASP A CB    
1671 C  CG    . ASP B 36  ? 0.68548 0.56067 0.63631 -0.06492 -0.03641 0.00359  731  ASP A CG    
1672 O  OD1   . ASP B 36  ? 0.77706 0.64947 0.71084 -0.07487 -0.03363 -0.00086 731  ASP A OD1   
1673 O  OD2   . ASP B 36  ? 0.63649 0.49454 0.58139 -0.05825 -0.03244 0.00285  731  ASP A OD2   
1674 N  N     . TYR B 37  ? 0.32636 0.26924 0.34261 -0.04944 -0.04991 0.02653  732  TYR A N     
1675 C  CA    . TYR B 37  ? 0.24965 0.20743 0.28491 -0.04617 -0.05371 0.03260  732  TYR A CA    
1676 C  C     . TYR B 37  ? 0.25091 0.22142 0.29026 -0.04455 -0.05344 0.03679  732  TYR A C     
1677 O  O     . TYR B 37  ? 0.23688 0.21606 0.28873 -0.04104 -0.05458 0.04199  732  TYR A O     
1678 C  CB    . TYR B 37  ? 0.24346 0.19841 0.28796 -0.03993 -0.05328 0.03548  732  TYR A CB    
1679 C  CG    . TYR B 37  ? 0.32693 0.27426 0.37329 -0.04139 -0.05494 0.03308  732  TYR A CG    
1680 C  CD1   . TYR B 37  ? 0.34550 0.27759 0.37894 -0.04111 -0.05220 0.02827  732  TYR A CD1   
1681 C  CD2   . TYR B 37  ? 0.28574 0.23900 0.34505 -0.04288 -0.05829 0.03575  732  TYR A CD2   
1682 C  CE1   . TYR B 37  ? 0.28607 0.21107 0.32117 -0.04209 -0.05363 0.02608  732  TYR A CE1   
1683 C  CE2   . TYR B 37  ? 0.22568 0.17191 0.28692 -0.04452 -0.05987 0.03354  732  TYR A CE2   
1684 C  CZ    . TYR B 37  ? 0.27112 0.20426 0.32121 -0.04400 -0.05799 0.02867  732  TYR A CZ    
1685 O  OH    . TYR B 37  ? 0.23237 0.15843 0.28446 -0.04532 -0.05952 0.02647  732  TYR A OH    
1686 N  N     . ILE B 38  ? 0.29789 0.26909 0.32563 -0.04799 -0.05147 0.03451  733  ILE A N     
1687 C  CA    . ILE B 38  ? 0.29815 0.28015 0.32899 -0.04568 -0.05070 0.03836  733  ILE A CA    
1688 C  C     . ILE B 38  ? 0.33725 0.33658 0.37967 -0.04519 -0.05366 0.04354  733  ILE A C     
1689 O  O     . ILE B 38  ? 0.36911 0.37722 0.41505 -0.04225 -0.05280 0.04738  733  ILE A O     
1690 C  CB    . ILE B 38  ? 0.32535 0.30411 0.33949 -0.05108 -0.04757 0.03444  733  ILE A CB    
1691 C  CG1   . ILE B 38  ? 0.27281 0.26172 0.28049 -0.06092 -0.04973 0.03159  733  ILE A CG1   
1692 C  CG2   . ILE B 38  ? 0.38578 0.34265 0.38454 -0.04941 -0.04203 0.03032  733  ILE A CG2   
1693 C  CD1   . ILE B 38  ? 0.28962 0.27658 0.27813 -0.06989 -0.04619 0.02696  733  ILE A CD1   
1694 N  N     . LYS B 39  ? 0.51210 0.51582 0.55940 -0.04710 -0.05636 0.04423  734  LYS A N     
1695 C  CA    . LYS B 39  ? 0.43342 0.45109 0.48982 -0.04400 -0.05730 0.05059  734  LYS A CA    
1696 C  C     . LYS B 39  ? 0.41001 0.42381 0.47591 -0.03783 -0.05551 0.05541  734  LYS A C     
1697 O  O     . LYS B 39  ? 0.37044 0.39205 0.44044 -0.03395 -0.05393 0.06111  734  LYS A O     
1698 C  CB    . LYS B 39  ? 0.34478 0.36651 0.40287 -0.04648 -0.05971 0.05072  734  LYS A CB    
1699 C  CG    . LYS B 39  ? 0.42812 0.46443 0.49253 -0.04161 -0.05922 0.05847  734  LYS A CG    
1700 C  CD    . LYS B 39  ? 0.55418 0.58359 0.62472 -0.03917 -0.05925 0.06108  734  LYS A CD    
1701 C  CE    . LYS B 39  ? 0.67809 0.71125 0.74556 -0.04443 -0.06251 0.05766  734  LYS A CE    
1702 N  NZ    . LYS B 39  ? 0.74393 0.77939 0.81637 -0.04030 -0.06192 0.06322  734  LYS A NZ    
1703 N  N     . ARG B 40  ? 0.40688 0.40933 0.47458 -0.03716 -0.05499 0.05336  735  ARG A N     
1704 C  CA    . ARG B 40  ? 0.47192 0.47231 0.54677 -0.03408 -0.05309 0.05703  735  ARG A CA    
1705 C  C     . ARG B 40  ? 0.46188 0.46782 0.53661 -0.03108 -0.05081 0.05972  735  ARG A C     
1706 O  O     . ARG B 40  ? 0.43107 0.43804 0.50998 -0.02956 -0.04853 0.06368  735  ARG A O     
1707 C  CB    . ARG B 40  ? 0.40657 0.39900 0.48244 -0.03447 -0.05329 0.05432  735  ARG A CB    
1708 C  CG    . ARG B 40  ? 0.44380 0.43379 0.52655 -0.03582 -0.05291 0.05651  735  ARG A CG    
1709 C  CD    . ARG B 40  ? 0.63251 0.61930 0.71618 -0.03573 -0.05323 0.05433  735  ARG A CD    
1710 N  NE    . ARG B 40  ? 0.68628 0.66658 0.77144 -0.03853 -0.05518 0.05209  735  ARG A NE    
1711 C  CZ    . ARG B 40  ? 0.71472 0.69298 0.80472 -0.04198 -0.05524 0.05396  735  ARG A CZ    
1712 N  NH1   . ARG B 40  ? 0.74279 0.71487 0.83406 -0.04449 -0.05714 0.05173  735  ARG A NH1   
1713 N  NH2   . ARG B 40  ? 0.76570 0.74598 0.85741 -0.04297 -0.05257 0.05806  735  ARG A NH2   
1714 N  N     . LEU B 41  ? 0.31869 0.32664 0.38701 -0.03101 -0.05071 0.05736  736  LEU A N     
1715 C  CA    . LEU B 41  ? 0.33325 0.34563 0.40106 -0.02819 -0.04869 0.05939  736  LEU A CA    
1716 C  C     . LEU B 41  ? 0.31007 0.33227 0.37968 -0.02668 -0.04789 0.06376  736  LEU A C     
1717 O  O     . LEU B 41  ? 0.31291 0.34140 0.38171 -0.02755 -0.04891 0.06499  736  LEU A O     
1718 C  CB    . LEU B 41  ? 0.32006 0.32889 0.37803 -0.02893 -0.04783 0.05548  736  LEU A CB    
1719 C  CG    . LEU B 41  ? 0.27103 0.26786 0.32306 -0.02883 -0.04700 0.05153  736  LEU A CG    
1720 C  CD1   . LEU B 41  ? 0.25666 0.24556 0.29391 -0.03051 -0.04427 0.04754  736  LEU A CD1   
1721 C  CD2   . LEU B 41  ? 0.32727 0.32384 0.38505 -0.02379 -0.04556 0.05408  736  LEU A CD2   
1722 N  N     . ARG B 42  ? 0.27589 0.30071 0.34724 -0.02378 -0.04566 0.06655  737  ARG A N     
1723 C  CA    . ARG B 42  ? 0.27234 0.30511 0.34424 -0.02085 -0.04373 0.07121  737  ARG A CA    
1724 C  C     . ARG B 42  ? 0.27836 0.31718 0.34691 -0.01995 -0.04327 0.07082  737  ARG A C     
1725 O  O     . ARG B 42  ? 0.24145 0.27613 0.30907 -0.01975 -0.04275 0.06884  737  ARG A O     
1726 C  CB    . ARG B 42  ? 0.23008 0.25795 0.30513 -0.01888 -0.04017 0.07513  737  ARG A CB    
1727 C  CG    . ARG B 42  ? 0.22893 0.24908 0.30574 -0.02080 -0.03977 0.07543  737  ARG A CG    
1728 C  CD    . ARG B 42  ? 0.26766 0.28036 0.34376 -0.02126 -0.03478 0.07862  737  ARG A CD    
1729 N  NE    . ARG B 42  ? 0.35768 0.36162 0.43280 -0.02276 -0.03282 0.08016  737  ARG A NE    
1730 C  CZ    . ARG B 42  ? 0.33380 0.32738 0.40637 -0.02674 -0.02849 0.08117  737  ARG A CZ    
1731 N  NH1   . ARG B 42  ? 0.32030 0.31352 0.39154 -0.03021 -0.02611 0.08066  737  ARG A NH1   
1732 N  NH2   . ARG B 42  ? 0.31853 0.30248 0.38880 -0.02815 -0.02623 0.08260  737  ARG A NH2   
1733 N  N     . TYR B 43  ? 0.38834 0.43857 0.45485 -0.01896 -0.04313 0.07337  738  TYR A N     
1734 C  CA    . TYR B 43  ? 0.28373 0.34129 0.34652 -0.01910 -0.04270 0.07316  738  TYR A CA    
1735 C  C     . TYR B 43  ? 0.33153 0.38996 0.39755 -0.01397 -0.03966 0.07751  738  TYR A C     
1736 O  O     . TYR B 43  ? 0.35280 0.41364 0.42068 -0.00968 -0.03709 0.08265  738  TYR A O     
1737 C  CB    . TYR B 43  ? 0.23918 0.31273 0.29807 -0.02130 -0.04384 0.07434  738  TYR A CB    
1738 C  CG    . TYR B 43  ? 0.24401 0.32473 0.29679 -0.02460 -0.04367 0.07257  738  TYR A CG    
1739 C  CD1   . TYR B 43  ? 0.30403 0.37597 0.34779 -0.03130 -0.04394 0.06617  738  TYR A CD1   
1740 C  CD2   . TYR B 43  ? 0.24385 0.33901 0.29788 -0.02105 -0.04229 0.07751  738  TYR A CD2   
1741 C  CE1   . TYR B 43  ? 0.34519 0.42116 0.38074 -0.03560 -0.04274 0.06430  738  TYR A CE1   
1742 C  CE2   . TYR B 43  ? 0.25192 0.35426 0.29987 -0.02528 -0.04212 0.07571  738  TYR A CE2   
1743 C  CZ    . TYR B 43  ? 0.34566 0.43771 0.38405 -0.03321 -0.04230 0.06887  738  TYR A CZ    
1744 O  OH    . TYR B 43  ? 0.35767 0.45339 0.38727 -0.03875 -0.04106 0.06662  738  TYR A OH    
1745 N  N     . CYS B 44  ? 0.36697 0.42211 0.43188 -0.01411 -0.03912 0.07560  739  CYS A N     
1746 C  CA    . CYS B 44  ? 0.37875 0.43485 0.44550 -0.01044 -0.03640 0.07872  739  CYS A CA    
1747 C  C     . CYS B 44  ? 0.41569 0.48359 0.47966 -0.00934 -0.03616 0.08060  739  CYS A C     
1748 O  O     . CYS B 44  ? 0.36936 0.43946 0.42887 -0.01265 -0.03740 0.07739  739  CYS A O     
1749 C  CB    . CYS B 44  ? 0.42498 0.47472 0.49210 -0.01085 -0.03609 0.07622  739  CYS A CB    
1750 S  SG    . CYS B 44  ? 0.35224 0.40421 0.42070 -0.00775 -0.03299 0.07930  739  CYS A SG    
1751 N  N     . GLU B 45  ? 0.55753 0.63251 0.62250 -0.00455 -0.03367 0.08617  740  GLU A N     
1752 C  CA    . GLU B 45  ? 0.58591 0.67673 0.64861 -0.00320 -0.03361 0.08887  740  GLU A CA    
1753 C  C     . GLU B 45  ? 0.61288 0.70378 0.67467 -0.00290 -0.03275 0.08810  740  GLU A C     
1754 O  O     . GLU B 45  ? 0.63302 0.73739 0.69244 -0.00348 -0.03309 0.08937  740  GLU A O     
1755 C  CB    . GLU B 45  ? 0.60132 0.70135 0.66422 0.00431  -0.03011 0.09653  740  GLU A CB    
1756 C  CG    . GLU B 45  ? 0.70877 0.81929 0.77132 0.00389  -0.03174 0.09830  740  GLU A CG    
1757 C  CD    . GLU B 45  ? 0.82438 0.95607 0.88412 -0.00215 -0.03553 0.09665  740  GLU A CD    
1758 O  OE1   . GLU B 45  ? 0.87713 1.02471 0.93623 -0.00149 -0.03627 0.09997  740  GLU A OE1   
1759 O  OE2   . GLU B 45  ? 0.84219 0.97512 0.89900 -0.00824 -0.03725 0.09216  740  GLU A OE2   
1760 N  N     . TYR B 46  ? 0.53208 0.61044 0.59547 -0.00265 -0.03171 0.08614  741  TYR A N     
1761 C  CA    . TYR B 46  ? 0.48432 0.56273 0.54683 -0.00224 -0.03097 0.08537  741  TYR A CA    
1762 C  C     . TYR B 46  ? 0.42585 0.49927 0.48477 -0.00670 -0.03289 0.08016  741  TYR A C     
1763 O  O     . TYR B 46  ? 0.42945 0.50681 0.48395 -0.00864 -0.03289 0.07900  741  TYR A O     
1764 C  CB    . TYR B 46  ? 0.45069 0.52081 0.51543 0.00062  -0.02787 0.08692  741  TYR A CB    
1765 C  CG    . TYR B 46  ? 0.56281 0.63213 0.62721 0.00038  -0.02776 0.08524  741  TYR A CG    
1766 C  CD1   . TYR B 46  ? 0.55742 0.63297 0.62066 0.00284  -0.02638 0.08740  741  TYR A CD1   
1767 C  CD2   . TYR B 46  ? 0.60942 0.67310 0.67438 -0.00144 -0.02874 0.08212  741  TYR A CD2   
1768 C  CE1   . TYR B 46  ? 0.48926 0.56381 0.55204 0.00271  -0.02623 0.08597  741  TYR A CE1   
1769 C  CE2   . TYR B 46  ? 0.57046 0.63446 0.63457 -0.00050 -0.02816 0.08143  741  TYR A CE2   
1770 C  CZ    . TYR B 46  ? 0.52173 0.59035 0.58483 0.00118  -0.02703 0.08307  741  TYR A CZ    
1771 O  OH    . TYR B 46  ? 0.48879 0.55738 0.55094 0.00216  -0.02639 0.08248  741  TYR A OH    
1772 N  N     . LEU B 47  ? 0.39392 0.45779 0.45312 -0.00798 -0.03360 0.07738  742  LEU A N     
1773 C  CA    . LEU B 47  ? 0.40550 0.46195 0.45856 -0.01000 -0.03355 0.07347  742  LEU A CA    
1774 C  C     . LEU B 47  ? 0.42207 0.47748 0.46649 -0.01568 -0.03433 0.07000  742  LEU A C     
1775 O  O     . LEU B 47  ? 0.49036 0.53697 0.52494 -0.01807 -0.03248 0.06672  742  LEU A O     
1776 C  CB    . LEU B 47  ? 0.43738 0.48608 0.49295 -0.00801 -0.03324 0.07271  742  LEU A CB    
1777 C  CG    . LEU B 47  ? 0.54714 0.59040 0.59759 -0.00544 -0.03109 0.07174  742  LEU A CG    
1778 C  CD1   . LEU B 47  ? 0.53036 0.57954 0.58563 -0.00233 -0.03005 0.07456  742  LEU A CD1   
1779 C  CD2   . LEU B 47  ? 0.58918 0.62626 0.63852 -0.00315 -0.03036 0.07097  742  LEU A CD2   
1780 N  N     . GLY B 48  ? 0.25609 0.31963 0.30209 -0.01810 -0.03618 0.07082  743  GLY A N     
1781 C  CA    . GLY B 48  ? 0.26203 0.32719 0.29916 -0.02536 -0.03702 0.06726  743  GLY A CA    
1782 C  C     . GLY B 48  ? 0.35447 0.40528 0.38585 -0.02798 -0.03682 0.06283  743  GLY A C     
1783 O  O     . GLY B 48  ? 0.47030 0.51787 0.48997 -0.03544 -0.03614 0.05861  743  GLY A O     
1784 N  N     . LYS B 49  ? 0.40166 0.44421 0.43950 -0.02290 -0.03691 0.06359  744  LYS A N     
1785 C  CA    . LYS B 49  ? 0.37706 0.40635 0.40944 -0.02386 -0.03622 0.06004  744  LYS A CA    
1786 C  C     . LYS B 49  ? 0.37350 0.40450 0.41572 -0.02223 -0.03875 0.06152  744  LYS A C     
1787 O  O     . LYS B 49  ? 0.38691 0.42613 0.43871 -0.01976 -0.03986 0.06545  744  LYS A O     
1788 C  CB    . LYS B 49  ? 0.39753 0.41532 0.42552 -0.01875 -0.03276 0.05977  744  LYS A CB    
1789 C  CG    . LYS B 49  ? 0.43579 0.45071 0.45454 -0.01914 -0.02949 0.05931  744  LYS A CG    
1790 C  CD    . LYS B 49  ? 0.48208 0.48289 0.49169 -0.01342 -0.02448 0.05915  744  LYS A CD    
1791 C  CE    . LYS B 49  ? 0.53186 0.51391 0.51990 -0.01782 -0.01901 0.05455  744  LYS A CE    
1792 N  NZ    . LYS B 49  ? 0.58670 0.55195 0.56511 -0.01016 -0.01354 0.05486  744  LYS A NZ    
1793 N  N     . TYR B 50  ? 0.37259 0.39374 0.41050 -0.02376 -0.03875 0.05833  745  TYR A N     
1794 C  CA    . TYR B 50  ? 0.33708 0.35828 0.38302 -0.02324 -0.04102 0.05910  745  TYR A CA    
1795 C  C     . TYR B 50  ? 0.37812 0.39524 0.42968 -0.01835 -0.04007 0.06066  745  TYR A C     
1796 O  O     . TYR B 50  ? 0.37187 0.38396 0.41852 -0.01476 -0.03743 0.06038  745  TYR A O     
1797 C  CB    . TYR B 50  ? 0.33583 0.35053 0.37419 -0.02846 -0.04192 0.05469  745  TYR A CB    
1798 C  CG    . TYR B 50  ? 0.49030 0.51677 0.52809 -0.03370 -0.04416 0.05484  745  TYR A CG    
1799 C  CD1   . TYR B 50  ? 0.52963 0.56447 0.57694 -0.03238 -0.04652 0.05823  745  TYR A CD1   
1800 C  CD2   . TYR B 50  ? 0.50701 0.53773 0.53372 -0.03993 -0.04322 0.05228  745  TYR A CD2   
1801 C  CE1   . TYR B 50  ? 0.54420 0.59355 0.59095 -0.03526 -0.04804 0.05989  745  TYR A CE1   
1802 C  CE2   . TYR B 50  ? 0.53682 0.58419 0.56326 -0.04481 -0.04533 0.05332  745  TYR A CE2   
1803 C  CZ    . TYR B 50  ? 0.52834 0.58628 0.56535 -0.04151 -0.04782 0.05759  745  TYR A CZ    
1804 O  OH    . TYR B 50  ? 0.46950 0.54761 0.50590 -0.04470 -0.04940 0.05998  745  TYR A OH    
1805 N  N     . PHE B 51  ? 0.31059 0.33097 0.37139 -0.01838 -0.04163 0.06280  746  PHE A N     
1806 C  CA    . PHE B 51  ? 0.30079 0.32256 0.36778 -0.01618 -0.04092 0.06484  746  PHE A CA    
1807 C  C     . PHE B 51  ? 0.29888 0.31778 0.36998 -0.01873 -0.04251 0.06424  746  PHE A C     
1808 O  O     . PHE B 51  ? 0.24876 0.26651 0.32089 -0.02142 -0.04391 0.06404  746  PHE A O     
1809 C  CB    . PHE B 51  ? 0.32891 0.35786 0.40153 -0.01596 -0.03975 0.06853  746  PHE A CB    
1810 C  CG    . PHE B 51  ? 0.38597 0.41885 0.45630 -0.01303 -0.03812 0.06957  746  PHE A CG    
1811 C  CD1   . PHE B 51  ? 0.32540 0.35825 0.39085 -0.01282 -0.03809 0.06879  746  PHE A CD1   
1812 C  CD2   . PHE B 51  ? 0.43844 0.47713 0.51142 -0.01124 -0.03658 0.07157  746  PHE A CD2   
1813 C  CE1   . PHE B 51  ? 0.29060 0.32623 0.35384 -0.01045 -0.03650 0.06970  746  PHE A CE1   
1814 C  CE2   . PHE B 51  ? 0.41269 0.45503 0.48365 -0.00831 -0.03509 0.07267  746  PHE A CE2   
1815 C  CZ    . PHE B 51  ? 0.33527 0.37467 0.40140 -0.00774 -0.03502 0.07163  746  PHE A CZ    
1816 N  N     . CYS B 52  ? 0.23204 0.25175 0.30556 -0.01751 -0.04202 0.06465  747  CYS A N     
1817 C  CA    . CYS B 52  ? 0.22726 0.24637 0.30585 -0.02069 -0.04317 0.06473  747  CYS A CA    
1818 C  C     . CYS B 52  ? 0.26360 0.28553 0.34694 -0.02498 -0.04222 0.06743  747  CYS A C     
1819 O  O     . CYS B 52  ? 0.23109 0.25716 0.31435 -0.02477 -0.04027 0.06958  747  CYS A O     
1820 C  CB    . CYS B 52  ? 0.22730 0.25176 0.30732 -0.01816 -0.04228 0.06570  747  CYS A CB    
1821 S  SG    . CYS B 52  ? 0.33756 0.37803 0.42187 -0.01807 -0.04016 0.06995  747  CYS A SG    
1822 N  N     . GLN B 53  ? 0.42554 0.44310 0.51122 -0.02908 -0.04269 0.06727  748  GLN A N     
1823 C  CA    . GLN B 53  ? 0.36780 0.38259 0.45372 -0.03341 -0.03981 0.06982  748  GLN A CA    
1824 C  C     . GLN B 53  ? 0.41921 0.44054 0.50565 -0.03805 -0.03702 0.07138  748  GLN A C     
1825 O  O     . GLN B 53  ? 0.43851 0.45491 0.52147 -0.04304 -0.03294 0.07311  748  GLN A O     
1826 C  CB    . GLN B 53  ? 0.42029 0.42667 0.50669 -0.03658 -0.04023 0.06934  748  GLN A CB    
1827 C  CG    . GLN B 53  ? 0.57636 0.57952 0.66188 -0.03330 -0.04321 0.06770  748  GLN A CG    
1828 C  CD    . GLN B 53  ? 0.64489 0.64078 0.72959 -0.03460 -0.04207 0.06943  748  GLN A CD    
1829 O  OE1   . GLN B 53  ? 0.67735 0.66668 0.76129 -0.03850 -0.03882 0.07115  748  GLN A OE1   
1830 N  NE2   . GLN B 53  ? 0.65933 0.65682 0.74276 -0.03187 -0.04412 0.06919  748  GLN A NE2   
1831 N  N     . CYS B 54  ? 0.37683 0.40938 0.46565 -0.03665 -0.03817 0.07118  749  CYS A N     
1832 C  CA    . CYS B 54  ? 0.40943 0.45321 0.49829 -0.04158 -0.03560 0.07304  749  CYS A CA    
1833 C  C     . CYS B 54  ? 0.40137 0.44925 0.48814 -0.03868 -0.03396 0.07433  749  CYS A C     
1834 O  O     . CYS B 54  ? 0.43685 0.48437 0.52006 -0.04437 -0.03034 0.07542  749  CYS A O     
1835 C  CB    . CYS B 54  ? 0.44316 0.50215 0.53573 -0.04067 -0.03707 0.07369  749  CYS A CB    
1836 S  SG    . CYS B 54  ? 0.56506 0.62458 0.66032 -0.04749 -0.03803 0.07287  749  CYS A SG    
1837 N  N     . CYS B 55  ? 0.28823 0.33813 0.37539 -0.03048 -0.03585 0.07402  750  CYS A N     
1838 C  CA    . CYS B 55  ? 0.29361 0.34625 0.37884 -0.02712 -0.03462 0.07506  750  CYS A CA    
1839 C  C     . CYS B 55  ? 0.34483 0.38741 0.42703 -0.02766 -0.03304 0.07532  750  CYS A C     
1840 O  O     . CYS B 55  ? 0.38163 0.42645 0.46190 -0.02703 -0.03100 0.07657  750  CYS A O     
1841 C  CB    . CYS B 55  ? 0.31703 0.37010 0.40077 -0.01886 -0.03607 0.07439  750  CYS A CB    
1842 S  SG    . CYS B 55  ? 0.33581 0.39861 0.42020 -0.01372 -0.03616 0.07555  750  CYS A SG    
1843 N  N     . HIS B 56  ? 0.30260 0.33556 0.38402 -0.02778 -0.03369 0.07470  751  HIS A N     
1844 C  CA    . HIS B 56  ? 0.30952 0.33586 0.38769 -0.02601 -0.03169 0.07637  751  HIS A CA    
1845 C  C     . HIS B 56  ? 0.34728 0.36386 0.42294 -0.02993 -0.02878 0.07763  751  HIS A C     
1846 O  O     . HIS B 56  ? 0.38537 0.39884 0.46306 -0.03075 -0.03109 0.07635  751  HIS A O     
1847 C  CB    . HIS B 56  ? 0.37514 0.40246 0.45327 -0.02122 -0.03493 0.07520  751  HIS A CB    
1848 C  CG    . HIS B 56  ? 0.37121 0.39804 0.44665 -0.01818 -0.03326 0.07794  751  HIS A CG    
1849 N  ND1   . HIS B 56  ? 0.41936 0.43982 0.49195 -0.01793 -0.02911 0.08142  751  HIS A ND1   
1850 C  CD2   . HIS B 56  ? 0.37738 0.41033 0.45134 -0.01489 -0.03454 0.07827  751  HIS A CD2   
1851 C  CE1   . HIS B 56  ? 0.41684 0.44121 0.48713 -0.01286 -0.02789 0.08458  751  HIS A CE1   
1852 N  NE2   . HIS B 56  ? 0.42167 0.45536 0.49346 -0.01174 -0.03165 0.08255  751  HIS A NE2   
1853 N  N     . GLU B 57  ? 0.45276 0.46242 0.52220 -0.03226 -0.02285 0.08013  752  GLU A N     
1854 C  CA    . GLU B 57  ? 0.39797 0.39413 0.46082 -0.03669 -0.01747 0.08174  752  GLU A CA    
1855 C  C     . GLU B 57  ? 0.45552 0.44145 0.51051 -0.03063 -0.01165 0.08616  752  GLU A C     
1856 O  O     . GLU B 57  ? 0.55219 0.52295 0.59661 -0.03337 -0.00376 0.08854  752  GLU A O     
1857 C  CB    . GLU B 57  ? 0.37299 0.36688 0.43043 -0.04696 -0.01300 0.08082  752  GLU A CB    
1858 C  CG    . GLU B 57  ? 0.61560 0.62550 0.68093 -0.05151 -0.01824 0.07798  752  GLU A CG    
1859 C  CD    . GLU B 57  ? 0.78909 0.80240 0.84919 -0.06397 -0.01424 0.07722  752  GLU A CD    
1860 O  OE1   . GLU B 57  ? 0.82269 0.83601 0.87562 -0.06862 -0.00953 0.07767  752  GLU A OE1   
1861 O  OE2   . GLU B 57  ? 0.85971 0.87719 0.92237 -0.06997 -0.01581 0.07602  752  GLU A OE2   
1862 N  N     . ASN B 58  ? 0.42783 0.42198 0.48612 -0.02237 -0.01451 0.08771  753  ASN A N     
1863 C  CA    . ASN B 58  ? 0.50495 0.49510 0.55689 -0.01437 -0.00942 0.09319  753  ASN A CA    
1864 C  C     . ASN B 58  ? 0.55222 0.53276 0.59387 -0.01360 -0.00106 0.09607  753  ASN A C     
1865 O  O     . ASN B 58  ? 0.64402 0.61167 0.67471 -0.00881 0.00742  0.10120  753  ASN A O     
1866 C  CB    . ASN B 58  ? 0.52075 0.50145 0.56865 -0.01227 -0.00628 0.09626  753  ASN A CB    
1867 C  CG    . ASN B 58  ? 0.48850 0.48195 0.54451 -0.00903 -0.01351 0.09549  753  ASN A CG    
1868 O  OD1   . ASN B 58  ? 0.43326 0.44168 0.49458 -0.00665 -0.01885 0.09420  753  ASN A OD1   
1869 N  ND2   . ASN B 58  ? 0.48509 0.47194 0.54070 -0.01021 -0.01334 0.09588  753  ASN A ND2   
1870 N  N     . ALA B 59  ? 0.40354 0.38959 0.44722 -0.01759 -0.00261 0.09315  754  ALA A N     
1871 C  CA    . ALA B 59  ? 0.43943 0.41920 0.47409 -0.01589 0.00424  0.09551  754  ALA A CA    
1872 C  C     . ALA B 59  ? 0.47375 0.46215 0.50980 -0.00471 0.00383  0.09972  754  ALA A C     
1873 O  O     . ALA B 59  ? 0.44694 0.45113 0.49275 -0.00160 -0.00374 0.09868  754  ALA A O     
1874 C  CB    . ALA B 59  ? 0.41151 0.39843 0.44907 -0.02298 0.00186  0.09139  754  ALA A CB    
1875 N  N     . GLN B 60  ? 0.61616 0.59410 0.64067 0.00089  0.01279  0.10460  755  GLN A N     
1876 C  CA    . GLN B 60  ? 0.56945 0.55767 0.59425 0.01239  0.01354  0.10997  755  GLN A CA    
1877 C  C     . GLN B 60  ? 0.63437 0.62454 0.65690 0.01337  0.01538  0.10971  755  GLN A C     
1878 O  O     . GLN B 60  ? 0.72568 0.70249 0.74025 0.00709  0.02049  0.10749  755  GLN A O     
1879 C  CB    . GLN B 60  ? 0.53721 0.51378 0.54981 0.02203  0.02334  0.11786  755  GLN A CB    
1880 C  CG    . GLN B 60  ? 0.63641 0.61992 0.65422 0.02483  0.01973  0.11972  755  GLN A CG    
1881 C  CD    . GLN B 60  ? 0.67293 0.64563 0.67777 0.03608  0.03035  0.12871  755  GLN A CD    
1882 O  OE1   . GLN B 60  ? 0.74771 0.69509 0.73879 0.03419  0.03984  0.13005  755  GLN A OE1   
1883 N  NE2   . GLN B 60  ? 0.61148 0.60360 0.61886 0.04797  0.02984  0.13551  755  GLN A NE2   
1884 N  N     . MET B 61  ? 0.52994 0.53783 0.55885 0.02017  0.01127  0.11180  756  MET A N     
1885 C  CA    . MET B 61  ? 0.49322 0.50610 0.52287 0.02045  0.01086  0.11068  756  MET A CA    
1886 C  C     . MET B 61  ? 0.53902 0.57117 0.57283 0.02929  0.00843  0.11502  756  MET A C     
1887 O  O     . MET B 61  ? 0.49841 0.54641 0.53958 0.02982  0.00218  0.11501  756  MET A O     
1888 C  CB    . MET B 61  ? 0.40793 0.42682 0.44675 0.01090  0.00303  0.10331  756  MET A CB    
1889 C  CG    . MET B 61  ? 0.48242 0.49741 0.51798 0.00785  0.00546  0.10142  756  MET A CG    
1890 S  SD    . MET B 61  ? 0.59963 0.59086 0.61973 0.00107  0.01604  0.10113  756  MET A SD    
1891 C  CE    . MET B 61  ? 0.57488 0.56634 0.59105 -0.00032 0.01856  0.09978  756  MET A CE    
1892 N  N     . ALA B 62  ? 0.54679 0.57846 0.57492 0.03530  0.01364  0.11862  757  ALA A N     
1893 C  CA    . ALA B 62  ? 0.52218 0.57605 0.55536 0.04175  0.01036  0.12209  757  ALA A CA    
1894 C  C     . ALA B 62  ? 0.43163 0.49809 0.47543 0.03344  0.00057  0.11522  757  ALA A C     
1895 O  O     . ALA B 62  ? 0.43214 0.48965 0.47840 0.02558  -0.00210 0.10913  757  ALA A O     
1896 C  CB    . ALA B 62  ? 0.48335 0.53390 0.50781 0.05069  0.01847  0.12776  757  ALA A CB    
1897 N  N     . ILE B 63  ? 0.35508 0.44304 0.40376 0.03491  -0.00417 0.11652  758  ILE A N     
1898 C  CA    . ILE B 63  ? 0.38152 0.47893 0.43677 0.02648  -0.01227 0.11015  758  ILE A CA    
1899 C  C     . ILE B 63  ? 0.52822 0.63734 0.58394 0.02755  -0.01300 0.11086  758  ILE A C     
1900 O  O     . ILE B 63  ? 0.57437 0.69882 0.62839 0.03402  -0.01072 0.11693  758  ILE A O     
1901 C  CB    . ILE B 63  ? 0.35071 0.46162 0.40855 0.02309  -0.01719 0.10931  758  ILE A CB    
1902 C  CG1   . ILE B 63  ? 0.38661 0.48631 0.44392 0.02332  -0.01593 0.10959  758  ILE A CG1   
1903 C  CG2   . ILE B 63  ? 0.38588 0.49810 0.44602 0.01352  -0.02336 0.10187  758  ILE A CG2   
1904 C  CD1   . ILE B 63  ? 0.35874 0.43981 0.41760 0.01685  -0.01724 0.10342  758  ILE A CD1   
1905 N  N     . PRO B 64  ? 0.65428 0.75794 0.71195 0.02193  -0.01578 0.10539  759  PRO A N     
1906 C  CA    . PRO B 64  ? 0.63815 0.75100 0.69577 0.02252  -0.01615 0.10584  759  PRO A CA    
1907 C  C     . PRO B 64  ? 0.61035 0.74593 0.66788 0.02147  -0.01872 0.10801  759  PRO A C     
1908 O  O     . PRO B 64  ? 0.60828 0.75728 0.66466 0.02735  -0.01610 0.11354  759  PRO A O     
1909 C  CB    . PRO B 64  ? 0.61534 0.71884 0.67463 0.01565  -0.01948 0.09913  759  PRO A CB    
1910 C  CG    . PRO B 64  ? 0.64516 0.73363 0.70510 0.01449  -0.01843 0.09715  759  PRO A CG    
1911 C  CD    . PRO B 64  ? 0.66431 0.75414 0.72389 0.01573  -0.01812 0.09934  759  PRO A CD    
1912 N  N     . SER B 65  ? 0.59052 0.73107 0.64791 0.01336  -0.02330 0.10367  760  SER A N     
1913 C  CA    . SER B 65  ? 0.59185 0.75520 0.64690 0.00869  -0.02567 0.10460  760  SER A CA    
1914 C  C     . SER B 65  ? 0.65795 0.84193 0.71354 0.01650  -0.02337 0.11298  760  SER A C     
1915 O  O     . SER B 65  ? 0.70336 0.91181 0.75775 0.01680  -0.02340 0.11706  760  SER A O     
1916 C  CB    . SER B 65  ? 0.54792 0.70854 0.59963 -0.00182 -0.02945 0.09825  760  SER A CB    
1917 O  OG    . SER B 65  ? 0.65125 0.80433 0.69777 -0.01016 -0.03061 0.09220  760  SER A OG    
1918 N  N     . ARG B 66  ? 0.56933 0.74490 0.62585 0.02315  -0.02081 0.11623  761  ARG A N     
1919 C  CA    . ARG B 66  ? 0.53533 0.72849 0.59083 0.03294  -0.01720 0.12541  761  ARG A CA    
1920 C  C     . ARG B 66  ? 0.53764 0.73098 0.59067 0.04557  -0.01031 0.13313  761  ARG A C     
1921 O  O     . ARG B 66  ? 0.61740 0.82793 0.66807 0.05610  -0.00599 0.14241  761  ARG A O     
1922 C  CB    . ARG B 66  ? 0.55777 0.73874 0.61312 0.03555  -0.01590 0.12619  761  ARG A CB    
1923 C  CG    . ARG B 66  ? 0.60948 0.80620 0.66578 0.02785  -0.02111 0.12392  761  ARG A CG    
1924 C  CD    . ARG B 66  ? 0.70567 0.89344 0.76193 0.03223  -0.01930 0.12629  761  ARG A CD    
1925 N  NE    . ARG B 66  ? 0.74285 0.94343 0.79976 0.02376  -0.02457 0.12301  761  ARG A NE    
1926 C  CZ    . ARG B 66  ? 0.80017 0.98748 0.85732 0.01226  -0.02933 0.11369  761  ARG A CZ    
1927 N  NH1   . ARG B 66  ? 0.78732 0.95128 0.84518 0.00900  -0.02966 0.10769  761  ARG A NH1   
1928 N  NH2   . ARG B 66  ? 0.84565 1.04372 0.90129 0.00443  -0.03320 0.11075  761  ARG A NH2   
1929 N  N     . VAL B 67  ? 0.49396 0.66924 0.54644 0.04543  -0.00858 0.13001  762  VAL A N     
1930 C  CA    . VAL B 67  ? 0.46631 0.64061 0.51479 0.05630  -0.00177 0.13646  762  VAL A CA    
1931 C  C     . VAL B 67  ? 0.47837 0.67511 0.52914 0.05366  -0.00480 0.13687  762  VAL A C     
1932 O  O     . VAL B 67  ? 0.51386 0.72485 0.56214 0.06355  -0.00017 0.14466  762  VAL A O     
1933 C  CB    . VAL B 67  ? 0.45280 0.59559 0.49777 0.05659  0.00246  0.13283  762  VAL A CB    
1934 C  CG1   . VAL B 67  ? 0.39648 0.53568 0.43541 0.06628  0.00981  0.13824  762  VAL A CG1   
1935 C  CG2   . VAL B 67  ? 0.50021 0.62250 0.54061 0.05863  0.00683  0.13335  762  VAL A CG2   
1936 N  N     . LEU B 68  ? 0.40650 0.60626 0.46049 0.04054  -0.01172 0.12892  763  LEU A N     
1937 C  CA    . LEU B 68  ? 0.41684 0.63321 0.47122 0.03549  -0.01418 0.12792  763  LEU A CA    
1938 C  C     . LEU B 68  ? 0.50107 0.75123 0.55477 0.02985  -0.01739 0.13041  763  LEU A C     
1939 O  O     . LEU B 68  ? 0.50362 0.77273 0.55644 0.02625  -0.01833 0.13139  763  LEU A O     
1940 C  CB    . LEU B 68  ? 0.47944 0.67705 0.53426 0.02449  -0.01803 0.11822  763  LEU A CB    
1941 C  CG    . LEU B 68  ? 0.51441 0.68479 0.56995 0.02858  -0.01522 0.11590  763  LEU A CG    
1942 C  CD1   . LEU B 68  ? 0.49721 0.65312 0.55308 0.01943  -0.01868 0.10776  763  LEU A CD1   
1943 C  CD2   . LEU B 68  ? 0.40462 0.57692 0.45872 0.03840  -0.00996 0.12167  763  LEU A CD2   
1944 N  N     . ARG B 69  ? 0.80600 1.06562 0.85946 0.02799  -0.01897 0.13139  764  ARG A N     
1945 C  CA    . ARG B 69  ? 0.84538 1.14085 0.89711 0.02156  -0.02174 0.13408  764  ARG A CA    
1946 C  C     . ARG B 69  ? 0.70866 1.03246 0.76113 0.03588  -0.01751 0.14666  764  ARG A C     
1947 O  O     . ARG B 69  ? 0.72546 1.08442 0.77721 0.03604  -0.01752 0.15249  764  ARG A O     
1948 C  CB    . ARG B 69  ? 0.88713 1.17865 0.93647 0.00848  -0.02630 0.12675  764  ARG A CB    
1949 C  CG    . ARG B 69  ? 0.97722 1.24812 1.02194 -0.00679 -0.02952 0.11535  764  ARG A CG    
1950 C  CD    . ARG B 69  ? 1.08285 1.35352 1.12601 -0.00926 -0.02875 0.11407  764  ARG A CD    
1951 N  NE    . ARG B 69  ? 1.13957 1.44334 1.17790 -0.01820 -0.02973 0.11591  764  ARG A NE    
1952 C  CZ    . ARG B 69  ? 1.15559 1.46054 1.18441 -0.03531 -0.03131 0.10870  764  ARG A CZ    
1953 N  NH1   . ARG B 69  ? 1.14309 1.41598 1.16565 -0.04361 -0.03154 0.09953  764  ARG A NH1   
1954 N  NH2   . ARG B 69  ? 1.17981 1.51843 1.20375 -0.04401 -0.03171 0.11118  764  ARG A NH2   
1955 N  N     . LYS B 70  ? 0.34688 0.65717 0.39960 0.04795  -0.01330 0.15147  765  LYS A N     
1956 C  CA    . LYS B 70  ? 0.33483 0.65901 0.38556 0.06688  -0.00580 0.16459  765  LYS A CA    
1957 C  C     . LYS B 70  ? 0.43873 0.72530 0.48618 0.07790  0.00132  0.16538  765  LYS A C     
1958 O  O     . LYS B 70  ? 0.60691 0.86285 0.65537 0.06990  -0.00079 0.15603  765  LYS A O     
1959 C  CB    . LYS B 70  ? 0.35731 0.69619 0.40745 0.07140  -0.00518 0.17014  765  LYS A CB    
1960 C  CG    . LYS B 70  ? 0.38938 0.75356 0.44137 0.05413  -0.01350 0.16437  765  LYS A CG    
1961 C  CD    . LYS B 70  ? 0.51879 0.92582 0.57017 0.06012  -0.01264 0.17481  765  LYS A CD    
1962 C  CE    . LYS B 70  ? 0.63701 1.07379 0.68763 0.03980  -0.02044 0.16856  765  LYS A CE    
1963 N  NZ    . LYS B 70  ? 0.70801 1.15374 0.75830 0.03705  -0.02257 0.16887  765  LYS A NZ    
1964 N  N     . TRP B 71  ? 0.51394 0.80251 0.55565 0.09617  0.01067  0.17677  766  TRP A N     
1965 C  CA    . TRP B 71  ? 0.59850 0.84970 0.63309 0.10522  0.01913  0.17729  766  TRP A CA    
1966 C  C     . TRP B 71  ? 0.55268 0.77513 0.58179 0.10860  0.02386  0.17710  766  TRP A C     
1967 O  O     . TRP B 71  ? 0.48139 0.68694 0.49954 0.12301  0.03501  0.18494  766  TRP A O     
1968 C  CB    . TRP B 71  ? 0.57511 0.83738 0.60247 0.12315  0.02875  0.18928  766  TRP A CB    
1969 C  CG    . TRP B 71  ? 0.53315 0.76077 0.55173 0.12938  0.03707  0.18848  766  TRP A CG    
1970 C  CD1   . TRP B 71  ? 0.57595 0.78509 0.58019 0.14696  0.05079  0.19777  766  TRP A CD1   
1971 C  CD2   . TRP B 71  ? 0.57734 0.78505 0.59878 0.11812  0.03318  0.17821  766  TRP A CD2   
1972 N  NE1   . TRP B 71  ? 0.62920 0.80775 0.62660 0.14583  0.05556  0.19317  766  TRP A NE1   
1973 C  CE2   . TRP B 71  ? 0.61189 0.79071 0.62079 0.12837  0.04440  0.18131  766  TRP A CE2   
1974 C  CE3   . TRP B 71  ? 0.57037 0.78060 0.60193 0.10078  0.02229  0.16704  766  TRP A CE3   
1975 C  CZ2   . TRP B 71  ? 0.57575 0.73170 0.58365 0.12091  0.04394  0.17334  766  TRP A CZ2   
1976 C  CZ3   . TRP B 71  ? 0.52793 0.71530 0.55888 0.09524  0.02217  0.16002  766  TRP A CZ3   
1977 C  CH2   . TRP B 71  ? 0.56538 0.72778 0.58547 0.10485  0.03235  0.16310  766  TRP A CH2   
1978 N  N     . ASP B 72  ? 0.56570 0.78036 0.60099 0.09443  0.01590  0.16763  767  ASP A N     
1979 C  CA    . ASP B 72  ? 0.59211 0.79102 0.62494 0.09510  0.01767  0.16751  767  ASP A CA    
1980 C  C     . ASP B 72  ? 0.54469 0.70336 0.57447 0.08844  0.01934  0.15925  767  ASP A C     
1981 O  O     . ASP B 72  ? 0.46343 0.61490 0.50008 0.07448  0.01143  0.14893  767  ASP A O     
1982 C  CB    . ASP B 72  ? 0.58274 0.80301 0.62366 0.08393  0.00801  0.16313  767  ASP A CB    
1983 C  CG    . ASP B 72  ? 0.58342 0.78936 0.62253 0.08476  0.00939  0.16320  767  ASP A CG    
1984 O  OD1   . ASP B 72  ? 0.60830 0.79388 0.63859 0.09641  0.01908  0.16939  767  ASP A OD1   
1985 O  OD2   . ASP B 72  ? 0.55051 0.76370 0.59545 0.07328  0.00144  0.15684  767  ASP A OD2   
1986 N  N     . PHE B 73  ? 0.54236 0.67558 0.56007 0.09841  0.03051  0.16431  768  PHE A N     
1987 C  CA    . PHE B 73  ? 0.52300 0.61944 0.53440 0.09192  0.03425  0.15774  768  PHE A CA    
1988 C  C     . PHE B 73  ? 0.61853 0.69791 0.62652 0.08927  0.03606  0.15658  768  PHE A C     
1989 O  O     . PHE B 73  ? 0.66401 0.71398 0.66510 0.08298  0.04006  0.15168  768  PHE A O     
1990 C  CB    . PHE B 73  ? 0.49993 0.57512 0.49598 0.10209  0.04707  0.16305  768  PHE A CB    
1991 C  CG    . PHE B 73  ? 0.60930 0.69242 0.60866 0.10093  0.04483  0.16104  768  PHE A CG    
1992 C  CD1   . PHE B 73  ? 0.61028 0.72404 0.61407 0.10945  0.04334  0.16777  768  PHE A CD1   
1993 C  CD2   . PHE B 73  ? 0.62453 0.68676 0.62262 0.09077  0.04411  0.15259  768  PHE A CD2   
1994 C  CE1   . PHE B 73  ? 0.56883 0.68946 0.57561 0.10792  0.04128  0.16579  768  PHE A CE1   
1995 C  CE2   . PHE B 73  ? 0.54512 0.61426 0.54627 0.08985  0.04205  0.15077  768  PHE A CE2   
1996 C  CZ    . PHE B 73  ? 0.54617 0.64318 0.55169 0.09841  0.04063  0.15718  768  PHE A CZ    
1997 N  N     . SER B 74  ? 0.63159 0.72993 0.64373 0.09299  0.03331  0.16092  769  SER A N     
1998 C  CA    . SER B 74  ? 0.62094 0.70332 0.62963 0.09134  0.03537  0.16045  769  SER A CA    
1999 C  C     . SER B 74  ? 0.55757 0.63016 0.57543 0.07420  0.02591  0.14828  769  SER A C     
2000 O  O     . SER B 74  ? 0.48934 0.57745 0.51843 0.06512  0.01584  0.14170  769  SER A O     
2001 C  CB    . SER B 74  ? 0.60509 0.71379 0.61698 0.09918  0.03385  0.16799  769  SER A CB    
2002 O  OG    . SER B 74  ? 0.60789 0.75231 0.63206 0.09417  0.02340  0.16622  769  SER A OG    
2003 N  N     . LYS B 75  ? 0.70929 0.75530 0.72058 0.07010  0.03026  0.14575  770  LYS A N     
2004 C  CA    . LYS B 75  ? 0.69194 0.72781 0.71022 0.05516  0.02303  0.13535  770  LYS A CA    
2005 C  C     . LYS B 75  ? 0.67479 0.72623 0.70393 0.05017  0.01368  0.13234  770  LYS A C     
2006 O  O     . LYS B 75  ? 0.68722 0.74800 0.71521 0.05706  0.01514  0.13820  770  LYS A O     
2007 C  CB    . LYS B 75  ? 0.68324 0.68703 0.68908 0.05117  0.03173  0.13395  770  LYS A CB    
2008 C  CG    . LYS B 75  ? 0.72525 0.70917 0.71437 0.05723  0.04435  0.13828  770  LYS A CG    
2009 C  CD    . LYS B 75  ? 0.81485 0.77237 0.79468 0.04494  0.04889  0.13181  770  LYS A CD    
2010 C  CE    . LYS B 75  ? 0.87344 0.81969 0.84234 0.04596  0.05619  0.13211  770  LYS A CE    
2011 N  NZ    . LYS B 75  ? 0.88557 0.84682 0.86809 0.03692  0.04591  0.12472  770  LYS A NZ    
2012 N  N     . TYR B 76  ? 0.58156 0.63590 0.62013 0.03866  0.00464  0.12347  771  TYR A N     
2013 C  CA    . TYR B 76  ? 0.49207 0.55814 0.53918 0.03240  -0.00401 0.11911  771  TYR A CA    
2014 C  C     . TYR B 76  ? 0.53810 0.58810 0.58798 0.02231  -0.00706 0.11154  771  TYR A C     
2015 O  O     . TYR B 76  ? 0.59554 0.63289 0.64328 0.01841  -0.00484 0.10868  771  TYR A O     
2016 C  CB    . TYR B 76  ? 0.50889 0.59722 0.56251 0.02907  -0.01140 0.11631  771  TYR A CB    
2017 C  CG    . TYR B 76  ? 0.56997 0.68175 0.62217 0.03728  -0.00986 0.12383  771  TYR A CG    
2018 C  CD1   . TYR B 76  ? 0.64548 0.76256 0.69444 0.04426  -0.00542 0.12861  771  TYR A CD1   
2019 C  CD2   . TYR B 76  ? 0.54196 0.67312 0.59588 0.03783  -0.01285 0.12638  771  TYR A CD2   
2020 C  CE1   . TYR B 76  ? 0.70658 0.84919 0.75444 0.05244  -0.00384 0.13646  771  TYR A CE1   
2021 C  CE2   . TYR B 76  ? 0.62159 0.77995 0.67433 0.04505  -0.01153 0.13406  771  TYR A CE2   
2022 C  CZ    . TYR B 76  ? 0.70780 0.87276 0.75775 0.05270  -0.00702 0.13940  771  TYR A CZ    
2023 O  OH    . TYR B 76  ? 0.71410 0.91021 0.76315 0.06031  -0.00569 0.14787  771  TYR A OH    
2024 N  N     . TYR B 77  ? 0.50237 0.55476 0.55660 0.01807  -0.01194 0.10865  772  TYR A N     
2025 C  CA    . TYR B 77  ? 0.41742 0.45712 0.47440 0.00957  -0.01466 0.10239  772  TYR A CA    
2026 C  C     . TYR B 77  ? 0.47890 0.52291 0.54091 0.00379  -0.02008 0.09629  772  TYR A C     
2027 O  O     . TYR B 77  ? 0.55273 0.60881 0.61779 0.00237  -0.02526 0.09384  772  TYR A O     
2028 C  CB    . TYR B 77  ? 0.48106 0.52302 0.54115 0.00729  -0.01856 0.10094  772  TYR A CB    
2029 C  CG    . TYR B 77  ? 0.48609 0.51915 0.54066 0.01219  -0.01260 0.10651  772  TYR A CG    
2030 C  CD1   . TYR B 77  ? 0.54115 0.55441 0.58713 0.01315  -0.00409 0.10915  772  TYR A CD1   
2031 C  CD2   . TYR B 77  ? 0.46983 0.51347 0.52576 0.01537  -0.01457 0.10920  772  TYR A CD2   
2032 C  CE1   . TYR B 77  ? 0.57137 0.57270 0.60928 0.01797  0.00299  0.11457  772  TYR A CE1   
2033 C  CE2   . TYR B 77  ? 0.56096 0.59598 0.61100 0.02118  -0.00840 0.11510  772  TYR A CE2   
2034 C  CZ    . TYR B 77  ? 0.57333 0.58575 0.61388 0.02290  0.00074  0.11791  772  TYR A CZ    
2035 O  OH    . TYR B 77  ? 0.62097 0.62123 0.65282 0.02899  0.00841  0.12409  772  TYR A OH    
2036 N  N     . VAL B 78  ? 0.38509 0.41930 0.44616 0.00010  -0.01807 0.09408  773  VAL A N     
2037 C  CA    . VAL B 78  ? 0.35127 0.38965 0.41632 -0.00375 -0.02212 0.08949  773  VAL A CA    
2038 C  C     . VAL B 78  ? 0.35357 0.38611 0.42092 -0.00982 -0.02351 0.08584  773  VAL A C     
2039 O  O     . VAL B 78  ? 0.41030 0.43373 0.47473 -0.01307 -0.01983 0.08660  773  VAL A O     
2040 C  CB    . VAL B 78  ? 0.30000 0.33883 0.36255 -0.00196 -0.01893 0.09085  773  VAL A CB    
2041 C  CG1   . VAL B 78  ? 0.29455 0.34164 0.35519 0.00450  -0.01759 0.09491  773  VAL A CG1   
2042 C  CG2   . VAL B 78  ? 0.30545 0.33154 0.36184 -0.00452 -0.01238 0.09214  773  VAL A CG2   
2043 N  N     . SER B 79  ? 0.25742 0.29533 0.32848 -0.01132 -0.02806 0.08219  774  SER A N     
2044 C  CA    . SER B 79  ? 0.24111 0.27846 0.31457 -0.01519 -0.02916 0.07977  774  SER A CA    
2045 C  C     . SER B 79  ? 0.32943 0.36695 0.40126 -0.01825 -0.02547 0.08083  774  SER A C     
2046 O  O     . SER B 79  ? 0.38924 0.42712 0.45837 -0.01653 -0.02289 0.08239  774  SER A O     
2047 C  CB    . SER B 79  ? 0.28096 0.32300 0.35561 -0.01342 -0.03263 0.07708  774  SER A CB    
2048 O  OG    . SER B 79  ? 0.36705 0.41389 0.44116 -0.01154 -0.03168 0.07755  774  SER A OG    
2049 N  N     . ASN B 80  ? 0.56783 0.60637 0.64067 -0.02367 -0.02514 0.07984  775  ASN A N     
2050 C  CA    . ASN B 80  ? 0.52667 0.56878 0.59687 -0.02939 -0.02176 0.08023  775  ASN A CA    
2051 C  C     . ASN B 80  ? 0.50165 0.55380 0.57349 -0.02623 -0.02276 0.08039  775  ASN A C     
2052 O  O     . ASN B 80  ? 0.57779 0.62960 0.64553 -0.02845 -0.01927 0.08117  775  ASN A O     
2053 C  CB    . ASN B 80  ? 0.54682 0.59500 0.61900 -0.03596 -0.02248 0.07920  775  ASN A CB    
2054 C  CG    . ASN B 80  ? 0.56475 0.60174 0.63079 -0.04391 -0.01802 0.07928  775  ASN A CG    
2055 O  OD1   . ASN B 80  ? 0.61931 0.64196 0.67910 -0.04259 -0.01399 0.08061  775  ASN A OD1   
2056 N  ND2   . ASN B 80  ? 0.53771 0.58136 0.60413 -0.05200 -0.01787 0.07841  775  ASN A ND2   
2057 N  N     . PHE B 81  ? 0.38076 0.44001 0.45683 -0.02092 -0.02664 0.07970  776  PHE A N     
2058 C  CA    . PHE B 81  ? 0.33708 0.40399 0.41353 -0.01670 -0.02698 0.08030  776  PHE A CA    
2059 C  C     . PHE B 81  ? 0.40772 0.46937 0.48151 -0.01427 -0.02561 0.08083  776  PHE A C     
2060 O  O     . PHE B 81  ? 0.45828 0.52458 0.53112 -0.01408 -0.02410 0.08159  776  PHE A O     
2061 C  CB    . PHE B 81  ? 0.40852 0.47740 0.48580 -0.01037 -0.02946 0.07973  776  PHE A CB    
2062 C  CG    . PHE B 81  ? 0.49033 0.56115 0.56537 -0.00487 -0.02899 0.08029  776  PHE A CG    
2063 C  CD1   . PHE B 81  ? 0.49636 0.57834 0.57189 -0.00182 -0.02791 0.08235  776  PHE A CD1   
2064 C  CD2   . PHE B 81  ? 0.49244 0.55560 0.56432 -0.00291 -0.02933 0.07919  776  PHE A CD2   
2065 C  CE1   . PHE B 81  ? 0.41603 0.49812 0.48855 0.00358  -0.02685 0.08316  776  PHE A CE1   
2066 C  CE2   . PHE B 81  ? 0.45054 0.51422 0.51923 0.00101  -0.02842 0.07951  776  PHE A CE2   
2067 C  CZ    . PHE B 81  ? 0.43838 0.50977 0.50715 0.00458  -0.02701 0.08143  776  PHE A CZ    
2068 N  N     . SER B 82  ? 0.35645 0.41072 0.42908 -0.01210 -0.02616 0.08080  777  SER A N     
2069 C  CA    . SER B 82  ? 0.39812 0.45090 0.46837 -0.00907 -0.02470 0.08220  777  SER A CA    
2070 C  C     . SER B 82  ? 0.37217 0.41940 0.43802 -0.01115 -0.01956 0.08426  777  SER A C     
2071 O  O     . SER B 82  ? 0.34071 0.38837 0.40416 -0.00922 -0.01735 0.08544  777  SER A O     
2072 C  CB    . SER B 82  ? 0.38045 0.43204 0.45013 -0.00633 -0.02649 0.08242  777  SER A CB    
2073 O  OG    . SER B 82  ? 0.31157 0.36484 0.38126 -0.00584 -0.02987 0.07983  777  SER A OG    
2074 N  N     . LYS B 83  ? 0.42057 0.46021 0.48331 -0.01511 -0.01663 0.08476  778  LYS A N     
2075 C  CA    . LYS B 83  ? 0.41056 0.44023 0.46455 -0.01768 -0.00959 0.08655  778  LYS A CA    
2076 C  C     . LYS B 83  ? 0.47350 0.50778 0.52551 -0.02302 -0.00798 0.08510  778  LYS A C     
2077 O  O     . LYS B 83  ? 0.42437 0.45436 0.47047 -0.02229 -0.00375 0.08611  778  LYS A O     
2078 C  CB    . LYS B 83  ? 0.40467 0.42255 0.45276 -0.02249 -0.00542 0.08704  778  LYS A CB    
2079 C  CG    . LYS B 83  ? 0.45959 0.46221 0.49379 -0.02677 0.00411  0.08844  778  LYS A CG    
2080 C  CD    . LYS B 83  ? 0.53782 0.52645 0.56378 -0.03331 0.00922  0.08851  778  LYS A CD    
2081 C  CE    . LYS B 83  ? 0.57075 0.53892 0.57776 -0.03901 0.02101  0.08955  778  LYS A CE    
2082 N  NZ    . LYS B 83  ? 0.58346 0.53531 0.57975 -0.02874 0.02888  0.09475  778  LYS A NZ    
2083 N  N     . ASP B 84  ? 0.67235 0.71736 0.72919 -0.02778 -0.01130 0.08312  779  ASP A N     
2084 C  CA    . ASP B 84  ? 0.64853 0.70406 0.70458 -0.03291 -0.01053 0.08227  779  ASP A CA    
2085 C  C     . ASP B 84  ? 0.62787 0.68879 0.68635 -0.02664 -0.01204 0.08283  779  ASP A C     
2086 O  O     . ASP B 84  ? 0.63944 0.70105 0.69306 -0.02993 -0.00872 0.08271  779  ASP A O     
2087 C  CB    . ASP B 84  ? 0.64484 0.71592 0.70723 -0.03560 -0.01446 0.08162  779  ASP A CB    
2088 C  CG    . ASP B 84  ? 0.81767 0.88755 0.87584 -0.04598 -0.01179 0.08078  779  ASP A CG    
2089 O  OD1   . ASP B 84  ? 0.88378 0.96873 0.94687 -0.04855 -0.01458 0.08083  779  ASP A OD1   
2090 O  OD2   . ASP B 84  ? 0.87574 0.92934 0.92441 -0.05131 -0.00614 0.08046  779  ASP A OD2   
2091 N  N     . LEU B 85  ? 0.49647 0.56017 0.56089 -0.01865 -0.01648 0.08313  780  LEU A N     
2092 C  CA    . LEU B 85  ? 0.51408 0.58315 0.58022 -0.01366 -0.01783 0.08347  780  LEU A CA    
2093 C  C     . LEU B 85  ? 0.56733 0.62841 0.62930 -0.01113 -0.01490 0.08457  780  LEU A C     
2094 O  O     . LEU B 85  ? 0.60996 0.67328 0.67023 -0.01083 -0.01336 0.08476  780  LEU A O     
2095 C  CB    . LEU B 85  ? 0.48743 0.55950 0.55757 -0.00765 -0.02200 0.08309  780  LEU A CB    
2096 C  CG    . LEU B 85  ? 0.54463 0.61982 0.61459 -0.00300 -0.02258 0.08340  780  LEU A CG    
2097 C  CD1   . LEU B 85  ? 0.67792 0.76055 0.74901 0.00041  -0.02372 0.08382  780  LEU A CD1   
2098 C  CD2   . LEU B 85  ? 0.47332 0.54271 0.54178 0.00015  -0.02373 0.08301  780  LEU A CD2   
2099 N  N     . LEU B 86  ? 0.63631 0.68930 0.69624 -0.00874 -0.01370 0.08585  781  LEU A N     
2100 C  CA    . LEU B 86  ? 0.68649 0.73362 0.74143 -0.00477 -0.00975 0.08831  781  LEU A CA    
2101 C  C     . LEU B 86  ? 0.67050 0.70880 0.71647 -0.00907 -0.00297 0.08858  781  LEU A C     
2102 O  O     . LEU B 86  ? 0.74197 0.77806 0.78402 -0.00640 0.00004  0.08970  781  LEU A O     
2103 C  CB    . LEU B 86  ? 0.64344 0.68631 0.69697 -0.00061 -0.00881 0.09090  781  LEU A CB    
2104 C  CG    . LEU B 86  ? 0.63871 0.69124 0.69773 0.00345  -0.01411 0.09105  781  LEU A CG    
2105 C  CD1   . LEU B 86  ? 0.68879 0.74719 0.75281 0.00097  -0.01942 0.08737  781  LEU A CD1   
2106 C  CD2   . LEU B 86  ? 0.66105 0.71257 0.71973 0.00514  -0.01423 0.09289  781  LEU A CD2   
2107 N  N     . ILE B 87  ? 0.47029 0.50288 0.51136 -0.01677 0.00007  0.08730  782  ILE A N     
2108 C  CA    . ILE B 87  ? 0.47597 0.49808 0.50470 -0.02361 0.00780  0.08675  782  ILE A CA    
2109 C  C     . ILE B 87  ? 0.56414 0.59735 0.59496 -0.02702 0.00609  0.08478  782  ILE A C     
2110 O  O     . ILE B 87  ? 0.62125 0.64746 0.64341 -0.02841 0.01138  0.08473  782  ILE A O     
2111 C  CB    . ILE B 87  ? 0.44361 0.45830 0.46519 -0.03368 0.01159  0.08528  782  ILE A CB    
2112 C  CG1   . ILE B 87  ? 0.39777 0.39520 0.41199 -0.02984 0.01673  0.08805  782  ILE A CG1   
2113 C  CG2   . ILE B 87  ? 0.51013 0.51947 0.51880 -0.04522 0.01840  0.08303  782  ILE A CG2   
2114 C  CD1   . ILE B 87  ? 0.38615 0.37381 0.39225 -0.04018 0.02094  0.08659  782  ILE A CD1   
2115 N  N     . LYS B 88  ? 0.67962 0.72999 0.72123 -0.02708 -0.00083 0.08362  783  LYS A N     
2116 C  CA    . LYS B 88  ? 0.60878 0.67233 0.65287 -0.02901 -0.00251 0.08267  783  LYS A CA    
2117 C  C     . LYS B 88  ? 0.68008 0.74127 0.72473 -0.02185 -0.00252 0.08360  783  LYS A C     
2118 O  O     . LYS B 88  ? 0.78065 0.84131 0.81979 -0.02514 0.00076  0.08286  783  LYS A O     
2119 C  CB    . LYS B 88  ? 0.54183 0.62282 0.59609 -0.02693 -0.00876 0.08282  783  LYS A CB    
2120 C  CG    . LYS B 88  ? 0.69218 0.78924 0.74894 -0.02725 -0.01010 0.08308  783  LYS A CG    
2121 C  CD    . LYS B 88  ? 0.76766 0.88363 0.83070 -0.02659 -0.01358 0.08439  783  LYS A CD    
2122 C  CE    . LYS B 88  ? 0.78010 0.89861 0.84928 -0.01489 -0.01734 0.08614  783  LYS A CE    
2123 N  NZ    . LYS B 88  ? 0.79112 0.91831 0.86403 -0.01205 -0.01944 0.08761  783  LYS A NZ    
2124 N  N     . ILE B 89  ? 0.61608 0.67607 0.66622 -0.01313 -0.00581 0.08505  784  ILE A N     
2125 C  CA    . ILE B 89  ? 0.57096 0.63217 0.62270 -0.00692 -0.00670 0.08597  784  ILE A CA    
2126 C  C     . ILE B 89  ? 0.57567 0.62533 0.62010 -0.00358 -0.00132 0.08808  784  ILE A C     
2127 O  O     . ILE B 89  ? 0.57897 0.63095 0.62548 0.00271  -0.00240 0.08974  784  ILE A O     
2128 C  CB    . ILE B 89  ? 0.49381 0.56104 0.55275 -0.00107 -0.01221 0.08629  784  ILE A CB    
2129 C  CG1   . ILE B 89  ? 0.48137 0.54425 0.54062 0.00051  -0.01290 0.08720  784  ILE A CG1   
2130 C  CG2   . ILE B 89  ? 0.50796 0.58447 0.57144 -0.00152 -0.01574 0.08520  784  ILE A CG2   
2131 C  CD1   . ILE B 89  ? 0.44861 0.51455 0.50969 0.00538  -0.01534 0.08825  784  ILE A CD1   
2132 N  N     . TRP B 90  ? 0.52640 0.56337 0.56073 -0.00753 0.00534  0.08848  785  TRP A N     
2133 C  CA    . TRP B 90  ? 0.49162 0.51527 0.51634 -0.00198 0.01235  0.09183  785  TRP A CA    
2134 C  C     . TRP B 90  ? 0.55206 0.57560 0.57413 0.00177  0.01448  0.09255  785  TRP A C     
2135 O  O     . TRP B 90  ? 0.55959 0.58509 0.58270 0.01056  0.01490  0.09607  785  TRP A O     
2136 C  CB    . TRP B 90  ? 0.53670 0.54219 0.54660 -0.00804 0.02130  0.09173  785  TRP A CB    
2137 C  CG    . TRP B 90  ? 0.62288 0.61121 0.61976 -0.00052 0.03062  0.09636  785  TRP A CG    
2138 C  CD1   . TRP B 90  ? 0.70616 0.67633 0.68594 -0.00064 0.04116  0.09734  785  TRP A CD1   
2139 C  CD2   . TRP B 90  ? 0.68074 0.66809 0.67858 0.00895  0.03146  0.10131  785  TRP A CD2   
2140 N  NE1   . TRP B 90  ? 0.77341 0.73051 0.74301 0.00996  0.04916  0.10336  785  TRP A NE1   
2141 C  CE2   . TRP B 90  ? 0.72582 0.69517 0.70708 0.01607  0.04303  0.10615  785  TRP A CE2   
2142 C  CE3   . TRP B 90  ? 0.69243 0.69269 0.70232 0.01225  0.02412  0.10235  785  TRP A CE3   
2143 C  CZ2   . TRP B 90  ? 0.71700 0.68384 0.69460 0.02765  0.04723  0.11294  785  TRP A CZ2   
2144 C  CZ3   . TRP B 90  ? 0.68035 0.67886 0.68707 0.02183  0.02755  0.10819  785  TRP A CZ3   
2145 C  CH2   . TRP B 90  ? 0.67797 0.66132 0.66926 0.03006  0.03891  0.11388  785  TRP A CH2   
2146 N  N     . ASN B 91  ? 0.58635 0.61034 0.60540 -0.00510 0.01552  0.08941  786  ASN A N     
2147 C  CA    . ASN B 91  ? 0.53509 0.55710 0.55030 -0.00268 0.01818  0.08957  786  ASN A CA    
2148 C  C     . ASN B 91  ? 0.48319 0.52178 0.51117 0.00004  0.01020  0.08864  786  ASN A C     
2149 O  O     . ASN B 91  ? 0.49004 0.52865 0.51627 0.00142  0.01145  0.08838  786  ASN A O     
2150 C  CB    . ASN B 91  ? 0.57841 0.58981 0.57999 -0.01269 0.02520  0.08654  786  ASN A CB    
2151 C  CG    . ASN B 91  ? 0.65733 0.64650 0.64115 -0.01594 0.03567  0.08742  786  ASN A CG    
2152 O  OD1   . ASN B 91  ? 0.69067 0.66924 0.66969 -0.00662 0.04013  0.09180  786  ASN A OD1   
2153 N  ND2   . ASN B 91  ? 0.66841 0.65127 0.64115 -0.02944 0.04024  0.08365  786  ASN A ND2   
2154 N  N     . ASP B 92  ? 0.65326 0.70353 0.69215 0.00113  0.00301  0.08826  787  ASP A N     
2155 C  CA    . ASP B 92  ? 0.69661 0.75867 0.74435 0.00387  -0.00300 0.08762  787  ASP A CA    
2156 C  C     . ASP B 92  ? 0.72527 0.78918 0.77530 0.01078  -0.00427 0.08991  787  ASP A C     
2157 O  O     . ASP B 92  ? 0.74283 0.80720 0.79363 0.01368  -0.00485 0.09183  787  ASP A O     
2158 C  CB    . ASP B 92  ? 0.78806 0.85814 0.84255 0.00271  -0.00816 0.08661  787  ASP A CB    
2159 C  CG    . ASP B 92  ? 0.83688 0.91267 0.89106 -0.00355 -0.00799 0.08505  787  ASP A CG    
2160 O  OD1   . ASP B 92  ? 0.82794 0.91285 0.88742 -0.00252 -0.01172 0.08503  787  ASP A OD1   
2161 O  OD2   . ASP B 92  ? 0.87770 0.94923 0.92483 -0.00967 -0.00343 0.08410  787  ASP A OD2   
2162 N  N     . PRO B 93  ? 0.73424 0.80153 0.78545 0.01291  -0.00496 0.08988  788  PRO A N     
2163 C  CA    . PRO B 93  ? 0.69517 0.76741 0.74817 0.01796  -0.00621 0.09209  788  PRO A CA    
2164 C  C     . PRO B 93  ? 0.68065 0.76017 0.73844 0.01716  -0.01149 0.09105  788  PRO A C     
2165 O  O     . PRO B 93  ? 0.70171 0.78392 0.76084 0.01663  -0.01357 0.08976  788  PRO A O     
2166 C  CB    . PRO B 93  ? 0.68411 0.75594 0.73573 0.01898  -0.00469 0.09178  788  PRO A CB    
2167 C  CG    . PRO B 93  ? 0.74821 0.81958 0.80052 0.01432  -0.00553 0.08884  788  PRO A CG    
2168 C  CD    . PRO B 93  ? 0.77605 0.84332 0.82565 0.01014  -0.00377 0.08808  788  PRO A CD    
2169 N  N     . LEU B 94  ? 0.54825 0.62913 0.60669 0.01676  -0.01280 0.09159  789  LEU A N     
2170 C  CA    . LEU B 94  ? 0.52587 0.61001 0.58561 0.01446  -0.01660 0.08983  789  LEU A CA    
2171 C  C     . LEU B 94  ? 0.48896 0.58133 0.54747 0.01425  -0.01778 0.09120  789  LEU A C     
2172 O  O     . LEU B 94  ? 0.48093 0.57444 0.53710 0.01061  -0.01978 0.08908  789  LEU A O     
2173 C  CB    . LEU B 94  ? 0.48405 0.56465 0.54472 0.01248  -0.01766 0.08856  789  LEU A CB    
2174 C  CG    . LEU B 94  ? 0.42951 0.50744 0.49130 0.01123  -0.01729 0.08713  789  LEU A CG    
2175 C  CD1   . LEU B 94  ? 0.43203 0.50826 0.49481 0.00914  -0.01779 0.08655  789  LEU A CD1   
2176 C  CD2   . LEU B 94  ? 0.41119 0.49009 0.47246 0.01206  -0.01858 0.08600  789  LEU A CD2   
2177 N  N     . PHE B 95  ? 0.48631 0.58484 0.54450 0.01789  -0.01575 0.09502  790  PHE A N     
2178 C  CA    . PHE B 95  ? 0.51539 0.62728 0.57275 0.01745  -0.01696 0.09728  790  PHE A CA    
2179 C  C     . PHE B 95  ? 0.51989 0.64330 0.57644 0.01900  -0.01621 0.09978  790  PHE A C     
2180 O  O     . PHE B 95  ? 0.55982 0.68345 0.61618 0.02531  -0.01270 0.10334  790  PHE A O     
2181 C  CB    . PHE B 95  ? 0.46804 0.58232 0.52527 0.02185  -0.01483 0.10120  790  PHE A CB    
2182 C  CG    . PHE B 95  ? 0.47831 0.58129 0.53630 0.01958  -0.01550 0.09864  790  PHE A CG    
2183 C  CD1   . PHE B 95  ? 0.44430 0.54869 0.50275 0.01440  -0.01918 0.09562  790  PHE A CD1   
2184 C  CD2   . PHE B 95  ? 0.59363 0.68385 0.65044 0.02135  -0.01204 0.09872  790  PHE A CD2   
2185 C  CE1   . PHE B 95  ? 0.48783 0.58259 0.54731 0.01265  -0.01984 0.09341  790  PHE A CE1   
2186 C  CE2   . PHE B 95  ? 0.60122 0.68319 0.65873 0.01807  -0.01277 0.09632  790  PHE A CE2   
2187 C  CZ    . PHE B 95  ? 0.52776 0.61271 0.58751 0.01449  -0.01692 0.09396  790  PHE A CZ    
2188 N  N     . ASN B 96  ? 0.65070 0.78254 0.70500 0.01261  -0.01876 0.09780  791  ASN A N     
2189 C  CA    . ASN B 96  ? 0.68688 0.83134 0.73983 0.01161  -0.01850 0.09951  791  ASN A CA    
2190 C  C     . ASN B 96  ? 0.68291 0.85072 0.73484 0.01082  -0.01893 0.10374  791  ASN A C     
2191 O  O     . ASN B 96  ? 0.78061 0.95623 0.82838 0.00191  -0.02113 0.10129  791  ASN A O     
2192 C  CB    . ASN B 96  ? 0.78547 0.92292 0.83376 0.00351  -0.01983 0.09447  791  ASN A CB    
2193 C  CG    . ASN B 96  ? 0.84023 0.98601 0.88731 0.00240  -0.01913 0.09558  791  ASN A CG    
2194 O  OD1   . ASN B 96  ? 0.76400 0.92928 0.81188 0.00362  -0.01879 0.09981  791  ASN A OD1   
2195 N  ND2   . ASN B 96  ? 0.89879 1.03115 0.94359 0.00045  -0.01866 0.09228  791  ASN A ND2   
2196 N  N     . VAL B 97  ? 0.38924 0.56875 0.44333 0.02021  -0.01602 0.11047  792  VAL A N     
2197 C  CA    . VAL B 97  ? 0.35378 0.55898 0.40748 0.02251  -0.01568 0.11650  792  VAL A CA    
2198 C  C     . VAL B 97  ? 0.49015 0.71819 0.54094 0.01260  -0.01829 0.11584  792  VAL A C     
2199 O  O     . VAL B 97  ? 0.48450 0.73164 0.53288 0.00630  -0.02017 0.11660  792  VAL A O     
2200 C  CB    . VAL B 97  ? 0.39592 0.60715 0.45019 0.03699  -0.01016 0.12501  792  VAL A CB    
2201 C  CG1   . VAL B 97  ? 0.35339 0.59907 0.40720 0.04081  -0.00935 0.13305  792  VAL A CG1   
2202 C  CG2   . VAL B 97  ? 0.40759 0.59942 0.46087 0.04436  -0.00651 0.12627  792  VAL A CG2   
2203 N  N     . GLN B 98  ? 0.75898 0.98608 0.80884 0.00985  -0.01817 0.11427  793  GLN A N     
2204 C  CA    . GLN B 98  ? 0.85252 1.10085 0.89768 -0.00135 -0.01986 0.11343  793  GLN A CA    
2205 C  C     . GLN B 98  ? 0.89310 1.13146 0.93016 -0.01668 -0.02205 0.10556  793  GLN A C     
2206 O  O     . GLN B 98  ? 0.91014 1.16864 0.94055 -0.02820 -0.02307 0.10490  793  GLN A O     
2207 C  CB    . GLN B 98  ? 0.93017 1.17690 0.97558 -0.00078 -0.01878 0.11337  793  GLN A CB    
2208 C  CG    . GLN B 98  ? 0.97892 1.25719 1.02122 -0.00780 -0.01918 0.11646  793  GLN A CG    
2209 C  CD    . GLN B 98  ? 1.08419 1.35410 1.11813 -0.02336 -0.02006 0.10935  793  GLN A CD    
2210 O  OE1   . GLN B 98  ? 1.15813 1.39856 1.19039 -0.02423 -0.01957 0.10387  793  GLN A OE1   
2211 N  NE2   . GLN B 98  ? 1.10259 1.39914 1.12976 -0.03607 -0.02065 0.10976  793  GLN A NE2   
2212 N  N     . ASP B 99  ? 0.89786 1.10578 0.93378 -0.01710 -0.02203 0.09985  794  ASP A N     
2213 C  CA    . ASP B 99  ? 0.91661 1.10995 0.94227 -0.02944 -0.02232 0.09283  794  ASP A CA    
2214 C  C     . ASP B 99  ? 0.86107 1.05905 0.88497 -0.03259 -0.02365 0.09220  794  ASP A C     
2215 O  O     . ASP B 99  ? 0.91503 1.10961 0.92749 -0.04523 -0.02331 0.08724  794  ASP A O     
2216 C  CB    . ASP B 99  ? 0.95849 1.12066 0.98344 -0.02630 -0.02113 0.08854  794  ASP A CB    
2217 C  CG    . ASP B 99  ? 0.99479 1.14922 1.01639 -0.02807 -0.01947 0.08708  794  ASP A CG    
2218 O  OD1   . ASP B 99  ? 1.02871 1.20125 1.04922 -0.03186 -0.01942 0.08919  794  ASP A OD1   
2219 O  OD2   . ASP B 99  ? 0.99765 1.12942 1.01751 -0.02549 -0.01805 0.08423  794  ASP A OD2   
2220 N  N     . ILE B 100 ? 0.63442 0.83737 0.66759 -0.02172 -0.02433 0.09684  795  ILE A N     
2221 C  CA    . ILE B 100 ? 0.58513 0.79066 0.61799 -0.02305 -0.02563 0.09657  795  ILE A CA    
2222 C  C     . ILE B 100 ? 0.57012 0.81035 0.60294 -0.02499 -0.02644 0.10203  795  ILE A C     
2223 O  O     . ILE B 100 ? 0.57645 0.82799 0.60151 -0.03701 -0.02768 0.09923  795  ILE A O     
2224 C  CB    . ILE B 100 ? 0.48744 0.67720 0.52867 -0.01095 -0.02514 0.09850  795  ILE A CB    
2225 C  CG1   . ILE B 100 ? 0.48657 0.64716 0.52678 -0.01134 -0.02477 0.09290  795  ILE A CG1   
2226 C  CG2   . ILE B 100 ? 0.35351 0.54984 0.39569 -0.01057 -0.02627 0.09986  795  ILE A CG2   
2227 C  CD1   . ILE B 100 ? 0.44533 0.59207 0.49239 -0.00225 -0.02410 0.09418  795  ILE A CD1   
2228 N  N     . ASN B 101 ? 0.58750 0.84578 0.62743 -0.01323 -0.02505 0.11018  796  ASN A N     
2229 C  CA    . ASN B 101 ? 0.63431 0.93051 0.67455 -0.01242 -0.02515 0.11739  796  ASN A CA    
2230 C  C     . ASN B 101 ? 0.67532 0.98895 0.71974 -0.00181 -0.02253 0.12518  796  ASN A C     
2231 O  O     . ASN B 101 ? 0.60872 0.91639 0.65819 0.01421  -0.01910 0.13136  796  ASN A O     
2232 C  CB    . ASN B 101 ? 0.60188 0.90369 0.64571 -0.00435 -0.02488 0.12193  796  ASN A CB    
2233 C  CG    . ASN B 101 ? 0.60570 0.94911 0.65048 0.00026  -0.02409 0.13149  796  ASN A CG    
2234 O  OD1   . ASN B 101 ? 0.60378 0.95407 0.65294 0.01687  -0.02040 0.14055  796  ASN A OD1   
2235 N  ND2   . ASN B 101 ? 0.59727 0.96960 0.63607 -0.01464 -0.02662 0.12999  796  ASN A ND2   
2236 N  N     . SER B 102 ? 0.82156 1.15659 0.86199 -0.01126 -0.02334 0.12503  797  SER A N     
2237 C  CA    . SER B 102 ? 0.80563 1.15852 0.84971 -0.00161 -0.02087 0.13237  797  SER A CA    
2238 C  C     . SER B 102 ? 0.76642 1.15581 0.81371 0.01076  -0.01858 0.14432  797  SER A C     
2239 O  O     . SER B 102 ? 0.80517 1.20107 0.85577 0.02652  -0.01437 0.15255  797  SER A O     
2240 C  CB    . SER B 102 ? 0.84038 1.20566 0.87865 -0.01650 -0.02229 0.12854  797  SER A CB    
2241 O  OG    . SER B 102 ? 0.90150 1.23384 0.93348 -0.02885 -0.02348 0.11785  797  SER A OG    
2242 N  N     . ALA B 103 ? 0.61133 1.02399 0.65654 0.00478  -0.02054 0.14585  798  ALA A N     
2243 C  CA    . ALA B 103 ? 0.52310 0.97497 0.57067 0.01674  -0.01818 0.15818  798  ALA A CA    
2244 C  C     . ALA B 103 ? 0.53220 0.96745 0.58352 0.03990  -0.01242 0.16616  798  ALA A C     
2245 O  O     . ALA B 103 ? 0.48660 0.94960 0.53860 0.05548  -0.00777 0.17855  798  ALA A O     
2246 C  CB    . ALA B 103 ? 0.47039 0.94524 0.51452 0.00469  -0.02164 0.15681  798  ALA A CB    
2247 N  N     . LEU B 104 ? 0.63566 1.02673 0.68766 0.04228  -0.01176 0.15973  799  LEU A N     
2248 C  CA    . LEU B 104 ? 0.62728 0.99842 0.67939 0.06131  -0.00524 0.16615  799  LEU A CA    
2249 C  C     . LEU B 104 ? 0.66712 1.03757 0.71777 0.07709  0.00162  0.17393  799  LEU A C     
2250 O  O     . LEU B 104 ? 0.61784 0.98506 0.66483 0.09541  0.00952  0.18347  799  LEU A O     
2251 C  CB    . LEU B 104 ? 0.59844 0.92450 0.65073 0.05716  -0.00625 0.15661  799  LEU A CB    
2252 C  CG    . LEU B 104 ? 0.56487 0.86327 0.61453 0.07231  0.00085  0.16071  799  LEU A CG    
2253 C  CD1   . LEU B 104 ? 0.52014 0.82578 0.56873 0.07730  0.00217  0.16543  799  LEU A CD1   
2254 C  CD2   . LEU B 104 ? 0.51967 0.77768 0.56955 0.06611  -0.00019 0.15079  799  LEU A CD2   
2255 N  N     . TYR B 105 ? 0.65780 1.02960 0.70955 0.07045  -0.00041 0.17014  800  TYR A N     
2256 C  CA    . TYR B 105 ? 0.59769 0.96886 0.64773 0.08414  0.00577  0.17671  800  TYR A CA    
2257 C  C     . TYR B 105 ? 0.59389 1.00631 0.64229 0.09911  0.01096  0.19133  800  TYR A C     
2258 O  O     . TYR B 105 ? 0.51205 0.91963 0.55628 0.11653  0.01914  0.19950  800  TYR A O     
2259 C  CB    . TYR B 105 ? 0.56363 0.93243 0.61572 0.07205  0.00154  0.16951  800  TYR A CB    
2260 C  CG    . TYR B 105 ? 0.56179 0.88629 0.61386 0.06774  0.00096  0.15962  800  TYR A CG    
2261 C  CD1   . TYR B 105 ? 0.54588 0.83858 0.59460 0.07983  0.00725  0.16080  800  TYR A CD1   
2262 C  CD2   . TYR B 105 ? 0.52365 0.83852 0.57723 0.05121  -0.00502 0.14940  800  TYR A CD2   
2263 C  CE1   . TYR B 105 ? 0.49290 0.74981 0.54146 0.07455  0.00651  0.15192  800  TYR A CE1   
2264 C  CE2   . TYR B 105 ? 0.52065 0.79923 0.57443 0.04832  -0.00543 0.14146  800  TYR A CE2   
2265 C  CZ    . TYR B 105 ? 0.52237 0.77433 0.57449 0.05955  -0.00020 0.14269  800  TYR A CZ    
2266 O  OH    . TYR B 105 ? 0.56021 0.78116 0.61243 0.05535  -0.00085 0.13501  800  TYR A OH    
2267 N  N     . ARG B 106 ? 0.79866 1.25227 0.84895 0.09309  0.00711  0.19525  801  ARG A N     
2268 C  CA    . ARG B 106 ? 0.79056 1.28962 0.83955 0.10819  0.01208  0.21056  801  ARG A CA    
2269 C  C     . ARG B 106 ? 0.69957 1.20029 0.74568 0.12213  0.01813  0.21819  801  ARG A C     
2270 O  O     . ARG B 106 ? 0.68419 1.20493 0.72847 0.13649  0.02882  0.22639  801  ARG A O     
2271 C  CB    . ARG B 106 ? 0.84470 1.39453 0.89654 0.09202  0.00565  0.21059  801  ARG A CB    
2272 C  CG    . ARG B 106 ? 0.94710 1.49239 1.00007 0.07620  0.00071  0.20188  801  ARG A CG    
2273 C  CD    . ARG B 106 ? 1.00492 1.60087 1.05765 0.05909  -0.00444 0.20251  801  ARG A CD    
2274 N  NE    . ARG B 106 ? 1.06415 1.65464 1.11412 0.03429  -0.01149 0.19035  801  ARG A NE    
2275 C  CZ    . ARG B 106 ? 1.07399 1.63369 1.12105 0.01576  -0.01548 0.17676  801  ARG A CZ    
2276 N  NH1   . ARG B 106 ? 1.09018 1.62343 1.13850 0.01880  -0.01411 0.17339  801  ARG A NH1   
2277 N  NH2   . ARG B 106 ? 1.03304 1.58690 1.07455 -0.00515 -0.02006 0.16678  801  ARG A NH2   
2278 N  N     . LYS B 107 ? 0.54863 1.02194 0.59471 0.11616  0.01477  0.21168  802  LYS A N     
2279 C  CA    . LYS B 107 ? 0.58328 1.05378 0.62574 0.12985  0.02077  0.21904  802  LYS A CA    
2280 C  C     . LYS B 107 ? 0.64595 1.07259 0.67990 0.14866  0.03148  0.22317  802  LYS A C     
2281 O  O     . LYS B 107 ? 0.71528 1.14000 0.74354 0.16420  0.04285  0.22984  802  LYS A O     
2282 C  CB    . LYS B 107 ? 0.55147 1.01534 0.59716 0.11380  0.01270  0.21013  802  LYS A CB    
2283 C  CG    . LYS B 107 ? 0.66581 1.17579 0.71536 0.09599  0.00403  0.20803  802  LYS A CG    
2284 C  CD    . LYS B 107 ? 0.75648 1.30898 0.80622 0.10442  0.01233  0.21677  802  LYS A CD    
2285 C  CE    . LYS B 107 ? 0.80646 1.38398 0.85763 0.09174  0.00809  0.21413  802  LYS A CE    
2286 N  NZ    . LYS B 107 ? 0.80745 1.37420 0.85724 0.10699  0.01507  0.21972  802  LYS A NZ    
2287 N  N     . VAL B 108 ? 0.50970 0.89469 0.54236 0.14326  0.03153  0.21366  803  VAL A N     
2288 C  CA    . VAL B 108 ? 0.54251 0.88372 0.56436 0.15732  0.04253  0.21575  803  VAL A CA    
2289 C  C     . VAL B 108 ? 0.56792 0.90720 0.58479 0.16758  0.04898  0.22038  803  VAL A C     
2290 O  O     . VAL B 108 ? 0.54038 0.87964 0.56338 0.15553  0.04260  0.21245  803  VAL A O     
2291 C  CB    . VAL B 108 ? 0.48511 0.78044 0.50743 0.14355  0.03903  0.20175  803  VAL A CB    
2292 C  CG1   . VAL B 108 ? 0.39378 0.64794 0.40196 0.15658  0.05145  0.20509  803  VAL A CG1   
2293 C  CG2   . VAL B 108 ? 0.45791 0.76092 0.48872 0.12747  0.02881  0.19395  803  VAL A CG2   
2294 N  N     . LYS B 109 ? 0.67595 1.01116 0.68105 0.18923  0.06286  0.23178  804  LYS A N     
2295 C  CA    . LYS B 109 ? 0.73917 1.06884 0.73849 0.19900  0.07090  0.23447  804  LYS A CA    
2296 C  C     . LYS B 109 ? 0.74407 1.02158 0.73314 0.19770  0.07455  0.22889  804  LYS A C     
2297 O  O     . LYS B 109 ? 0.71990 0.99082 0.71128 0.19201  0.07227  0.22343  804  LYS A O     
2298 C  CB    . LYS B 109 ? 0.79157 1.13248 0.78326 0.21953  0.08706  0.24302  804  LYS A CB    
2299 C  CG    . LYS B 109 ? 0.85043 1.24737 0.85259 0.22122  0.08607  0.24806  804  LYS A CG    
2300 C  CD    . LYS B 109 ? 0.92312 1.32743 0.91737 0.24465  0.10394  0.25707  804  LYS A CD    
2301 C  CE    . LYS B 109 ? 0.92633 1.32929 0.91740 0.25166  0.10925  0.25860  804  LYS A CE    
2302 N  NZ    . LYS B 109 ? 0.95924 1.30731 0.93803 0.25122  0.11161  0.25321  804  LYS A NZ    
2303 N  N     . LEU B 110 ? 0.76174 1.00127 0.74048 0.19926  0.08094  0.22655  805  LEU A N     
2304 C  CA    . LEU B 110 ? 0.72291 0.91228 0.69163 0.19320  0.08581  0.21723  805  LEU A CA    
2305 C  C     . LEU B 110 ? 0.74729 0.93212 0.73053 0.17014  0.07188  0.20186  805  LEU A C     
2306 O  O     . LEU B 110 ? 0.75495 0.91153 0.73326 0.16478  0.07393  0.19484  805  LEU A O     
2307 C  CB    . LEU B 110 ? 0.67837 0.83254 0.63387 0.19551  0.09403  0.21692  805  LEU A CB    
2308 C  CG    . LEU B 110 ? 0.80651 0.92761 0.73580 0.21489  0.11402  0.22623  805  LEU A CG    
2309 C  CD1   . LEU B 110 ? 0.86820 1.02155 0.79880 0.23304  0.12193  0.23435  805  LEU A CD1   
2310 C  CD2   . LEU B 110 ? 0.81117 0.89682 0.72624 0.21462  0.12231  0.22505  805  LEU A CD2   
2311 N  N     . LEU B 111 ? 0.59672 0.80907 0.59620 0.15667  0.05851  0.19690  806  LEU A N     
2312 C  CA    . LEU B 111 ? 0.53125 0.73996 0.54251 0.13676  0.04664  0.18370  806  LEU A CA    
2313 C  C     . LEU B 111 ? 0.58357 0.81449 0.60093 0.13482  0.04269  0.18390  806  LEU A C     
2314 O  O     . LEU B 111 ? 0.54008 0.75351 0.55927 0.12620  0.03988  0.17569  806  LEU A O     
2315 C  CB    . LEU B 111 ? 0.45010 0.67400 0.47251 0.12283  0.03567  0.17788  806  LEU A CB    
2316 C  CG    . LEU B 111 ? 0.44862 0.66290 0.47991 0.10389  0.02546  0.16472  806  LEU A CG    
2317 C  CD1   . LEU B 111 ? 0.37477 0.54879 0.40089 0.10011  0.02848  0.15736  806  LEU A CD1   
2318 C  CD2   . LEU B 111 ? 0.46104 0.68969 0.50045 0.09100  0.01610  0.15954  806  LEU A CD2   
2319 N  N     . ASN B 112 ? 0.72265 0.99380 0.74306 0.14227  0.04245  0.19340  807  ASN A N     
2320 C  CA    . ASN B 112 ? 0.74095 1.03342 0.76571 0.14096  0.03989  0.19441  807  ASN A CA    
2321 C  C     . ASN B 112 ? 0.70363 0.96962 0.71843 0.15211  0.04942  0.19638  807  ASN A C     
2322 O  O     . ASN B 112 ? 0.60323 0.86715 0.62175 0.14548  0.04598  0.19118  807  ASN A O     
2323 C  CB    . ASN B 112 ? 0.76182 1.10495 0.78942 0.14898  0.03996  0.20623  807  ASN A CB    
2324 C  CG    . ASN B 112 ? 0.76561 1.13581 0.79975 0.14149  0.03453  0.20516  807  ASN A CG    
2325 O  OD1   . ASN B 112 ? 0.77745 1.13712 0.81752 0.12379  0.02641  0.19355  807  ASN A OD1   
2326 N  ND2   . ASN B 112 ? 0.73927 1.14420 0.77137 0.15554  0.03972  0.21779  807  ASN A ND2   
2327 N  N     . GLN B 113 ? 0.66978 0.91318 0.67005 0.16859  0.06220  0.20362  808  GLN A N     
2328 C  CA    . GLN B 113 ? 0.65785 0.87150 0.64474 0.17838  0.07294  0.20495  808  GLN A CA    
2329 C  C     . GLN B 113 ? 0.69815 0.87704 0.68619 0.16220  0.06856  0.19072  808  GLN A C     
2330 O  O     . GLN B 113 ? 0.76657 0.93674 0.75288 0.16141  0.06973  0.18793  808  GLN A O     
2331 C  CB    . GLN B 113 ? 0.68362 0.87362 0.65044 0.19750  0.08915  0.21468  808  GLN A CB    
2332 C  CG    . GLN B 113 ? 0.77761 1.00252 0.74047 0.21863  0.09643  0.23139  808  GLN A CG    
2333 C  CD    . GLN B 113 ? 0.87010 1.06558 0.81353 0.23547  0.11516  0.23522  808  GLN A CD    
2334 O  OE1   . GLN B 113 ? 0.87503 1.02276 0.80204 0.23415  0.12279  0.23139  808  GLN A OE1   
2335 N  NE2   . GLN B 113 ? 0.89483 1.11899 0.83950 0.25046  0.12338  0.24225  808  GLN A NE2   
2336 N  N     . VAL B 114 ? 0.62818 0.78918 0.61937 0.14933  0.06340  0.18195  809  VAL A N     
2337 C  CA    . VAL B 114 ? 0.57516 0.70833 0.56759 0.13479  0.05942  0.16962  809  VAL A CA    
2338 C  C     . VAL B 114 ? 0.51468 0.66824 0.52344 0.12099  0.04635  0.16246  809  VAL A C     
2339 O  O     . VAL B 114 ? 0.47207 0.61194 0.48152 0.11445  0.04467  0.15592  809  VAL A O     
2340 C  CB    . VAL B 114 ? 0.53853 0.64559 0.52745 0.12607  0.05936  0.16306  809  VAL A CB    
2341 C  CG1   . VAL B 114 ? 0.56959 0.65405 0.53954 0.13908  0.07365  0.17032  809  VAL A CG1   
2342 C  CG2   . VAL B 114 ? 0.49251 0.61894 0.49619 0.11507  0.04751  0.15895  809  VAL A CG2   
2343 N  N     . ARG B 115 ? 0.50942 0.69521 0.52948 0.11622  0.03795  0.16381  810  ARG A N     
2344 C  CA    . ARG B 115 ? 0.53939 0.74332 0.57053 0.10399  0.02811  0.15825  810  ARG A CA    
2345 C  C     . ARG B 115 ? 0.58853 0.79850 0.61778 0.11019  0.03141  0.16151  810  ARG A C     
2346 O  O     . ARG B 115 ? 0.56307 0.76307 0.59565 0.10164  0.02752  0.15438  810  ARG A O     
2347 C  CB    . ARG B 115 ? 0.52828 0.76813 0.56709 0.09868  0.02133  0.16087  810  ARG A CB    
2348 C  CG    . ARG B 115 ? 0.49030 0.75085 0.53581 0.08786  0.01433  0.15745  810  ARG A CG    
2349 C  CD    . ARG B 115 ? 0.50654 0.80074 0.55655 0.07890  0.00822  0.15860  810  ARG A CD    
2350 N  NE    . ARG B 115 ? 0.61419 0.94711 0.66401 0.08705  0.01072  0.16914  810  ARG A NE    
2351 C  CZ    . ARG B 115 ? 0.60786 0.96395 0.66015 0.08030  0.00766  0.16925  810  ARG A CZ    
2352 N  NH1   . ARG B 115 ? 0.53011 0.87042 0.58428 0.06593  0.00261  0.15923  810  ARG A NH1   
2353 N  NH2   . ARG B 115 ? 0.49479 0.89063 0.54699 0.08810  0.01012  0.17983  810  ARG A NH2   
2354 N  N     . LEU B 116 ? 0.60886 0.83606 0.63240 0.12603  0.03898  0.17294  811  LEU A N     
2355 C  CA    . LEU B 116 ? 0.55300 0.78598 0.57363 0.13399  0.04329  0.17713  811  LEU A CA    
2356 C  C     . LEU B 116 ? 0.56907 0.76161 0.57984 0.13605  0.04996  0.17220  811  LEU A C     
2357 O  O     . LEU B 116 ? 0.67924 0.86670 0.69304 0.13016  0.04706  0.16698  811  LEU A O     
2358 C  CB    . LEU B 116 ? 0.53308 0.79298 0.54783 0.15322  0.05166  0.19194  811  LEU A CB    
2359 C  CG    . LEU B 116 ? 0.55897 0.86808 0.58318 0.15066  0.04516  0.19800  811  LEU A CG    
2360 C  CD1   . LEU B 116 ? 0.53824 0.88033 0.55928 0.16726  0.05169  0.21153  811  LEU A CD1   
2361 C  CD2   . LEU B 116 ? 0.56054 0.88565 0.59713 0.12826  0.03192  0.18804  811  LEU A CD2   
2362 N  N     . LEU B 117 ? 0.50854 0.67170 0.50622 0.14311  0.05925  0.17344  812  LEU A N     
2363 C  CA    . LEU B 117 ? 0.60918 0.73337 0.59504 0.14162  0.06594  0.16757  812  LEU A CA    
2364 C  C     . LEU B 117 ? 0.67415 0.78871 0.67016 0.12286  0.05553  0.15476  812  LEU A C     
2365 O  O     . LEU B 117 ? 0.68850 0.78773 0.68132 0.11963  0.05682  0.15000  812  LEU A O     
2366 C  CB    . LEU B 117 ? 0.67142 0.76515 0.64070 0.14714  0.07671  0.16919  812  LEU A CB    
2367 C  CG    . LEU B 117 ? 0.74474 0.83057 0.69483 0.16850  0.09279  0.18158  812  LEU A CG    
2368 C  CD1   . LEU B 117 ? 0.79228 0.84742 0.72513 0.17200  0.10330  0.18293  812  LEU A CD1   
2369 C  CD2   . LEU B 117 ? 0.69090 0.75866 0.62834 0.17507  0.10168  0.18223  812  LEU A CD2   
2370 N  N     . ARG B 118 ? 0.68362 0.80782 0.69120 0.11111  0.04562  0.14957  813  ARG A N     
2371 C  CA    . ARG B 118 ? 0.66483 0.78087 0.68087 0.09550  0.03680  0.13882  813  ARG A CA    
2372 C  C     . ARG B 118 ? 0.61282 0.74659 0.63841 0.09050  0.02995  0.13682  813  ARG A C     
2373 O  O     . ARG B 118 ? 0.53359 0.65592 0.56219 0.08167  0.02608  0.12943  813  ARG A O     
2374 C  CB    . ARG B 118 ? 0.59601 0.71598 0.61973 0.08580  0.02941  0.13453  813  ARG A CB    
2375 C  CG    . ARG B 118 ? 0.55532 0.65103 0.57068 0.08495  0.03433  0.13245  813  ARG A CG    
2376 C  CD    . ARG B 118 ? 0.55497 0.65724 0.57826 0.07699  0.02721  0.12928  813  ARG A CD    
2377 N  NE    . ARG B 118 ? 0.57034 0.67670 0.60379 0.06486  0.01780  0.12172  813  ARG A NE    
2378 C  CZ    . ARG B 118 ? 0.60541 0.71076 0.64397 0.05673  0.01224  0.11721  813  ARG A CZ    
2379 N  NH1   . ARG B 118 ? 0.55390 0.65564 0.58978 0.05850  0.01426  0.11910  813  ARG A NH1   
2380 N  NH2   . ARG B 118 ? 0.62748 0.73455 0.67270 0.04773  0.00544  0.11133  813  ARG A NH2   
2381 N  N     . VAL B 119 ? 0.52588 0.68902 0.55597 0.09513  0.02835  0.14334  814  VAL A N     
2382 C  CA    . VAL B 119 ? 0.46109 0.64031 0.49829 0.08933  0.02281  0.14150  814  VAL A CA    
2383 C  C     . VAL B 119 ? 0.49401 0.65856 0.52538 0.09541  0.02844  0.14164  814  VAL A C     
2384 O  O     . VAL B 119 ? 0.49330 0.64996 0.52837 0.08726  0.02435  0.13513  814  VAL A O     
2385 C  CB    . VAL B 119 ? 0.46083 0.67801 0.50254 0.09149  0.02052  0.14878  814  VAL A CB    
2386 C  CG1   . VAL B 119 ? 0.40777 0.64067 0.45439 0.08528  0.01633  0.14736  814  VAL A CG1   
2387 C  CG2   . VAL B 119 ? 0.51325 0.74336 0.56006 0.08154  0.01399  0.14643  814  VAL A CG2   
2388 N  N     . GLN B 120 ? 0.56005 0.71794 0.58041 0.11026  0.03888  0.14908  815  GLN A N     
2389 C  CA    . GLN B 120 ? 0.53993 0.67991 0.55144 0.11666  0.04600  0.14921  815  GLN A CA    
2390 C  C     . GLN B 120 ? 0.60287 0.71075 0.61044 0.10688  0.04578  0.13919  815  GLN A C     
2391 O  O     . GLN B 120 ? 0.62291 0.72380 0.63178 0.10238  0.04410  0.13449  815  GLN A O     
2392 C  CB    . GLN B 120 ? 0.48845 0.62178 0.48458 0.13524  0.05950  0.15935  815  GLN A CB    
2393 C  CG    . GLN B 120 ? 0.54996 0.72031 0.54981 0.14686  0.06040  0.17089  815  GLN A CG    
2394 C  CD    . GLN B 120 ? 0.71223 0.87603 0.69518 0.16817  0.07528  0.18265  815  GLN A CD    
2395 O  OE1   . GLN B 120 ? 0.79033 0.91898 0.75722 0.17287  0.08527  0.18180  815  GLN A OE1   
2396 N  NE2   . GLN B 120 ? 0.75284 0.95101 0.73768 0.18107  0.07766  0.19415  815  GLN A NE2   
2397 N  N     . LEU B 121 ? 0.58614 0.67647 0.58888 0.10296  0.04738  0.13602  816  LEU A N     
2398 C  CA    . LEU B 121 ? 0.50604 0.56943 0.50345 0.09323  0.04808  0.12730  816  LEU A CA    
2399 C  C     . LEU B 121 ? 0.57706 0.64748 0.58793 0.08023  0.03706  0.11951  816  LEU A C     
2400 O  O     . LEU B 121 ? 0.69361 0.74911 0.70134 0.07431  0.03752  0.11369  816  LEU A O     
2401 C  CB    . LEU B 121 ? 0.52567 0.57412 0.51661 0.09005  0.05095  0.12573  816  LEU A CB    
2402 C  CG    . LEU B 121 ? 0.60853 0.63512 0.57923 0.10032  0.06507  0.13103  816  LEU A CG    
2403 C  CD1   . LEU B 121 ? 0.59778 0.61149 0.56398 0.09426  0.06622  0.12846  816  LEU A CD1   
2404 C  CD2   . LEU B 121 ? 0.65565 0.65597 0.60960 0.10101  0.07475  0.12850  816  LEU A CD2   
2405 N  N     . CYS B 122 ? 0.58180 0.67402 0.60575 0.07554  0.02802  0.11946  817  CYS A N     
2406 C  CA    . CYS B 122 ? 0.61978 0.71637 0.65367 0.06465  0.01926  0.11304  817  CYS A CA    
2407 C  C     . CYS B 122 ? 0.68266 0.78392 0.71866 0.06525  0.01844  0.11276  817  CYS A C     
2408 O  O     . CYS B 122 ? 0.68676 0.78170 0.72619 0.05808  0.01456  0.10710  817  CYS A O     
2409 C  CB    . CYS B 122 ? 0.59335 0.70763 0.63624 0.05883  0.01181  0.11287  817  CYS A CB    
2410 S  SG    . CYS B 122 ? 0.67277 0.78159 0.71527 0.05596  0.01088  0.11175  817  CYS A SG    
2411 N  N     . HIS B 123 ? 0.74017 0.85354 0.77398 0.07430  0.02230  0.11931  818  HIS A N     
2412 C  CA    . HIS B 123 ? 0.69434 0.81124 0.72934 0.07543  0.02227  0.11928  818  HIS A CA    
2413 C  C     . HIS B 123 ? 0.66040 0.75341 0.68492 0.07951  0.02960  0.11737  818  HIS A C     
2414 O  O     . HIS B 123 ? 0.76041 0.84700 0.78649 0.07507  0.02770  0.11290  818  HIS A O     
2415 C  CB    . HIS B 123 ? 0.76172 0.90365 0.79804 0.08360  0.02389  0.12755  818  HIS A CB    
2416 C  CG    . HIS B 123 ? 0.82007 0.98780 0.86541 0.07585  0.01635  0.12822  818  HIS A CG    
2417 N  ND1   . HIS B 123 ? 0.83484 1.00464 0.88634 0.06339  0.00924  0.12218  818  HIS A ND1   
2418 C  CD2   . HIS B 123 ? 0.83477 1.02652 0.88184 0.07803  0.01568  0.13414  818  HIS A CD2   
2419 C  CE1   . HIS B 123 ? 0.83632 1.02794 0.89135 0.05701  0.00502  0.12370  818  HIS A CE1   
2420 N  NE2   . HIS B 123 ? 0.81536 1.02255 0.86863 0.06520  0.00824  0.13079  818  HIS A NE2   
2421 N  N     . MET B 124 ? 0.52327 0.60142 0.53520 0.08736  0.03879  0.12054  819  MET A N     
2422 C  CA    . MET B 124 ? 0.60275 0.65412 0.60059 0.08870  0.04715  0.11760  819  MET A CA    
2423 C  C     . MET B 124 ? 0.67521 0.71336 0.67481 0.07513  0.04264  0.10824  819  MET A C     
2424 O  O     . MET B 124 ? 0.74365 0.76875 0.73769 0.07173  0.04491  0.10388  819  MET A O     
2425 C  CB    . MET B 124 ? 0.61174 0.64564 0.59210 0.09814  0.05928  0.12243  819  MET A CB    
2426 C  CG    . MET B 124 ? 0.69134 0.74080 0.66908 0.11389  0.06476  0.13334  819  MET A CG    
2427 S  SD    . MET B 124 ? 0.77202 0.79156 0.72249 0.12794  0.08330  0.13953  819  MET A SD    
2428 C  CE    . MET B 124 ? 0.71826 0.76734 0.67041 0.14817  0.08754  0.15404  819  MET A CE    
2429 N  N     . LYS B 125 ? 0.64665 0.68976 0.65361 0.06758  0.03646  0.10545  820  LYS A N     
2430 C  CA    . LYS B 125 ? 0.58632 0.62132 0.59496 0.05605  0.03257  0.09800  820  LYS A CA    
2431 C  C     . LYS B 125 ? 0.58411 0.62772 0.60296 0.05105  0.02538  0.09450  820  LYS A C     
2432 O  O     . LYS B 125 ? 0.56883 0.60351 0.58447 0.04527  0.02578  0.08961  820  LYS A O     
2433 C  CB    . LYS B 125 ? 0.59493 0.63549 0.60938 0.05105  0.02790  0.09706  820  LYS A CB    
2434 C  CG    . LYS B 125 ? 0.56276 0.59947 0.57918 0.04027  0.02412  0.09077  820  LYS A CG    
2435 C  CD    . LYS B 125 ? 0.62610 0.64476 0.62763 0.03633  0.03202  0.08852  820  LYS A CD    
2436 C  CE    . LYS B 125 ? 0.71145 0.73301 0.71585 0.02712  0.02832  0.08497  820  LYS A CE    
2437 N  NZ    . LYS B 125 ? 0.71785 0.74557 0.72747 0.02966  0.02589  0.08796  820  LYS A NZ    
2438 N  N     . ASN B 126 ? 0.69607 0.75712 0.72574 0.05261  0.01941  0.09704  821  ASN A N     
2439 C  CA    . ASN B 126 ? 0.65467 0.72185 0.69225 0.04798  0.01354  0.09417  821  ASN A CA    
2440 C  C     . ASN B 126 ? 0.67981 0.73953 0.71258 0.05064  0.01730  0.09339  821  ASN A C     
2441 O  O     . ASN B 126 ? 0.78624 0.84338 0.82187 0.04569  0.01432  0.08934  821  ASN A O     
2442 C  CB    . ASN B 126 ? 0.67605 0.76124 0.72190 0.04783  0.00844  0.09714  821  ASN A CB    
2443 C  CG    . ASN B 126 ? 0.76980 0.85985 0.82044 0.04212  0.00347  0.09573  821  ASN A CG    
2444 O  OD1   . ASN B 126 ? 0.82111 0.90302 0.87173 0.03809  0.00221  0.09219  821  ASN A OD1   
2445 N  ND2   . ASN B 126 ? 0.76606 0.87060 0.81982 0.04142  0.00103  0.09867  821  ASN A ND2   
2446 N  N     . MET B 127 ? 0.57144 0.62761 0.59615 0.05927  0.02438  0.09769  822  MET A N     
2447 C  CA    . MET B 127 ? 0.67454 0.72106 0.69243 0.06263  0.02927  0.09706  822  MET A CA    
2448 C  C     . MET B 127 ? 0.71635 0.74082 0.72185 0.05794  0.03489  0.09174  822  MET A C     
2449 O  O     . MET B 127 ? 0.77104 0.78875 0.77458 0.05416  0.03493  0.08763  822  MET A O     
2450 C  CB    . MET B 127 ? 0.70932 0.75971 0.72087 0.07510  0.03627  0.10453  822  MET A CB    
2451 C  CG    . MET B 127 ? 0.71164 0.78837 0.73494 0.07752  0.03055  0.10944  822  MET A CG    
2452 S  SD    . MET B 127 ? 0.77458 0.86382 0.79147 0.09351  0.03865  0.12000  822  MET A SD    
2453 C  CE    . MET B 127 ? 0.79846 0.86119 0.80003 0.09978  0.04875  0.11844  822  MET A CE    
2454 N  N     . PHE B 128 ? 0.66634 0.67988 0.66240 0.05690  0.03989  0.09153  823  PHE A N     
2455 C  CA    . PHE B 128 ? 0.75639 0.74972 0.73803 0.04958  0.04599  0.08601  823  PHE A CA    
2456 C  C     . PHE B 128 ? 0.76964 0.76985 0.75958 0.03745  0.03824  0.07981  823  PHE A C     
2457 O  O     . PHE B 128 ? 0.80409 0.79368 0.78426 0.02961  0.04162  0.07465  823  PHE A O     
2458 C  CB    . PHE B 128 ? 0.75565 0.73454 0.72294 0.05087  0.05440  0.08766  823  PHE A CB    
2459 C  CG    . PHE B 128 ? 0.86423 0.83384 0.81942 0.06472  0.06454  0.09475  823  PHE A CG    
2460 C  CD1   . PHE B 128 ? 0.89200 0.86142 0.84483 0.07352  0.06792  0.09784  823  PHE A CD1   
2461 C  CD2   . PHE B 128 ? 0.92324 0.88524 0.86902 0.07003  0.07118  0.09909  823  PHE A CD2   
2462 C  CE1   . PHE B 128 ? 0.89588 0.85923 0.83695 0.08840  0.07810  0.10577  823  PHE A CE1   
2463 C  CE2   . PHE B 128 ? 0.93295 0.88764 0.86651 0.08499  0.08159  0.10704  823  PHE A CE2   
2464 C  CZ    . PHE B 128 ? 0.92833 0.88451 0.85945 0.09472  0.08521  0.11072  823  PHE A CZ    
2465 N  N     . LYS B 129 ? 0.59601 0.61414 0.60214 0.03590  0.02875  0.08054  824  LYS A N     
2466 C  CA    . LYS B 129 ? 0.53722 0.56357 0.55102 0.02755  0.02217  0.07637  824  LYS A CA    
2467 C  C     . LYS B 129 ? 0.62399 0.65152 0.64049 0.02657  0.02023  0.07416  824  LYS A C     
2468 O  O     . LYS B 129 ? 0.63820 0.66961 0.65616 0.01985  0.01756  0.07057  824  LYS A O     
2469 C  CB    . LYS B 129 ? 0.48417 0.52568 0.51159 0.02788  0.01432  0.07839  824  LYS A CB    
2470 C  CG    . LYS B 129 ? 0.53646 0.57860 0.56262 0.02565  0.01458  0.07890  824  LYS A CG    
2471 C  CD    . LYS B 129 ? 0.61648 0.67125 0.65411 0.02662  0.00778  0.08093  824  LYS A CD    
2472 C  CE    . LYS B 129 ? 0.66914 0.72443 0.70580 0.02494  0.00799  0.08155  824  LYS A CE    
2473 N  NZ    . LYS B 129 ? 0.65735 0.72249 0.70285 0.02599  0.00243  0.08340  824  LYS A NZ    
2474 N  N     . THR B 130 ? 0.65312 0.67938 0.67035 0.03333  0.02156  0.07665  825  THR A N     
2475 C  CA    . THR B 130 ? 0.54675 0.57455 0.56769 0.03276  0.01921  0.07485  825  THR A CA    
2476 C  C     . THR B 130 ? 0.62069 0.63368 0.62907 0.03532  0.02692  0.07371  825  THR A C     
2477 O  O     . THR B 130 ? 0.66433 0.67784 0.67541 0.03611  0.02555  0.07270  825  THR A O     
2478 C  CB    . THR B 130 ? 0.53595 0.57653 0.56893 0.03685  0.01351  0.07833  825  THR A CB    
2479 O  OG1   . THR B 130 ? 0.59481 0.63744 0.62573 0.04456  0.01698  0.08322  825  THR A OG1   
2480 C  CG2   . THR B 130 ? 0.44105 0.49211 0.48290 0.03378  0.00735  0.07897  825  THR A CG2   
2481 N  N     . CYS B 131 ? 0.78559 0.78329 0.77858 0.03664  0.03584  0.07386  826  CYS A N     
2482 C  CA    . CYS B 131 ? 0.82385 0.80213 0.79977 0.03931  0.04575  0.07277  826  CYS A CA    
2483 C  C     . CYS B 131 ? 0.86805 0.83099 0.82786 0.02801  0.05150  0.06645  826  CYS A C     
2484 O  O     . CYS B 131 ? 0.93943 0.89436 0.88945 0.02495  0.05626  0.06629  826  CYS A O     
2485 C  CB    . CYS B 131 ? 0.91742 0.88789 0.88416 0.05152  0.05405  0.07927  826  CYS A CB    
2486 S  SG    . CYS B 131 ? 0.99189 0.93283 0.93212 0.05714  0.06956  0.07904  826  CYS A SG    
2487 N  N     . ARG B 132 ? 0.79292 0.75291 0.74933 0.02066  0.05113  0.06112  827  ARG A N     
2488 C  CA    . ARG B 132 ? 0.74582 0.69717 0.68765 0.00679  0.05539  0.05457  827  ARG A CA    
2489 C  C     . ARG B 132 ? 0.78300 0.70487 0.69677 0.00534  0.07011  0.05296  827  ARG A C     
2490 O  O     . ARG B 132 ? 0.81716 0.72999 0.71501 -0.00813 0.07532  0.04751  827  ARG A O     
2491 C  CB    . ARG B 132 ? 0.72024 0.67787 0.66475 -0.00075 0.05156  0.04957  827  ARG A CB    
2492 C  CG    . ARG B 132 ? 0.73327 0.67786 0.67194 0.00574  0.05594  0.04947  827  ARG A CG    
2493 C  CD    . ARG B 132 ? 0.64931 0.60372 0.59560 0.00044  0.05002  0.04560  827  ARG A CD    
2494 N  NE    . ARG B 132 ? 0.71156 0.65346 0.65350 0.00834  0.05408  0.04636  827  ARG A NE    
2495 C  CZ    . ARG B 132 ? 0.82554 0.74225 0.74455 0.00757  0.06577  0.04349  827  ARG A CZ    
2496 N  NH1   . ARG B 132 ? 0.87697 0.77631 0.77331 -0.00253 0.07517  0.03899  827  ARG A NH1   
2497 N  NH2   . ARG B 132 ? 0.82536 0.73309 0.74229 0.01654  0.06893  0.04512  827  ARG A NH2   
2498 N  N     . LEU B 133 ? 0.77123 0.67821 0.67682 0.01868  0.07781  0.05795  828  LEU A N     
2499 C  CA    . LEU B 133 ? 0.86316 0.73790 0.73862 0.01973  0.09409  0.05752  828  LEU A CA    
2500 C  C     . LEU B 133 ? 0.95728 0.82515 0.82590 0.02435  0.09943  0.06207  828  LEU A C     
2501 O  O     . LEU B 133 ? 1.04218 0.88083 0.88275 0.02256  0.11393  0.06110  828  LEU A O     
2502 C  CB    . LEU B 133 ? 0.91544 0.77544 0.78155 0.03371  0.10218  0.06150  828  LEU A CB    
2503 C  CG    . LEU B 133 ? 0.97153 0.83557 0.84313 0.03081  0.09799  0.05744  828  LEU A CG    
2504 C  CD1   . LEU B 133 ? 0.97646 0.82653 0.83844 0.04640  0.10675  0.06253  828  LEU A CD1   
2505 C  CD2   . LEU B 133 ? 1.02384 0.87376 0.87749 0.01240  0.10243  0.04770  828  LEU A CD2   
2506 N  N     . ALA B 134 ? 1.06366 0.95566 0.95510 0.02962  0.08896  0.06678  829  ALA A N     
2507 C  CA    . ALA B 134 ? 1.04846 0.93693 0.93595 0.03430  0.09273  0.07137  829  ALA A CA    
2508 C  C     . ALA B 134 ? 1.04610 0.94461 0.93940 0.02028  0.08652  0.06701  829  ALA A C     
2509 O  O     . ALA B 134 ? 1.06439 0.97989 0.97362 0.02372  0.07912  0.07066  829  ALA A O     
2510 C  CB    . ALA B 134 ? 0.96313 0.87205 0.86994 0.04981  0.08637  0.08003  829  ALA A CB    
2511 N  N     . LYS B 135 ? 1.06233 0.95269 0.94272 0.00391  0.08938  0.05935  830  LYS A N     
2512 C  CA    . LYS B 135 ? 1.05003 0.95552 0.93768 -0.00884 0.08283  0.05613  830  LYS A CA    
2513 C  C     . LYS B 135 ? 1.08801 0.97251 0.95281 -0.01630 0.09385  0.05475  830  LYS A C     
2514 O  O     . LYS B 135 ? 1.02511 0.92303 0.89733 -0.02388 0.08860  0.05393  830  LYS A O     
2515 C  CB    . LYS B 135 ? 0.97962 0.89953 0.87129 -0.02342 0.07687  0.04948  830  LYS A CB    
2516 C  CG    . LYS B 135 ? 1.00153 0.94643 0.90726 -0.03252 0.06756  0.04841  830  LYS A CG    
2517 C  CD    . LYS B 135 ? 1.02993 1.00329 0.96524 -0.02416 0.05339  0.05217  830  LYS A CD    
2518 C  CE    . LYS B 135 ? 1.07800 1.05768 1.02005 -0.02245 0.04950  0.05070  830  LYS A CE    
2519 N  NZ    . LYS B 135 ? 1.07076 1.07883 1.03463 -0.02231 0.03751  0.05192  830  LYS A NZ    
2520 N  N     . GLU B 136 ? 1.28623 1.13685 1.12221 -0.01366 0.10981  0.05495  831  GLU A N     
2521 C  CA    . GLU B 136 ? 1.32546 1.15394 1.14000 -0.01707 0.12105  0.05557  831  GLU A CA    
2522 C  C     . GLU B 136 ? 1.32715 1.15867 1.15177 0.00113  0.12038  0.06478  831  GLU A C     
2523 O  O     . GLU B 136 ? 1.40579 1.22838 1.22172 -0.00091 0.12515  0.06617  831  GLU A O     
2524 C  CB    . GLU B 136 ? 1.44273 1.22971 1.21764 -0.02241 0.14060  0.05208  831  GLU A CB    
2525 C  CG    . GLU B 136 ? 1.53511 1.30586 1.30102 -0.00887 0.14780  0.05475  831  GLU A CG    
2526 C  CD    . GLU B 136 ? 1.62592 1.34870 1.34776 -0.01008 0.17059  0.05333  831  GLU A CD    
2527 O  OE1   . GLU B 136 ? 1.67047 1.37194 1.36806 -0.02315 0.18079  0.04969  831  GLU A OE1   
2528 O  OE2   . GLU B 136 ? 1.64566 1.35061 1.35533 0.00201  0.17923  0.05600  831  GLU A OE2   
2529 N  N     . LEU B 137 ? 0.96835 0.81443 0.81117 0.01793  0.11433  0.07109  832  LEU A N     
2530 C  CA    . LEU B 137 ? 0.84542 0.70273 0.70101 0.03370  0.11155  0.07989  832  LEU A CA    
2531 C  C     . LEU B 137 ? 0.81465 0.70307 0.69808 0.02919  0.09577  0.07963  832  LEU A C     
2532 O  O     . LEU B 137 ? 0.79576 0.68974 0.68468 0.03574  0.09469  0.08462  832  LEU A O     
2533 C  CB    . LEU B 137 ? 0.76460 0.63044 0.62893 0.05144  0.11076  0.08682  832  LEU A CB    
2534 C  CG    . LEU B 137 ? 0.92389 0.78760 0.78400 0.07004  0.11773  0.09725  832  LEU A CG    
2535 C  CD1   . LEU B 137 ? 1.05372 0.88590 0.88550 0.06918  0.13304  0.09812  832  LEU A CD1   
2536 C  CD2   . LEU B 137 ? 0.92822 0.79010 0.78380 0.08634  0.12379  0.10363  832  LEU A CD2   
2537 N  N     . LEU B 138 ? 0.81943 0.72770 0.71937 0.01899  0.08422  0.07434  833  LEU A N     
2538 C  CA    . LEU B 138 ? 0.76025 0.69445 0.68263 0.01440  0.07115  0.07388  833  LEU A CA    
2539 C  C     . LEU B 138 ? 0.81444 0.74212 0.72691 0.00278  0.07433  0.07078  833  LEU A C     
2540 O  O     . LEU B 138 ? 0.82866 0.77041 0.75415 0.00321  0.06763  0.07271  833  LEU A O     
2541 C  CB    . LEU B 138 ? 0.72305 0.67746 0.66165 0.00778  0.06038  0.06986  833  LEU A CB    
2542 C  CG    . LEU B 138 ? 0.64071 0.61484 0.60108 0.01771  0.05049  0.07371  833  LEU A CG    
2543 C  CD1   . LEU B 138 ? 0.49685 0.49019 0.47234 0.01088  0.04027  0.07034  833  LEU A CD1   
2544 C  CD2   . LEU B 138 ? 0.71687 0.70077 0.68759 0.02534  0.04676  0.07907  833  LEU A CD2   
2545 N  N     . ASP B 139 ? 1.10111 1.00744 0.98937 -0.00898 0.08484  0.06559  834  ASP A N     
2546 C  CA    . ASP B 139 ? 1.14292 1.04229 1.01885 -0.02216 0.08910  0.06231  834  ASP A CA    
2547 C  C     . ASP B 139 ? 1.13059 1.01147 0.99529 -0.01345 0.09766  0.06752  834  ASP A C     
2548 O  O     . ASP B 139 ? 1.24437 1.12984 1.11136 -0.01905 0.09574  0.06738  834  ASP A O     
2549 C  CB    . ASP B 139 ? 1.24544 1.12620 1.09498 -0.03944 0.09929  0.05487  834  ASP A CB    
2550 C  CG    . ASP B 139 ? 1.25488 1.15528 1.11451 -0.04769 0.09138  0.05011  834  ASP A CG    
2551 O  OD1   . ASP B 139 ? 1.23224 1.16089 1.11947 -0.04111 0.07778  0.05245  834  ASP A OD1   
2552 O  OD2   . ASP B 139 ? 1.29304 1.17928 1.13105 -0.06100 0.09967  0.04407  834  ASP A OD2   
2553 N  N     . SER B 140 ? 0.96447 0.82565 0.81695 0.00114  0.10739  0.07280  835  SER A N     
2554 C  CA    . SER B 140 ? 0.92160 0.76818 0.76446 0.01262  0.11565  0.07954  835  SER A CA    
2555 C  C     . SER B 140 ? 0.91846 0.79368 0.78950 0.02290  0.10288  0.08524  835  SER A C     
2556 O  O     . SER B 140 ? 1.04073 0.91057 0.90803 0.02871  0.10664  0.08980  835  SER A O     
2557 C  CB    . SER B 140 ? 0.92200 0.74439 0.74528 0.02862  0.12959  0.08555  835  SER A CB    
2558 O  OG    . SER B 140 ? 0.88345 0.72984 0.72931 0.04484  0.12088  0.09212  835  SER A OG    
2559 N  N     . PHE B 141 ? 0.80926 0.71289 0.70621 0.02541  0.08899  0.08525  836  PHE A N     
2560 C  CA    . PHE B 141 ? 0.80546 0.73519 0.72675 0.03259  0.07731  0.08960  836  PHE A CA    
2561 C  C     . PHE B 141 ? 0.84793 0.78786 0.77794 0.02190  0.07037  0.08632  836  PHE A C     
2562 O  O     . PHE B 141 ? 0.88538 0.84175 0.83100 0.02691  0.06286  0.08968  836  PHE A O     
2563 C  CB    . PHE B 141 ? 0.73843 0.69181 0.68100 0.03608  0.06593  0.08979  836  PHE A CB    
2564 C  CG    . PHE B 141 ? 0.71147 0.66952 0.65639 0.05150  0.06804  0.09683  836  PHE A CG    
2565 C  CD1   . PHE B 141 ? 0.73492 0.67138 0.65906 0.06078  0.08171  0.10081  836  PHE A CD1   
2566 C  CD2   . PHE B 141 ? 0.68534 0.66947 0.65126 0.05654  0.05734  0.09981  836  PHE A CD2   
2567 C  CE1   . PHE B 141 ? 0.73254 0.67731 0.65899 0.07614  0.08396  0.10846  836  PHE A CE1   
2568 C  CE2   . PHE B 141 ? 0.68383 0.67683 0.65178 0.06943  0.05920  0.10663  836  PHE A CE2   
2569 C  CZ    . PHE B 141 ? 0.72801 0.70324 0.67726 0.07989  0.07217  0.11134  836  PHE A CZ    
2570 N  N     . ASP B 142 ? 1.02091 0.95288 0.94051 0.00681  0.07295  0.07993  837  ASP A N     
2571 C  CA    . ASP B 142 ? 1.09556 1.03922 1.02265 -0.00363 0.06689  0.07711  837  ASP A CA    
2572 C  C     . ASP B 142 ? 1.08319 1.00434 0.98871 -0.01042 0.07790  0.07627  837  ASP A C     
2573 O  O     . ASP B 142 ? 1.09577 1.02438 1.00345 -0.02164 0.07472  0.07322  837  ASP A O     
2574 C  CB    . ASP B 142 ? 1.18864 1.14866 1.12305 -0.01629 0.05990  0.07128  837  ASP A CB    
2575 C  CG    . ASP B 142 ? 1.26259 1.24315 1.21763 -0.00918 0.04945  0.07252  837  ASP A CG    
2576 O  OD1   . ASP B 142 ? 1.34726 1.32738 1.29919 -0.01229 0.05015  0.06972  837  ASP A OD1   
2577 O  OD2   . ASP B 142 ? 1.20634 1.20199 1.17895 -0.00120 0.04124  0.07609  837  ASP A OD2   
2578 N  N     . THR B 143 ? 0.81665 0.70989 0.70015 -0.00334 0.09161  0.07940  838  THR A N     
2579 C  CA    . THR B 143 ? 0.83126 0.70207 0.69535 -0.00567 0.10234  0.08068  838  THR A CA    
2580 C  C     . THR B 143 ? 0.79890 0.68254 0.67876 0.00533  0.09638  0.08678  838  THR A C     
2581 O  O     . THR B 143 ? 0.80205 0.67047 0.66933 0.00371  0.10348  0.08816  838  THR A O     
2582 C  CB    . THR B 143 ? 0.82954 0.66311 0.66174 0.00054  0.12104  0.08323  838  THR A CB    
2583 O  OG1   . THR B 143 ? 0.76301 0.60008 0.60168 0.02117  0.12169  0.09107  838  THR A OG1   
2584 C  CG2   . THR B 143 ? 0.89080 0.70741 0.70233 -0.01402 0.12871  0.07580  838  THR A CG2   
2585 N  N     . VAL B 144 ? 0.83385 0.74401 0.73908 0.01547  0.08421  0.09021  839  VAL A N     
2586 C  CA    . VAL B 144 ? 0.81228 0.73850 0.73366 0.02366  0.07711  0.09506  839  VAL A CA    
2587 C  C     . VAL B 144 ? 0.82566 0.77947 0.77115 0.01634  0.06184  0.09122  839  VAL A C     
2588 O  O     . VAL B 144 ? 0.83169 0.79386 0.78249 0.00927  0.05712  0.08674  839  VAL A O     
2589 C  CB    . VAL B 144 ? 0.82023 0.75295 0.74623 0.04182  0.07819  0.10319  839  VAL A CB    
2590 C  CG1   . VAL B 144 ? 0.87600 0.77981 0.77535 0.05122  0.09529  0.10830  839  VAL A CG1   
2591 C  CG2   . VAL B 144 ? 0.82780 0.77803 0.76785 0.04465  0.07047  0.10252  839  VAL A CG2   
2592 N  N     . PRO B 145 ? 0.90748 0.87475 0.86618 0.01795  0.05476  0.09298  840  PRO A N     
2593 C  CA    . PRO B 145 ? 0.84871 0.83873 0.82699 0.01202  0.04211  0.08976  840  PRO A CA    
2594 C  C     . PRO B 145 ? 0.79635 0.80148 0.78736 0.01540  0.03496  0.08937  840  PRO A C     
2595 O  O     . PRO B 145 ? 0.90172 0.90630 0.89224 0.02437  0.03691  0.09277  840  PRO A O     
2596 C  CB    . PRO B 145 ? 0.87322 0.87217 0.86129 0.01754  0.03750  0.09329  840  PRO A CB    
2597 C  CG    . PRO B 145 ? 0.86422 0.84325 0.83569 0.02106  0.04825  0.09662  840  PRO A CG    
2598 C  CD    . PRO B 145 ? 0.90679 0.86740 0.86097 0.02528  0.05910  0.09811  840  PRO A CD    
2599 N  N     . GLY B 146 ? 0.60667 0.62594 0.60842 0.00862  0.02715  0.08575  841  GLY A N     
2600 C  CA    . GLY B 146 ? 0.57071 0.60126 0.58197 0.01091  0.02162  0.08512  841  GLY A CA    
2601 C  C     . GLY B 146 ? 0.52451 0.56477 0.54613 0.02007  0.01687  0.08890  841  GLY A C     
2602 O  O     . GLY B 146 ? 0.49871 0.54184 0.52246 0.02432  0.01628  0.08989  841  GLY A O     
2603 N  N     . HIS B 147 ? 0.60063 0.64675 0.62790 0.02214  0.01366  0.09087  842  HIS A N     
2604 C  CA    . HIS B 147 ? 0.61750 0.67620 0.65423 0.02712  0.00819  0.09334  842  HIS A CA    
2605 C  C     . HIS B 147 ? 0.63657 0.69634 0.66984 0.03554  0.01213  0.09843  842  HIS A C     
2606 O  O     . HIS B 147 ? 0.66564 0.73854 0.70529 0.03837  0.00822  0.10053  842  HIS A O     
2607 C  CB    . HIS B 147 ? 0.65286 0.71771 0.69547 0.02503  0.00358  0.09311  842  HIS A CB    
2608 C  CG    . HIS B 147 ? 0.73068 0.78942 0.76802 0.02686  0.00759  0.09546  842  HIS A CG    
2609 N  ND1   . HIS B 147 ? 0.76213 0.80968 0.79229 0.02218  0.01176  0.09373  842  HIS A ND1   
2610 C  CD2   . HIS B 147 ? 0.74684 0.80985 0.78412 0.03256  0.00851  0.09969  842  HIS A CD2   
2611 C  CE1   . HIS B 147 ? 0.75113 0.79335 0.77665 0.02546  0.01542  0.09674  842  HIS A CE1   
2612 N  NE2   . HIS B 147 ? 0.75002 0.80241 0.78026 0.03248  0.01338  0.10068  842  HIS A NE2   
2613 N  N     . LEU B 148 ? 0.53935 0.58602 0.56099 0.03954  0.02063  0.10088  843  LEU A N     
2614 C  CA    . LEU B 148 ? 0.57306 0.62243 0.59025 0.05015  0.02563  0.10741  843  LEU A CA    
2615 C  C     . LEU B 148 ? 0.64906 0.70403 0.66739 0.05422  0.02586  0.10866  843  LEU A C     
2616 O  O     . LEU B 148 ? 0.66388 0.73244 0.68449 0.06196  0.02610  0.11413  843  LEU A O     
2617 C  CB    . LEU B 148 ? 0.58591 0.61530 0.58669 0.05466  0.03686  0.11027  843  LEU A CB    
2618 C  CG    . LEU B 148 ? 0.52541 0.55150 0.52436 0.05401  0.03786  0.11160  843  LEU A CG    
2619 C  CD1   . LEU B 148 ? 0.52843 0.53169 0.50782 0.05963  0.05099  0.11534  843  LEU A CD1   
2620 C  CD2   . LEU B 148 ? 0.45167 0.49978 0.46181 0.05936  0.03187  0.11602  843  LEU A CD2   
2621 N  N     . THR B 149 ? 0.71318 0.76039 0.73022 0.04878  0.02557  0.10388  844  THR A N     
2622 C  CA    . THR B 149 ? 0.67257 0.72276 0.68992 0.05222  0.02619  0.10460  844  THR A CA    
2623 C  C     . THR B 149 ? 0.68436 0.74653 0.71370 0.04623  0.01732  0.10084  844  THR A C     
2624 O  O     . THR B 149 ? 0.73577 0.80214 0.76673 0.04842  0.01689  0.10137  844  THR A O     
2625 C  CB    . THR B 149 ? 0.67918 0.70860 0.68238 0.05156  0.03471  0.10251  844  THR A CB    
2626 O  OG1   . THR B 149 ? 0.77105 0.79502 0.77480 0.04021  0.03186  0.09584  844  THR A OG1   
2627 C  CG2   . THR B 149 ? 0.68464 0.69680 0.67140 0.05775  0.04590  0.10648  844  THR A CG2   
2628 N  N     . GLU B 150 ? 0.70404 0.77063 0.74046 0.03942  0.01110  0.09746  845  GLU A N     
2629 C  CA    . GLU B 150 ? 0.73496 0.81067 0.77986 0.03554  0.00445  0.09510  845  GLU A CA    
2630 C  C     . GLU B 150 ? 0.80558 0.89394 0.85631 0.03476  -0.00034 0.09662  845  GLU A C     
2631 O  O     . GLU B 150 ? 0.81661 0.91137 0.87092 0.03211  -0.00397 0.09563  845  GLU A O     
2632 C  CB    . GLU B 150 ? 0.77396 0.84528 0.82035 0.02921  0.00206  0.09057  845  GLU A CB    
2633 C  CG    . GLU B 150 ? 0.88265 0.94290 0.92110 0.02701  0.00722  0.08845  845  GLU A CG    
2634 C  CD    . GLU B 150 ? 0.87992 0.94114 0.91989 0.02374  0.00556  0.08544  845  GLU A CD    
2635 O  OE1   . GLU B 150 ? 0.84849 0.91727 0.89552 0.02437  0.00083  0.08547  845  GLU A OE1   
2636 O  OE2   . GLU B 150 ? 0.92377 0.97725 0.95609 0.02004  0.00978  0.08307  845  GLU A OE2   
2637 N  N     . ASP B 151 ? 1.00542 1.09676 1.05545 0.03632  0.00028  0.09894  846  ASP A N     
2638 C  CA    . ASP B 151 ? 0.97248 1.07729 1.02603 0.03482  -0.00343 0.10053  846  ASP A CA    
2639 C  C     . ASP B 151 ? 0.91237 1.02681 0.96361 0.04155  -0.00007 0.10646  846  ASP A C     
2640 O  O     . ASP B 151 ? 0.99795 1.10430 1.04364 0.04806  0.00586  0.10931  846  ASP A O     
2641 C  CB    . ASP B 151 ? 0.99957 1.10147 1.05501 0.02956  -0.00686 0.09753  846  ASP A CB    
2642 C  CG    . ASP B 151 ? 1.04646 1.14908 1.10329 0.02389  -0.01069 0.09433  846  ASP A CG    
2643 O  OD1   . ASP B 151 ? 1.08057 1.19017 1.13687 0.02230  -0.01146 0.09489  846  ASP A OD1   
2644 O  OD2   . ASP B 151 ? 1.05513 1.15072 1.11221 0.02131  -0.01208 0.09162  846  ASP A OD2   
2645 N  N     . LEU B 152 ? 0.71899 0.85097 0.77267 0.03981  -0.00302 0.10864  847  LEU A N     
2646 C  CA    . LEU B 152 ? 0.76991 0.91823 0.82210 0.04688  -0.00015 0.11560  847  LEU A CA    
2647 C  C     . LEU B 152 ? 0.85348 1.00948 0.90616 0.04595  -0.00150 0.11720  847  LEU A C     
2648 O  O     . LEU B 152 ? 0.92691 1.09087 0.97698 0.05445  0.00263  0.12361  847  LEU A O     
2649 C  CB    . LEU B 152 ? 0.79060 0.96088 0.84455 0.04542  -0.00197 0.11828  847  LEU A CB    
2650 C  CG    . LEU B 152 ? 0.79529 0.96053 0.84960 0.04467  -0.00177 0.11627  847  LEU A CG    
2651 C  CD1   . LEU B 152 ? 0.78111 0.94083 0.83703 0.03325  -0.00679 0.10961  847  LEU A CD1   
2652 C  CD2   . LEU B 152 ? 0.79357 0.98032 0.84761 0.05021  0.00035  0.12263  847  LEU A CD2   
2653 N  N     . HIS B 153 ? 0.75725 0.91047 0.81206 0.03671  -0.00643 0.11203  848  HIS A N     
2654 C  CA    . HIS B 153 ? 0.75899 0.92208 0.81407 0.03405  -0.00844 0.11299  848  HIS A CA    
2655 C  C     . HIS B 153 ? 0.73528 0.88118 0.79057 0.03194  -0.00920 0.10922  848  HIS A C     
2656 O  O     . HIS B 153 ? 0.68586 0.83716 0.74133 0.02912  -0.01112 0.10915  848  HIS A O     
2657 C  CB    . HIS B 153 ? 0.72945 0.90713 0.78395 0.02367  -0.01276 0.11056  848  HIS A CB    
2658 C  CG    . HIS B 153 ? 0.69269 0.89464 0.74678 0.02444  -0.01218 0.11533  848  HIS A CG    
2659 N  ND1   . HIS B 153 ? 0.61552 0.83948 0.67001 0.03232  -0.00980 0.12319  848  HIS A ND1   
2660 C  CD2   . HIS B 153 ? 0.62653 0.83564 0.67944 0.01886  -0.01321 0.11403  848  HIS A CD2   
2661 C  CE1   . HIS B 153 ? 0.61340 0.85981 0.66765 0.03142  -0.00977 0.12669  848  HIS A CE1   
2662 N  NE2   . HIS B 153 ? 0.65943 0.89658 0.71272 0.02252  -0.01195 0.12084  848  HIS A NE2   
2663 N  N     . LEU B 154 ? 0.78972 0.91700 0.84470 0.03268  -0.00770 0.10621  849  LEU A N     
2664 C  CA    . LEU B 154 ? 0.67851 0.79247 0.73370 0.03014  -0.00830 0.10300  849  LEU A CA    
2665 C  C     . LEU B 154 ? 0.61471 0.72012 0.66594 0.03632  -0.00276 0.10625  849  LEU A C     
2666 O  O     . LEU B 154 ? 0.65879 0.75662 0.70554 0.04089  0.00230  0.10795  849  LEU A O     
2667 C  CB    . LEU B 154 ? 0.67198 0.77440 0.72819 0.02599  -0.00977 0.09807  849  LEU A CB    
2668 C  CG    . LEU B 154 ? 0.69671 0.80211 0.75363 0.02002  -0.01388 0.09489  849  LEU A CG    
2669 C  CD1   . LEU B 154 ? 0.66549 0.76186 0.72260 0.01835  -0.01441 0.09167  849  LEU A CD1   
2670 C  CD2   . LEU B 154 ? 0.69516 0.80077 0.75165 0.01677  -0.01590 0.09370  849  LEU A CD2   
2671 N  N     . TYR B 155 ? 0.50566 0.61033 0.55663 0.03619  -0.00286 0.10703  850  TYR A N     
2672 C  CA    . TYR B 155 ? 0.48605 0.57845 0.53098 0.04065  0.00322  0.10955  850  TYR A CA    
2673 C  C     . TYR B 155 ? 0.49424 0.57663 0.54031 0.03429  0.00120  0.10525  850  TYR A C     
2674 O  O     . TYR B 155 ? 0.45394 0.54197 0.50557 0.02910  -0.00466 0.10210  850  TYR A O     
2675 C  CB    . TYR B 155 ? 0.41398 0.51630 0.45601 0.04888  0.00672  0.11664  850  TYR A CB    
2676 C  CG    . TYR B 155 ? 0.44847 0.56400 0.48849 0.05719  0.00997  0.12270  850  TYR A CG    
2677 C  CD1   . TYR B 155 ? 0.40738 0.54487 0.45342 0.05449  0.00455  0.12304  850  TYR A CD1   
2678 C  CD2   . TYR B 155 ? 0.47848 0.58423 0.50869 0.06754  0.01939  0.12838  850  TYR A CD2   
2679 C  CE1   . TYR B 155 ? 0.34235 0.49550 0.38705 0.06168  0.00730  0.12901  850  TYR A CE1   
2680 C  CE2   . TYR B 155 ? 0.47769 0.59706 0.50580 0.07672  0.02288  0.13484  850  TYR A CE2   
2681 C  CZ    . TYR B 155 ? 0.47720 0.62227 0.51377 0.07369  0.01625  0.13525  850  TYR A CZ    
2682 O  OH    . TYR B 155 ? 0.57569 0.73768 0.61067 0.08235  0.01950  0.14202  850  TYR A OH    
2683 N  N     . SER B 156 ? 0.57850 0.64519 0.61753 0.03418  0.00688  0.10506  851  SER A N     
2684 C  CA    . SER B 156 ? 0.62742 0.68623 0.66594 0.02892  0.00644  0.10253  851  SER A CA    
2685 C  C     . SER B 156 ? 0.61124 0.66632 0.64436 0.03431  0.01110  0.10725  851  SER A C     
2686 O  O     . SER B 156 ? 0.59332 0.65031 0.62130 0.04306  0.01617  0.11300  851  SER A O     
2687 C  CB    . SER B 156 ? 0.61996 0.66501 0.65216 0.02285  0.01030  0.09907  851  SER A CB    
2688 O  OG    . SER B 156 ? 0.66180 0.69308 0.68147 0.02647  0.01948  0.10167  851  SER A OG    
2689 N  N     . LEU B 157 ? 0.49259 0.54304 0.52652 0.02985  0.00978  0.10539  852  LEU A N     
2690 C  CA    . LEU B 157 ? 0.46492 0.50931 0.49272 0.03458  0.01482  0.10976  852  LEU A CA    
2691 C  C     . LEU B 157 ? 0.51830 0.54349 0.53051 0.03923  0.02643  0.11330  852  LEU A C     
2692 O  O     . LEU B 157 ? 0.59621 0.61806 0.60079 0.04867  0.03306  0.11985  852  LEU A O     
2693 C  CB    . LEU B 157 ? 0.49185 0.53201 0.52243 0.02752  0.01177  0.10628  852  LEU A CB    
2694 C  CG    . LEU B 157 ? 0.42295 0.47812 0.46509 0.02458  0.00246  0.10377  852  LEU A CG    
2695 C  CD1   . LEU B 157 ? 0.39991 0.45000 0.44492 0.01660  -0.00063 0.09908  852  LEU A CD1   
2696 C  CD2   . LEU B 157 ? 0.41600 0.48048 0.45890 0.03044  0.00222  0.10838  852  LEU A CD2   
2697 N  N     . ASN B 158 ? 0.57645 0.58867 0.58197 0.03286  0.02990  0.10936  853  ASN A N     
2698 C  CA    . ASN B 158 ? 0.60300 0.59323 0.58992 0.03557  0.04230  0.11172  853  ASN A CA    
2699 C  C     . ASN B 158 ? 0.65323 0.64719 0.63625 0.04862  0.04699  0.11821  853  ASN A C     
2700 O  O     . ASN B 158 ? 0.62917 0.60929 0.59736 0.05813  0.05798  0.12448  853  ASN A O     
2701 C  CB    . ASN B 158 ? 0.54887 0.52951 0.53035 0.02415  0.04370  0.10537  853  ASN A CB    
2702 C  CG    . ASN B 158 ? 0.70010 0.65323 0.65808 0.02302  0.05783  0.10616  853  ASN A CG    
2703 O  OD1   . ASN B 158 ? 0.81768 0.75492 0.76179 0.03088  0.06766  0.11155  853  ASN A OD1   
2704 N  ND2   . ASN B 158 ? 0.78377 0.73028 0.73519 0.01303  0.05982  0.10093  853  ASN A ND2   
2705 N  N     . ASP B 159 ? 0.62089 0.63333 0.61590 0.04967  0.03954  0.11726  854  ASP A N     
2706 C  CA    . ASP B 159 ? 0.63945 0.65914 0.63193 0.06119  0.04327  0.12334  854  ASP A CA    
2707 C  C     . ASP B 159 ? 0.62278 0.65784 0.61759 0.07228  0.04381  0.13133  854  ASP A C     
2708 O  O     . ASP B 159 ? 0.60600 0.63945 0.59077 0.08516  0.05270  0.13934  854  ASP A O     
2709 C  CB    . ASP B 159 ? 0.74363 0.78044 0.74862 0.05793  0.03464  0.12001  854  ASP A CB    
2710 C  CG    . ASP B 159 ? 0.77037 0.79780 0.77595 0.04665  0.03221  0.11223  854  ASP A CG    
2711 O  OD1   . ASP B 159 ? 0.80979 0.81652 0.80166 0.04340  0.04032  0.11051  854  ASP A OD1   
2712 O  OD2   . ASP B 159 ? 0.66750 0.70859 0.68576 0.04086  0.02285  0.10810  854  ASP A OD2   
2713 N  N     . LEU B 160 ? 0.54986 0.60093 0.55688 0.06788  0.03490  0.12969  855  LEU A N     
2714 C  CA    . LEU B 160 ? 0.56473 0.63425 0.57429 0.07680  0.03470  0.13700  855  LEU A CA    
2715 C  C     . LEU B 160 ? 0.55134 0.60369 0.54628 0.08607  0.04608  0.14352  855  LEU A C     
2716 O  O     . LEU B 160 ? 0.57127 0.63294 0.56044 0.09995  0.05245  0.15307  855  LEU A O     
2717 C  CB    . LEU B 160 ? 0.49595 0.58240 0.51901 0.06811  0.02355  0.13267  855  LEU A CB    
2718 C  CG    . LEU B 160 ? 0.42742 0.52779 0.46054 0.06069  0.01498  0.12747  855  LEU A CG    
2719 C  CD1   . LEU B 160 ? 0.37256 0.48328 0.41523 0.05074  0.00544  0.12192  855  LEU A CD1   
2720 C  CD2   . LEU B 160 ? 0.43446 0.55593 0.46820 0.06849  0.01599  0.13370  855  LEU A CD2   
2721 N  N     . THR B 161 ? 0.48988 0.51707 0.47700 0.07893  0.04981  0.13905  856  THR A N     
2722 C  CA    . THR B 161 ? 0.55622 0.56168 0.52587 0.08666  0.06238  0.14487  856  THR A CA    
2723 C  C     . THR B 161 ? 0.62371 0.60983 0.57401 0.09698  0.07640  0.15031  856  THR A C     
2724 O  O     . THR B 161 ? 0.58163 0.56638 0.52069 0.11276  0.08635  0.16049  856  THR A O     
2725 C  CB    . THR B 161 ? 0.55725 0.54045 0.52190 0.07393  0.06320  0.13803  856  THR A CB    
2726 O  OG1   . THR B 161 ? 0.54670 0.54756 0.52816 0.06675  0.05123  0.13415  856  THR A OG1   
2727 C  CG2   . THR B 161 ? 0.54822 0.50406 0.49121 0.08067  0.07793  0.14372  856  THR A CG2   
2728 N  N     . ALA B 162 ? 0.78329 0.75475 0.72851 0.08886  0.07791  0.14405  857  ALA A N     
2729 C  CA    . ALA B 162 ? 0.75745 0.70835 0.68291 0.09721  0.09140  0.14801  857  ALA A CA    
2730 C  C     . ALA B 162 ? 0.69591 0.66793 0.62388 0.11491  0.09342  0.15799  857  ALA A C     
2731 O  O     . ALA B 162 ? 0.70046 0.65602 0.60871 0.12883  0.10793  0.16591  857  ALA A O     
2732 C  CB    . ALA B 162 ? 0.78003 0.72144 0.70509 0.08413  0.08893  0.13888  857  ALA A CB    
2733 N  N     . THR B 163 ? 0.57952 0.58786 0.52969 0.11443  0.07994  0.15804  858  THR A N     
2734 C  CA    . THR B 163 ? 0.55249 0.58836 0.50656 0.12972  0.08071  0.16809  858  THR A CA    
2735 C  C     . THR B 163 ? 0.65384 0.69647 0.60086 0.14444  0.08797  0.17917  858  THR A C     
2736 O  O     . THR B 163 ? 0.64558 0.69288 0.58159 0.16247  0.09844  0.19046  858  THR A O     
2737 C  CB    . THR B 163 ? 0.50684 0.57864 0.48401 0.12169  0.06484  0.16420  858  THR A CB    
2738 O  OG1   . THR B 163 ? 0.56263 0.62650 0.54549 0.10889  0.05876  0.15439  858  THR A OG1   
2739 C  CG2   . THR B 163 ? 0.51800 0.62062 0.49851 0.13464  0.06554  0.17377  858  THR A CG2   
2740 N  N     . ARG B 164 ? 0.80758 0.85227 0.76060 0.13813  0.08289  0.17685  859  ARG A N     
2741 C  CA    . ARG B 164 ? 0.81044 0.86165 0.75652 0.15228  0.08993  0.18761  859  ARG A CA    
2742 C  C     . ARG B 164 ? 0.83759 0.84958 0.75593 0.16383  0.10915  0.19375  859  ARG A C     
2743 O  O     . ARG B 164 ? 0.97224 0.98821 0.87831 0.18367  0.12059  0.20672  859  ARG A O     
2744 C  CB    . ARG B 164 ? 0.84541 0.90515 0.80319 0.14232  0.08050  0.18321  859  ARG A CB    
2745 C  CG    . ARG B 164 ? 0.91787 0.98531 0.86844 0.15730  0.08785  0.19475  859  ARG A CG    
2746 C  CD    . ARG B 164 ? 0.92277 0.97880 0.87525 0.14869  0.08477  0.19041  859  ARG A CD    
2747 N  NE    . ARG B 164 ? 0.98013 1.00504 0.93057 0.13149  0.08275  0.17823  859  ARG A NE    
2748 C  CZ    . ARG B 164 ? 0.98668 0.97435 0.91910 0.12973  0.09366  0.17719  859  ARG A CZ    
2749 N  NH1   . ARG B 164 ? 1.01238 0.98420 0.92546 0.14525  0.10851  0.18769  859  ARG A NH1   
2750 N  NH2   . ARG B 164 ? 0.92759 0.89433 0.85989 0.11231  0.09045  0.16604  859  ARG A NH2   
2751 N  N     . LYS B 165 ? 0.77258 0.74650 0.67863 0.15169  0.11403  0.18503  860  LYS A N     
2752 C  CA    . LYS B 165 ? 0.89778 0.82994 0.77274 0.16055  0.13420  0.18989  860  LYS A CA    
2753 C  C     . LYS B 165 ? 1.06896 0.99601 0.93051 0.17453  0.14483  0.19645  860  LYS A C     
2754 O  O     . LYS B 165 ? 1.18459 1.07591 1.01779 0.18367  0.16333  0.20054  860  LYS A O     
2755 C  CB    . LYS B 165 ? 0.93344 0.82868 0.79700 0.14104  0.13691  0.17816  860  LYS A CB    
2756 C  CG    . LYS B 165 ? 0.99450 0.88162 0.85931 0.13227  0.13460  0.17516  860  LYS A CG    
2757 C  CD    . LYS B 165 ? 1.05281 0.90287 0.90161 0.11341  0.14025  0.16506  860  LYS A CD    
2758 C  CE    . LYS B 165 ? 1.08319 0.92686 0.93328 0.10571  0.13829  0.16302  860  LYS A CE    
2759 N  NZ    . LYS B 165 ? 1.12640 0.93444 0.95740 0.08737  0.14593  0.15451  860  LYS A NZ    
2760 N  N     . GLY B 166 ? 1.04459 1.00551 0.92511 0.17573  0.13401  0.19642  861  GLY A N     
2761 C  CA    . GLY B 166 ? 1.00408 0.96669 0.87487 0.19031  0.14273  0.20364  861  GLY A CA    
2762 C  C     . GLY B 166 ? 0.97257 0.89726 0.82492 0.18330  0.15174  0.19675  861  GLY A C     
2763 O  O     . GLY B 166 ? 0.96935 0.88134 0.80373 0.19795  0.16514  0.20379  861  GLY A O     
2764 N  N     . GLU B 167 ? 1.04141 0.94905 0.89718 0.16114  0.14504  0.18312  862  GLU A N     
2765 C  CA    . GLU B 167 ? 1.06752 0.94145 0.90561 0.15121  0.15285  0.17544  862  GLU A CA    
2766 C  C     . GLU B 167 ? 1.02964 0.92346 0.88774 0.13945  0.13879  0.16680  862  GLU A C     
2767 O  O     . GLU B 167 ? 1.12327 0.99532 0.96761 0.13484  0.14543  0.16238  862  GLU A O     
2768 C  CB    . GLU B 167 ? 1.14800 0.98796 0.97143 0.13369  0.15759  0.16666  862  GLU A CB    
2769 C  CG    . GLU B 167 ? 1.21860 1.07930 1.06549 0.11992  0.14160  0.16039  862  GLU A CG    
2770 C  CD    . GLU B 167 ? 1.27545 1.10734 1.10971 0.10050  0.14497  0.15102  862  GLU A CD    
2771 O  OE1   . GLU B 167 ? 1.32580 1.15808 1.16618 0.08288  0.13775  0.14063  862  GLU A OE1   
2772 O  OE2   . GLU B 167 ? 1.29645 1.10785 1.11509 0.10264  0.15457  0.15439  862  GLU A OE2   
2773 N  N     . LEU B 168 ? 0.79157 0.72440 0.67964 0.13441  0.12060  0.16435  863  LEU A N     
2774 C  CA    . LEU B 168 ? 0.75906 0.70729 0.66432 0.12257  0.10807  0.15592  863  LEU A CA    
2775 C  C     . LEU B 168 ? 0.81486 0.77618 0.72065 0.13475  0.11030  0.16159  863  LEU A C     
2776 O  O     . LEU B 168 ? 0.78287 0.73681 0.68783 0.12803  0.10923  0.15570  863  LEU A O     
2777 C  CB    . LEU B 168 ? 0.66606 0.64591 0.59880 0.11239  0.08992  0.15109  863  LEU A CB    
2778 C  CG    . LEU B 168 ? 0.70125 0.69670 0.65119 0.10084  0.07728  0.14299  863  LEU A CG    
2779 C  CD1   . LEU B 168 ? 0.73048 0.69942 0.66961 0.08885  0.08111  0.13453  863  LEU A CD1   
2780 C  CD2   . LEU B 168 ? 0.66489 0.68364 0.63619 0.09080  0.06235  0.13823  863  LEU A CD2   
2781 N  N     . GLY B 169 ? 0.85511 0.83806 0.76248 0.15251  0.11331  0.17326  864  GLY A N     
2782 C  CA    . GLY B 169 ? 0.85148 0.84499 0.75490 0.16690  0.11876  0.18080  864  GLY A CA    
2783 C  C     . GLY B 169 ? 0.96280 0.91657 0.83893 0.17202  0.13535  0.18100  864  GLY A C     
2784 O  O     . GLY B 169 ? 1.00605 0.95879 0.88264 0.17026  0.13461  0.17790  864  GLY A O     
2785 N  N     . PRO B 170 ? 1.05931 0.97778 0.90906 0.17821  0.15159  0.18465  865  PRO A N     
2786 C  CA    . PRO B 170 ? 1.10615 0.98084 0.92442 0.18143  0.16973  0.18415  865  PRO A CA    
2787 C  C     . PRO B 170 ? 1.13294 0.99051 0.95094 0.16055  0.16503  0.17022  865  PRO A C     
2788 O  O     . PRO B 170 ? 1.20214 1.04459 1.00698 0.16381  0.17277  0.16975  865  PRO A O     
2789 C  CB    . PRO B 170 ? 1.11499 0.95402 0.90686 0.18467  0.18526  0.18741  865  PRO A CB    
2790 C  CG    . PRO B 170 ? 1.08672 0.95811 0.89422 0.19715  0.17982  0.19641  865  PRO A CG    
2791 C  CD    . PRO B 170 ? 1.04471 0.96337 0.88897 0.18738  0.15686  0.19244  865  PRO A CD    
2792 N  N     . ARG B 171 ? 1.22793 1.08776 1.05887 0.13974  0.15332  0.15934  866  ARG A N     
2793 C  CA    . ARG B 171 ? 1.25294 1.10245 1.08495 0.12029  0.14824  0.14699  866  ARG A CA    
2794 C  C     . ARG B 171 ? 1.22898 1.10895 1.08432 0.12001  0.13497  0.14504  866  ARG A C     
2795 O  O     . ARG B 171 ? 1.26190 1.13157 1.11312 0.11085  0.13498  0.13809  866  ARG A O     
2796 C  CB    . ARG B 171 ? 1.24986 1.10071 1.09175 0.10009  0.13853  0.13747  866  ARG A CB    
2797 C  CG    . ARG B 171 ? 1.32684 1.14594 1.14472 0.09703  0.15155  0.13802  866  ARG A CG    
2798 C  CD    . ARG B 171 ? 1.35818 1.16082 1.16892 0.07299  0.15041  0.12612  866  ARG A CD    
2799 N  NE    . ARG B 171 ? 1.28697 1.12245 1.12833 0.05995  0.13057  0.11873  866  ARG A NE    
2800 C  CZ    . ARG B 171 ? 1.23179 1.08970 1.09425 0.05599  0.11822  0.11785  866  ARG A CZ    
2801 N  NH1   . ARG B 171 ? 1.21510 1.06840 1.07345 0.06331  0.12241  0.12355  866  ARG A NH1   
2802 N  NH2   . ARG B 171 ? 1.19285 1.07695 1.07942 0.04547  0.10234  0.11162  866  ARG A NH2   
2803 N  N     . LEU B 172 ? 1.00965 0.92697 0.88809 0.12899  0.12413  0.15098  867  LEU A N     
2804 C  CA    . LEU B 172 ? 0.89059 0.83695 0.78982 0.12833  0.11220  0.14964  867  LEU A CA    
2805 C  C     . LEU B 172 ? 0.91937 0.86809 0.80938 0.14591  0.12130  0.15848  867  LEU A C     
2806 O  O     . LEU B 172 ? 0.91879 0.87426 0.81523 0.14315  0.11699  0.15521  867  LEU A O     
2807 C  CB    . LEU B 172 ? 0.79862 0.78389 0.72487 0.12640  0.09653  0.15079  867  LEU A CB    
2808 C  CG    . LEU B 172 ? 0.79191 0.77914 0.73085 0.10876  0.08531  0.14139  867  LEU A CG    
2809 C  CD1   . LEU B 172 ? 0.81301 0.83650 0.77701 0.10523  0.06995  0.14092  867  LEU A CD1   
2810 C  CD2   . LEU B 172 ? 0.78088 0.74940 0.71578 0.09400  0.08430  0.13109  867  LEU A CD2   
2811 N  N     . ALA B 173 ? 0.92892 0.87326 0.80385 0.16483  0.13410  0.17025  868  ALA A N     
2812 C  CA    . ALA B 173 ? 0.95626 0.89975 0.81831 0.18374  0.14555  0.17987  868  ALA A CA    
2813 C  C     . ALA B 173 ? 0.95873 0.86121 0.79634 0.18029  0.15801  0.17443  868  ALA A C     
2814 O  O     . ALA B 173 ? 0.92818 0.83399 0.76442 0.18647  0.16006  0.17602  868  ALA A O     
2815 C  CB    . ALA B 173 ? 1.02778 0.97164 0.87492 0.20603  0.15904  0.19446  868  ALA A CB    
2816 N  N     . GLU B 174 ? 1.04712 0.91113 0.86442 0.16906  0.16653  0.16760  869  GLU A N     
2817 C  CA    . GLU B 174 ? 1.15825 0.98320 0.95101 0.16074  0.17773  0.16034  869  GLU A CA    
2818 C  C     . GLU B 174 ? 1.19764 1.03798 1.00933 0.14628  0.16383  0.15045  869  GLU A C     
2819 O  O     . GLU B 174 ? 1.25549 1.07470 1.05135 0.14513  0.17182  0.14729  869  GLU A O     
2820 C  CB    . GLU B 174 ? 1.24223 1.03087 1.01386 0.14549  0.18588  0.15301  869  GLU A CB    
2821 C  CG    . GLU B 174 ? 1.34873 1.08548 1.07868 0.14444  0.20795  0.15099  869  GLU A CG    
2822 C  CD    . GLU B 174 ? 1.36372 1.07271 1.07870 0.11889  0.21033  0.13841  869  GLU A CD    
2823 O  OE1   . GLU B 174 ? 1.34932 1.07540 1.08335 0.09976  0.19557  0.12785  869  GLU A OE1   
2824 O  OE2   . GLU B 174 ? 1.39286 1.06548 1.07821 0.11757  0.22625  0.13816  869  GLU A OE2   
2825 N  N     . LEU B 175 ? 0.93517 0.81044 0.77887 0.13558  0.14399  0.14569  870  LEU A N     
2826 C  CA    . LEU B 175 ? 0.76633 0.65570 0.62763 0.12216  0.13105  0.13674  870  LEU A CA    
2827 C  C     . LEU B 175 ? 0.78025 0.70020 0.65923 0.13273  0.12374  0.14205  870  LEU A C     
2828 O  O     . LEU B 175 ? 0.85888 0.77854 0.74096 0.12762  0.12066  0.13712  870  LEU A O     
2829 C  CB    . LEU B 175 ? 0.71553 0.62260 0.59872 0.10467  0.11510  0.12859  870  LEU A CB    
2830 C  CG    . LEU B 175 ? 0.76446 0.64715 0.63474 0.08754  0.11839  0.11993  870  LEU A CG    
2831 C  CD1   . LEU B 175 ? 0.73270 0.63706 0.62637 0.07092  0.10173  0.11149  870  LEU A CD1   
2832 C  CD2   . LEU B 175 ? 0.83955 0.68588 0.68066 0.08204  0.13292  0.11547  870  LEU A CD2   
2833 N  N     . THR B 176 ? 0.81656 0.76498 0.70733 0.14612  0.12056  0.15180  871  THR A N     
2834 C  CA    . THR B 176 ? 0.74626 0.72572 0.65153 0.15534  0.11481  0.15745  871  THR A CA    
2835 C  C     . THR B 176 ? 0.83746 0.80246 0.72249 0.17267  0.13001  0.16526  871  THR A C     
2836 O  O     . THR B 176 ? 0.76646 0.75684 0.66143 0.18122  0.12673  0.17063  871  THR A O     
2837 C  CB    . THR B 176 ? 0.76109 0.77929 0.68363 0.16274  0.10717  0.16567  871  THR A CB    
2838 O  OG1   . THR B 176 ? 0.79209 0.80354 0.69810 0.18005  0.12046  0.17672  871  THR A OG1   
2839 C  CG2   . THR B 176 ? 0.77241 0.80315 0.71329 0.14623  0.09297  0.15804  871  THR A CG2   
2840 N  N     . ARG B 177 ? 1.02115 0.94566 0.87633 0.17817  0.14745  0.16644  872  ARG A N     
2841 C  CA    . ARG B 177 ? 1.05848 0.95931 0.88859 0.19343  0.16449  0.17240  872  ARG A CA    
2842 C  C     . ARG B 177 ? 0.98702 0.85953 0.80633 0.17978  0.16672  0.16120  872  ARG A C     
2843 O  O     . ARG B 177 ? 0.95753 0.83476 0.77773 0.18522  0.16738  0.16226  872  ARG A O     
2844 C  CB    . ARG B 177 ? 1.15006 1.01780 0.94807 0.20819  0.18532  0.18078  872  ARG A CB    
2845 C  CG    . ARG B 177 ? 1.18756 1.08008 0.98584 0.23384  0.19167  0.19715  872  ARG A CG    
2846 C  CD    . ARG B 177 ? 1.23501 1.09240 1.00733 0.24678  0.21149  0.19575  872  ARG A CD    
2847 N  NE    . ARG B 177 ? 1.24748 1.07167 1.00481 0.23405  0.21611  0.18923  872  ARG A NE    
2848 C  CZ    . ARG B 177 ? 1.20017 1.03488 0.96365 0.23624  0.21406  0.19255  872  ARG A CZ    
2849 N  NH1   . ARG B 177 ? 1.21231 1.09067 0.99627 0.25051  0.20774  0.20217  872  ARG A NH1   
2850 N  NH2   . ARG B 177 ? 1.14126 0.94397 0.89009 0.22297  0.21844  0.18573  872  ARG A NH2   
2851 N  N     . ALA B 178 ? 1.08553 0.93039 0.89426 0.16163  0.16801  0.15061  873  ALA A N     
2852 C  CA    . ALA B 178 ? 1.10507 0.92964 0.90641 0.14533  0.16775  0.13902  873  ALA A CA    
2853 C  C     . ALA B 178 ? 1.14334 1.00142 0.97446 0.13924  0.15019  0.13494  873  ALA A C     
2854 O  O     . ALA B 178 ? 1.21530 1.06409 1.04078 0.13743  0.15245  0.13127  873  ALA A O     
2855 C  CB    . ALA B 178 ? 1.00205 0.80718 0.79614 0.12346  0.16655  0.12817  873  ALA A CB    
2856 N  N     . GLY B 179 ? 0.87437 0.76982 0.73548 0.13606  0.13352  0.13563  874  GLY A N     
2857 C  CA    . GLY B 179 ? 0.81126 0.73612 0.69810 0.13022  0.11816  0.13220  874  GLY A CA    
2858 C  C     . GLY B 179 ? 0.79486 0.73686 0.68491 0.14673  0.12048  0.14103  874  GLY A C     
2859 O  O     . GLY B 179 ? 0.82020 0.76749 0.71686 0.14369  0.11608  0.13763  874  GLY A O     
2860 N  N     . ALA B 180 ? 0.62324 0.57628 0.50880 0.16461  0.12745  0.15297  875  ALA A N     
2861 C  CA    . ALA B 180 ? 0.58161 0.55731 0.47094 0.18111  0.12961  0.16283  875  ALA A CA    
2862 C  C     . ALA B 180 ? 0.71849 0.66487 0.58479 0.18970  0.14386  0.16359  875  ALA A C     
2863 O  O     . ALA B 180 ? 0.69111 0.65459 0.56403 0.19705  0.14224  0.16732  875  ALA A O     
2864 C  CB    . ALA B 180 ? 0.47936 0.47536 0.36694 0.19945  0.13526  0.17661  875  ALA A CB    
2865 N  N     . THR B 181 ? 0.96025 0.86184 0.79786 0.18810  0.15849  0.15993  876  THR A N     
2866 C  CA    . THR B 181 ? 1.01748 0.88708 0.82982 0.19470  0.17320  0.15962  876  THR A CA    
2867 C  C     . THR B 181 ? 1.00938 0.87026 0.82769 0.17533  0.16497  0.14625  876  THR A C     
2868 O  O     . THR B 181 ? 1.03897 0.89077 0.84903 0.18039  0.17030  0.14620  876  THR A O     
2869 C  CB    . THR B 181 ? 1.05041 0.87128 0.82356 0.20078  0.19525  0.16139  876  THR A CB    
2870 O  OG1   . THR B 181 ? 1.04337 0.83853 0.80876 0.17777  0.19364  0.14829  876  THR A OG1   
2871 C  CG2   . THR B 181 ? 1.08979 0.91718 0.85591 0.21962  0.20390  0.17469  876  THR A CG2   
2872 N  N     . HIS B 182 ? 0.90973 0.77441 0.74196 0.15413  0.15239  0.13547  877  HIS A N     
2873 C  CA    . HIS B 182 ? 0.84833 0.71228 0.68943 0.13739  0.14328  0.12429  877  HIS A CA    
2874 C  C     . HIS B 182 ? 0.81133 0.70890 0.67720 0.14182  0.13129  0.12685  877  HIS A C     
2875 O  O     . HIS B 182 ? 0.79268 0.68323 0.65620 0.13913  0.13160  0.12268  877  HIS A O     
2876 C  CB    . HIS B 182 ? 0.79285 0.66237 0.64710 0.11644  0.13121  0.11441  877  HIS A CB    
2877 C  CG    . HIS B 182 ? 0.84855 0.72616 0.71646 0.10136  0.11996  0.10484  877  HIS A CG    
2878 N  ND1   . HIS B 182 ? 0.85435 0.70659 0.70524 0.08769  0.12529  0.09554  877  HIS A ND1   
2879 C  CD2   . HIS B 182 ? 0.83086 0.73890 0.72607 0.09804  0.10460  0.10357  877  HIS A CD2   
2880 C  CE1   . HIS B 182 ? 0.83236 0.70120 0.70116 0.07775  0.11310  0.08949  877  HIS A CE1   
2881 N  NE2   . HIS B 182 ? 0.81724 0.71797 0.71239 0.08413  0.10086  0.09424  877  HIS A NE2   
2882 N  N     . VAL B 183 ? 0.84844 0.78251 0.73708 0.14726  0.12090  0.13332  878  VAL A N     
2883 C  CA    . VAL B 183 ? 0.80942 0.77687 0.72051 0.14912  0.10963  0.13564  878  VAL A CA    
2884 C  C     . VAL B 183 ? 0.82492 0.79323 0.72517 0.16767  0.12016  0.14476  878  VAL A C     
2885 O  O     . VAL B 183 ? 0.78970 0.77025 0.69944 0.16706  0.11508  0.14369  878  VAL A O     
2886 C  CB    . VAL B 183 ? 0.76709 0.77154 0.70124 0.14758  0.09723  0.13959  878  VAL A CB    
2887 C  CG1   . VAL B 183 ? 0.71042 0.75095 0.66257 0.15178  0.08905  0.14469  878  VAL A CG1   
2888 C  CG2   . VAL B 183 ? 0.75093 0.75565 0.69790 0.12854  0.08541  0.12959  878  VAL A CG2   
2889 N  N     . GLU B 184 ? 0.89691 0.85154 0.77605 0.18514  0.13571  0.15428  879  GLU A N     
2890 C  CA    . GLU B 184 ? 1.00282 0.95650 0.86876 0.20503  0.14774  0.16399  879  GLU A CA    
2891 C  C     . GLU B 184 ? 1.05401 0.97179 0.90107 0.20154  0.15634  0.15677  879  GLU A C     
2892 O  O     . GLU B 184 ? 1.14596 1.07016 0.99207 0.21143  0.15937  0.16087  879  GLU A O     
2893 C  CB    . GLU B 184 ? 1.00044 0.94508 0.84503 0.22641  0.16438  0.17683  879  GLU A CB    
2894 C  CG    . GLU B 184 ? 1.07064 1.01598 0.89944 0.25095  0.17889  0.18939  879  GLU A CG    
2895 C  CD    . GLU B 184 ? 1.11873 1.11939 0.97265 0.25998  0.16859  0.19912  879  GLU A CD    
2896 O  OE1   . GLU B 184 ? 1.11200 1.12479 0.95778 0.28117  0.17959  0.21000  879  GLU A OE1   
2897 O  OE2   . GLU B 184 ? 1.12237 1.15572 1.00491 0.24396  0.14983  0.19362  879  GLU A OE2   
2898 N  N     . ARG B 185 ? 0.92954 0.81176 0.76176 0.18636  0.15991  0.14581  880  ARG A N     
2899 C  CA    . ARG B 185 ? 0.96369 0.80687 0.77165 0.18155  0.17086  0.13851  880  ARG A CA    
2900 C  C     . ARG B 185 ? 0.92533 0.77133 0.74836 0.15951  0.15718  0.12506  880  ARG A C     
2901 O  O     . ARG B 185 ? 0.89001 0.71180 0.69759 0.15550  0.16376  0.11924  880  ARG A O     
2902 C  CB    . ARG B 185 ? 1.02050 0.81775 0.79344 0.17946  0.18840  0.13603  880  ARG A CB    
2903 C  CG    . ARG B 185 ? 1.10511 0.89787 0.88406 0.15633  0.17960  0.12514  880  ARG A CG    
2904 C  CD    . ARG B 185 ? 1.19885 0.94264 0.94019 0.14748  0.19688  0.11918  880  ARG A CD    
2905 N  NE    . ARG B 185 ? 1.24364 0.95742 0.95213 0.16770  0.21905  0.12941  880  ARG A NE    
2906 C  CZ    . ARG B 185 ? 1.19103 0.87705 0.87519 0.16767  0.23201  0.13089  880  ARG A CZ    
2907 N  NH1   . ARG B 185 ? 1.16341 0.85019 0.85389 0.14760  0.22413  0.12254  880  ARG A NH1   
2908 N  NH2   . ARG B 185 ? 1.12403 0.78672 0.78539 0.18715  0.24896  0.13710  880  ARG A NH2   
2909 N  N     . CYS B 186 ? 0.86816 0.74146 0.71870 0.14565  0.13952  0.12024  881  CYS A N     
2910 C  CA    . CYS B 186 ? 0.89399 0.77230 0.75908 0.12627  0.12678  0.10882  881  CYS A CA    
2911 C  C     . CYS B 186 ? 0.95849 0.87543 0.85414 0.12711  0.11122  0.11120  881  CYS A C     
2912 O  O     . CYS B 186 ? 1.02201 0.96664 0.93707 0.12679  0.10127  0.11471  881  CYS A O     
2913 C  CB    . CYS B 186 ? 0.85553 0.73029 0.72365 0.10906  0.12087  0.10115  881  CYS A CB    
2914 S  SG    . CYS B 186 ? 0.79422 0.69475 0.69177 0.08984  0.10043  0.09186  881  CYS A SG    
2915 N  N     . MET B 187 ? 1.22537 1.14282 1.12361 0.12724  0.10975  0.10901  882  MET A N     
2916 C  CA    . MET B 187 ? 1.23356 1.18470 1.15621 0.12942  0.09790  0.11235  882  MET A CA    
2917 C  C     . MET B 187 ? 1.14077 1.10244 1.08239 0.11214  0.08338  0.10323  882  MET A C     
2918 O  O     . MET B 187 ? 1.17801 1.15925 1.13533 0.11135  0.07520  0.10380  882  MET A O     
2919 C  CB    . MET B 187 ? 1.36345 1.31240 1.27779 0.14330  0.10591  0.11791  882  MET A CB    
2920 C  CG    . MET B 187 ? 1.46984 1.40651 1.36214 0.16316  0.12257  0.12836  882  MET A CG    
2921 S  SD    . MET B 187 ? 1.52427 1.48555 1.41857 0.18545  0.12779  0.14194  882  MET A SD    
2922 C  CE    . MET B 187 ? 1.54781 1.51659 1.43069 0.20490  0.13896  0.15584  882  MET A CE    
2923 N  N     . LEU B 188 ? 0.76696 0.71625 0.70611 0.09859  0.08086  0.09535  883  LEU A N     
2924 C  CA    . LEU B 188 ? 0.65295 0.62018 0.61267 0.08548  0.06661  0.09026  883  LEU A CA    
2925 C  C     . LEU B 188 ? 0.72447 0.71492 0.69841 0.08764  0.05995  0.09561  883  LEU A C     
2926 O  O     . LEU B 188 ? 0.66188 0.67238 0.65399 0.08133  0.04874  0.09455  883  LEU A O     
2927 C  CB    . LEU B 188 ? 0.62817 0.57907 0.58000 0.07168  0.06682  0.08163  883  LEU A CB    
2928 C  CG    . LEU B 188 ? 0.62524 0.56739 0.57474 0.06164  0.06504  0.07371  883  LEU A CG    
2929 C  CD1   . LEU B 188 ? 0.53022 0.46900 0.47748 0.04675  0.06215  0.06653  883  LEU A CD1   
2930 C  CD2   . LEU B 188 ? 0.64069 0.60339 0.61055 0.06190  0.05444  0.07443  883  LEU A CD2   
2931 N  N     . CYS B 189 ? 0.83896 0.82509 0.80277 0.09636  0.06770  0.10135  884  CYS A N     
2932 C  CA    . CYS B 189 ? 0.75096 0.76004 0.72663 0.09953  0.06246  0.10718  884  CYS A CA    
2933 C  C     . CYS B 189 ? 0.69384 0.72738 0.67694 0.11076  0.06187  0.11592  884  CYS A C     
2934 O  O     . CYS B 189 ? 0.68828 0.74849 0.68705 0.10777  0.05296  0.11838  884  CYS A O     
2935 C  CB    . CYS B 189 ? 0.76442 0.75950 0.72619 0.10365  0.07085  0.10972  884  CYS A CB    
2936 S  SG    . CYS B 189 ? 0.77800 0.74932 0.73100 0.08768  0.07114  0.09955  884  CYS A SG    
2937 N  N     . GLN B 190 ? 0.64868 0.67432 0.61960 0.12295  0.07163  0.12061  885  GLN A N     
2938 C  CA    . GLN B 190 ? 0.63232 0.68526 0.61092 0.13315  0.07078  0.12914  885  GLN A CA    
2939 C  C     . GLN B 190 ? 0.60176 0.67343 0.59845 0.12225  0.05869  0.12494  885  GLN A C     
2940 O  O     . GLN B 190 ? 0.63818 0.74054 0.64646 0.12354  0.05347  0.13043  885  GLN A O     
2941 C  CB    . GLN B 190 ? 0.67770 0.71636 0.63844 0.14904  0.08437  0.13486  885  GLN A CB    
2942 C  CG    . GLN B 190 ? 0.75442 0.79262 0.70007 0.16762  0.09716  0.14614  885  GLN A CG    
2943 C  CD    . GLN B 190 ? 0.81061 0.88876 0.76562 0.18087  0.09635  0.15854  885  GLN A CD    
2944 O  OE1   . GLN B 190 ? 0.79353 0.90040 0.76622 0.17440  0.08593  0.15826  885  GLN A OE1   
2945 N  NE2   . GLN B 190 ? 0.85062 0.93125 0.79222 0.19941  0.10820  0.16990  885  GLN A NE2   
2946 N  N     . ALA B 191 ? 0.75108 0.80541 0.74915 0.11088  0.05466  0.11544  886  ALA A N     
2947 C  CA    . ALA B 191 ? 0.72522 0.79327 0.73849 0.10062  0.04417  0.11138  886  ALA A CA    
2948 C  C     . ALA B 191 ? 0.70596 0.79339 0.73321 0.09072  0.03415  0.11056  886  ALA A C     
2949 O  O     . ALA B 191 ? 0.66070 0.76653 0.69859 0.08490  0.02738  0.11086  886  ALA A O     
2950 C  CB    . ALA B 191 ? 0.69902 0.74418 0.70928 0.09183  0.04299  0.10210  886  ALA A CB    
2951 N  N     . LYS B 192 ? 0.76059 0.84271 0.78631 0.08800  0.03376  0.10933  887  LYS A N     
2952 C  CA    . LYS B 192 ? 0.70672 0.80493 0.74307 0.07963  0.02569  0.10888  887  LYS A CA    
2953 C  C     . LYS B 192 ? 0.65063 0.77400 0.68919 0.08586  0.02649  0.11728  887  LYS A C     
2954 O  O     . LYS B 192 ? 0.61643 0.75274 0.66136 0.07904  0.02100  0.11719  887  LYS A O     
2955 C  CB    . LYS B 192 ? 0.65297 0.73542 0.68728 0.07341  0.02447  0.10358  887  LYS A CB    
2956 C  CG    . LYS B 192 ? 0.63920 0.69849 0.66728 0.06942  0.02647  0.09677  887  LYS A CG    
2957 C  CD    . LYS B 192 ? 0.65038 0.70493 0.68254 0.05949  0.02113  0.09126  887  LYS A CD    
2958 C  CE    . LYS B 192 ? 0.63037 0.66821 0.65695 0.05446  0.02258  0.08499  887  LYS A CE    
2959 N  NZ    . LYS B 192 ? 0.68096 0.70118 0.69151 0.05941  0.03261  0.08517  887  LYS A NZ    
2960 N  N     . GLY B 193 ? 0.46773 0.59905 0.50014 0.09903  0.03376  0.12491  888  GLY A N     
2961 C  CA    . GLY B 193 ? 0.44278 0.60473 0.47808 0.10550  0.03434  0.13410  888  GLY A CA    
2962 C  C     . GLY B 193 ? 0.46514 0.65537 0.51165 0.09557  0.02628  0.13446  888  GLY A C     
2963 O  O     . GLY B 193 ? 0.48092 0.66331 0.53229 0.08431  0.02071  0.12752  888  GLY A O     
2964 N  N     . PHE B 194 ? 0.43743 0.66118 0.48669 0.09907  0.02622  0.14273  889  PHE A N     
2965 C  CA    . PHE B 194 ? 0.35967 0.61273 0.41695 0.08683  0.01928  0.14303  889  PHE A CA    
2966 C  C     . PHE B 194 ? 0.37540 0.65866 0.43298 0.09565  0.02267  0.15214  889  PHE A C     
2967 O  O     . PHE B 194 ? 0.43104 0.71878 0.48266 0.11349  0.03076  0.16057  889  PHE A O     
2968 C  CB    . PHE B 194 ? 0.32139 0.59522 0.38153 0.07868  0.01512  0.14442  889  PHE A CB    
2969 C  CG    . PHE B 194 ? 0.34039 0.59277 0.40196 0.06486  0.00962  0.13504  889  PHE A CG    
2970 C  CD1   . PHE B 194 ? 0.38937 0.61615 0.44801 0.06902  0.01142  0.13191  889  PHE A CD1   
2971 C  CD2   . PHE B 194 ? 0.34073 0.59900 0.40476 0.04774  0.00362  0.12990  889  PHE A CD2   
2972 C  CE1   . PHE B 194 ? 0.43168 0.64179 0.49169 0.05765  0.00671  0.12435  889  PHE A CE1   
2973 C  CE2   . PHE B 194 ? 0.32815 0.56594 0.39149 0.03699  -0.00003 0.12233  889  PHE A CE2   
2974 C  CZ    . PHE B 194 ? 0.40315 0.61833 0.46542 0.04267  0.00122  0.11987  889  PHE A CZ    
2975 N  N     . ILE B 195 ? 0.35858 0.66226 0.42168 0.08290  0.01716  0.15070  890  ILE A N     
2976 C  CA    . ILE B 195 ? 0.38820 0.73267 0.45334 0.08609  0.01827  0.15968  890  ILE A CA    
2977 C  C     . ILE B 195 ? 0.42070 0.79831 0.48913 0.06933  0.01228  0.16011  890  ILE A C     
2978 O  O     . ILE B 195 ? 0.44032 0.80594 0.50941 0.05066  0.00658  0.15120  890  ILE A O     
2979 C  CB    . ILE B 195 ? 0.41876 0.75881 0.48545 0.08405  0.01792  0.15739  890  ILE A CB    
2980 C  CG1   . ILE B 195 ? 0.40617 0.70762 0.46765 0.09720  0.02362  0.15457  890  ILE A CG1   
2981 C  CG2   . ILE B 195 ? 0.37010 0.75422 0.43849 0.09008  0.02019  0.16800  890  ILE A CG2   
2982 C  CD1   . ILE B 195 ? 0.36533 0.67387 0.41982 0.11993  0.03358  0.16513  890  ILE A CD1   
2983 N  N     . CYS B 196 ? 0.39937 0.81818 0.46799 0.07617  0.01451  0.17077  891  CYS A N     
2984 C  CA    . CYS B 196 ? 0.41166 0.86564 0.48153 0.05945  0.00955  0.17159  891  CYS A CA    
2985 C  C     . CYS B 196 ? 0.36862 0.83468 0.43907 0.03891  0.00489  0.16656  891  CYS A C     
2986 O  O     . CYS B 196 ? 0.47476 0.96182 0.54694 0.04254  0.00643  0.17158  891  CYS A O     
2987 C  CB    . CYS B 196 ? 0.48924 0.99104 0.55932 0.07245  0.01343  0.18555  891  CYS A CB    
2988 S  SG    . CYS B 196 ? 0.45642 1.01338 0.52673 0.05231  0.00825  0.18876  891  CYS A SG    
2989 N  N     . GLU B 197 ? 0.43704 0.88739 0.50440 0.01747  0.00007  0.15667  892  GLU A N     
2990 C  CA    . GLU B 197 ? 0.51952 0.97456 0.58368 -0.00366 -0.00292 0.15107  892  GLU A CA    
2991 C  C     . GLU B 197 ? 0.58037 1.09168 0.64367 -0.01249 -0.00319 0.15884  892  GLU A C     
2992 O  O     . GLU B 197 ? 0.57401 1.09696 0.63569 -0.02422 -0.00399 0.15759  892  GLU A O     
2993 C  CB    . GLU B 197 ? 0.59074 1.01659 0.64776 -0.02347 -0.00583 0.14012  892  GLU A CB    
2994 C  CG    . GLU B 197 ? 0.60678 1.01083 0.65790 -0.04085 -0.00689 0.13175  892  GLU A CG    
2995 C  CD    . GLU B 197 ? 0.61209 0.97374 0.65543 -0.05194 -0.00755 0.12168  892  GLU A CD    
2996 O  OE1   . GLU B 197 ? 0.55691 0.89168 0.60358 -0.04016 -0.00760 0.11969  892  GLU A OE1   
2997 O  OE2   . GLU B 197 ? 0.65045 1.00570 0.68269 -0.07260 -0.00720 0.11608  892  GLU A OE2   
2998 N  N     . PHE B 198 ? 0.61577 1.16422 0.67983 -0.00739 -0.00240 0.16717  893  PHE A N     
2999 C  CA    . PHE B 198 ? 0.58315 1.19188 0.64620 -0.01637 -0.00273 0.17542  893  PHE A CA    
3000 C  C     . PHE B 198 ? 0.52847 1.16605 0.59727 0.00042  0.00055  0.18595  893  PHE A C     
3001 O  O     . PHE B 198 ? 0.48783 1.14716 0.55566 -0.01218 -0.00055 0.18600  893  PHE A O     
3002 C  CB    . PHE B 198 ? 0.55830 1.19980 0.62106 -0.01270 -0.00244 0.18246  893  PHE A CB    
3003 C  CG    . PHE B 198 ? 0.54475 1.17113 0.59990 -0.03418 -0.00571 0.17297  893  PHE A CG    
3004 C  CD1   . PHE B 198 ? 0.55254 1.19108 0.59781 -0.06402 -0.00800 0.16630  893  PHE A CD1   
3005 C  CD2   . PHE B 198 ? 0.54152 1.14075 0.59738 -0.02522 -0.00560 0.17072  893  PHE A CD2   
3006 C  CE1   . PHE B 198 ? 0.55806 1.17920 0.59310 -0.08370 -0.00950 0.15746  893  PHE A CE1   
3007 C  CE2   . PHE B 198 ? 0.57396 1.15884 0.62201 -0.04429 -0.00810 0.16222  893  PHE A CE2   
3008 C  CZ    . PHE B 198 ? 0.58378 1.17851 0.62085 -0.07310 -0.00973 0.15558  893  PHE A CZ    
3009 N  N     . CYS B 199 ? 0.48972 1.12726 0.56282 0.02908  0.00554  0.19531  894  CYS A N     
3010 C  CA    . CYS B 199 ? 0.50077 1.16895 0.57718 0.04909  0.01058  0.20775  894  CYS A CA    
3011 C  C     . CYS B 199 ? 0.49728 1.12619 0.57488 0.05870  0.01284  0.20356  894  CYS A C     
3012 O  O     . CYS B 199 ? 0.44645 1.09991 0.52595 0.06668  0.01552  0.21075  894  CYS A O     
3013 C  CB    . CYS B 199 ? 0.50347 1.17675 0.57482 0.07468  0.01914  0.21829  894  CYS A CB    
3014 S  SG    . CYS B 199 ? 0.57673 1.19700 0.65025 0.09222  0.02058  0.21484  894  CYS A SG    
3015 N  N     . GLN B 200 ? 0.46038 1.03126 0.53665 0.05802  0.01192  0.19242  895  GLN A N     
3016 C  CA    . GLN B 200 ? 0.45731 0.98716 0.53390 0.06405  0.01338  0.18648  895  GLN A CA    
3017 C  C     . GLN B 200 ? 0.48504 1.01087 0.56012 0.09303  0.02187  0.19597  895  GLN A C     
3018 O  O     . GLN B 200 ? 0.53478 1.04049 0.60946 0.09958  0.02425  0.19414  895  GLN A O     
3019 C  CB    . GLN B 200 ? 0.44174 0.98242 0.51979 0.04654  0.00962  0.18234  895  GLN A CB    
3020 C  CG    . GLN B 200 ? 0.42721 0.95634 0.50226 0.01808  0.00345  0.17112  895  GLN A CG    
3021 C  CD    . GLN B 200 ? 0.55638 1.02854 0.63025 0.01430  0.00193  0.15920  895  GLN A CD    
3022 O  OE1   . GLN B 200 ? 0.66051 1.11204 0.73645 0.02324  0.00359  0.15780  895  GLN A OE1   
3023 N  NE2   . GLN B 200 ? 0.60328 1.05036 0.67327 0.00142  -0.00089 0.15083  895  GLN A NE2   
3024 N  N     . ASN B 201 ? 0.49074 1.03390 0.56317 0.11093  0.02746  0.20634  896  ASN A N     
3025 C  CA    . ASN B 201 ? 0.55580 1.09204 0.62260 0.13965  0.03789  0.21622  896  ASN A CA    
3026 C  C     . ASN B 201 ? 0.54674 1.01935 0.60781 0.14549  0.04105  0.20658  896  ASN A C     
3027 O  O     . ASN B 201 ? 0.57770 1.02319 0.63486 0.14786  0.04235  0.20306  896  ASN A O     
3028 C  CB    . ASN B 201 ? 0.61287 1.17165 0.67239 0.15424  0.04633  0.22669  896  ASN A CB    
3029 C  CG    . ASN B 201 ? 0.72018 1.25806 0.76659 0.18117  0.06151  0.23362  896  ASN A CG    
3030 O  OD1   . ASN B 201 ? 0.85309 1.39541 0.89476 0.18962  0.06770  0.23739  896  ASN A OD1   
3031 N  ND2   . ASN B 201 ? 0.73520 1.25149 0.77402 0.19423  0.06848  0.23563  896  ASN A ND2   
3032 N  N     . GLU B 202 ? 0.70099 1.15070 0.76102 0.14702  0.04239  0.20219  897  GLU A N     
3033 C  CA    . GLU B 202 ? 0.76513 1.15752 0.81893 0.15020  0.04521  0.19257  897  GLU A CA    
3034 C  C     . GLU B 202 ? 0.74504 1.11717 0.78524 0.17645  0.05846  0.20032  897  GLU A C     
3035 O  O     . GLU B 202 ? 0.79371 1.11974 0.82542 0.18027  0.06298  0.19336  897  GLU A O     
3036 C  CB    . GLU B 202 ? 0.84024 1.21323 0.89740 0.13957  0.04118  0.18357  897  GLU A CB    
3037 C  CG    . GLU B 202 ? 0.91681 1.32519 0.97762 0.14233  0.04174  0.19079  897  GLU A CG    
3038 C  CD    . GLU B 202 ? 0.94823 1.34618 1.01540 0.12322  0.03414  0.18058  897  GLU A CD    
3039 O  OE1   . GLU B 202 ? 0.95643 1.38932 1.03016 0.10788  0.02808  0.18151  897  GLU A OE1   
3040 O  OE2   . GLU B 202 ? 0.95617 1.31144 1.02062 0.12257  0.03459  0.17162  897  GLU A OE2   
3041 N  N     . ASP B 203 ? 0.68363 1.08870 0.71969 0.19420  0.06561  0.21472  898  ASP A N     
3042 C  CA    . ASP B 203 ? 0.79502 1.17897 0.81408 0.21950  0.08072  0.22272  898  ASP A CA    
3043 C  C     . ASP B 203 ? 0.82251 1.19457 0.83560 0.22387  0.08396  0.22404  898  ASP A C     
3044 O  O     . ASP B 203 ? 0.84690 1.19272 0.84272 0.24088  0.09802  0.22747  898  ASP A O     
3045 C  CB    . ASP B 203 ? 0.86943 1.28558 0.88077 0.23213  0.09171  0.23281  898  ASP A CB    
3046 C  CG    . ASP B 203 ? 0.96526 1.39156 0.98018 0.22926  0.08985  0.23224  898  ASP A CG    
3047 O  OD1   . ASP B 203 ? 1.00673 1.39565 1.01915 0.23055  0.08991  0.22579  898  ASP A OD1   
3048 O  OD2   . ASP B 203 ? 0.99141 1.46293 1.01031 0.22564  0.08896  0.23847  898  ASP A OD2   
3049 N  N     . ASP B 204 ? 0.82995 1.21644 0.85479 0.20614  0.07256  0.21911  899  ASP A N     
3050 C  CA    . ASP B 204 ? 0.79509 1.17615 0.81659 0.20815  0.07389  0.22041  899  ASP A CA    
3051 C  C     . ASP B 204 ? 0.74169 1.09538 0.77038 0.18440  0.06317  0.20470  899  ASP A C     
3052 O  O     . ASP B 204 ? 0.71548 1.09382 0.75547 0.16680  0.05278  0.20120  899  ASP A O     
3053 C  CB    . ASP B 204 ? 0.79261 1.22604 0.81884 0.20865  0.07376  0.22953  899  ASP A CB    
3054 C  CG    . ASP B 204 ? 0.76907 1.19997 0.79391 0.20859  0.07359  0.23023  899  ASP A CG    
3055 O  OD1   . ASP B 204 ? 0.79422 1.18916 0.80603 0.22251  0.08350  0.23110  899  ASP A OD1   
3056 O  OD2   . ASP B 204 ? 0.72681 1.19063 0.76224 0.19358  0.06398  0.22954  899  ASP A OD2   
3057 N  N     . ILE B 205 ? 0.64887 0.95211 0.66923 0.18399  0.06659  0.19562  900  ILE A N     
3058 C  CA    . ILE B 205 ? 0.67918 0.95556 0.70518 0.16398  0.05767  0.18160  900  ILE A CA    
3059 C  C     . ILE B 205 ? 0.68056 0.95303 0.70404 0.16469  0.05839  0.18259  900  ILE A C     
3060 O  O     . ILE B 205 ? 0.70985 0.95874 0.71992 0.17842  0.06852  0.18595  900  ILE A O     
3061 C  CB    . ILE B 205 ? 0.67263 0.90216 0.69096 0.16204  0.06071  0.17183  900  ILE A CB    
3062 C  CG1   . ILE B 205 ? 0.64487 0.87914 0.66832 0.15769  0.05761  0.16919  900  ILE A CG1   
3063 C  CG2   . ILE B 205 ? 0.56586 0.76925 0.58829 0.14459  0.05318  0.15922  900  ILE A CG2   
3064 C  CD1   . ILE B 205 ? 0.71107 0.95874 0.72705 0.17670  0.06721  0.17995  900  ILE A CD1   
3065 N  N     . ILE B 206 ? 0.61940 0.91302 0.65405 0.14924  0.04834  0.17939  901  ILE A N     
3066 C  CA    . ILE B 206 ? 0.57664 0.87261 0.61092 0.14825  0.04755  0.18047  901  ILE A CA    
3067 C  C     . ILE B 206 ? 0.61151 0.87211 0.64719 0.13372  0.04213  0.16762  901  ILE A C     
3068 O  O     . ILE B 206 ? 0.55515 0.80446 0.59682 0.11913  0.03509  0.15817  901  ILE A O     
3069 C  CB    . ILE B 206 ? 0.50042 0.84445 0.54428 0.14002  0.04063  0.18550  901  ILE A CB    
3070 C  CG1   . ILE B 206 ? 0.31908 0.67002 0.37222 0.11816  0.03026  0.17646  901  ILE A CG1   
3071 C  CG2   . ILE B 206 ? 0.59265 0.97761 0.63448 0.15681  0.04700  0.20041  901  ILE A CG2   
3072 C  CD1   . ILE B 206 ? 0.39918 0.79439 0.45836 0.10661  0.02435  0.17994  901  ILE A CD1   
3073 N  N     . PHE B 207 ? 0.78859 1.03306 0.81833 0.13809  0.04575  0.16787  902  PHE A N     
3074 C  CA    . PHE B 207 ? 0.76116 0.97749 0.79217 0.12545  0.04102  0.15726  902  PHE A CA    
3075 C  C     . PHE B 207 ? 0.72601 0.96026 0.76260 0.11908  0.03583  0.15823  902  PHE A C     
3076 O  O     . PHE B 207 ? 0.76209 1.02471 0.79833 0.12770  0.03842  0.16784  902  PHE A O     
3077 C  CB    . PHE B 207 ? 0.77595 0.95314 0.79301 0.13379  0.05037  0.15522  902  PHE A CB    
3078 C  CG    . PHE B 207 ? 0.83667 0.99470 0.84483 0.14084  0.05728  0.15467  902  PHE A CG    
3079 C  CD1   . PHE B 207 ? 0.84459 0.98226 0.85517 0.12936  0.05290  0.14453  902  PHE A CD1   
3080 C  CD2   . PHE B 207 ? 0.85664 1.01781 0.85318 0.15968  0.06869  0.16485  902  PHE A CD2   
3081 C  CE1   . PHE B 207 ? 0.83370 0.95396 0.83556 0.13510  0.05923  0.14365  902  PHE A CE1   
3082 C  CE2   . PHE B 207 ? 0.85847 1.00021 0.84513 0.16626  0.07580  0.16420  902  PHE A CE2   
3083 C  CZ    . PHE B 207 ? 0.84275 0.96389 0.83231 0.15315  0.07073  0.15312  902  PHE A CZ    
3084 N  N     . PRO B 208 ? 0.60150 0.82181 0.64299 0.10433  0.02868  0.14890  903  PRO A N     
3085 C  CA    . PRO B 208 ? 0.64468 0.88205 0.69106 0.09675  0.02341  0.14912  903  PRO A CA    
3086 C  C     . PRO B 208 ? 0.63087 0.86425 0.67109 0.10750  0.02924  0.15454  903  PRO A C     
3087 O  O     . PRO B 208 ? 0.52244 0.77756 0.56608 0.10477  0.02621  0.15764  903  PRO A O     
3088 C  CB    . PRO B 208 ? 0.58951 0.80704 0.64030 0.08044  0.01604  0.13785  903  PRO A CB    
3089 C  CG    . PRO B 208 ? 0.63413 0.82049 0.68100 0.08248  0.01897  0.13252  903  PRO A CG    
3090 C  CD    . PRO B 208 ? 0.58870 0.78177 0.63187 0.09354  0.02473  0.13834  903  PRO A CD    
3091 N  N     . PHE B 209 ? 0.59499 0.80064 0.62457 0.11884  0.03813  0.15568  904  PHE A N     
3092 C  CA    . PHE B 209 ? 0.57156 0.76905 0.59304 0.12825  0.04469  0.16044  904  PHE A CA    
3093 C  C     . PHE B 209 ? 0.72591 0.94644 0.74125 0.14667  0.05311  0.17405  904  PHE A C     
3094 O  O     . PHE B 209 ? 0.74692 0.96478 0.75505 0.15620  0.05923  0.17988  904  PHE A O     
3095 C  CB    . PHE B 209 ? 0.50890 0.66426 0.51800 0.13039  0.05198  0.15541  904  PHE A CB    
3096 C  CG    . PHE B 209 ? 0.63351 0.77197 0.63110 0.14038  0.06121  0.15746  904  PHE A CG    
3097 C  CD1   . PHE B 209 ? 0.69758 0.83160 0.68007 0.15929  0.07440  0.16765  904  PHE A CD1   
3098 C  CD2   . PHE B 209 ? 0.68888 0.81417 0.68910 0.13153  0.05763  0.14943  904  PHE A CD2   
3099 C  CE1   . PHE B 209 ? 0.72936 0.84472 0.69867 0.16885  0.08417  0.16944  904  PHE A CE1   
3100 C  CE2   . PHE B 209 ? 0.68281 0.79122 0.67148 0.13998  0.06630  0.15072  904  PHE A CE2   
3101 C  CZ    . PHE B 209 ? 0.73759 0.84022 0.71029 0.15851  0.07978  0.16055  904  PHE A CZ    
3102 N  N     . GLU B 210 ? 0.95471 1.19826 0.97212 0.15264  0.05410  0.17985  905  GLU A N     
3103 C  CA    . GLU B 210 ? 0.94757 1.22010 0.95992 0.17145  0.06206  0.19439  905  GLU A CA    
3104 C  C     . GLU B 210 ? 0.89682 1.21678 0.92112 0.16441  0.05369  0.19872  905  GLU A C     
3105 O  O     . GLU B 210 ? 0.82709 1.18140 0.85897 0.15987  0.04895  0.20147  905  GLU A O     
3106 C  CB    . GLU B 210 ? 1.00358 1.28030 1.01202 0.18132  0.06743  0.19894  905  GLU A CB    
3107 C  CG    . GLU B 210 ? 1.06652 1.29739 1.05932 0.18980  0.07797  0.19598  905  GLU A CG    
3108 C  CD    . GLU B 210 ? 1.07930 1.31311 1.07106 0.19443  0.08030  0.19729  905  GLU A CD    
3109 O  OE1   . GLU B 210 ? 1.13266 1.34020 1.10763 0.20912  0.09304  0.20088  905  GLU A OE1   
3110 O  OE2   . GLU B 210 ? 1.03412 1.29506 1.04027 0.18294  0.07009  0.19465  905  GLU A OE2   
3111 N  N     . LEU B 211 ? 0.85462 1.17664 0.87943 0.16233  0.05220  0.19908  906  LEU A N     
3112 C  CA    . LEU B 211 ? 0.81237 1.17665 0.84692 0.15271  0.04410  0.20155  906  LEU A CA    
3113 C  C     . LEU B 211 ? 0.76482 1.17435 0.79749 0.16911  0.04976  0.21744  906  LEU A C     
3114 O  O     . LEU B 211 ? 0.73898 1.19104 0.77914 0.16014  0.04321  0.22031  906  LEU A O     
3115 C  CB    . LEU B 211 ? 0.82014 1.17099 0.85604 0.14407  0.04016  0.19592  906  LEU A CB    
3116 C  CG    . LEU B 211 ? 0.78385 1.09577 0.82220 0.12798  0.03422  0.18124  906  LEU A CG    
3117 C  CD1   . LEU B 211 ? 0.75434 1.02953 0.78389 0.13548  0.04074  0.17982  906  LEU A CD1   
3118 C  CD2   . LEU B 211 ? 0.77727 1.10386 0.82439 0.10770  0.02329  0.17391  906  LEU A CD2   
3119 N  N     . HIS B 212 ? 0.80783 1.20962 0.82908 0.19271  0.06247  0.22807  907  HIS A N     
3120 C  CA    . HIS B 212 ? 0.89454 1.33470 0.91480 0.20443  0.07143  0.23723  907  HIS A CA    
3121 C  C     . HIS B 212 ? 0.91438 1.38933 0.94341 0.19482  0.06557  0.23707  907  HIS A C     
3122 O  O     . HIS B 212 ? 0.81587 1.33794 0.85114 0.18925  0.06435  0.24090  907  HIS A O     
3123 C  CB    . HIS B 212 ? 1.02649 1.43906 1.03133 0.22785  0.08913  0.24264  907  HIS A CB    
3124 C  CG    . HIS B 212 ? 1.13053 1.49789 1.12652 0.23057  0.09151  0.23810  907  HIS A CG    
3125 N  ND1   . HIS B 212 ? 1.16213 1.47976 1.14797 0.23033  0.09306  0.23326  907  HIS A ND1   
3126 C  CD2   . HIS B 212 ? 1.14998 1.51488 1.14493 0.23282  0.09313  0.23767  907  HIS A CD2   
3127 C  CE1   . HIS B 212 ? 1.15832 1.44466 1.13699 0.23124  0.09594  0.22920  907  HIS A CE1   
3128 N  NE2   . HIS B 212 ? 1.14696 1.46097 1.13121 0.23390  0.09559  0.23243  907  HIS A NE2   
3129 N  N     . LYS B 213 ? 0.95114 1.40323 0.98027 0.19155  0.06202  0.23242  908  LYS A N     
3130 C  CA    . LYS B 213 ? 0.92811 1.40365 0.96207 0.18727  0.06006  0.23298  908  LYS A CA    
3131 C  C     . LYS B 213 ? 0.87832 1.37908 0.92461 0.16262  0.04460  0.22671  908  LYS A C     
3132 O  O     . LYS B 213 ? 0.84867 1.38948 0.89956 0.15431  0.04273  0.22878  908  LYS A O     
3133 C  CB    . LYS B 213 ? 0.92281 1.35789 0.94994 0.19588  0.06435  0.23049  908  LYS A CB    
3134 C  CG    . LYS B 213 ? 0.95908 1.41318 0.98871 0.19627  0.06543  0.23218  908  LYS A CG    
3135 C  CD    . LYS B 213 ? 0.97835 1.39953 0.99409 0.21629  0.07947  0.23511  908  LYS A CD    
3136 C  CE    . LYS B 213 ? 0.98041 1.43288 0.99496 0.22511  0.08726  0.24192  908  LYS A CE    
3137 N  NZ    . LYS B 213 ? 0.94820 1.37300 0.94586 0.24842  0.10505  0.24674  908  LYS A NZ    
3138 N  N     . CYS B 214 ? 0.85256 1.31978 0.90156 0.14561  0.03746  0.21331  909  CYS A N     
3139 C  CA    . CYS B 214 ? 0.85038 1.31831 0.90643 0.12040  0.02708  0.20171  909  CYS A CA    
3140 C  C     . CYS B 214 ? 0.76682 1.22567 0.82490 0.10409  0.02045  0.19339  909  CYS A C     
3141 O  O     . CYS B 214 ? 0.76199 1.20233 0.81708 0.11178  0.02330  0.19391  909  CYS A O     
3142 C  CB    . CYS B 214 ? 0.93647 1.36238 0.99188 0.11685  0.02676  0.19199  909  CYS A CB    
3143 S  SG    . CYS B 214 ? 1.02631 1.39278 1.07417 0.12735  0.03282  0.18624  909  CYS A SG    
3144 N  N     . ARG B 215 ? 0.76590 1.23687 0.82738 0.08126  0.01241  0.18581  910  ARG A N     
3145 C  CA    . ARG B 215 ? 0.78558 1.24158 0.84693 0.06422  0.00661  0.17633  910  ARG A CA    
3146 C  C     . ARG B 215 ? 0.76373 1.18604 0.82498 0.04848  0.00226  0.16367  910  ARG A C     
3147 O  O     . ARG B 215 ? 0.74053 1.17206 0.80215 0.04042  0.00076  0.16214  910  ARG A O     
3148 C  CB    . ARG B 215 ? 0.81255 1.31349 0.87361 0.05083  0.00278  0.17943  910  ARG A CB    
3149 C  CG    . ARG B 215 ? 0.80455 1.32650 0.86382 0.02736  -0.00220 0.17426  910  ARG A CG    
3150 C  CD    . ARG B 215 ? 0.85150 1.41800 0.90803 0.01446  -0.00475 0.17769  910  ARG A CD    
3151 N  NE    . ARG B 215 ? 0.89946 1.47745 0.94964 -0.01307 -0.00881 0.17004  910  ARG A NE    
3152 C  CZ    . ARG B 215 ? 0.91437 1.46624 0.95727 -0.03261 -0.01165 0.15870  910  ARG A CZ    
3153 N  NH1   . ARG B 215 ? 0.89514 1.41091 0.93861 -0.02711 -0.01192 0.15393  910  ARG A NH1   
3154 N  NH2   . ARG B 215 ? 0.93581 1.49627 0.96912 -0.05772 -0.01334 0.15225  910  ARG A NH2   
3155 N  N     . THR B 216 ? 0.66204 1.04566 0.72239 0.04547  0.00088  0.15538  911  THR A N     
3156 C  CA    . THR B 216 ? 0.64360 0.99332 0.70320 0.03375  -0.00222 0.14445  911  THR A CA    
3157 C  C     . THR B 216 ? 0.62956 0.98301 0.68522 0.01254  -0.00693 0.13772  911  THR A C     
3158 O  O     . THR B 216 ? 0.71046 1.06840 0.76443 0.00891  -0.00811 0.13737  911  THR A O     
3159 C  CB    . THR B 216 ? 0.57598 0.88451 0.63566 0.04201  -0.00054 0.13977  911  THR A CB    
3160 O  OG1   . THR B 216 ? 0.59696 0.89902 0.65613 0.06063  0.00560  0.14579  911  THR A OG1   
3161 C  CG2   . THR B 216 ? 0.53546 0.81431 0.59474 0.03266  -0.00310 0.13044  911  THR A CG2   
3162 N  N     . CYS B 217 ? 0.62917 0.97972 0.68150 -0.00162 -0.00874 0.13251  912  CYS A N     
3163 C  CA    . CYS B 217 ? 0.67215 1.00978 0.71645 -0.02110 -0.01106 0.12421  912  CYS A CA    
3164 C  C     . CYS B 217 ? 0.84927 1.14834 0.89352 -0.01735 -0.01134 0.11830  912  CYS A C     
3165 O  O     . CYS B 217 ? 0.90384 1.18173 0.95348 -0.00402 -0.01021 0.11834  912  CYS A O     
3166 C  CB    . CYS B 217 ? 0.63065 0.96130 0.66947 -0.03425 -0.01116 0.11943  912  CYS A CB    
3167 S  SG    . CYS B 217 ? 0.67991 0.98582 0.70364 -0.05689 -0.01104 0.10939  912  CYS A SG    
3168 N  N     . GLU B 218 ? 1.17620 1.46711 1.21336 -0.02922 -0.01237 0.11343  913  GLU A N     
3169 C  CA    . GLU B 218 ? 1.20084 1.45751 1.23807 -0.02509 -0.01247 0.10847  913  GLU A CA    
3170 C  C     . GLU B 218 ? 1.17142 1.40329 1.19742 -0.03940 -0.01182 0.10071  913  GLU A C     
3171 O  O     . GLU B 218 ? 1.23255 1.44025 1.25609 -0.03837 -0.01156 0.09690  913  GLU A O     
3172 C  CB    . GLU B 218 ? 1.25595 1.51919 1.29599 -0.01908 -0.01304 0.11110  913  GLU A CB    
3173 C  CG    . GLU B 218 ? 1.28641 1.53710 1.33487 -0.00081 -0.01173 0.11424  913  GLU A CG    
3174 C  CD    . GLU B 218 ? 1.28246 1.53715 1.33289 0.00574  -0.01152 0.11711  913  GLU A CD    
3175 O  OE1   . GLU B 218 ? 1.25506 1.53896 1.30531 0.00536  -0.01158 0.12247  913  GLU A OE1   
3176 O  OE2   . GLU B 218 ? 1.26528 1.49552 1.31723 0.01107  -0.01117 0.11431  913  GLU A OE2   
3177 N  N     . GLU B 219 ? 1.04536 1.28229 1.06319 -0.05222 -0.01068 0.09880  914  GLU A N     
3178 C  CA    . GLU B 219 ? 1.16249 1.36956 1.16876 -0.06182 -0.00810 0.09243  914  GLU A CA    
3179 C  C     . GLU B 219 ? 1.19852 1.39171 1.21046 -0.05398 -0.00779 0.09233  914  GLU A C     
3180 O  O     . GLU B 219 ? 1.21580 1.37931 1.22576 -0.05004 -0.00643 0.08895  914  GLU A O     
3181 C  CB    . GLU B 219 ? 1.22694 1.44381 1.21668 -0.08318 -0.00560 0.08964  914  GLU A CB    
3182 C  CG    . GLU B 219 ? 1.33141 1.51210 1.30257 -0.09459 -0.00055 0.08286  914  GLU A CG    
3183 C  CD    . GLU B 219 ? 1.41928 1.58964 1.38285 -0.10177 0.00244  0.08100  914  GLU A CD    
3184 O  OE1   . GLU B 219 ? 1.41995 1.60482 1.39639 -0.09375 -0.00028 0.08452  914  GLU A OE1   
3185 O  OE2   . GLU B 219 ? 1.47292 1.61841 1.41605 -0.11519 0.00834  0.07608  914  GLU A OE2   
3186 N  N     . CYS B 220 ? 1.01881 1.23476 1.03761 -0.05106 -0.00882 0.09648  915  CYS A N     
3187 C  CA    . CYS B 220 ? 0.86362 1.06985 0.88851 -0.04322 -0.00870 0.09680  915  CYS A CA    
3188 C  C     . CYS B 220 ? 0.78995 0.99663 0.82801 -0.02453 -0.00979 0.10063  915  CYS A C     
3189 O  O     . CYS B 220 ? 0.81887 1.00943 0.86097 -0.01729 -0.00943 0.09947  915  CYS A O     
3190 C  CB    . CYS B 220 ? 0.87230 1.10259 0.89570 -0.05095 -0.00846 0.09919  915  CYS A CB    
3191 S  SG    . CYS B 220 ? 0.96644 1.21269 0.97322 -0.07516 -0.00677 0.09676  915  CYS A SG    
3192 N  N     . LYS B 221 ? 0.72667 0.95056 0.76961 -0.01721 -0.01032 0.10513  916  LYS A N     
3193 C  CA    . LYS B 221 ? 0.68068 0.90582 0.73205 -0.00020 -0.00937 0.10962  916  LYS A CA    
3194 C  C     . LYS B 221 ? 0.64354 0.88075 0.69882 0.00727  -0.00784 0.11389  916  LYS A C     
3195 O  O     . LYS B 221 ? 0.60690 0.84018 0.66593 0.02163  -0.00531 0.11736  916  LYS A O     
3196 C  CB    . LYS B 221 ? 0.72947 0.92395 0.78258 0.00641  -0.00912 0.10562  916  LYS A CB    
3197 C  CG    . LYS B 221 ? 0.83265 1.01773 0.88277 0.00206  -0.01019 0.10279  916  LYS A CG    
3198 C  CD    . LYS B 221 ? 0.90086 1.07046 0.94280 -0.01054 -0.01059 0.09712  916  LYS A CD    
3199 C  CE    . LYS B 221 ? 0.89756 1.05843 0.93498 -0.01443 -0.01088 0.09476  916  LYS A CE    
3200 N  NZ    . LYS B 221 ? 0.87912 1.01321 0.90968 -0.01814 -0.00953 0.08992  916  LYS A NZ    
3201 N  N     . ALA B 222 ? 0.40943 0.66052 0.46209 -0.00267 -0.00849 0.11374  917  ALA A N     
3202 C  CA    . ALA B 222 ? 0.41043 0.68346 0.46663 0.00362  -0.00708 0.11952  917  ALA A CA    
3203 C  C     . ALA B 222 ? 0.44894 0.75164 0.50812 0.01506  -0.00509 0.12859  917  ALA A C     
3204 O  O     . ALA B 222 ? 0.42132 0.73871 0.47907 0.01191  -0.00591 0.13049  917  ALA A O     
3205 C  CB    . ALA B 222 ? 0.39710 0.68671 0.44870 -0.01214 -0.00824 0.11831  917  ALA A CB    
3206 N  N     . CYS B 223 ? 0.47997 0.79105 0.54217 0.02923  -0.00174 0.13466  918  CYS A N     
3207 C  CA    . CYS B 223 ? 0.50561 0.84020 0.56878 0.04459  0.00228  0.14463  918  CYS A CA    
3208 C  C     . CYS B 223 ? 0.68395 1.05873 0.74833 0.04579  0.00330  0.15261  918  CYS A C     
3209 O  O     . CYS B 223 ? 0.75246 1.12507 0.81780 0.04598  0.00381  0.15199  918  CYS A O     
3210 C  CB    . CYS B 223 ? 0.51523 0.82306 0.57716 0.06262  0.00780  0.14616  918  CYS A CB    
3211 S  SG    . CYS B 223 ? 0.56404 0.88429 0.62271 0.08128  0.01434  0.15654  918  CYS A SG    
3212 N  N     . TYR B 224 ? 0.69385 1.10733 0.75821 0.04623  0.00352  0.16028  919  TYR A N     
3213 C  CA    . TYR B 224 ? 0.61383 1.07386 0.67937 0.04733  0.00454  0.16936  919  TYR A CA    
3214 C  C     . TYR B 224 ? 0.64805 1.13559 0.71371 0.06769  0.01002  0.18231  919  TYR A C     
3215 O  O     . TYR B 224 ? 0.71235 1.18702 0.77658 0.07454  0.01154  0.18289  919  TYR A O     
3216 C  CB    . TYR B 224 ? 0.58191 1.07122 0.64515 0.02327  -0.00062 0.16636  919  TYR A CB    
3217 C  CG    . TYR B 224 ? 0.54343 1.00261 0.60266 0.00249  -0.00449 0.15385  919  TYR A CG    
3218 C  CD1   . TYR B 224 ? 0.62773 1.05684 0.68298 -0.00741 -0.00668 0.14520  919  TYR A CD1   
3219 C  CD2   . TYR B 224 ? 0.58631 1.04744 0.64451 -0.00673 -0.00520 0.15132  919  TYR A CD2   
3220 C  CE1   . TYR B 224 ? 0.70188 1.10222 0.75111 -0.02439 -0.00859 0.13495  919  TYR A CE1   
3221 C  CE2   . TYR B 224 ? 0.64936 1.08122 0.70169 -0.02475 -0.00737 0.14068  919  TYR A CE2   
3222 C  CZ    . TYR B 224 ? 0.72119 1.12236 0.76846 -0.03284 -0.00863 0.13285  919  TYR A CZ    
3223 O  OH    . TYR B 224 ? 0.76011 1.13111 0.79940 -0.04855 -0.00919 0.12351  919  TYR A OH    
3224 N  N     . HIS B 225 ? 0.55932 1.08589 0.62597 0.07792  0.01352  0.19340  920  HIS A N     
3225 C  CA    . HIS B 225 ? 0.56863 1.12997 0.63422 0.09679  0.01917  0.20757  920  HIS A CA    
3226 C  C     . HIS B 225 ? 0.55472 1.14917 0.62094 0.08323  0.01456  0.20854  920  HIS A C     
3227 O  O     . HIS B 225 ? 0.53179 1.13929 0.59815 0.05852  0.00792  0.20128  920  HIS A O     
3228 C  CB    . HIS B 225 ? 0.49626 1.09940 0.56236 0.10903  0.02397  0.21987  920  HIS A CB    
3229 C  CG    . HIS B 225 ? 0.50228 1.07734 0.56614 0.12611  0.03003  0.22143  920  HIS A CG    
3230 N  ND1   . HIS B 225 ? 0.46104 1.03823 0.52751 0.11853  0.02778  0.21816  920  HIS A ND1   
3231 C  CD2   . HIS B 225 ? 0.46303 1.00394 0.51977 0.14878  0.03974  0.22474  920  HIS A CD2   
3232 C  CE1   . HIS B 225 ? 0.42692 0.97470 0.48933 0.13676  0.03486  0.21999  920  HIS A CE1   
3233 N  NE2   . HIS B 225 ? 0.44777 0.97293 0.50334 0.15518  0.04240  0.22414  920  HIS A NE2   
3234 N  N     . LYS B 226 ? 0.54098 1.14721 0.60563 0.09916  0.01896  0.21746  921  LYS A N     
3235 C  CA    . LYS B 226 ? 0.58427 1.22512 0.64842 0.08717  0.01727  0.21861  921  LYS A CA    
3236 C  C     . LYS B 226 ? 0.60341 1.29401 0.66706 0.07417  0.01868  0.22161  921  LYS A C     
3237 O  O     . LYS B 226 ? 0.56252 1.27525 0.62523 0.04949  0.01191  0.21634  921  LYS A O     
3238 C  CB    . LYS B 226 ? 0.49905 1.13945 0.56015 0.10688  0.02674  0.22592  921  LYS A CB    
3239 C  CG    . LYS B 226 ? 0.48763 1.10618 0.54874 0.10230  0.02131  0.22121  921  LYS A CG    
3240 C  CD    . LYS B 226 ? 0.58354 1.17496 0.64009 0.12700  0.03123  0.22675  921  LYS A CD    
3241 C  CE    . LYS B 226 ? 0.61764 1.17645 0.67379 0.12400  0.02570  0.22143  921  LYS A CE    
3242 N  NZ    . LYS B 226 ? 0.63773 1.16721 0.68682 0.14729  0.03688  0.22667  921  LYS A NZ    
3243 N  N     . ALA B 227 ? 0.55894 1.26660 0.62136 0.08996  0.02841  0.23001  922  ALA A N     
3244 C  CA    . ALA B 227 ? 0.53843 1.28130 0.60006 0.07990  0.02587  0.23025  922  ALA A CA    
3245 C  C     . ALA B 227 ? 0.57352 1.32439 0.63463 0.05180  0.01643  0.22200  922  ALA A C     
3246 O  O     . ALA B 227 ? 0.63292 1.41136 0.69120 0.03218  0.01124  0.21820  922  ALA A O     
3247 C  CB    . ALA B 227 ? 0.54488 1.28679 0.60499 0.10192  0.03409  0.23737  922  ALA A CB    
3248 N  N     . CYS B 228 ? 0.58976 1.31431 0.65243 0.04910  0.01437  0.21867  923  CYS A N     
3249 C  CA    . CYS B 228 ? 0.65873 1.38460 0.72051 0.02494  0.00618  0.21067  923  CYS A CA    
3250 C  C     . CYS B 228 ? 0.64507 1.36166 0.70575 -0.00202 -0.00228 0.19933  923  CYS A C     
3251 O  O     . CYS B 228 ? 0.56581 1.29163 0.62072 -0.02790 -0.00549 0.19239  923  CYS A O     
3252 C  CB    . CYS B 228 ? 0.69845 1.38793 0.76708 0.03415  0.00490  0.20702  923  CYS A CB    
3253 S  SG    . CYS B 228 ? 0.60542 1.28496 0.67400 0.06821  0.01602  0.21748  923  CYS A SG    
3254 N  N     . PHE B 229 ? 0.77095 1.45893 0.83082 0.00187  -0.00266 0.19542  924  PHE A N     
3255 C  CA    . PHE B 229 ? 0.82807 1.48630 0.88088 -0.02204 -0.00678 0.18190  924  PHE A CA    
3256 C  C     . PHE B 229 ? 0.92431 1.62207 0.97136 -0.03878 -0.00896 0.18327  924  PHE A C     
3257 O  O     . PHE B 229 ? 0.88160 1.61168 0.92154 -0.06152 -0.01107 0.18149  924  PHE A O     
3258 C  CB    . PHE B 229 ? 0.76017 1.36115 0.81467 -0.01077 -0.00627 0.17528  924  PHE A CB    
3259 C  CG    . PHE B 229 ? 0.70454 1.26212 0.75186 -0.03147 -0.00926 0.16070  924  PHE A CG    
3260 C  CD1   . PHE B 229 ? 0.65598 1.21941 0.69438 -0.05670 -0.01091 0.15406  924  PHE A CD1   
3261 C  CD2   . PHE B 229 ? 0.69273 1.20423 0.74045 -0.02564 -0.00947 0.15420  924  PHE A CD2   
3262 C  CE1   . PHE B 229 ? 0.62185 1.14369 0.65066 -0.07394 -0.01175 0.14180  924  PHE A CE1   
3263 C  CE2   . PHE B 229 ? 0.68024 1.15460 0.72046 -0.04238 -0.01120 0.14240  924  PHE A CE2   
3264 C  CZ    . PHE B 229 ? 0.65714 1.13518 0.68726 -0.06571 -0.01188 0.13640  924  PHE A CZ    
3265 N  N     . LYS B 230 ? 1.27473 1.96743 1.32360 -0.02827 -0.00857 0.18565  925  LYS A N     
3266 C  CA    . LYS B 230 ? 1.33380 2.04941 1.37701 -0.04261 -0.01076 0.18465  925  LYS A CA    
3267 C  C     . LYS B 230 ? 1.37356 2.11239 1.40595 -0.07515 -0.01507 0.17693  925  LYS A C     
3268 O  O     . LYS B 230 ? 1.39285 2.11491 1.41472 -0.09509 -0.01592 0.16790  925  LYS A O     
3269 C  CB    . LYS B 230 ? 1.28086 2.03153 1.33172 -0.02217 -0.00560 0.19640  925  LYS A CB    
3270 C  CG    . LYS B 230 ? 1.27605 2.04284 1.32444 -0.03324 -0.00782 0.19319  925  LYS A CG    
3271 C  CD    . LYS B 230 ? 1.29474 2.09773 1.34200 -0.04654 -0.01127 0.19073  925  LYS A CD    
3272 C  CE    . LYS B 230 ? 1.19809 2.01184 1.23928 -0.06539 -0.01575 0.18438  925  LYS A CE    
3273 N  NZ    . LYS B 230 ? 1.14937 1.94590 1.17675 -0.09596 -0.02167 0.17224  925  LYS A NZ    
3274 N  N     . SER B 231 ? 1.43113 2.19716 1.46375 -0.08019 -0.01859 0.17780  926  SER A N     
3275 C  CA    . SER B 231 ? 1.41043 2.18751 1.43051 -0.11089 -0.02375 0.16765  926  SER A CA    
3276 C  C     . SER B 231 ? 1.41706 2.15404 1.42590 -0.12986 -0.02122 0.15739  926  SER A C     
3277 O  O     . SER B 231 ? 1.46654 2.18905 1.48054 -0.11999 -0.01783 0.15998  926  SER A O     
3278 C  CB    . SER B 231 ? 1.37931 2.18987 1.40159 -0.10778 -0.02419 0.17136  926  SER A CB    
3279 O  OG    . SER B 231 ? 1.35585 2.16931 1.36639 -0.13435 -0.02786 0.16240  926  SER A OG    
3280 N  N     . GLY B 232 ? 1.10102 1.81481 1.09376 -0.15606 -0.02111 0.14538  927  GLY A N     
3281 C  CA    . GLY B 232 ? 1.01477 1.68679 0.99369 -0.17491 -0.01715 0.13502  927  GLY A CA    
3282 C  C     . GLY B 232 ? 0.90616 1.52465 0.88679 -0.16528 -0.01130 0.13267  927  GLY A C     
3283 O  O     . GLY B 232 ? 0.76036 1.36328 0.75097 -0.14560 -0.01254 0.13491  927  GLY A O     
3284 N  N     . SER B 233 ? 1.16137 1.73985 1.13299 -0.17550 -0.00908 0.12427  928  SER A N     
3285 C  CA    . SER B 233 ? 1.17134 1.68561 1.14226 -0.16682 -0.00786 0.11647  928  SER A CA    
3286 C  C     . SER B 233 ? 1.16267 1.66157 1.15124 -0.14137 -0.00910 0.12072  928  SER A C     
3287 O  O     . SER B 233 ? 1.15435 1.68876 1.15431 -0.13028 -0.01022 0.12942  928  SER A O     
3288 C  CB    . SER B 233 ? 1.20366 1.68164 1.15131 -0.19268 -0.00328 0.10527  928  SER A CB    
3289 O  OG    . SER B 233 ? 1.18981 1.66926 1.13581 -0.19845 -0.00196 0.10507  928  SER A OG    
3290 N  N     . CYS B 234 ? 1.09777 1.54265 1.08734 -0.13205 -0.00831 0.11454  929  CYS A N     
3291 C  CA    . CYS B 234 ? 1.06170 1.48297 1.06481 -0.11060 -0.00894 0.11623  929  CYS A CA    
3292 C  C     . CYS B 234 ? 1.03964 1.44019 1.03513 -0.12157 -0.00696 0.11101  929  CYS A C     
3293 O  O     . CYS B 234 ? 1.05763 1.42682 1.03686 -0.13817 -0.00398 0.10275  929  CYS A O     
3294 C  CB    . CYS B 234 ? 1.09788 1.47687 1.10545 -0.09624 -0.00922 0.11264  929  CYS A CB    
3295 S  SG    . CYS B 234 ? 1.07438 1.41292 1.09262 -0.07643 -0.00913 0.11105  929  CYS A SG    
3296 N  N     . PRO B 235 ? 0.90358 1.31997 0.90866 -0.11273 -0.00766 0.11587  930  PRO A N     
3297 C  CA    . PRO B 235 ? 0.84603 1.24474 0.84373 -0.12407 -0.00579 0.11111  930  PRO A CA    
3298 C  C     . PRO B 235 ? 0.85102 1.19398 0.84652 -0.11830 -0.00434 0.10404  930  PRO A C     
3299 O  O     . PRO B 235 ? 0.85620 1.17523 0.83845 -0.13282 -0.00123 0.09807  930  PRO A O     
3300 C  CB    . PRO B 235 ? 0.76586 1.19618 0.77727 -0.11096 -0.00724 0.11923  930  PRO A CB    
3301 C  CG    . PRO B 235 ? 0.76739 1.21025 0.79363 -0.08584 -0.00870 0.12688  930  PRO A CG    
3302 C  CD    . PRO B 235 ? 0.86276 1.31467 0.88378 -0.09229 -0.00921 0.12643  930  PRO A CD    
3303 N  N     . ARG B 236 ? 0.75961 1.08225 0.76630 -0.09801 -0.00587 0.10489  931  ARG A N     
3304 C  CA    . ARG B 236 ? 0.76874 1.04474 0.77510 -0.09081 -0.00481 0.09944  931  ARG A CA    
3305 C  C     . ARG B 236 ? 0.87590 1.12049 0.86354 -0.10707 -0.00105 0.09204  931  ARG A C     
3306 O  O     . ARG B 236 ? 0.85805 1.07262 0.83711 -0.11178 0.00200  0.08764  931  ARG A O     
3307 C  CB    . ARG B 236 ? 0.71883 0.98394 0.73840 -0.06923 -0.00679 0.10172  931  ARG A CB    
3308 C  CG    . ARG B 236 ? 0.68597 0.90939 0.70660 -0.06094 -0.00610 0.09701  931  ARG A CG    
3309 C  CD    . ARG B 236 ? 0.63062 0.85135 0.66435 -0.04360 -0.00728 0.09976  931  ARG A CD    
3310 N  NE    . ARG B 236 ? 0.58195 0.80631 0.62520 -0.02726 -0.00818 0.10337  931  ARG A NE    
3311 C  CZ    . ARG B 236 ? 0.71317 0.91224 0.75896 -0.01857 -0.00826 0.10076  931  ARG A CZ    
3312 N  NH1   . ARG B 236 ? 0.77461 0.94535 0.81527 -0.02295 -0.00774 0.09531  931  ARG A NH1   
3313 N  NH2   . ARG B 236 ? 0.71970 0.92223 0.77185 -0.00550 -0.00814 0.10403  931  ARG A NH2   
3314 N  N     . CYS B 237 ? 1.30095 1.55101 1.28040 -0.11539 -0.00035 0.09090  932  CYS A N     
3315 C  CA    . CYS B 237 ? 1.35710 1.57457 1.31586 -0.12981 0.00474  0.08413  932  CYS A CA    
3316 C  C     . CYS B 237 ? 1.30457 1.52441 1.24188 -0.15520 0.00975  0.08045  932  CYS A C     
3317 O  O     . CYS B 237 ? 1.28214 1.46518 1.19896 -0.16611 0.01627  0.07471  932  CYS A O     
3318 C  CB    . CYS B 237 ? 1.43424 1.65509 1.39083 -0.12988 0.00410  0.08384  932  CYS A CB    
3319 S  SG    . CYS B 237 ? 1.49536 1.77299 1.46419 -0.12851 -0.00084 0.09104  932  CYS A SG    
3320 N  N     . GLU B 238 ? 1.09793 1.36021 1.03791 -0.16475 0.00773  0.08406  933  GLU A N     
3321 C  CA    . GLU B 238 ? 1.16053 1.42782 1.08008 -0.19044 0.01256  0.08059  933  GLU A CA    
3322 C  C     . GLU B 238 ? 1.23924 1.46890 1.15124 -0.19121 0.01673  0.07688  933  GLU A C     
3323 O  O     . GLU B 238 ? 1.27689 1.48270 1.16350 -0.21166 0.02418  0.07125  933  GLU A O     
3324 C  CB    . GLU B 238 ? 1.17746 1.50197 1.10585 -0.19636 0.00876  0.08674  933  GLU A CB    
3325 C  CG    . GLU B 238 ? 1.27487 1.62016 1.17986 -0.22841 0.01320  0.08354  933  GLU A CG    
3326 C  CD    . GLU B 238 ? 1.36649 1.72208 1.26772 -0.23942 0.01474  0.08374  933  GLU A CD    
3327 O  OE1   . GLU B 238 ? 1.42213 1.76739 1.33948 -0.22108 0.01217  0.08632  933  GLU A OE1   
3328 O  OE2   . GLU B 238 ? 1.37769 1.75070 1.25897 -0.26697 0.01855  0.08079  933  GLU A OE2   
3329 N  N     . ARG B 239 ? 1.26437 1.48645 1.19624 -0.16935 0.01284  0.07989  934  ARG A N     
3330 C  CA    . ARG B 239 ? 1.22940 1.41626 1.15625 -0.16736 0.01625  0.07692  934  ARG A CA    
3331 C  C     . ARG B 239 ? 1.21769 1.35633 1.13642 -0.15888 0.02036  0.07322  934  ARG A C     
3332 O  O     . ARG B 239 ? 1.25700 1.36061 1.15520 -0.16854 0.02783  0.06904  934  ARG A O     
3333 C  CB    . ARG B 239 ? 1.16151 1.36165 1.11185 -0.14845 0.01068  0.08151  934  ARG A CB    
3334 C  CG    . ARG B 239 ? 1.13220 1.37480 1.08913 -0.15481 0.00807  0.08573  934  ARG A CG    
3335 C  CD    . ARG B 239 ? 1.09678 1.34422 1.07482 -0.13370 0.00383  0.08984  934  ARG A CD    
3336 N  NE    . ARG B 239 ? 1.04012 1.27907 1.03369 -0.11078 0.00055  0.09208  934  ARG A NE    
3337 C  CZ    . ARG B 239 ? 0.93432 1.20326 0.94206 -0.09746 -0.00293 0.09820  934  ARG A CZ    
3338 N  NH1   . ARG B 239 ? 0.88450 1.19713 0.89425 -0.10309 -0.00396 0.10358  934  ARG A NH1   
3339 N  NH2   . ARG B 239 ? 0.86744 1.12361 0.88600 -0.07861 -0.00467 0.09943  934  ARG A NH2   
3340 N  N     . LEU B 240 ? 1.21770 1.35439 1.15167 -0.14003 0.01620  0.07532  935  LEU A N     
3341 C  CA    . LEU B 240 ? 1.26272 1.35979 1.19299 -0.12856 0.01914  0.07324  935  LEU A CA    
3342 C  C     . LEU B 240 ? 1.37051 1.43640 1.27216 -0.14350 0.02815  0.06860  935  LEU A C     
3343 O  O     . LEU B 240 ? 1.38940 1.41738 1.28032 -0.13771 0.03388  0.06704  935  LEU A O     
3344 C  CB    . LEU B 240 ? 1.18678 1.29278 1.13531 -0.11062 0.01355  0.07603  935  LEU A CB    
3345 C  CG    . LEU B 240 ? 1.09123 1.20719 1.06377 -0.09029 0.00747  0.07970  935  LEU A CG    
3346 C  CD1   . LEU B 240 ? 1.04475 1.17224 1.03000 -0.07798 0.00340  0.08214  935  LEU A CD1   
3347 C  CD2   . LEU B 240 ? 1.04027 1.12492 1.01287 -0.08079 0.00949  0.07824  935  LEU A CD2   
3348 N  N     . GLN B 241 ? 1.41708 1.49841 1.30483 -0.16205 0.03023  0.06676  936  GLN A N     
3349 C  CA    . GLN B 241 ? 1.44340 1.49411 1.29994 -0.17862 0.04016  0.06180  936  GLN A CA    
3350 C  C     . GLN B 241 ? 1.42907 1.47829 1.26046 -0.20514 0.04727  0.05814  936  GLN A C     
3351 O  O     . GLN B 241 ? 1.47632 1.49726 1.27635 -0.22232 0.05751  0.05338  936  GLN A O     
3352 C  CB    . GLN B 241 ? 1.43291 1.49576 1.28799 -0.18131 0.03864  0.06128  936  GLN A CB    
3353 C  CG    . GLN B 241 ? 1.40510 1.44245 1.26642 -0.16144 0.03852  0.06207  936  GLN A CG    
3354 C  CD    . GLN B 241 ? 1.36382 1.39856 1.25023 -0.13686 0.03274  0.06601  936  GLN A CD    
3355 O  OE1   . GLN B 241 ? 1.33917 1.40396 1.25088 -0.12524 0.02398  0.06970  936  GLN A OE1   
3356 N  NE2   . GLN B 241 ? 1.33059 1.32911 1.20786 -0.12931 0.03859  0.06543  936  GLN A NE2   
3357 N  N     . ALA B 242 ? 1.28328 1.36063 1.12572 -0.20936 0.04299  0.06018  937  ALA A N     
3358 C  CA    . ALA B 242 ? 1.32114 1.38499 1.14148 -0.22919 0.05047  0.05694  937  ALA A CA    
3359 C  C     . ALA B 242 ? 1.36058 1.38855 1.18217 -0.21555 0.05351  0.05729  937  ALA A C     
3360 O  O     . ALA B 242 ? 1.34937 1.35997 1.15235 -0.22965 0.06046  0.05482  937  ALA A O     
3361 C  CB    . ALA B 242 ? 1.28074 1.39461 1.11081 -0.24188 0.04492  0.05923  937  ALA A CB    
3362 N  N     . ARG B 243 ? 1.62317 1.64084 1.46537 -0.18932 0.04874  0.06036  938  ARG A N     
3363 C  CA    . ARG B 243 ? 1.65960 1.64531 1.50390 -0.17446 0.05134  0.06125  938  ARG A CA    
3364 C  C     . ARG B 243 ? 1.72535 1.66058 1.54007 -0.17634 0.06381  0.05878  938  ARG A C     
3365 O  O     . ARG B 243 ? 1.74993 1.65498 1.54092 -0.18645 0.07359  0.05676  938  ARG A O     
3366 C  CB    . ARG B 243 ? 1.59011 1.58818 1.46622 -0.14764 0.04176  0.06543  938  ARG A CB    
3367 C  CG    . ARG B 243 ? 1.50932 1.54154 1.41088 -0.14087 0.03269  0.06839  938  ARG A CG    
3368 C  CD    . ARG B 243 ? 1.46777 1.48174 1.37277 -0.13311 0.03374  0.06875  938  ARG A CD    
3369 N  NE    . ARG B 243 ? 1.43804 1.48265 1.35995 -0.13298 0.02744  0.07070  938  ARG A NE    
3370 C  CZ    . ARG B 243 ? 1.42557 1.49811 1.37264 -0.11819 0.01905  0.07418  938  ARG A CZ    
3371 N  NH1   . ARG B 243 ? 1.39464 1.46890 1.35330 -0.10365 0.01554  0.07569  938  ARG A NH1   
3372 N  NH2   . ARG B 243 ? 1.44140 1.53905 1.40037 -0.11801 0.01503  0.07631  938  ARG A NH2   
3373 N  N     . ARG B 244 ? 1.76875 1.69346 1.58378 -0.16549 0.06429  0.05946  939  ARG A N     
3374 C  CA    . ARG B 244 ? 1.81980 1.69885 1.60415 -0.16725 0.07723  0.05774  939  ARG A CA    
3375 C  C     . ARG B 244 ? 1.93533 1.79720 1.68234 -0.19605 0.08879  0.05251  939  ARG A C     
3376 O  O     . ARG B 244 ? 1.96989 1.78556 1.68368 -0.20062 0.10310  0.05082  939  ARG A O     
3377 C  CB    . ARG B 244 ? 1.75080 1.63113 1.54323 -0.15408 0.07445  0.05913  939  ARG A CB    
3378 C  CG    . ARG B 244 ? 1.76272 1.59700 1.52906 -0.14742 0.08696  0.05937  939  ARG A CG    
3379 C  CD    . ARG B 244 ? 1.75003 1.55223 1.50738 -0.13603 0.09445  0.06216  939  ARG A CD    
3380 N  NE    . ARG B 244 ? 1.74716 1.51576 1.49079 -0.11940 0.10333  0.06543  939  ARG A NE    
3381 C  CZ    . ARG B 244 ? 1.67856 1.44466 1.43839 -0.09538 0.10085  0.07091  939  ARG A CZ    
3382 N  NH1   . ARG B 244 ? 1.59762 1.33643 1.34328 -0.08054 0.10972  0.07472  939  ARG A NH1   
3383 N  NH2   . ARG B 244 ? 1.68843 1.48004 1.47727 -0.08641 0.09012  0.07283  939  ARG A NH2   
3384 N  N     . GLU B 245 ? 2.08611 1.98499 1.83631 -0.21574 0.08367  0.05026  940  GLU A N     
3385 C  CA    . GLU B 245 ? 2.15361 2.04392 1.86884 -0.24711 0.09378  0.04482  940  GLU A CA    
3386 C  C     . GLU B 245 ? 2.18137 2.03897 1.87238 -0.25787 0.10447  0.04298  940  GLU A C     
3387 O  O     . GLU B 245 ? 2.24019 2.06424 1.90075 -0.26750 0.11414  0.03489  940  GLU A O     
3388 C  CB    . GLU B 245 ? 2.13590 2.08291 1.86568 -0.26329 0.08415  0.04453  940  GLU A CB    
3389 C  CG    . GLU B 245 ? 2.12572 2.07699 1.82751 -0.29144 0.08938  0.03666  940  GLU A CG    
3390 C  CD    . GLU B 245 ? 2.07983 2.04470 1.77977 -0.29506 0.08759  0.03555  940  GLU A CD    
3391 O  OE1   . GLU B 245 ? 2.06576 2.06409 1.76415 -0.31113 0.08245  0.03061  940  GLU A OE1   
3392 O  OE2   . GLU B 245 ? 2.07468 2.01800 1.77589 -0.28042 0.09018  0.03902  940  GLU A OE2   
3393 N  N     . ALA B 246 ? 2.12921 2.00222 1.84262 -0.24850 0.09750  0.04595  941  ALA A N     
3394 C  CA    . ALA B 246 ? 2.09755 1.94204 1.79230 -0.25588 0.10590  0.04391  941  ALA A CA    
3395 C  C     . ALA B 246 ? 2.07440 1.87253 1.76253 -0.23490 0.11368  0.04765  941  ALA A C     
3396 O  O     . ALA B 246 ? 2.10894 1.87889 1.78175 -0.23543 0.12059  0.04454  941  ALA A O     
3397 C  CB    . ALA B 246 ? 2.03926 1.92307 1.75680 -0.26076 0.09654  0.04614  941  ALA A CB    
3398 N  N     . LEU B 247 ? 1.76702 1.56478 1.47482 -0.20936 0.10840  0.05151  942  LEU A N     
3399 C  CA    . LEU B 247 ? 1.69931 1.45773 1.40080 -0.18716 0.11559  0.05534  942  LEU A CA    
3400 C  C     . LEU B 247 ? 1.75593 1.46469 1.41524 -0.19266 0.13324  0.05389  942  LEU A C     
3401 O  O     . LEU B 247 ? 1.75208 1.42138 1.39348 -0.18131 0.14395  0.05539  942  LEU A O     
3402 C  CB    . LEU B 247 ? 1.55117 1.33370 1.28998 -0.15950 0.10284  0.06007  942  LEU A CB    
3403 C  CG    . LEU B 247 ? 1.44532 1.20207 1.18706 -0.13328 0.10655  0.06543  942  LEU A CG    
3404 C  CD1   . LEU B 247 ? 1.46580 1.19920 1.19877 -0.12969 0.11285  0.06731  942  LEU A CD1   
3405 C  CD2   . LEU B 247 ? 1.33068 1.12177 1.11183 -0.11203 0.09182  0.06887  942  LEU A CD2   
3406 N  N     . ALA B 248 ? 1.68891 1.40182 1.33531 -0.20601 0.13520  0.05026  943  ALA A N     
3407 C  CA    . ALA B 248 ? 1.72290 1.39770 1.34019 -0.20314 0.14681  0.04557  943  ALA A CA    
3408 C  C     . ALA B 248 ? 1.73321 1.37730 1.31975 -0.21493 0.15684  0.03540  943  ALA A C     
3409 O  O     . ALA B 248 ? 1.72622 1.33029 1.28619 -0.20843 0.16875  0.03206  943  ALA A O     
3410 C  CB    . ALA B 248 ? 1.72103 1.41461 1.33780 -0.21379 0.14339  0.04293  943  ALA A CB    
3411 P  PG    . GTP C .   ? 0.60584 0.65978 0.66651 0.03157  -0.00778 0.07581  1401 GTP B PG    
3412 O  O1G   . GTP C .   ? 0.60366 0.66523 0.66484 0.02862  -0.00824 0.07226  1401 GTP B O1G   
3413 O  O2G   . GTP C .   ? 0.59927 0.64556 0.66016 0.02910  -0.00775 0.07472  1401 GTP B O2G   
3414 O  O3G   . GTP C .   ? 0.61224 0.66900 0.67138 0.03357  -0.00718 0.07877  1401 GTP B O3G   
3415 O  O3B   . GTP C .   ? 0.57576 0.62609 0.63476 0.03513  -0.00675 0.07824  1401 GTP B O3B   
3416 P  PB    . GTP C .   ? 0.49497 0.54799 0.55585 0.03431  -0.00763 0.07577  1401 GTP B PB    
3417 O  O1B   . GTP C .   ? 0.40716 0.44816 0.46619 0.03552  -0.00644 0.07701  1401 GTP B O1B   
3418 O  O2B   . GTP C .   ? 0.49383 0.54758 0.55594 0.02941  -0.00852 0.07080  1401 GTP B O2B   
3419 O  O3A   . GTP C .   ? 0.52781 0.59579 0.58841 0.03797  -0.00741 0.07863  1401 GTP B O3A   
3420 P  PA    . GTP C .   ? 0.55027 0.63006 0.61178 0.03774  -0.00814 0.07779  1401 GTP B PA    
3421 O  O1A   . GTP C .   ? 0.48971 0.56027 0.55199 0.03337  -0.00897 0.07291  1401 GTP B O1A   
3422 O  O2A   . GTP C .   ? 0.49730 0.59495 0.55873 0.03327  -0.00905 0.07602  1401 GTP B O2A   
3423 O  "O5'" . GTP C .   ? 0.55554 0.63672 0.61470 0.04698  -0.00572 0.08470  1401 GTP B "O5'" 
3424 C  "C5'" . GTP C .   ? 0.54482 0.63402 0.60124 0.05427  -0.00337 0.09102  1401 GTP B "C5'" 
3425 C  "C4'" . GTP C .   ? 0.46989 0.58068 0.52618 0.06074  -0.00242 0.09624  1401 GTP B "C4'" 
3426 O  "O4'" . GTP C .   ? 0.48854 0.59142 0.54245 0.06582  -0.00036 0.09871  1401 GTP B "O4'" 
3427 C  "C3'" . GTP C .   ? 0.49462 0.62800 0.55489 0.05266  -0.00594 0.09193  1401 GTP B "C3'" 
3428 O  "O3'" . GTP C .   ? 0.52635 0.68673 0.58653 0.05713  -0.00529 0.09755  1401 GTP B "O3'" 
3429 C  "C2'" . GTP C .   ? 0.50790 0.64029 0.56885 0.05124  -0.00668 0.08984  1401 GTP B "C2'" 
3430 O  "O2'" . GTP C .   ? 0.50551 0.66419 0.56732 0.04664  -0.00832 0.08884  1401 GTP B "O2'" 
3431 C  "C1'" . GTP C .   ? 0.52044 0.64209 0.57791 0.06308  -0.00281 0.09707  1401 GTP B "C1'" 
3432 N  N9    . GTP C .   ? 0.48881 0.59514 0.54645 0.06108  -0.00315 0.09393  1401 GTP B N9    
3433 C  C8    . GTP C .   ? 0.50151 0.59048 0.56096 0.05282  -0.00522 0.08685  1401 GTP B C8    
3434 N  N7    . GTP C .   ? 0.50144 0.58081 0.56073 0.05318  -0.00499 0.08586  1401 GTP B N7    
3435 C  C5    . GTP C .   ? 0.58033 0.66974 0.63736 0.06183  -0.00260 0.09232  1401 GTP B C5    
3436 C  C6    . GTP C .   ? 0.62854 0.71410 0.68402 0.06630  -0.00106 0.09466  1401 GTP B C6    
3437 O  O6    . GTP C .   ? 0.67239 0.74277 0.72901 0.06138  -0.00226 0.08995  1401 GTP B O6    
3438 N  N1    . GTP C .   ? 0.61212 0.71189 0.66442 0.07721  0.00225  0.10298  1401 GTP B N1    
3439 C  C2    . GTP C .   ? 0.58700 0.70625 0.63795 0.08381  0.00395  0.10915  1401 GTP B C2    
3440 N  N2    . GTP C .   ? 0.55569 0.69110 0.60304 0.09623  0.00790  0.11852  1401 GTP B N2    
3441 N  N3    . GTP C .   ? 0.60061 0.72336 0.65360 0.07838  0.00197  0.10624  1401 GTP B N3    
3442 C  C4    . GTP C .   ? 0.55543 0.66287 0.61128 0.06749  -0.00122 0.09787  1401 GTP B C4    
3443 MG MG    . MG  D .   ? 0.94998 1.00337 1.01002 0.02535  -0.00741 0.06757  1402 MG  B MG    
3444 ZN ZN    . ZN  E .   ? 1.51578 1.56119 1.59410 -0.00834 -0.03742 0.07179  1001 ZN  A ZN    
3445 ZN ZN    . ZN  F .   ? 2.25403 2.18117 2.17570 0.07772  0.08495  0.09018  1002 ZN  A ZN    
3446 ZN ZN    . ZN  G .   ? 2.02798 2.63829 2.09934 0.08580  0.01773  0.21114  1003 ZN  A ZN    
3447 ZN ZN    . ZN  H .   ? 2.41671 2.72813 2.42293 -0.08552 -0.00864 0.10410  1004 ZN  A ZN    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   -1  ?   ?   ?   B . n 
A 1 2   ASN 2   0   ?   ?   ?   B . n 
A 1 3   ALA 3   1   ?   ?   ?   B . n 
A 1 4   THR 4   2   ?   ?   ?   B . n 
A 1 5   SER 5   3   ?   ?   ?   B . n 
A 1 6   ARG 6   4   ?   ?   ?   B . n 
A 1 7   LYS 7   5   ?   ?   ?   B . n 
A 1 8   LYS 8   6   ?   ?   ?   B . n 
A 1 9   VAL 9   7   7   VAL VAL B . n 
A 1 10  LEU 10  8   8   LEU LEU B . n 
A 1 11  LEU 11  9   9   LEU LEU B . n 
A 1 12  LYS 12  10  10  LYS LYS B . n 
A 1 13  VAL 13  11  11  VAL VAL B . n 
A 1 14  ILE 14  12  12  ILE ILE B . n 
A 1 15  ILE 15  13  13  ILE ILE B . n 
A 1 16  LEU 16  14  14  LEU LEU B . n 
A 1 17  GLY 17  15  15  GLY GLY B . n 
A 1 18  ASP 18  16  16  ASP ASP B . n 
A 1 19  SER 19  17  17  SER SER B . n 
A 1 20  GLY 20  18  18  GLY GLY B . n 
A 1 21  VAL 21  19  19  VAL VAL B . n 
A 1 22  GLY 22  20  20  GLY GLY B . n 
A 1 23  LYS 23  21  21  LYS LYS B . n 
A 1 24  THR 24  22  22  THR THR B . n 
A 1 25  SER 25  23  23  SER SER B . n 
A 1 26  LEU 26  24  24  LEU LEU B . n 
A 1 27  MET 27  25  25  MET MET B . n 
A 1 28  ASN 28  26  26  ASN ASN B . n 
A 1 29  GLN 29  27  27  GLN GLN B . n 
A 1 30  TYR 30  28  28  TYR TYR B . n 
A 1 31  VAL 31  29  29  VAL VAL B . n 
A 1 32  ASN 32  30  30  ASN ASN B . n 
A 1 33  LYS 33  31  31  LYS LYS B . n 
A 1 34  LYS 34  32  32  LYS LYS B . n 
A 1 35  PHE 35  33  33  PHE PHE B . n 
A 1 36  SER 36  34  34  SER SER B . n 
A 1 37  ASN 37  35  35  ASN ASN B . n 
A 1 38  GLN 38  36  36  GLN GLN B . n 
A 1 39  TYR 39  37  37  TYR TYR B . n 
A 1 40  LYS 40  38  38  LYS LYS B . n 
A 1 41  ALA 41  39  39  ALA ALA B . n 
A 1 42  THR 42  40  40  THR THR B . n 
A 1 43  ILE 43  41  41  ILE ILE B . n 
A 1 44  GLY 44  42  42  GLY GLY B . n 
A 1 45  ALA 45  43  43  ALA ALA B . n 
A 1 46  ASP 46  44  44  ASP ASP B . n 
A 1 47  PHE 47  45  45  PHE PHE B . n 
A 1 48  LEU 48  46  46  LEU LEU B . n 
A 1 49  THR 49  47  47  THR THR B . n 
A 1 50  LYS 50  48  48  LYS LYS B . n 
A 1 51  GLU 51  49  49  GLU GLU B . n 
A 1 52  VAL 52  50  50  VAL VAL B . n 
A 1 53  MET 53  51  51  MET MET B . n 
A 1 54  VAL 54  52  52  VAL VAL B . n 
A 1 55  ASP 55  53  53  ASP ASP B . n 
A 1 56  ASP 56  54  54  ASP ASP B . n 
A 1 57  ARG 57  55  55  ARG ARG B . n 
A 1 58  LEU 58  56  56  LEU LEU B . n 
A 1 59  VAL 59  57  57  VAL VAL B . n 
A 1 60  THR 60  58  58  THR THR B . n 
A 1 61  MET 61  59  59  MET MET B . n 
A 1 62  GLN 62  60  60  GLN GLN B . n 
A 1 63  ILE 63  61  61  ILE ILE B . n 
A 1 64  TRP 64  62  62  TRP TRP B . n 
A 1 65  ASP 65  63  63  ASP ASP B . n 
A 1 66  THR 66  64  64  THR THR B . n 
A 1 67  ALA 67  65  65  ALA ALA B . n 
A 1 68  GLY 68  66  66  GLY GLY B . n 
A 1 69  LEU 69  67  67  LEU LEU B . n 
A 1 70  GLU 70  68  68  GLU GLU B . n 
A 1 71  ARG 71  69  69  ARG ARG B . n 
A 1 72  PHE 72  70  70  PHE PHE B . n 
A 1 73  GLN 73  71  71  GLN GLN B . n 
A 1 74  SER 74  72  72  SER SER B . n 
A 1 75  LEU 75  73  73  LEU LEU B . n 
A 1 76  GLY 76  74  74  GLY GLY B . n 
A 1 77  VAL 77  75  75  VAL VAL B . n 
A 1 78  ALA 78  76  76  ALA ALA B . n 
A 1 79  PHE 79  77  77  PHE PHE B . n 
A 1 80  TYR 80  78  78  TYR TYR B . n 
A 1 81  ARG 81  79  79  ARG ARG B . n 
A 1 82  GLY 82  80  80  GLY GLY B . n 
A 1 83  ALA 83  81  81  ALA ALA B . n 
A 1 84  ASP 84  82  82  ASP ASP B . n 
A 1 85  CYS 85  83  83  CYS CYS B . n 
A 1 86  CYS 86  84  84  CYS CYS B . n 
A 1 87  VAL 87  85  85  VAL VAL B . n 
A 1 88  LEU 88  86  86  LEU LEU B . n 
A 1 89  VAL 89  87  87  VAL VAL B . n 
A 1 90  PHE 90  88  88  PHE PHE B . n 
A 1 91  ASP 91  89  89  ASP ASP B . n 
A 1 92  VAL 92  90  90  VAL VAL B . n 
A 1 93  THR 93  91  91  THR THR B . n 
A 1 94  ALA 94  92  92  ALA ALA B . n 
A 1 95  PRO 95  93  93  PRO PRO B . n 
A 1 96  ASN 96  94  94  ASN ASN B . n 
A 1 97  THR 97  95  95  THR THR B . n 
A 1 98  PHE 98  96  96  PHE PHE B . n 
A 1 99  LYS 99  97  97  LYS LYS B . n 
A 1 100 THR 100 98  98  THR THR B . n 
A 1 101 LEU 101 99  99  LEU LEU B . n 
A 1 102 ASP 102 100 100 ASP ASP B . n 
A 1 103 SER 103 101 101 SER SER B . n 
A 1 104 TRP 104 102 102 TRP TRP B . n 
A 1 105 ARG 105 103 103 ARG ARG B . n 
A 1 106 ASP 106 104 104 ASP ASP B . n 
A 1 107 GLU 107 105 105 GLU GLU B . n 
A 1 108 PHE 108 106 106 PHE PHE B . n 
A 1 109 LEU 109 107 107 LEU LEU B . n 
A 1 110 ILE 110 108 108 ILE ILE B . n 
A 1 111 GLN 111 109 109 GLN GLN B . n 
A 1 112 ALA 112 110 110 ALA ALA B . n 
A 1 113 SER 113 111 111 SER SER B . n 
A 1 114 PRO 114 112 112 PRO PRO B . n 
A 1 115 ARG 115 113 113 ARG ARG B . n 
A 1 116 ASP 116 114 114 ASP ASP B . n 
A 1 117 PRO 117 115 115 PRO PRO B . n 
A 1 118 GLU 118 116 116 GLU GLU B . n 
A 1 119 ASN 119 117 117 ASN ASN B . n 
A 1 120 PHE 120 118 118 PHE PHE B . n 
A 1 121 PRO 121 119 119 PRO PRO B . n 
A 1 122 PHE 122 120 120 PHE PHE B . n 
A 1 123 VAL 123 121 121 VAL VAL B . n 
A 1 124 VAL 124 122 122 VAL VAL B . n 
A 1 125 LEU 125 123 123 LEU LEU B . n 
A 1 126 GLY 126 124 124 GLY GLY B . n 
A 1 127 ASN 127 125 125 ASN ASN B . n 
A 1 128 LYS 128 126 126 LYS LYS B . n 
A 1 129 ILE 129 127 127 ILE ILE B . n 
A 1 130 ASP 130 128 128 ASP ASP B . n 
A 1 131 LEU 131 129 129 LEU LEU B . n 
A 1 132 GLU 132 130 130 GLU GLU B . n 
A 1 133 ASN 133 131 131 ASN ASN B . n 
A 1 134 ARG 134 132 132 ARG ARG B . n 
A 1 135 GLN 135 133 133 GLN GLN B . n 
A 1 136 VAL 136 134 134 VAL VAL B . n 
A 1 137 ALA 137 135 135 ALA ALA B . n 
A 1 138 THR 138 136 136 THR THR B . n 
A 1 139 LYS 139 137 137 LYS LYS B . n 
A 1 140 ARG 140 138 138 ARG ARG B . n 
A 1 141 ALA 141 139 139 ALA ALA B . n 
A 1 142 GLN 142 140 140 GLN GLN B . n 
A 1 143 ALA 143 141 141 ALA ALA B . n 
A 1 144 TRP 144 142 142 TRP TRP B . n 
A 1 145 CYS 145 143 143 CYS CYS B . n 
A 1 146 TYR 146 144 144 TYR TYR B . n 
A 1 147 SER 147 145 145 SER SER B . n 
A 1 148 LYS 148 146 146 LYS LYS B . n 
A 1 149 ASN 149 147 147 ASN ASN B . n 
A 1 150 ASN 150 148 148 ASN ASN B . n 
A 1 151 ILE 151 149 149 ILE ILE B . n 
A 1 152 PRO 152 150 150 PRO PRO B . n 
A 1 153 TYR 153 151 151 TYR TYR B . n 
A 1 154 PHE 154 152 152 PHE PHE B . n 
A 1 155 GLU 155 153 153 GLU GLU B . n 
A 1 156 THR 156 154 154 THR THR B . n 
A 1 157 SER 157 155 155 SER SER B . n 
A 1 158 ALA 158 156 156 ALA ALA B . n 
A 1 159 LYS 159 157 157 LYS LYS B . n 
A 1 160 GLU 160 158 158 GLU GLU B . n 
A 1 161 ALA 161 159 159 ALA ALA B . n 
A 1 162 ILE 162 160 160 ILE ILE B . n 
A 1 163 ASN 163 161 161 ASN ASN B . n 
A 1 164 VAL 164 162 162 VAL VAL B . n 
A 1 165 GLU 165 163 163 GLU GLU B . n 
A 1 166 GLN 166 164 164 GLN GLN B . n 
A 1 167 ALA 167 165 165 ALA ALA B . n 
A 1 168 PHE 168 166 166 PHE PHE B . n 
A 1 169 GLN 169 167 167 GLN GLN B . n 
A 1 170 THR 170 168 168 THR THR B . n 
A 1 171 ILE 171 169 169 ILE ILE B . n 
A 1 172 ALA 172 170 170 ALA ALA B . n 
A 1 173 ARG 173 171 171 ARG ARG B . n 
A 1 174 ASN 174 172 172 ASN ASN B . n 
A 1 175 ALA 175 173 173 ALA ALA B . n 
A 1 176 LEU 176 174 174 LEU LEU B . n 
A 1 177 LYS 177 175 175 LYS LYS B . n 
A 1 178 GLN 178 176 176 GLN GLN B . n 
A 1 179 GLU 179 177 177 GLU GLU B . n 
A 1 180 THR 180 178 178 THR THR B . n 
A 1 181 GLU 181 179 179 GLU GLU B . n 
A 1 182 VAL 182 180 180 VAL VAL B . n 
A 1 183 GLU 183 181 181 GLU GLU B . n 
A 1 184 LEU 184 182 182 LEU LEU B . n 
B 2 1   SER 1   696 ?   ?   ?   A . n 
B 2 2   ASN 2   697 697 ASN ASN A . n 
B 2 3   ALA 3   698 698 ALA ALA A . n 
B 2 4   GLN 4   699 699 GLN GLN A . n 
B 2 5   ILE 5   700 700 ILE ILE A . n 
B 2 6   ILE 6   701 701 ILE ILE A . n 
B 2 7   PHE 7   702 702 PHE PHE A . n 
B 2 8   ASN 8   703 703 ASN ASN A . n 
B 2 9   VAL 9   704 704 VAL VAL A . n 
B 2 10  HIS 10  705 705 HIS HIS A . n 
B 2 11  PRO 11  706 706 PRO PRO A . n 
B 2 12  ALA 12  707 707 ALA ALA A . n 
B 2 13  PRO 13  708 708 PRO PRO A . n 
B 2 14  THR 14  709 709 THR THR A . n 
B 2 15  ARG 15  710 710 ARG ARG A . n 
B 2 16  LYS 16  711 711 LYS LYS A . n 
B 2 17  ILE 17  712 712 ILE ILE A . n 
B 2 18  ALA 18  713 713 ALA ALA A . n 
B 2 19  VAL 19  714 714 VAL VAL A . n 
B 2 20  ALA 20  715 715 ALA ALA A . n 
B 2 21  LYS 21  716 716 LYS LYS A . n 
B 2 22  GLN 22  717 717 GLN GLN A . n 
B 2 23  ASN 23  718 718 ASN ASN A . n 
B 2 24  TYR 24  719 719 TYR TYR A . n 
B 2 25  ARG 25  720 720 ARG ARG A . n 
B 2 26  CYS 26  721 721 CYS CYS A . n 
B 2 27  ALA 27  722 722 ALA ALA A . n 
B 2 28  GLY 28  723 723 GLY GLY A . n 
B 2 29  CYS 29  724 724 CYS CYS A . n 
B 2 30  GLY 30  725 725 GLY GLY A . n 
B 2 31  ILE 31  726 726 ILE ILE A . n 
B 2 32  ARG 32  727 727 ARG ARG A . n 
B 2 33  THR 33  728 728 THR THR A . n 
B 2 34  ASP 34  729 729 ASP ASP A . n 
B 2 35  PRO 35  730 730 PRO PRO A . n 
B 2 36  ASP 36  731 731 ASP ASP A . n 
B 2 37  TYR 37  732 732 TYR TYR A . n 
B 2 38  ILE 38  733 733 ILE ILE A . n 
B 2 39  LYS 39  734 734 LYS LYS A . n 
B 2 40  ARG 40  735 735 ARG ARG A . n 
B 2 41  LEU 41  736 736 LEU LEU A . n 
B 2 42  ARG 42  737 737 ARG ARG A . n 
B 2 43  TYR 43  738 738 TYR TYR A . n 
B 2 44  CYS 44  739 739 CYS CYS A . n 
B 2 45  GLU 45  740 740 GLU GLU A . n 
B 2 46  TYR 46  741 741 TYR TYR A . n 
B 2 47  LEU 47  742 742 LEU LEU A . n 
B 2 48  GLY 48  743 743 GLY GLY A . n 
B 2 49  LYS 49  744 744 LYS LYS A . n 
B 2 50  TYR 50  745 745 TYR TYR A . n 
B 2 51  PHE 51  746 746 PHE PHE A . n 
B 2 52  CYS 52  747 747 CYS CYS A . n 
B 2 53  GLN 53  748 748 GLN GLN A . n 
B 2 54  CYS 54  749 749 CYS CYS A . n 
B 2 55  CYS 55  750 750 CYS CYS A . n 
B 2 56  HIS 56  751 751 HIS HIS A . n 
B 2 57  GLU 57  752 752 GLU GLU A . n 
B 2 58  ASN 58  753 753 ASN ASN A . n 
B 2 59  ALA 59  754 754 ALA ALA A . n 
B 2 60  GLN 60  755 755 GLN GLN A . n 
B 2 61  MET 61  756 756 MET MET A . n 
B 2 62  ALA 62  757 757 ALA ALA A . n 
B 2 63  ILE 63  758 758 ILE ILE A . n 
B 2 64  PRO 64  759 759 PRO PRO A . n 
B 2 65  SER 65  760 760 SER SER A . n 
B 2 66  ARG 66  761 761 ARG ARG A . n 
B 2 67  VAL 67  762 762 VAL VAL A . n 
B 2 68  LEU 68  763 763 LEU LEU A . n 
B 2 69  ARG 69  764 764 ARG ARG A . n 
B 2 70  LYS 70  765 765 LYS LYS A . n 
B 2 71  TRP 71  766 766 TRP TRP A . n 
B 2 72  ASP 72  767 767 ASP ASP A . n 
B 2 73  PHE 73  768 768 PHE PHE A . n 
B 2 74  SER 74  769 769 SER SER A . n 
B 2 75  LYS 75  770 770 LYS LYS A . n 
B 2 76  TYR 76  771 771 TYR TYR A . n 
B 2 77  TYR 77  772 772 TYR TYR A . n 
B 2 78  VAL 78  773 773 VAL VAL A . n 
B 2 79  SER 79  774 774 SER SER A . n 
B 2 80  ASN 80  775 775 ASN ASN A . n 
B 2 81  PHE 81  776 776 PHE PHE A . n 
B 2 82  SER 82  777 777 SER SER A . n 
B 2 83  LYS 83  778 778 LYS LYS A . n 
B 2 84  ASP 84  779 779 ASP ASP A . n 
B 2 85  LEU 85  780 780 LEU LEU A . n 
B 2 86  LEU 86  781 781 LEU LEU A . n 
B 2 87  ILE 87  782 782 ILE ILE A . n 
B 2 88  LYS 88  783 783 LYS LYS A . n 
B 2 89  ILE 89  784 784 ILE ILE A . n 
B 2 90  TRP 90  785 785 TRP TRP A . n 
B 2 91  ASN 91  786 786 ASN ASN A . n 
B 2 92  ASP 92  787 787 ASP ASP A . n 
B 2 93  PRO 93  788 788 PRO PRO A . n 
B 2 94  LEU 94  789 789 LEU LEU A . n 
B 2 95  PHE 95  790 790 PHE PHE A . n 
B 2 96  ASN 96  791 791 ASN ASN A . n 
B 2 97  VAL 97  792 792 VAL VAL A . n 
B 2 98  GLN 98  793 793 GLN GLN A . n 
B 2 99  ASP 99  794 794 ASP ASP A . n 
B 2 100 ILE 100 795 795 ILE ILE A . n 
B 2 101 ASN 101 796 796 ASN ASN A . n 
B 2 102 SER 102 797 797 SER SER A . n 
B 2 103 ALA 103 798 798 ALA ALA A . n 
B 2 104 LEU 104 799 799 LEU LEU A . n 
B 2 105 TYR 105 800 800 TYR TYR A . n 
B 2 106 ARG 106 801 801 ARG ARG A . n 
B 2 107 LYS 107 802 802 LYS LYS A . n 
B 2 108 VAL 108 803 803 VAL VAL A . n 
B 2 109 LYS 109 804 804 LYS LYS A . n 
B 2 110 LEU 110 805 805 LEU LEU A . n 
B 2 111 LEU 111 806 806 LEU LEU A . n 
B 2 112 ASN 112 807 807 ASN ASN A . n 
B 2 113 GLN 113 808 808 GLN GLN A . n 
B 2 114 VAL 114 809 809 VAL VAL A . n 
B 2 115 ARG 115 810 810 ARG ARG A . n 
B 2 116 LEU 116 811 811 LEU LEU A . n 
B 2 117 LEU 117 812 812 LEU LEU A . n 
B 2 118 ARG 118 813 813 ARG ARG A . n 
B 2 119 VAL 119 814 814 VAL VAL A . n 
B 2 120 GLN 120 815 815 GLN GLN A . n 
B 2 121 LEU 121 816 816 LEU LEU A . n 
B 2 122 CYS 122 817 817 CYS CYS A . n 
B 2 123 HIS 123 818 818 HIS HIS A . n 
B 2 124 MET 124 819 819 MET MET A . n 
B 2 125 LYS 125 820 820 LYS LYS A . n 
B 2 126 ASN 126 821 821 ASN ASN A . n 
B 2 127 MET 127 822 822 MET MET A . n 
B 2 128 PHE 128 823 823 PHE PHE A . n 
B 2 129 LYS 129 824 824 LYS LYS A . n 
B 2 130 THR 130 825 825 THR THR A . n 
B 2 131 CYS 131 826 826 CYS CYS A . n 
B 2 132 ARG 132 827 827 ARG ARG A . n 
B 2 133 LEU 133 828 828 LEU LEU A . n 
B 2 134 ALA 134 829 829 ALA ALA A . n 
B 2 135 LYS 135 830 830 LYS LYS A . n 
B 2 136 GLU 136 831 831 GLU GLU A . n 
B 2 137 LEU 137 832 832 LEU LEU A . n 
B 2 138 LEU 138 833 833 LEU LEU A . n 
B 2 139 ASP 139 834 834 ASP ASP A . n 
B 2 140 SER 140 835 835 SER SER A . n 
B 2 141 PHE 141 836 836 PHE PHE A . n 
B 2 142 ASP 142 837 837 ASP ASP A . n 
B 2 143 THR 143 838 838 THR THR A . n 
B 2 144 VAL 144 839 839 VAL VAL A . n 
B 2 145 PRO 145 840 840 PRO PRO A . n 
B 2 146 GLY 146 841 841 GLY GLY A . n 
B 2 147 HIS 147 842 842 HIS HIS A . n 
B 2 148 LEU 148 843 843 LEU LEU A . n 
B 2 149 THR 149 844 844 THR THR A . n 
B 2 150 GLU 150 845 845 GLU GLU A . n 
B 2 151 ASP 151 846 846 ASP ASP A . n 
B 2 152 LEU 152 847 847 LEU LEU A . n 
B 2 153 HIS 153 848 848 HIS HIS A . n 
B 2 154 LEU 154 849 849 LEU LEU A . n 
B 2 155 TYR 155 850 850 TYR TYR A . n 
B 2 156 SER 156 851 851 SER SER A . n 
B 2 157 LEU 157 852 852 LEU LEU A . n 
B 2 158 ASN 158 853 853 ASN ASN A . n 
B 2 159 ASP 159 854 854 ASP ASP A . n 
B 2 160 LEU 160 855 855 LEU LEU A . n 
B 2 161 THR 161 856 856 THR THR A . n 
B 2 162 ALA 162 857 857 ALA ALA A . n 
B 2 163 THR 163 858 858 THR THR A . n 
B 2 164 ARG 164 859 859 ARG ARG A . n 
B 2 165 LYS 165 860 860 LYS LYS A . n 
B 2 166 GLY 166 861 861 GLY GLY A . n 
B 2 167 GLU 167 862 862 GLU GLU A . n 
B 2 168 LEU 168 863 863 LEU LEU A . n 
B 2 169 GLY 169 864 864 GLY GLY A . n 
B 2 170 PRO 170 865 865 PRO PRO A . n 
B 2 171 ARG 171 866 866 ARG ARG A . n 
B 2 172 LEU 172 867 867 LEU LEU A . n 
B 2 173 ALA 173 868 868 ALA ALA A . n 
B 2 174 GLU 174 869 869 GLU GLU A . n 
B 2 175 LEU 175 870 870 LEU LEU A . n 
B 2 176 THR 176 871 871 THR THR A . n 
B 2 177 ARG 177 872 872 ARG ARG A . n 
B 2 178 ALA 178 873 873 ALA ALA A . n 
B 2 179 GLY 179 874 874 GLY GLY A . n 
B 2 180 ALA 180 875 875 ALA ALA A . n 
B 2 181 THR 181 876 876 THR THR A . n 
B 2 182 HIS 182 877 877 HIS HIS A . n 
B 2 183 VAL 183 878 878 VAL VAL A . n 
B 2 184 GLU 184 879 879 GLU GLU A . n 
B 2 185 ARG 185 880 880 ARG ARG A . n 
B 2 186 CYS 186 881 881 CYS CYS A . n 
B 2 187 MET 187 882 882 MET MET A . n 
B 2 188 LEU 188 883 883 LEU LEU A . n 
B 2 189 CYS 189 884 884 CYS CYS A . n 
B 2 190 GLN 190 885 885 GLN GLN A . n 
B 2 191 ALA 191 886 886 ALA ALA A . n 
B 2 192 LYS 192 887 887 LYS LYS A . n 
B 2 193 GLY 193 888 888 GLY GLY A . n 
B 2 194 PHE 194 889 889 PHE PHE A . n 
B 2 195 ILE 195 890 890 ILE ILE A . n 
B 2 196 CYS 196 891 891 CYS CYS A . n 
B 2 197 GLU 197 892 892 GLU GLU A . n 
B 2 198 PHE 198 893 893 PHE PHE A . n 
B 2 199 CYS 199 894 894 CYS CYS A . n 
B 2 200 GLN 200 895 895 GLN GLN A . n 
B 2 201 ASN 201 896 896 ASN ASN A . n 
B 2 202 GLU 202 897 897 GLU GLU A . n 
B 2 203 ASP 203 898 898 ASP ASP A . n 
B 2 204 ASP 204 899 899 ASP ASP A . n 
B 2 205 ILE 205 900 900 ILE ILE A . n 
B 2 206 ILE 206 901 901 ILE ILE A . n 
B 2 207 PHE 207 902 902 PHE PHE A . n 
B 2 208 PRO 208 903 903 PRO PRO A . n 
B 2 209 PHE 209 904 904 PHE PHE A . n 
B 2 210 GLU 210 905 905 GLU GLU A . n 
B 2 211 LEU 211 906 906 LEU LEU A . n 
B 2 212 HIS 212 907 907 HIS HIS A . n 
B 2 213 LYS 213 908 908 LYS LYS A . n 
B 2 214 CYS 214 909 909 CYS CYS A . n 
B 2 215 ARG 215 910 910 ARG ARG A . n 
B 2 216 THR 216 911 911 THR THR A . n 
B 2 217 CYS 217 912 912 CYS CYS A . n 
B 2 218 GLU 218 913 913 GLU GLU A . n 
B 2 219 GLU 219 914 914 GLU GLU A . n 
B 2 220 CYS 220 915 915 CYS CYS A . n 
B 2 221 LYS 221 916 916 LYS LYS A . n 
B 2 222 ALA 222 917 917 ALA ALA A . n 
B 2 223 CYS 223 918 918 CYS CYS A . n 
B 2 224 TYR 224 919 919 TYR TYR A . n 
B 2 225 HIS 225 920 920 HIS HIS A . n 
B 2 226 LYS 226 921 921 LYS LYS A . n 
B 2 227 ALA 227 922 922 ALA ALA A . n 
B 2 228 CYS 228 923 923 CYS CYS A . n 
B 2 229 PHE 229 924 924 PHE PHE A . n 
B 2 230 LYS 230 925 925 LYS LYS A . n 
B 2 231 SER 231 926 926 SER SER A . n 
B 2 232 GLY 232 927 927 GLY GLY A . n 
B 2 233 SER 233 928 928 SER SER A . n 
B 2 234 CYS 234 929 929 CYS CYS A . n 
B 2 235 PRO 235 930 930 PRO PRO A . n 
B 2 236 ARG 236 931 931 ARG ARG A . n 
B 2 237 CYS 237 932 932 CYS CYS A . n 
B 2 238 GLU 238 933 933 GLU GLU A . n 
B 2 239 ARG 239 934 934 ARG ARG A . n 
B 2 240 LEU 240 935 935 LEU LEU A . n 
B 2 241 GLN 241 936 936 GLN GLN A . n 
B 2 242 ALA 242 937 937 ALA ALA A . n 
B 2 243 ARG 243 938 938 ARG ARG A . n 
B 2 244 ARG 244 939 939 ARG ARG A . n 
B 2 245 GLU 245 940 940 GLU GLU A . n 
B 2 246 ALA 246 941 941 ALA ALA A . n 
B 2 247 LEU 247 942 942 LEU LEU A . n 
B 2 248 ALA 248 943 943 ALA ALA A . n 
B 2 249 ARG 249 944 ?   ?   ?   A . n 
B 2 250 GLN 250 945 ?   ?   ?   A . n 
B 2 251 SER 251 946 ?   ?   ?   A . n 
B 2 252 LEU 252 947 ?   ?   ?   A . n 
B 2 253 GLU 253 948 ?   ?   ?   A . n 
B 2 254 SER 254 949 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 GTP 1 1401 1401 GTP GTP B . 
D 4 MG  1 1402 278  MG  MG  B . 
E 5 ZN  1 1001 1426 ZN  ZN  A . 
F 5 ZN  1 1002 1437 ZN  ZN  A . 
G 5 ZN  1 1003 1448 ZN  ZN  A . 
H 5 ZN  1 1004 1459 ZN  ZN  A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG1 ? A THR 24  ? B THR 22   ? 1_555 MG ? D MG . ? B MG 1402 ? 1_555 OG1 ? A THR 42  ? B THR 40   ? 1_555 136.2 ? 
2  OG1 ? A THR 24  ? B THR 22   ? 1_555 MG ? D MG . ? B MG 1402 ? 1_555 O1G ? C GTP .   ? B GTP 1401 ? 1_555 120.6 ? 
3  OG1 ? A THR 42  ? B THR 40   ? 1_555 MG ? D MG . ? B MG 1402 ? 1_555 O1G ? C GTP .   ? B GTP 1401 ? 1_555 86.6  ? 
4  OG1 ? A THR 24  ? B THR 22   ? 1_555 MG ? D MG . ? B MG 1402 ? 1_555 O2B ? C GTP .   ? B GTP 1401 ? 1_555 71.6  ? 
5  OG1 ? A THR 42  ? B THR 40   ? 1_555 MG ? D MG . ? B MG 1402 ? 1_555 O2B ? C GTP .   ? B GTP 1401 ? 1_555 152.1 ? 
6  O1G ? C GTP .   ? B GTP 1401 ? 1_555 MG ? D MG . ? B MG 1402 ? 1_555 O2B ? C GTP .   ? B GTP 1401 ? 1_555 73.7  ? 
7  SG  ? B CYS 26  ? A CYS 721  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 SG  ? B CYS 29  ? A CYS 724  ? 1_555 106.5 ? 
8  SG  ? B CYS 26  ? A CYS 721  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 SG  ? B CYS 52  ? A CYS 747  ? 1_555 122.1 ? 
9  SG  ? B CYS 29  ? A CYS 724  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 SG  ? B CYS 52  ? A CYS 747  ? 1_555 119.5 ? 
10 SG  ? B CYS 26  ? A CYS 721  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 SG  ? B CYS 55  ? A CYS 750  ? 1_555 108.6 ? 
11 SG  ? B CYS 29  ? A CYS 724  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 SG  ? B CYS 55  ? A CYS 750  ? 1_555 99.5  ? 
12 SG  ? B CYS 52  ? A CYS 747  ? 1_555 ZN ? E ZN . ? A ZN 1001 ? 1_555 SG  ? B CYS 55  ? A CYS 750  ? 1_555 97.1  ? 
13 SG  ? B CYS 131 ? A CYS 826  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 NE2 ? B HIS 182 ? A HIS 877  ? 1_555 136.1 ? 
14 SG  ? B CYS 131 ? A CYS 826  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 SG  ? B CYS 186 ? A CYS 881  ? 1_555 105.4 ? 
15 NE2 ? B HIS 182 ? A HIS 877  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 SG  ? B CYS 186 ? A CYS 881  ? 1_555 95.3  ? 
16 SG  ? B CYS 131 ? A CYS 826  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 SG  ? B CYS 189 ? A CYS 884  ? 1_555 100.3 ? 
17 NE2 ? B HIS 182 ? A HIS 877  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 SG  ? B CYS 189 ? A CYS 884  ? 1_555 107.0 ? 
18 SG  ? B CYS 186 ? A CYS 881  ? 1_555 ZN ? F ZN . ? A ZN 1002 ? 1_555 SG  ? B CYS 189 ? A CYS 884  ? 1_555 112.3 ? 
19 SG  ? B CYS 196 ? A CYS 891  ? 1_555 ZN ? G ZN . ? A ZN 1003 ? 1_555 SG  ? B CYS 199 ? A CYS 894  ? 1_555 103.2 ? 
20 SG  ? B CYS 196 ? A CYS 891  ? 1_555 ZN ? G ZN . ? A ZN 1003 ? 1_555 ND1 ? B HIS 225 ? A HIS 920  ? 1_555 117.6 ? 
21 SG  ? B CYS 199 ? A CYS 894  ? 1_555 ZN ? G ZN . ? A ZN 1003 ? 1_555 ND1 ? B HIS 225 ? A HIS 920  ? 1_555 105.9 ? 
22 SG  ? B CYS 196 ? A CYS 891  ? 1_555 ZN ? G ZN . ? A ZN 1003 ? 1_555 SG  ? B CYS 228 ? A CYS 923  ? 1_555 102.2 ? 
23 SG  ? B CYS 199 ? A CYS 894  ? 1_555 ZN ? G ZN . ? A ZN 1003 ? 1_555 SG  ? B CYS 228 ? A CYS 923  ? 1_555 111.1 ? 
24 ND1 ? B HIS 225 ? A HIS 920  ? 1_555 ZN ? G ZN . ? A ZN 1003 ? 1_555 SG  ? B CYS 228 ? A CYS 923  ? 1_555 116.1 ? 
25 SG  ? B CYS 217 ? A CYS 912  ? 1_555 ZN ? H ZN . ? A ZN 1004 ? 1_555 SG  ? B CYS 220 ? A CYS 915  ? 1_555 93.5  ? 
26 SG  ? B CYS 217 ? A CYS 912  ? 1_555 ZN ? H ZN . ? A ZN 1004 ? 1_555 SG  ? B CYS 234 ? A CYS 929  ? 1_555 114.0 ? 
27 SG  ? B CYS 220 ? A CYS 915  ? 1_555 ZN ? H ZN . ? A ZN 1004 ? 1_555 SG  ? B CYS 234 ? A CYS 929  ? 1_555 84.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-07-01 
2 'Structure model' 1 1 2020-07-22 
3 'Structure model' 1 2 2020-08-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Database references'  
3 3 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 3 'Structure model' struct_conn     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
2  2 'Structure model' '_citation.title'                   
3  3 'Structure model' '_citation.journal_volume'          
4  3 'Structure model' '_citation.page_first'              
5  3 'Structure model' '_citation.page_last'               
6  3 'Structure model' '_struct_conn.pdbx_dist_value'      
7  3 'Structure model' '_struct_conn.ptnr1_auth_asym_id'   
8  3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'   
9  3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'    
10 3 'Structure model' '_struct_conn.ptnr1_label_asym_id'  
11 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'  
12 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'  
13 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'   
14 3 'Structure model' '_struct_conn.ptnr2_auth_asym_id'   
15 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id'   
16 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'    
17 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'  
18 3 'Structure model' '_struct_conn.ptnr2_label_atom_id'  
19 3 'Structure model' '_struct_conn.ptnr2_label_comp_id'  
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -3.97387330335 
_pdbx_refine_tls.origin_y         24.7072069095 
_pdbx_refine_tls.origin_z         38.6235448201 
_pdbx_refine_tls.T[1][1]          0.2649171581 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          0.0319573900416 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          -0.00480449627833 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          0.375452392478 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          0.0958277321209 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          0.322596506454 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          0.208932859123 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          0.225932558673 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          -1.06707365976 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          -0.00725053557181 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          -0.380485090947 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          2.40464517327 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          0.0467383014816 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          0.0856833581124 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          0.0240848780564 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          0.0111097981558 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          0.0598718620997 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          0.000128416162956 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          -0.0455502657974 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          -0.306900529773 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          -0.039085844215 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   all 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? 1.14_3260 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice ? ? ? .         2 
? 'data processing' ? ? ? ? ? ? ? ? ? ? ? ELVES   ? ? ? .         3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? MOSFLM  ? ? ? .         4 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .         5 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .         6 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot    ? ? ? .         7 
# 
_pdbx_entry_details.entry_id                 6WCW 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   N 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A LEU 906 ? ? NZ  A LYS 921 ? ? 2.05 
2 1 NH2 B ARG 132 ? ? OE2 B GLU 153 ? ? 2.09 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 NH2 B ARG 113 ? ? 1_555 O  A HIS 705 ? ? 4_455 2.05 
2 1 O   A LYS 860 ? ? 1_555 NZ A LYS 925 ? ? 4_455 2.16 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_1              923 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_2              923 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             SG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             CYS 
_pdbx_validate_rmsd_angle.auth_seq_id_3              923 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                121.50 
_pdbx_validate_rmsd_angle.angle_target_value         114.20 
_pdbx_validate_rmsd_angle.angle_deviation            7.30 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.10 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP B 54  ? ? 69.14   -16.48 
2  1 LEU B 67  ? ? -65.18  -99.99 
3  1 GLU B 68  ? ? -160.78 44.34  
4  1 ARG B 69  ? ? -98.66  42.63  
5  1 SER B 72  ? ? 70.36   -17.18 
6  1 VAL B 75  ? ? -149.38 25.12  
7  1 ASP B 114 ? ? 58.26   71.64  
8  1 LYS B 126 ? ? 81.06   34.66  
9  1 ASN B 148 ? ? 63.68   61.49  
10 1 ILE A 701 ? ? -131.92 -38.20 
11 1 GLN A 717 ? ? -107.57 40.91  
12 1 TRP A 766 ? ? -91.13  53.61  
13 1 ALA A 829 ? ? -102.90 50.08  
14 1 LYS A 916 ? ? 58.47   7.46   
15 1 PHE A 924 ? ? -96.79  -91.00 
16 1 LYS A 925 ? ? 5.23    -45.03 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B SER -1  ? A SER 1   
2  1 Y 1 B ASN 0   ? A ASN 2   
3  1 Y 1 B ALA 1   ? A ALA 3   
4  1 Y 1 B THR 2   ? A THR 4   
5  1 Y 1 B SER 3   ? A SER 5   
6  1 Y 1 B ARG 4   ? A ARG 6   
7  1 Y 1 B LYS 5   ? A LYS 7   
8  1 Y 1 B LYS 6   ? A LYS 8   
9  1 Y 1 A SER 696 ? B SER 1   
10 1 Y 1 A ARG 944 ? B ARG 249 
11 1 Y 1 A GLN 945 ? B GLN 250 
12 1 Y 1 A SER 946 ? B SER 251 
13 1 Y 1 A LEU 947 ? B LEU 252 
14 1 Y 1 A GLU 948 ? B GLU 253 
15 1 Y 1 A SER 949 ? B SER 254 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R01 GM123089' 1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R01 GM111730' 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 "GUANOSINE-5'-TRIPHOSPHATE" GTP 
4 'MAGNESIUM ION'             MG  
5 'ZINC ION'                  ZN  
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'gel filtration'    'Complex tightly associates as a heterodimer on size exclusion chromatography.'      
2 1 immunoprecipitation 'The Rubicon RH domain is sufficient to pull down GTP-bound Rab7 from cell lysates.' 
3 1 microscopy          'Rubicon and Rab7 colocalize in human cells.'                                        
# 
_space_group.name_H-M_alt     'I 1 2 1' 
_space_group.name_Hall        'C 2y (x,y,-x+z)' 
_space_group.IT_number        5 
_space_group.crystal_system   monoclinic 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z               
2 -x,y,-z             
3 x+1/2,y+1/2,z+1/2   
4 -x+1/2,y+1/2,-z+1/2 
#