data_6WG4
# 
_entry.id   6WG4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6WG4         
WWPDB D_1000248139 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          6WG3 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6WG4 
_pdbx_database_status.recvd_initial_deposition_date   2020-04-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shi, Z.B.' 1 0000-0002-9624-4960 
'Yu, H.'    2 0000-0002-8861-049X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            368 
_citation.language                  ? 
_citation.page_first                1454 
_citation.page_last                 1459 
_citation.title                     'Cryo-EM structure of the human cohesin-NIPBL-DNA complex.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.abb0981 
_citation.pdbx_database_id_PubMed   32409525 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shi, Z.'   1 ? 
primary 'Gao, H.'   2 ? 
primary 'Bai, X.C.' 3 ? 
primary 'Yu, H.'    4 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6WG4 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     78.291 
_cell.length_a_esd                 ? 
_cell.length_b                     119.612 
_cell.length_b_esd                 ? 
_cell.length_c                     127.119 
_cell.length_c_esd                 ? 
_cell.volume                       1190411.353 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6WG4 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            'I 2 2' 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Structural maintenance of chromosomes protein'   20161.402 1   ? ? ? ? 
2 polymer man 'Structural maintenance of chromosomes protein 3' 22762.137 1   ? ? ? ? 
3 water   nat water                                             18.015    209 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
;SMC-3,Basement membrane-associated chondroitin proteoglycan,Bamacan,Chondroitin sulfate proteoglycan 6,Chromosome-associated polypeptide,hCAP
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYL
EVKPTDEKLRELKGAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVALDGTLFQKSGVISGGA
SDLKAKARRWDEKAVDKLK
;
;GPRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYL
EVKPTDEKLRELKGAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVALDGTLFQKSGVISGGA
SDLKAKARRWDEKAVDKLK
;
A ? 
2 'polypeptide(L)' no no 
;GPLGSGRPKQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVD
SDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLAR
AFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKA
;
;GPLGSGRPKQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVD
SDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLAR
AFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKA
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   ARG n 
1 4   LYS n 
1 5   ALA n 
1 6   GLU n 
1 7   ILE n 
1 8   MET n 
1 9   GLU n 
1 10  SER n 
1 11  ILE n 
1 12  LYS n 
1 13  ARG n 
1 14  LEU n 
1 15  TYR n 
1 16  PRO n 
1 17  GLY n 
1 18  SER n 
1 19  VAL n 
1 20  TYR n 
1 21  GLY n 
1 22  ARG n 
1 23  LEU n 
1 24  ILE n 
1 25  ASP n 
1 26  LEU n 
1 27  CYS n 
1 28  GLN n 
1 29  PRO n 
1 30  THR n 
1 31  GLN n 
1 32  LYS n 
1 33  LYS n 
1 34  TYR n 
1 35  GLN n 
1 36  ILE n 
1 37  ALA n 
1 38  VAL n 
1 39  THR n 
1 40  LYS n 
1 41  VAL n 
1 42  LEU n 
1 43  GLY n 
1 44  LYS n 
1 45  ASN n 
1 46  MET n 
1 47  ASP n 
1 48  ALA n 
1 49  ILE n 
1 50  ILE n 
1 51  VAL n 
1 52  ASP n 
1 53  SER n 
1 54  GLU n 
1 55  LYS n 
1 56  THR n 
1 57  GLY n 
1 58  ARG n 
1 59  ASP n 
1 60  CYS n 
1 61  ILE n 
1 62  GLN n 
1 63  TYR n 
1 64  ILE n 
1 65  LYS n 
1 66  GLU n 
1 67  GLN n 
1 68  ARG n 
1 69  GLY n 
1 70  GLU n 
1 71  PRO n 
1 72  GLU n 
1 73  THR n 
1 74  PHE n 
1 75  LEU n 
1 76  PRO n 
1 77  LEU n 
1 78  ASP n 
1 79  TYR n 
1 80  LEU n 
1 81  GLU n 
1 82  VAL n 
1 83  LYS n 
1 84  PRO n 
1 85  THR n 
1 86  ASP n 
1 87  GLU n 
1 88  LYS n 
1 89  LEU n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  LYS n 
1 94  GLY n 
1 95  ALA n 
1 96  LYS n 
1 97  LEU n 
1 98  VAL n 
1 99  ILE n 
1 100 ASP n 
1 101 VAL n 
1 102 ILE n 
1 103 ARG n 
1 104 TYR n 
1 105 GLU n 
1 106 PRO n 
1 107 PRO n 
1 108 HIS n 
1 109 ILE n 
1 110 LYS n 
1 111 LYS n 
1 112 ALA n 
1 113 LEU n 
1 114 GLN n 
1 115 TYR n 
1 116 ALA n 
1 117 CYS n 
1 118 GLY n 
1 119 ASN n 
1 120 ALA n 
1 121 LEU n 
1 122 VAL n 
1 123 CYS n 
1 124 ASP n 
1 125 ASN n 
1 126 VAL n 
1 127 GLU n 
1 128 ASP n 
1 129 ALA n 
1 130 ARG n 
1 131 ARG n 
1 132 ILE n 
1 133 ALA n 
1 134 PHE n 
1 135 GLY n 
1 136 GLY n 
1 137 HIS n 
1 138 GLN n 
1 139 ARG n 
1 140 HIS n 
1 141 LYS n 
1 142 THR n 
1 143 VAL n 
1 144 ALA n 
1 145 LEU n 
1 146 ASP n 
1 147 GLY n 
1 148 THR n 
1 149 LEU n 
1 150 PHE n 
1 151 GLN n 
1 152 LYS n 
1 153 SER n 
1 154 GLY n 
1 155 VAL n 
1 156 ILE n 
1 157 SER n 
1 158 GLY n 
1 159 GLY n 
1 160 ALA n 
1 161 SER n 
1 162 ASP n 
1 163 LEU n 
1 164 LYS n 
1 165 ALA n 
1 166 LYS n 
1 167 ALA n 
1 168 ARG n 
1 169 ARG n 
1 170 TRP n 
1 171 ASP n 
1 172 GLU n 
1 173 LYS n 
1 174 ALA n 
1 175 VAL n 
1 176 ASP n 
1 177 LYS n 
1 178 LEU n 
1 179 LYS n 
2 1   GLY n 
2 2   PRO n 
2 3   LEU n 
2 4   GLY n 
2 5   SER n 
2 6   GLY n 
2 7   ARG n 
2 8   PRO n 
2 9   LYS n 
2 10  GLN n 
2 11  GLN n 
2 12  LEU n 
2 13  LEU n 
2 14  ARG n 
2 15  ALA n 
2 16  ALA n 
2 17  THR n 
2 18  GLY n 
2 19  LYS n 
2 20  ALA n 
2 21  ILE n 
2 22  LEU n 
2 23  ASN n 
2 24  GLY n 
2 25  ILE n 
2 26  ASP n 
2 27  SER n 
2 28  ILE n 
2 29  ASN n 
2 30  LYS n 
2 31  VAL n 
2 32  LEU n 
2 33  ASP n 
2 34  HIS n 
2 35  PHE n 
2 36  ARG n 
2 37  ARG n 
2 38  LYS n 
2 39  GLY n 
2 40  ILE n 
2 41  ASN n 
2 42  GLN n 
2 43  HIS n 
2 44  VAL n 
2 45  GLN n 
2 46  ASN n 
2 47  GLY n 
2 48  TYR n 
2 49  HIS n 
2 50  GLY n 
2 51  ILE n 
2 52  VAL n 
2 53  MET n 
2 54  ASN n 
2 55  ASN n 
2 56  PHE n 
2 57  GLU n 
2 58  CYS n 
2 59  GLU n 
2 60  PRO n 
2 61  ALA n 
2 62  PHE n 
2 63  TYR n 
2 64  THR n 
2 65  CYS n 
2 66  VAL n 
2 67  GLU n 
2 68  VAL n 
2 69  THR n 
2 70  ALA n 
2 71  GLY n 
2 72  ASN n 
2 73  ARG n 
2 74  LEU n 
2 75  PHE n 
2 76  TYR n 
2 77  HIS n 
2 78  ILE n 
2 79  VAL n 
2 80  ASP n 
2 81  SER n 
2 82  ASP n 
2 83  GLU n 
2 84  VAL n 
2 85  SER n 
2 86  THR n 
2 87  LYS n 
2 88  ILE n 
2 89  LEU n 
2 90  MET n 
2 91  GLU n 
2 92  PHE n 
2 93  ASN n 
2 94  LYS n 
2 95  MET n 
2 96  ASN n 
2 97  LEU n 
2 98  PRO n 
2 99  GLY n 
2 100 GLU n 
2 101 VAL n 
2 102 THR n 
2 103 PHE n 
2 104 LEU n 
2 105 PRO n 
2 106 LEU n 
2 107 ASN n 
2 108 LYS n 
2 109 LEU n 
2 110 ASP n 
2 111 VAL n 
2 112 ARG n 
2 113 ASP n 
2 114 THR n 
2 115 ALA n 
2 116 TYR n 
2 117 PRO n 
2 118 GLU n 
2 119 THR n 
2 120 ASN n 
2 121 ASP n 
2 122 ALA n 
2 123 ILE n 
2 124 PRO n 
2 125 MET n 
2 126 ILE n 
2 127 SER n 
2 128 LYS n 
2 129 LEU n 
2 130 ARG n 
2 131 TYR n 
2 132 ASN n 
2 133 PRO n 
2 134 ARG n 
2 135 PHE n 
2 136 ASP n 
2 137 LYS n 
2 138 ALA n 
2 139 PHE n 
2 140 LYS n 
2 141 HIS n 
2 142 VAL n 
2 143 PHE n 
2 144 GLY n 
2 145 LYS n 
2 146 THR n 
2 147 LEU n 
2 148 ILE n 
2 149 CYS n 
2 150 ARG n 
2 151 SER n 
2 152 MET n 
2 153 GLU n 
2 154 VAL n 
2 155 SER n 
2 156 THR n 
2 157 GLN n 
2 158 LEU n 
2 159 ALA n 
2 160 ARG n 
2 161 ALA n 
2 162 PHE n 
2 163 THR n 
2 164 MET n 
2 165 ASP n 
2 166 CYS n 
2 167 ILE n 
2 168 THR n 
2 169 LEU n 
2 170 GLU n 
2 171 GLY n 
2 172 ASP n 
2 173 GLN n 
2 174 VAL n 
2 175 SER n 
2 176 HIS n 
2 177 ARG n 
2 178 GLY n 
2 179 ALA n 
2 180 LEU n 
2 181 THR n 
2 182 GLY n 
2 183 GLY n 
2 184 TYR n 
2 185 TYR n 
2 186 ASP n 
2 187 THR n 
2 188 ARG n 
2 189 LYS n 
2 190 SER n 
2 191 ARG n 
2 192 LEU n 
2 193 GLU n 
2 194 LEU n 
2 195 GLN n 
2 196 LYS n 
2 197 ASP n 
2 198 VAL n 
2 199 ARG n 
2 200 LYS n 
2 201 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 179 Human ? SMC1A                           ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 201 Human ? 'SMC3, BAM, BMH, CSPG6, SMC3L1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Trichoplusia ni'            7111   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP G8JLG1_HUMAN G8JLG1 ? 1 
;RKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEV
KPTDEKLRELKGAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVALDGTLFQKSGVISGGASD
LKAKARRWDEKAVDKLK
;
477 
2 UNP SMC3_HUMAN   Q9UQE7 ? 2 
;KQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNFECEPAFYTCVEVTAGNRLFYHIVDSDEVSTKI
LMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCIT
LEGDQVSHRGALTGGYYDTRKSRLELQKDVRKA
;
493 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6WG4 A 3 ? 179 ? G8JLG1 477 ? 653 ? 499 675 
2 2 6WG4 B 9 ? 201 ? Q9UQE7 493 ? 685 ? 493 685 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6WG4 GLY A 1 ? UNP G8JLG1 ? ? 'expression tag' 497 1  
1 6WG4 PRO A 2 ? UNP G8JLG1 ? ? 'expression tag' 498 2  
2 6WG4 GLY B 1 ? UNP Q9UQE7 ? ? 'expression tag' 485 3  
2 6WG4 PRO B 2 ? UNP Q9UQE7 ? ? 'expression tag' 486 4  
2 6WG4 LEU B 3 ? UNP Q9UQE7 ? ? 'expression tag' 487 5  
2 6WG4 GLY B 4 ? UNP Q9UQE7 ? ? 'expression tag' 488 6  
2 6WG4 SER B 5 ? UNP Q9UQE7 ? ? 'expression tag' 489 7  
2 6WG4 GLY B 6 ? UNP Q9UQE7 ? ? 'expression tag' 490 8  
2 6WG4 ARG B 7 ? UNP Q9UQE7 ? ? 'expression tag' 491 9  
2 6WG4 PRO B 8 ? UNP Q9UQE7 ? ? 'expression tag' 492 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6WG4 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.47 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.52 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '2% 1,4-dioxane, 0.1 Tris pH 8.0, 15% polyethylene glycol 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-12-12 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97926 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97926 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            29.64 
_reflns.entry_id                         6WG4 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       21541 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.3 
_reflns.pdbx_Rmerge_I_obs                0.053 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            43.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.055 
_reflns.pdbx_Rpim_I_all                  0.015 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_CC_star                     1.000 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.3 
_reflns_shell.d_res_low                   2.34 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           751 
_reflns_shell.percent_possible_all        86 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.108 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             1.180 
_reflns_shell.pdbx_Rpim_I_all             0.389 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.768 
_reflns_shell.pdbx_CC_star                0.932 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               55.06 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6WG4 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.31 
_refine.ls_d_res_low                             43.56 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     21536 
_refine.ls_number_reflns_R_free                  2000 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    81.00 
_refine.ls_percent_reflns_R_free                 9.29 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1877 
_refine.ls_R_factor_R_free                       0.2354 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1829 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2WD5 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.8758 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2270 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.31 
_refine_hist.d_res_low                        43.56 
_refine_hist.number_atoms_solvent             209 
_refine_hist.number_atoms_total               2913 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        2704 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0078  ? 2817 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.0518  ? 3800 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0533  ? 421  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0068  ? 496  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 28.0029 ? 387  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.31 2.37  . . 53  455  27.06  . . . 0.2606 . 0.1988 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.37 2.43  . . 55  581  34.10  . . . 0.2594 . 0.2212 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.43 2.50  . . 73  711  42.04  . . . 0.2588 . 0.2255 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.50 2.58  . . 84  929  53.74  . . . 0.3394 . 0.2016 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.58 2.68  . . 147 1364 81.24  . . . 0.2651 . 0.2164 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.68 2.78  . . 165 1680 98.03  . . . 0.2828 . 0.2189 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.78 2.91  . . 184 1708 99.68  . . . 0.2674 . 0.2108 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.91 3.06  . . 168 1692 99.09  . . . 0.2873 . 0.2131 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.06 3.25  . . 186 1695 99.26  . . . 0.2651 . 0.1995 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.26 3.51  . . 169 1724 100.00 . . . 0.2095 . 0.1684 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.51 3.86  . . 177 1727 99.63  . . . 0.2064 . 0.1684 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.86 4.42  . . 176 1709 98.64  . . . 0.2122 . 0.1466 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.42 5.56  . . 184 1746 99.90  . . . 0.1939 . 0.1562 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.56 43.56 . . 179 1815 98.13  . . . 0.2423 . 0.1962 . . . . . . . . . . . 
# 
_struct.entry_id                     6WG4 
_struct.title                        'Crystal structure of human SMC1-SMC3 hinge domain heterodimer in south-open conformation' 
_struct.pdbx_descriptor              
'Structural maintenance of chromosomes protein, Structural maintenance of chromosomes protein 3' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6WG4 
_struct_keywords.text            
'ATPase, DNA-binding protein, Genome organization, Sister chromatid cohesion, Transcription regulation, CELL CYCLE' 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 3   ? TYR A 15  ? ARG A 499 TYR A 511 1 ? 13 
HELX_P HELX_P2  AA2 LEU A 23  ? LEU A 26  ? LEU A 519 LEU A 522 1 ? 4  
HELX_P HELX_P3  AA3 GLN A 31  ? LYS A 33  ? GLN A 527 LYS A 529 5 ? 3  
HELX_P HELX_P4  AA4 TYR A 34  ? GLY A 43  ? TYR A 530 GLY A 539 1 ? 10 
HELX_P HELX_P5  AA5 LYS A 44  ? ASP A 47  ? LYS A 540 ASP A 543 5 ? 4  
HELX_P HELX_P6  AA6 SER A 53  ? GLN A 67  ? SER A 549 GLN A 563 1 ? 15 
HELX_P HELX_P7  AA7 ASP A 86  ? LEU A 92  ? ASP A 582 LEU A 588 5 ? 7  
HELX_P HELX_P8  AA8 PRO A 106 ? HIS A 108 ? PRO A 602 HIS A 604 5 ? 3  
HELX_P HELX_P9  AA9 ILE A 109 ? GLY A 118 ? ILE A 605 GLY A 614 1 ? 10 
HELX_P HELX_P10 AB1 ASN A 125 ? GLY A 135 ? ASN A 621 GLY A 631 1 ? 11 
HELX_P HELX_P11 AB2 GLY A 159 ? ARG A 168 ? GLY A 655 ARG A 664 1 ? 10 
HELX_P HELX_P12 AB3 ARG A 168 ? LYS A 173 ? ARG A 664 LYS A 669 1 ? 6  
HELX_P HELX_P13 AB4 THR B 17  ? GLY B 39  ? THR B 501 GLY B 523 1 ? 23 
HELX_P HELX_P14 AB5 ASN B 41  ? GLY B 47  ? ASN B 525 GLY B 531 1 ? 7  
HELX_P HELX_P15 AB6 MET B 53  ? PHE B 56  ? MET B 537 PHE B 540 5 ? 4  
HELX_P HELX_P16 AB7 GLU B 59  ? ALA B 61  ? GLU B 543 ALA B 545 5 ? 3  
HELX_P HELX_P17 AB8 PHE B 62  ? GLY B 71  ? PHE B 546 GLY B 555 1 ? 10 
HELX_P HELX_P18 AB9 ASN B 72  ? PHE B 75  ? ASN B 556 PHE B 559 5 ? 4  
HELX_P HELX_P19 AC1 SER B 81  ? MET B 95  ? SER B 565 MET B 579 1 ? 15 
HELX_P HELX_P20 AC2 ILE B 126 ? LEU B 129 ? ILE B 610 LEU B 613 5 ? 4  
HELX_P HELX_P21 AC3 ASN B 132 ? ARG B 134 ? ASN B 616 ARG B 618 5 ? 3  
HELX_P HELX_P22 AC4 PHE B 135 ? GLY B 144 ? PHE B 619 GLY B 628 1 ? 10 
HELX_P HELX_P23 AC5 SER B 151 ? PHE B 162 ? SER B 635 PHE B 646 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 8 ? 
AA4 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? parallel      
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA3 6 7 ? parallel      
AA3 7 8 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 19  ? ARG A 22  ? VAL A 515 ARG A 518 
AA1 2 ILE A 49  ? VAL A 51  ? ILE A 545 VAL A 547 
AA1 3 PHE A 74  ? PRO A 76  ? PHE A 570 PRO A 572 
AA2 1 CYS A 27  ? PRO A 29  ? CYS A 523 PRO A 525 
AA2 2 ILE A 102 ? TYR A 104 ? ILE A 598 TYR A 600 
AA3 1 ALA A 95  ? LEU A 97  ? ALA A 591 LEU A 593 
AA3 2 LEU A 121 ? CYS A 123 ? LEU A 617 CYS A 619 
AA3 3 THR A 142 ? VAL A 143 ? THR A 638 VAL A 639 
AA3 4 LEU A 149 ? PHE A 150 ? LEU A 645 PHE A 646 
AA3 5 ILE A 156 ? GLY A 158 ? ILE A 652 GLY A 654 
AA3 6 VAL B 101 ? PRO B 105 ? VAL B 585 PRO B 589 
AA3 7 HIS B 77  ? VAL B 79  ? HIS B 561 VAL B 563 
AA3 8 TYR B 48  ? ILE B 51  ? TYR B 532 ILE B 535 
AA4 1 ALA B 122 ? PRO B 124 ? ALA B 606 PRO B 608 
AA4 2 THR B 146 ? CYS B 149 ? THR B 630 CYS B 633 
AA4 3 ASP B 165 ? THR B 168 ? ASP B 649 THR B 652 
AA4 4 GLN B 173 ? VAL B 174 ? GLN B 657 VAL B 658 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLY A 21  ? N GLY A 517 O ILE A 50  ? O ILE A 546 
AA1 2 3 N ILE A 49  ? N ILE A 545 O LEU A 75  ? O LEU A 571 
AA2 1 2 N GLN A 28  ? N GLN A 524 O ARG A 103 ? O ARG A 599 
AA3 1 2 N LYS A 96  ? N LYS A 592 O VAL A 122 ? O VAL A 618 
AA3 2 3 N LEU A 121 ? N LEU A 617 O VAL A 143 ? O VAL A 639 
AA3 3 4 N THR A 142 ? N THR A 638 O PHE A 150 ? O PHE A 646 
AA3 4 5 N LEU A 149 ? N LEU A 645 O SER A 157 ? O SER A 653 
AA3 5 6 N ILE A 156 ? N ILE A 652 O PHE B 103 ? O PHE B 587 
AA3 6 7 O LEU B 104 ? O LEU B 588 N HIS B 77  ? N HIS B 561 
AA3 7 8 O ILE B 78  ? O ILE B 562 N GLY B 50  ? N GLY B 534 
AA4 1 2 N ILE B 123 ? N ILE B 607 O ILE B 148 ? O ILE B 632 
AA4 2 3 N CYS B 149 ? N CYS B 633 O ILE B 167 ? O ILE B 651 
AA4 3 4 N CYS B 166 ? N CYS B 650 O VAL B 174 ? O VAL B 658 
# 
_atom_sites.entry_id                    6WG4 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.012773 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008360 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007867 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 3   ? -15.42094 -19.41268 -32.29387 1.000 112.76023 ? 499 ARG A N   1 
ATOM   2    C CA  . ARG A 1 3   ? -14.24827 -18.66299 -31.85224 1.000 114.41176 ? 499 ARG A CA  1 
ATOM   3    C C   . ARG A 1 3   ? -13.20157 -19.56403 -31.18793 1.000 115.34878 ? 499 ARG A C   1 
ATOM   4    O O   . ARG A 1 3   ? -11.99120 -19.36959 -31.35985 1.000 114.20689 ? 499 ARG A O   1 
ATOM   5    C CB  . ARG A 1 3   ? -14.65919 -17.54421 -30.89305 1.000 116.22278 ? 499 ARG A CB  1 
ATOM   6    C CG  . ARG A 1 3   ? -13.47443 -16.77738 -30.34803 1.000 111.19332 ? 499 ARG A CG  1 
ATOM   7    C CD  . ARG A 1 3   ? -13.82793 -15.44865 -29.74328 1.000 117.68267 ? 499 ARG A CD  1 
ATOM   8    N NE  . ARG A 1 3   ? -12.66884 -14.91920 -29.03719 1.000 119.18647 ? 499 ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 3   ? -12.38374 -15.19218 -27.76877 1.000 122.49614 ? 499 ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 3   ? -13.18821 -15.97105 -27.05531 1.000 121.53668 ? 499 ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 3   ? -11.29939 -14.67525 -27.20967 1.000 123.41334 ? 499 ARG A NH2 1 
ATOM   12   N N   . LYS A 1 4   ? -13.66745 -20.57521 -30.44891 1.000 118.41266 ? 500 LYS A N   1 
ATOM   13   C CA  . LYS A 1 4   ? -12.75592 -21.51848 -29.80464 1.000 114.55172 ? 500 LYS A CA  1 
ATOM   14   C C   . LYS A 1 4   ? -11.99059 -22.38321 -30.79060 1.000 103.41863 ? 500 LYS A C   1 
ATOM   15   O O   . LYS A 1 4   ? -11.04609 -23.06242 -30.37783 1.000 104.61875 ? 500 LYS A O   1 
ATOM   16   C CB  . LYS A 1 4   ? -13.50860 -22.42346 -28.82389 1.000 120.19865 ? 500 LYS A CB  1 
ATOM   17   C CG  . LYS A 1 4   ? -13.83593 -21.73496 -27.52193 1.000 125.71124 ? 500 LYS A CG  1 
ATOM   18   C CD  . LYS A 1 4   ? -12.56117 -21.18712 -26.90403 1.000 124.78288 ? 500 LYS A CD  1 
ATOM   19   C CE  . LYS A 1 4   ? -12.78048 -19.76775 -26.42973 1.000 131.55351 ? 500 LYS A CE  1 
ATOM   20   N NZ  . LYS A 1 4   ? -13.08715 -18.85020 -27.56570 1.000 133.11259 ? 500 LYS A NZ  1 
ATOM   21   N N   . ALA A 1 5   ? -12.38019 -22.38631 -32.06508 1.000 89.93833  ? 501 ALA A N   1 
ATOM   22   C CA  . ALA A 1 5   ? -11.64177 -23.14533 -33.06275 1.000 85.35206  ? 501 ALA A CA  1 
ATOM   23   C C   . ALA A 1 5   ? -10.28715 -22.51059 -33.35079 1.000 86.51271  ? 501 ALA A C   1 
ATOM   24   O O   . ALA A 1 5   ? -9.28547  -23.22099 -33.50129 1.000 80.16844  ? 501 ALA A O   1 
ATOM   25   C CB  . ALA A 1 5   ? -12.46584 -23.26103 -34.34233 1.000 88.09619  ? 501 ALA A CB  1 
ATOM   26   N N   . GLU A 1 6   ? -10.22691 -21.17819 -33.42918 1.000 90.78805  ? 502 GLU A N   1 
ATOM   27   C CA  . GLU A 1 6   ? -8.96855  -20.52637 -33.76835 1.000 96.40578  ? 502 GLU A CA  1 
ATOM   28   C C   . GLU A 1 6   ? -8.16540  -20.07771 -32.54726 1.000 86.02566  ? 502 GLU A C   1 
ATOM   29   O O   . GLU A 1 6   ? -6.95347  -19.87494 -32.67450 1.000 85.76082  ? 502 GLU A O   1 
ATOM   30   C CB  . GLU A 1 6   ? -9.21533  -19.34105 -34.72137 1.000 110.94656 ? 502 GLU A CB  1 
ATOM   31   C CG  . GLU A 1 6   ? -7.98143  -18.91705 -35.57009 1.000 111.73454 ? 502 GLU A CG  1 
ATOM   32   C CD  . GLU A 1 6   ? -7.65197  -19.87993 -36.71513 1.000 110.90953 ? 502 GLU A CD  1 
ATOM   33   O OE1 . GLU A 1 6   ? -6.49982  -19.85033 -37.20559 1.000 109.16155 ? 502 GLU A OE1 1 
ATOM   34   O OE2 . GLU A 1 6   ? -8.53854  -20.65930 -37.12835 1.000 112.05078 ? 502 GLU A OE2 1 
ATOM   35   N N   . ILE A 1 7   ? -8.78675  -19.93608 -31.36905 1.000 82.58031  ? 503 ILE A N   1 
ATOM   36   C CA  . ILE A 1 7   ? -7.99929  -19.94239 -30.13466 1.000 77.08149  ? 503 ILE A CA  1 
ATOM   37   C C   . ILE A 1 7   ? -7.24048  -21.25614 -30.02778 1.000 75.46936  ? 503 ILE A C   1 
ATOM   38   O O   . ILE A 1 7   ? -6.05139  -21.29003 -29.68230 1.000 70.66354  ? 503 ILE A O   1 
ATOM   39   C CB  . ILE A 1 7   ? -8.89820  -19.69770 -28.90470 1.000 78.20424  ? 503 ILE A CB  1 
ATOM   40   C CG1 . ILE A 1 7   ? -9.27236  -18.21403 -28.80612 1.000 85.01079  ? 503 ILE A CG1 1 
ATOM   41   C CG2 . ILE A 1 7   ? -8.22478  -20.19171 -27.62354 1.000 76.10473  ? 503 ILE A CG2 1 
ATOM   42   C CD1 . ILE A 1 7   ? -9.73412  -17.76115 -27.42263 1.000 84.46161  ? 503 ILE A CD1 1 
ATOM   43   N N   . MET A 1 8   ? -7.90901  -22.35126 -30.38320 1.000 73.23873  ? 504 MET A N   1 
ATOM   44   C CA  . MET A 1 8   ? -7.26013  -23.65362 -30.45945 1.000 70.95712  ? 504 MET A CA  1 
ATOM   45   C C   . MET A 1 8   ? -6.16699  -23.69501 -31.52034 1.000 69.56597  ? 504 MET A C   1 
ATOM   46   O O   . MET A 1 8   ? -5.09384  -24.25345 -31.27997 1.000 67.39090  ? 504 MET A O   1 
ATOM   47   C CB  . MET A 1 8   ? -8.31584  -24.73408 -30.72474 1.000 82.45369  ? 504 MET A CB  1 
ATOM   48   C CG  . MET A 1 8   ? -7.84891  -26.15861 -31.09685 1.000 86.42759  ? 504 MET A CG  1 
ATOM   49   S SD  . MET A 1 8   ? -6.86427  -27.14649 -29.93341 1.000 89.74568  ? 504 MET A SD  1 
ATOM   50   C CE  . MET A 1 8   ? -7.18096  -26.38171 -28.34540 1.000 78.32519  ? 504 MET A CE  1 
ATOM   51   N N   . GLU A 1 9   ? -6.41419  -23.11796 -32.70040 1.000 81.80356  ? 505 GLU A N   1 
ATOM   52   C CA  . GLU A 1 9   ? -5.38958  -23.13042 -33.73923 1.000 76.98878  ? 505 GLU A CA  1 
ATOM   53   C C   . GLU A 1 9   ? -4.21789  -22.23616 -33.37130 1.000 70.76214  ? 505 GLU A C   1 
ATOM   54   O O   . GLU A 1 9   ? -3.08762  -22.48109 -33.80885 1.000 67.93825  ? 505 GLU A O   1 
ATOM   55   C CB  . GLU A 1 9   ? -5.98585  -22.70783 -35.08064 1.000 84.03152  ? 505 GLU A CB  1 
ATOM   56   C CG  . GLU A 1 9   ? -5.47215  -23.50828 -36.27689 1.000 95.76681  ? 505 GLU A CG  1 
ATOM   57   C CD  . GLU A 1 9   ? -6.13556  -24.87313 -36.42125 1.000 105.39404 ? 505 GLU A CD  1 
ATOM   58   O OE1 . GLU A 1 9   ? -5.79826  -25.59548 -37.38595 1.000 109.71263 ? 505 GLU A OE1 1 
ATOM   59   O OE2 . GLU A 1 9   ? -6.98973  -25.22747 -35.57681 1.000 106.21435 ? 505 GLU A OE2 1 
ATOM   60   N N   . SER A 1 10  ? -4.46692  -21.22210 -32.54551 1.000 69.70122  ? 506 SER A N   1 
ATOM   61   C CA  . SER A 1 10  ? -3.40901  -20.31304 -32.13280 1.000 69.09718  ? 506 SER A CA  1 
ATOM   62   C C   . SER A 1 10  ? -2.46168  -20.96337 -31.12200 1.000 66.81748  ? 506 SER A C   1 
ATOM   63   O O   . SER A 1 10  ? -1.24357  -20.77566 -31.21156 1.000 66.07727  ? 506 SER A O   1 
ATOM   64   C CB  . SER A 1 10  ? -4.03333  -19.03240 -31.58006 1.000 71.33694  ? 506 SER A CB  1 
ATOM   65   O OG  . SER A 1 10  ? -3.25457  -18.48015 -30.54187 1.000 89.62000  ? 506 SER A OG  1 
ATOM   66   N N   . ILE A 1 11  ? -2.98541  -21.73495 -30.16063 1.000 66.19833  ? 507 ILE A N   1 
ATOM   67   C CA  . ILE A 1 11  ? -2.09829  -22.39514 -29.19912 1.000 64.63410  ? 507 ILE A CA  1 
ATOM   68   C C   . ILE A 1 11  ? -1.34232  -23.55525 -29.83644 1.000 63.24026  ? 507 ILE A C   1 
ATOM   69   O O   . ILE A 1 11  ? -0.27165  -23.92609 -29.34468 1.000 62.39086  ? 507 ILE A O   1 
ATOM   70   C CB  . ILE A 1 11  ? -2.83433  -22.88909 -27.92508 1.000 64.93659  ? 507 ILE A CB  1 
ATOM   71   C CG1 . ILE A 1 11  ? -3.61223  -24.17639 -28.17841 1.000 64.72421  ? 507 ILE A CG1 1 
ATOM   72   C CG2 . ILE A 1 11  ? -3.74676  -21.82927 -27.34164 1.000 67.04817  ? 507 ILE A CG2 1 
ATOM   73   C CD1 . ILE A 1 11  ? -4.28072  -24.72365 -26.93933 1.000 65.40218  ? 507 ILE A CD1 1 
ATOM   74   N N   . LYS A 1 12  ? -1.85855  -24.13461 -30.92318 1.000 63.60437  ? 508 LYS A N   1 
ATOM   75   C CA  . LYS A 1 12  ? -1.11032  -25.16227 -31.63922 1.000 63.04003  ? 508 LYS A CA  1 
ATOM   76   C C   . LYS A 1 12  ? 0.10124   -24.56362 -32.35608 1.000 74.74403  ? 508 LYS A C   1 
ATOM   77   O O   . LYS A 1 12  ? 1.17295   -25.18037 -32.40850 1.000 69.64160  ? 508 LYS A O   1 
ATOM   78   C CB  . LYS A 1 12  ? -2.02572  -25.87175 -32.63317 1.000 64.31784  ? 508 LYS A CB  1 
ATOM   79   C CG  . LYS A 1 12  ? -2.51292  -27.23416 -32.19261 1.000 64.41263  ? 508 LYS A CG  1 
ATOM   80   C CD  . LYS A 1 12  ? -3.71250  -27.69081 -33.02159 1.000 66.57800  ? 508 LYS A CD  1 
ATOM   81   C CE  . LYS A 1 12  ? -3.39074  -28.94499 -33.81655 1.000 67.61197  ? 508 LYS A CE  1 
ATOM   82   N NZ  . LYS A 1 12  ? -4.62338  -29.67734 -34.20704 1.000 76.27756  ? 508 LYS A NZ  1 
ATOM   83   N N   . ARG A 1 13  ? -0.04402  -23.36134 -32.91044 1.000 64.09498  ? 509 ARG A N   1 
ATOM   84   C CA  . ARG A 1 13  ? 1.08483   -22.70150 -33.55041 1.000 72.42070  ? 509 ARG A CA  1 
ATOM   85   C C   . ARG A 1 13  ? 1.99412   -21.99356 -32.55239 1.000 69.73606  ? 509 ARG A C   1 
ATOM   86   O O   . ARG A 1 13  ? 3.11197   -21.60768 -32.92189 1.000 70.18998  ? 509 ARG A O   1 
ATOM   87   C CB  . ARG A 1 13  ? 0.58487   -21.70858 -34.61032 1.000 66.56445  ? 509 ARG A CB  1 
ATOM   88   C CG  . ARG A 1 13  ? 0.12513   -22.37581 -35.89601 1.000 67.82208  ? 509 ARG A CG  1 
ATOM   89   C CD  . ARG A 1 13  ? -0.43660  -21.36528 -36.86019 1.000 70.33760  ? 509 ARG A CD  1 
ATOM   90   N NE  . ARG A 1 13  ? -1.89261  -21.30182 -36.83995 1.000 71.57785  ? 509 ARG A NE  1 
ATOM   91   C CZ  . ARG A 1 13  ? -2.58644  -20.23155 -36.46504 1.000 72.79554  ? 509 ARG A CZ  1 
ATOM   92   N NH1 . ARG A 1 13  ? -1.95867  -19.13533 -36.06832 1.000 73.67672  ? 509 ARG A NH1 1 
ATOM   93   N NH2 . ARG A 1 13  ? -3.90937  -20.25317 -36.48630 1.000 74.48617  ? 509 ARG A NH2 1 
ATOM   94   N N   . LEU A 1 14  ? 1.54699   -21.82125 -31.30477 1.000 63.92553  ? 510 LEU A N   1 
ATOM   95   C CA  . LEU A 1 14  ? 2.38081   -21.19098 -30.28811 1.000 72.03114  ? 510 LEU A CA  1 
ATOM   96   C C   . LEU A 1 14  ? 3.29514   -22.20054 -29.60830 1.000 69.65271  ? 510 LEU A C   1 
ATOM   97   O O   . LEU A 1 14  ? 4.39174   -21.84623 -29.15593 1.000 64.43475  ? 510 LEU A O   1 
ATOM   98   C CB  . LEU A 1 14  ? 1.50578   -20.48599 -29.24857 1.000 65.19566  ? 510 LEU A CB  1 
ATOM   99   C CG  . LEU A 1 14  ? 2.05654   -19.18571 -28.65088 1.000 67.52085  ? 510 LEU A CG  1 
ATOM   100  C CD1 . LEU A 1 14  ? 2.79573   -18.35070 -29.69260 1.000 68.36395  ? 510 LEU A CD1 1 
ATOM   101  C CD2 . LEU A 1 14  ? 0.95037   -18.37539 -28.01019 1.000 70.27814  ? 510 LEU A CD2 1 
ATOM   102  N N   . TYR A 1 15  ? 2.86862   -23.45435 -29.53720 1.000 66.87291  ? 511 TYR A N   1 
ATOM   103  C CA  . TYR A 1 15  ? 3.66158   -24.53624 -28.95576 1.000 68.29419  ? 511 TYR A CA  1 
ATOM   104  C C   . TYR A 1 15  ? 3.67483   -25.71999 -29.91663 1.000 66.93233  ? 511 TYR A C   1 
ATOM   105  O O   . TYR A 1 15  ? 3.03628   -26.74964 -29.65190 1.000 63.22220  ? 511 TYR A O   1 
ATOM   106  C CB  . TYR A 1 15  ? 3.09670   -24.93115 -27.59005 1.000 71.03800  ? 511 TYR A CB  1 
ATOM   107  C CG  . TYR A 1 15  ? 2.80944   -23.73543 -26.71100 1.000 70.54809  ? 511 TYR A CG  1 
ATOM   108  C CD1 . TYR A 1 15  ? 1.50902   -23.28408 -26.51980 1.000 63.32721  ? 511 TYR A CD1 1 
ATOM   109  C CD2 . TYR A 1 15  ? 3.84812   -23.03543 -26.10016 1.000 65.39133  ? 511 TYR A CD2 1 
ATOM   110  C CE1 . TYR A 1 15  ? 1.24930   -22.18279 -25.72413 1.000 64.90980  ? 511 TYR A CE1 1 
ATOM   111  C CE2 . TYR A 1 15  ? 3.60094   -21.93509 -25.30402 1.000 66.18439  ? 511 TYR A CE2 1 
ATOM   112  C CZ  . TYR A 1 15  ? 2.30224   -21.51156 -25.11937 1.000 66.35865  ? 511 TYR A CZ  1 
ATOM   113  O OH  . TYR A 1 15  ? 2.05552   -20.41429 -24.32446 1.000 70.94605  ? 511 TYR A OH  1 
ATOM   114  N N   . PRO A 1 16  ? 4.38255   -25.59965 -31.05352 1.000 71.16018  ? 512 PRO A N   1 
ATOM   115  C CA  . PRO A 1 16  ? 4.41986   -26.70872 -32.01928 1.000 62.79143  ? 512 PRO A CA  1 
ATOM   116  C C   . PRO A 1 16  ? 5.09975   -27.92588 -31.41788 1.000 63.13827  ? 512 PRO A C   1 
ATOM   117  O O   . PRO A 1 16  ? 6.05426   -27.80982 -30.64628 1.000 71.50250  ? 512 PRO A O   1 
ATOM   118  C CB  . PRO A 1 16  ? 5.22785   -26.13763 -33.19458 1.000 71.03552  ? 512 PRO A CB  1 
ATOM   119  C CG  . PRO A 1 16  ? 5.22721   -24.62422 -32.99141 1.000 64.08640  ? 512 PRO A CG  1 
ATOM   120  C CD  . PRO A 1 16  ? 5.22054   -24.46509 -31.50320 1.000 65.22938  ? 512 PRO A CD  1 
ATOM   121  N N   . GLY A 1 17  ? 4.56481   -29.10050 -31.74062 1.000 63.47285  ? 513 GLY A N   1 
ATOM   122  C CA  . GLY A 1 17  ? 4.97176   -30.33357 -31.09881 1.000 68.73601  ? 513 GLY A CA  1 
ATOM   123  C C   . GLY A 1 17  ? 4.47158   -30.53631 -29.67959 1.000 74.96111  ? 513 GLY A C   1 
ATOM   124  O O   . GLY A 1 17  ? 4.59675   -31.65326 -29.15284 1.000 74.26817  ? 513 GLY A O   1 
ATOM   125  N N   . SER A 1 18  ? 3.90495   -29.50855 -29.03923 1.000 62.47688  ? 514 SER A N   1 
ATOM   126  C CA  . SER A 1 18  ? 3.52098   -29.57608 -27.63582 1.000 64.83644  ? 514 SER A CA  1 
ATOM   127  C C   . SER A 1 18  ? 2.01839   -29.65231 -27.39830 1.000 64.73544  ? 514 SER A C   1 
ATOM   128  O O   . SER A 1 18  ? 1.60124   -30.20690 -26.38489 1.000 62.60306  ? 514 SER A O   1 
ATOM   129  C CB  . SER A 1 18  ? 4.07973   -28.36914 -26.87900 1.000 62.56470  ? 514 SER A CB  1 
ATOM   130  O OG  . SER A 1 18  ? 5.40793   -28.61760 -26.48448 1.000 71.45486  ? 514 SER A OG  1 
ATOM   131  N N   . VAL A 1 19  ? 1.20547   -29.10168 -28.29787 1.000 54.02634  ? 515 VAL A N   1 
ATOM   132  C CA  . VAL A 1 19  ? -0.24734  -29.13131 -28.20587 1.000 47.61049  ? 515 VAL A CA  1 
ATOM   133  C C   . VAL A 1 19  ? -0.73232  -29.97611 -29.37275 1.000 51.76642  ? 515 VAL A C   1 
ATOM   134  O O   . VAL A 1 19  ? -0.64224  -29.54901 -30.52823 1.000 47.13496  ? 515 VAL A O   1 
ATOM   135  C CB  . VAL A 1 19  ? -0.84962  -27.71964 -28.24424 1.000 47.89685  ? 515 VAL A CB  1 
ATOM   136  C CG1 . VAL A 1 19  ? -2.37977  -27.77837 -28.38133 1.000 47.07748  ? 515 VAL A CG1 1 
ATOM   137  C CG2 . VAL A 1 19  ? -0.43150  -26.92774 -27.00830 1.000 48.75466  ? 515 VAL A CG2 1 
ATOM   138  N N   . TYR A 1 20  ? -1.21840  -31.19439 -29.08734 1.000 48.75024  ? 516 TYR A N   1 
ATOM   139  C CA  . TYR A 1 20  ? -1.62435  -32.06852 -30.18595 1.000 50.58460  ? 516 TYR A CA  1 
ATOM   140  C C   . TYR A 1 20  ? -3.03934  -31.76927 -30.65618 1.000 58.45639  ? 516 TYR A C   1 
ATOM   141  O O   . TYR A 1 20  ? -3.33682  -31.91608 -31.84909 1.000 63.24225  ? 516 TYR A O   1 
ATOM   142  C CB  . TYR A 1 20  ? -1.52681  -33.54002 -29.79352 1.000 47.39113  ? 516 TYR A CB  1 
ATOM   143  C CG  . TYR A 1 20  ? -0.18952  -34.00037 -29.26122 1.000 59.52118  ? 516 TYR A CG  1 
ATOM   144  C CD1 . TYR A 1 20  ? 0.74759   -34.59459 -30.09822 1.000 66.15855  ? 516 TYR A CD1 1 
ATOM   145  C CD2 . TYR A 1 20  ? 0.11832   -33.88829 -27.90694 1.000 70.16564  ? 516 TYR A CD2 1 
ATOM   146  C CE1 . TYR A 1 20  ? 1.97226   -35.04047 -29.60283 1.000 74.30386  ? 516 TYR A CE1 1 
ATOM   147  C CE2 . TYR A 1 20  ? 1.33330   -34.33186 -27.40399 1.000 78.21134  ? 516 TYR A CE2 1 
ATOM   148  C CZ  . TYR A 1 20  ? 2.25596   -34.90527 -28.25602 1.000 78.57041  ? 516 TYR A CZ  1 
ATOM   149  O OH  . TYR A 1 20  ? 3.46145   -35.34248 -27.75318 1.000 79.47903  ? 516 TYR A OH  1 
ATOM   150  N N   . GLY A 1 21  ? -3.91899  -31.36790 -29.74676 1.000 53.29071  ? 517 GLY A N   1 
ATOM   151  C CA  . GLY A 1 21  ? -5.24671  -30.92952 -30.10289 1.000 52.69397  ? 517 GLY A CA  1 
ATOM   152  C C   . GLY A 1 21  ? -6.31370  -31.61954 -29.28232 1.000 53.30031  ? 517 GLY A C   1 
ATOM   153  O O   . GLY A 1 21  ? -6.03973  -32.39769 -28.36931 1.000 57.75094  ? 517 GLY A O   1 
ATOM   154  N N   . ARG A 1 22  ? -7.55991  -31.28737 -29.61202 1.000 48.25479  ? 518 ARG A N   1 
ATOM   155  C CA  . ARG A 1 22  ? -8.71597  -31.90631 -28.98837 1.000 43.27106  ? 518 ARG A CA  1 
ATOM   156  C C   . ARG A 1 22  ? -8.78514  -33.37634 -29.36948 1.000 52.35163  ? 518 ARG A C   1 
ATOM   157  O O   . ARG A 1 22  ? -8.53022  -33.73905 -30.52363 1.000 50.74997  ? 518 ARG A O   1 
ATOM   158  C CB  . ARG A 1 22  ? -9.99644  -31.18847 -29.41252 1.000 43.61644  ? 518 ARG A CB  1 
ATOM   159  C CG  . ARG A 1 22  ? -11.19306 -31.52229 -28.51651 1.000 61.62730  ? 518 ARG A CG  1 
ATOM   160  C CD  . ARG A 1 22  ? -12.39950 -30.64732 -28.83740 1.000 50.63759  ? 518 ARG A CD  1 
ATOM   161  N NE  . ARG A 1 22  ? -12.01680 -29.25376 -29.02806 1.000 48.83133  ? 518 ARG A NE  1 
ATOM   162  C CZ  . ARG A 1 22  ? -11.95011 -28.36409 -28.04571 1.000 46.56680  ? 518 ARG A CZ  1 
ATOM   163  N NH1 . ARG A 1 22  ? -12.24749 -28.71920 -26.79872 1.000 44.93870  ? 518 ARG A NH1 1 
ATOM   164  N NH2 . ARG A 1 22  ? -11.59484 -27.11693 -28.31253 1.000 46.55894  ? 518 ARG A NH2 1 
ATOM   165  N N   . LEU A 1 23  ? -9.13014  -34.22180 -28.38113 1.000 45.04153  ? 519 LEU A N   1 
ATOM   166  C CA  . LEU A 1 23  ? -9.05253  -35.66707 -28.57147 1.000 43.42233  ? 519 LEU A CA  1 
ATOM   167  C C   . LEU A 1 23  ? -9.99787  -36.14558 -29.66302 1.000 41.76004  ? 519 LEU A C   1 
ATOM   168  O O   . LEU A 1 23  ? -9.66547  -37.08870 -30.39878 1.000 45.55410  ? 519 LEU A O   1 
ATOM   169  C CB  . LEU A 1 23  ? -9.32338  -36.39788 -27.24926 1.000 41.14408  ? 519 LEU A CB  1 
ATOM   170  C CG  . LEU A 1 23  ? -9.55005  -37.90559 -27.39880 1.000 43.47957  ? 519 LEU A CG  1 
ATOM   171  C CD1 . LEU A 1 23  ? -8.23852  -38.57657 -27.73651 1.000 45.69597  ? 519 LEU A CD1 1 
ATOM   172  C CD2 . LEU A 1 23  ? -10.12150 -38.53890 -26.16450 1.000 52.49659  ? 519 LEU A CD2 1 
ATOM   173  N N   . ILE A 1 24  ? -11.14750 -35.47714 -29.82051 1.000 41.88826  ? 520 ILE A N   1 
ATOM   174  C CA  . ILE A 1 24  ? -12.06711 -35.82914 -30.90269 1.000 49.17513  ? 520 ILE A CA  1 
ATOM   175  C C   . ILE A 1 24  ? -11.41635 -35.60424 -32.26188 1.000 50.59353  ? 520 ILE A C   1 
ATOM   176  O O   . ILE A 1 24  ? -11.62544 -36.38929 -33.19410 1.000 48.18482  ? 520 ILE A O   1 
ATOM   177  C CB  . ILE A 1 24  ? -13.40642 -35.06143 -30.76526 1.000 47.01066  ? 520 ILE A CB  1 
ATOM   178  C CG1 . ILE A 1 24  ? -14.42154 -35.55206 -31.79711 1.000 50.16149  ? 520 ILE A CG1 1 
ATOM   179  C CG2 . ILE A 1 24  ? -13.23613 -33.55100 -30.86618 1.000 43.20532  ? 520 ILE A CG2 1 
ATOM   180  C CD1 . ILE A 1 24  ? -15.76442 -34.86037 -31.69528 1.000 55.43846  ? 520 ILE A CD1 1 
ATOM   181  N N   . ASP A 1 25  ? -10.57472 -34.57639 -32.38328 1.000 55.68656  ? 521 ASP A N   1 
ATOM   182  C CA  . ASP A 1 25  ? -9.90046  -34.31041 -33.64585 1.000 60.68004  ? 521 ASP A CA  1 
ATOM   183  C C   . ASP A 1 25  ? -8.74376  -35.26127 -33.88703 1.000 63.98267  ? 521 ASP A C   1 
ATOM   184  O O   . ASP A 1 25  ? -8.34683  -35.45434 -35.03948 1.000 71.17651  ? 521 ASP A O   1 
ATOM   185  C CB  . ASP A 1 25  ? -9.41349  -32.86566 -33.68414 1.000 44.31671  ? 521 ASP A CB  1 
ATOM   186  C CG  . ASP A 1 25  ? -10.55261 -31.87732 -33.50004 1.000 56.27559  ? 521 ASP A CG  1 
ATOM   187  O OD1 . ASP A 1 25  ? -10.38246 -30.88833 -32.75479 1.000 57.11540  ? 521 ASP A OD1 1 
ATOM   188  O OD2 . ASP A 1 25  ? -11.63512 -32.10424 -34.08812 1.000 57.13213  ? 521 ASP A OD2 1 
ATOM   189  N N   . LEU A 1 26  ? -8.22201  -35.88595 -32.83697 1.000 56.02376  ? 522 LEU A N   1 
ATOM   190  C CA  . LEU A 1 26  ? -7.07141  -36.76140 -32.98330 1.000 49.86535  ? 522 LEU A CA  1 
ATOM   191  C C   . LEU A 1 26  ? -7.45407  -38.21104 -33.19589 1.000 49.14631  ? 522 LEU A C   1 
ATOM   192  O O   . LEU A 1 26  ? -6.57576  -39.02711 -33.48209 1.000 44.81022  ? 522 LEU A O   1 
ATOM   193  C CB  . LEU A 1 26  ? -6.16893  -36.65724 -31.75259 1.000 43.08340  ? 522 LEU A CB  1 
ATOM   194  C CG  . LEU A 1 26  ? -5.69933  -35.21463 -31.59697 1.000 57.33761  ? 522 LEU A CG  1 
ATOM   195  C CD1 . LEU A 1 26  ? -5.14821  -34.95514 -30.20304 1.000 57.63105  ? 522 LEU A CD1 1 
ATOM   196  C CD2 . LEU A 1 26  ? -4.67764  -34.87363 -32.68446 1.000 60.34585  ? 522 LEU A CD2 1 
ATOM   197  N N   . CYS A 1 27  ? -8.72278  -38.56442 -33.04434 1.000 44.46885  ? 523 CYS A N   1 
ATOM   198  C CA  . CYS A 1 27  ? -9.07919  -39.95501 -33.22449 1.000 48.76359  ? 523 CYS A CA  1 
ATOM   199  C C   . CYS A 1 27  ? -10.46998 -40.03913 -33.82707 1.000 50.11954  ? 523 CYS A C   1 
ATOM   200  O O   . CYS A 1 27  ? -11.17353 -39.03653 -33.93291 1.000 49.87804  ? 523 CYS A O   1 
ATOM   201  C CB  . CYS A 1 27  ? -8.96334  -40.72154 -31.90429 1.000 56.31738  ? 523 CYS A CB  1 
ATOM   202  S SG  . CYS A 1 27  ? -10.20492 -40.27073 -30.70696 1.000 50.50914  ? 523 CYS A SG  1 
ATOM   203  N N   . GLN A 1 28  ? -10.84057 -41.25436 -34.25894 1.000 49.45703  ? 524 GLN A N   1 
ATOM   204  C CA  . GLN A 1 28  ? -12.11503 -41.52677 -34.91944 1.000 47.96960  ? 524 GLN A CA  1 
ATOM   205  C C   . GLN A 1 28  ? -12.49508 -42.97560 -34.65366 1.000 44.95162  ? 524 GLN A C   1 
ATOM   206  O O   . GLN A 1 28  ? -11.62478 -43.86182 -34.70051 1.000 45.16226  ? 524 GLN A O   1 
ATOM   207  C CB  . GLN A 1 28  ? -12.04777 -41.26321 -36.43818 1.000 45.43358  ? 524 GLN A CB  1 
ATOM   208  C CG  . GLN A 1 28  ? -13.33834 -41.55846 -37.21311 1.000 45.63587  ? 524 GLN A CG  1 
ATOM   209  C CD  . GLN A 1 28  ? -14.35403 -40.40728 -37.19684 1.000 53.12423  ? 524 GLN A CD  1 
ATOM   210  O OE1 . GLN A 1 28  ? -14.02349 -39.25610 -36.88780 1.000 61.07995  ? 524 GLN A OE1 1 
ATOM   211  N NE2 . GLN A 1 28  ? -15.61009 -40.72891 -37.51188 1.000 57.82038  ? 524 GLN A NE2 1 
ATOM   212  N N   . PRO A 1 29  ? -13.75213 -43.24975 -34.34424 1.000 46.54552  ? 525 PRO A N   1 
ATOM   213  C CA  . PRO A 1 29  ? -14.16745 -44.65217 -34.21642 1.000 52.46555  ? 525 PRO A CA  1 
ATOM   214  C C   . PRO A 1 29  ? -14.11634 -45.30435 -35.58488 1.000 58.87132  ? 525 PRO A C   1 
ATOM   215  O O   . PRO A 1 29  ? -14.35893 -44.64910 -36.60422 1.000 60.49579  ? 525 PRO A O   1 
ATOM   216  C CB  . PRO A 1 29  ? -15.59401 -44.57505 -33.65534 1.000 44.98182  ? 525 PRO A CB  1 
ATOM   217  C CG  . PRO A 1 29  ? -15.99367 -43.12271 -33.69684 1.000 44.37146  ? 525 PRO A CG  1 
ATOM   218  C CD  . PRO A 1 29  ? -14.77405 -42.28645 -33.90388 1.000 44.33016  ? 525 PRO A CD  1 
ATOM   219  N N   . THR A 1 30  ? -13.73703 -46.58847 -35.60098 1.000 57.65356  ? 526 THR A N   1 
ATOM   220  C CA  . THR A 1 30  ? -13.45893 -47.26058 -36.86848 1.000 59.68337  ? 526 THR A CA  1 
ATOM   221  C C   . THR A 1 30  ? -14.71898 -47.38585 -37.72410 1.000 72.52748  ? 526 THR A C   1 
ATOM   222  O O   . THR A 1 30  ? -14.65534 -47.27111 -38.95469 1.000 85.84746  ? 526 THR A O   1 
ATOM   223  C CB  . THR A 1 30  ? -12.81540 -48.63696 -36.62490 1.000 53.50442  ? 526 THR A CB  1 
ATOM   224  O OG1 . THR A 1 30  ? -13.67998 -49.48857 -35.86370 1.000 45.66577  ? 526 THR A OG1 1 
ATOM   225  C CG2 . THR A 1 30  ? -11.50157 -48.48895 -35.89339 1.000 49.27490  ? 526 THR A CG2 1 
ATOM   226  N N   . GLN A 1 31  ? -15.87443 -47.59339 -37.09388 1.000 68.86384  ? 527 GLN A N   1 
ATOM   227  C CA  . GLN A 1 31  ? -17.14428 -47.72061 -37.79644 1.000 72.20576  ? 527 GLN A CA  1 
ATOM   228  C C   . GLN A 1 31  ? -18.17885 -46.79876 -37.16094 1.000 77.13051  ? 527 GLN A C   1 
ATOM   229  O O   . GLN A 1 31  ? -17.99709 -46.29753 -36.04778 1.000 77.41881  ? 527 GLN A O   1 
ATOM   230  C CB  . GLN A 1 31  ? -17.66076 -49.16728 -37.78049 1.000 69.23479  ? 527 GLN A CB  1 
ATOM   231  C CG  . GLN A 1 31  ? -16.57686 -50.23617 -37.81693 1.000 72.86988  ? 527 GLN A CG  1 
ATOM   232  C CD  . GLN A 1 31  ? -17.09154 -51.55514 -38.34380 1.000 85.91511  ? 527 GLN A CD  1 
ATOM   233  O OE1 . GLN A 1 31  ? -17.83810 -51.58918 -39.32186 1.000 95.67958  ? 527 GLN A OE1 1 
ATOM   234  N NE2 . GLN A 1 31  ? -16.69816 -52.65255 -37.69961 1.000 87.40935  ? 527 GLN A NE2 1 
ATOM   235  N N   . LYS A 1 32  ? -19.28061 -46.57614 -37.88256 1.000 77.19676  ? 528 LYS A N   1 
ATOM   236  C CA  . LYS A 1 32  ? -20.31467 -45.69504 -37.35262 1.000 72.21133  ? 528 LYS A CA  1 
ATOM   237  C C   . LYS A 1 32  ? -21.08262 -46.35963 -36.22206 1.000 67.22219  ? 528 LYS A C   1 
ATOM   238  O O   . LYS A 1 32  ? -21.52520 -45.67240 -35.29342 1.000 67.59499  ? 528 LYS A O   1 
ATOM   239  C CB  . LYS A 1 32  ? -21.27987 -45.25895 -38.45454 1.000 75.55647  ? 528 LYS A CB  1 
ATOM   240  C CG  . LYS A 1 32  ? -22.04008 -43.97802 -38.10794 1.000 75.39346  ? 528 LYS A CG  1 
ATOM   241  C CD  . LYS A 1 32  ? -23.40273 -43.90568 -38.77544 1.000 75.80578  ? 528 LYS A CD  1 
ATOM   242  C CE  . LYS A 1 32  ? -23.90854 -42.46478 -38.85032 1.000 76.07705  ? 528 LYS A CE  1 
ATOM   243  N NZ  . LYS A 1 32  ? -23.78896 -41.75021 -37.54682 1.000 73.51528  ? 528 LYS A NZ  1 
ATOM   244  N N   . LYS A 1 33  ? -21.21951 -47.69170 -36.26848 1.000 62.94053  ? 529 LYS A N   1 
ATOM   245  C CA  . LYS A 1 33  ? -21.93205 -48.44327 -35.23501 1.000 60.03110  ? 529 LYS A CA  1 
ATOM   246  C C   . LYS A 1 33  ? -21.33433 -48.26030 -33.84812 1.000 61.20238  ? 529 LYS A C   1 
ATOM   247  O O   . LYS A 1 33  ? -22.04205 -48.45028 -32.85184 1.000 65.15187  ? 529 LYS A O   1 
ATOM   248  C CB  . LYS A 1 33  ? -21.93661 -49.93404 -35.58152 1.000 58.70940  ? 529 LYS A CB  1 
ATOM   249  C CG  . LYS A 1 33  ? -20.57557 -50.46277 -35.98861 1.000 54.08261  ? 529 LYS A CG  1 
ATOM   250  C CD  . LYS A 1 33  ? -20.60870 -51.93306 -36.35423 1.000 48.33581  ? 529 LYS A CD  1 
ATOM   251  C CE  . LYS A 1 33  ? -21.02393 -52.77749 -35.17811 1.000 47.34449  ? 529 LYS A CE  1 
ATOM   252  N NZ  . LYS A 1 33  ? -20.74362 -54.22801 -35.42590 1.000 52.94438  ? 529 LYS A NZ  1 
ATOM   253  N N   . TYR A 1 34  ? -20.05466 -47.88981 -33.76832 1.000 55.22628  ? 530 TYR A N   1 
ATOM   254  C CA  . TYR A 1 34  ? -19.32472 -47.73699 -32.52165 1.000 43.68473  ? 530 TYR A CA  1 
ATOM   255  C C   . TYR A 1 34  ? -19.29037 -46.29224 -32.02203 1.000 42.63057  ? 530 TYR A C   1 
ATOM   256  O O   . TYR A 1 34  ? -18.65201 -46.01846 -31.00397 1.000 48.51765  ? 530 TYR A O   1 
ATOM   257  C CB  . TYR A 1 34  ? -17.90105 -48.26112 -32.70080 1.000 44.08191  ? 530 TYR A CB  1 
ATOM   258  C CG  . TYR A 1 34  ? -17.79326 -49.75791 -32.89801 1.000 43.29221  ? 530 TYR A CG  1 
ATOM   259  C CD1 . TYR A 1 34  ? -18.39158 -50.63284 -32.02072 1.000 49.04568  ? 530 TYR A CD1 1 
ATOM   260  C CD2 . TYR A 1 34  ? -17.06437 -50.29251 -33.95197 1.000 47.30696  ? 530 TYR A CD2 1 
ATOM   261  C CE1 . TYR A 1 34  ? -18.28060 -52.00745 -32.18459 1.000 55.66780  ? 530 TYR A CE1 1 
ATOM   262  C CE2 . TYR A 1 34  ? -16.95661 -51.66461 -34.13280 1.000 50.09056  ? 530 TYR A CE2 1 
ATOM   263  C CZ  . TYR A 1 34  ? -17.56261 -52.51445 -33.24520 1.000 58.17888  ? 530 TYR A CZ  1 
ATOM   264  O OH  . TYR A 1 34  ? -17.45687 -53.87974 -33.40818 1.000 69.13282  ? 530 TYR A OH  1 
ATOM   265  N N   . GLN A 1 35  ? -19.97186 -45.36868 -32.69865 1.000 43.49148  ? 531 GLN A N   1 
ATOM   266  C CA  . GLN A 1 35  ? -19.84193 -43.95398 -32.35562 1.000 47.57269  ? 531 GLN A CA  1 
ATOM   267  C C   . GLN A 1 35  ? -20.43264 -43.64783 -30.98284 1.000 50.41651  ? 531 GLN A C   1 
ATOM   268  O O   . GLN A 1 35  ? -19.79942 -42.95490 -30.17517 1.000 45.98067  ? 531 GLN A O   1 
ATOM   269  C CB  . GLN A 1 35  ? -20.49285 -43.08498 -33.43478 1.000 51.04976  ? 531 GLN A CB  1 
ATOM   270  C CG  . GLN A 1 35  ? -19.47509 -42.35578 -34.30850 1.000 59.55045  ? 531 GLN A CG  1 
ATOM   271  C CD  . GLN A 1 35  ? -20.02342 -41.86336 -35.64785 1.000 66.19864  ? 531 GLN A CD  1 
ATOM   272  O OE1 . GLN A 1 35  ? -21.22976 -41.66803 -35.81994 1.000 65.67108  ? 531 GLN A OE1 1 
ATOM   273  N NE2 . GLN A 1 35  ? -19.12239 -41.63933 -36.59729 1.000 65.57659  ? 531 GLN A NE2 1 
ATOM   274  N N   . ILE A 1 36  ? -21.63247 -44.17721 -30.69382 1.000 53.40571  ? 532 ILE A N   1 
ATOM   275  C CA  . ILE A 1 36  ? -22.31355 -43.89210 -29.42899 1.000 50.89411  ? 532 ILE A CA  1 
ATOM   276  C C   . ILE A 1 36  ? -21.56610 -44.52186 -28.25775 1.000 40.98919  ? 532 ILE A C   1 
ATOM   277  O O   . ILE A 1 36  ? -21.41444 -43.90902 -27.18986 1.000 40.43064  ? 532 ILE A O   1 
ATOM   278  C CB  . ILE A 1 36  ? -23.77673 -44.37734 -29.50058 1.000 55.61314  ? 532 ILE A CB  1 
ATOM   279  C CG1 . ILE A 1 36  ? -24.61039 -43.44081 -30.37967 1.000 51.67279  ? 532 ILE A CG1 1 
ATOM   280  C CG2 . ILE A 1 36  ? -24.40747 -44.54011 -28.10207 1.000 42.43231  ? 532 ILE A CG2 1 
ATOM   281  C CD1 . ILE A 1 36  ? -25.98387 -43.99604 -30.72418 1.000 47.33965  ? 532 ILE A CD1 1 
ATOM   282  N N   . ALA A 1 37  ? -21.06858 -45.74288 -28.45003 1.000 40.69252  ? 533 ALA A N   1 
ATOM   283  C CA  . ALA A 1 37  ? -20.32542 -46.42074 -27.39838 1.000 39.68821  ? 533 ALA A CA  1 
ATOM   284  C C   . ALA A 1 37  ? -19.01025 -45.71643 -27.10890 1.000 40.42653  ? 533 ALA A C   1 
ATOM   285  O O   . ALA A 1 37  ? -18.64364 -45.54692 -25.94198 1.000 44.69664  ? 533 ALA A O   1 
ATOM   286  C CB  . ALA A 1 37  ? -20.08321 -47.87777 -27.78072 1.000 39.73717  ? 533 ALA A CB  1 
ATOM   287  N N   . VAL A 1 38  ? -18.29147 -45.28854 -28.15241 1.000 47.02765  ? 534 VAL A N   1 
ATOM   288  C CA  . VAL A 1 38  ? -17.04798 -44.55315 -27.94118 1.000 39.43007  ? 534 VAL A CA  1 
ATOM   289  C C   . VAL A 1 38  ? -17.33580 -43.20197 -27.29732 1.000 39.37191  ? 534 VAL A C   1 
ATOM   290  O O   . VAL A 1 38  ? -16.62258 -42.77712 -26.38138 1.000 42.31043  ? 534 VAL A O   1 
ATOM   291  C CB  . VAL A 1 38  ? -16.27186 -44.41164 -29.26617 1.000 42.72276  ? 534 VAL A CB  1 
ATOM   292  C CG1 . VAL A 1 38  ? -15.14839 -43.40136 -29.13806 1.000 39.96134  ? 534 VAL A CG1 1 
ATOM   293  C CG2 . VAL A 1 38  ? -15.69167 -45.75317 -29.68079 1.000 40.18471  ? 534 VAL A CG2 1 
ATOM   294  N N   . THR A 1 39  ? -18.40976 -42.53191 -27.73133 1.000 41.55682  ? 535 THR A N   1 
ATOM   295  C CA  . THR A 1 39  ? -18.82403 -41.27635 -27.10465 1.000 44.36713  ? 535 THR A CA  1 
ATOM   296  C C   . THR A 1 39  ? -19.05339 -41.44120 -25.60630 1.000 43.78927  ? 535 THR A C   1 
ATOM   297  O O   . THR A 1 39  ? -18.57138 -40.62644 -24.80763 1.000 39.44100  ? 535 THR A O   1 
ATOM   298  C CB  . THR A 1 39  ? -20.09032 -40.75098 -27.77734 1.000 45.38991  ? 535 THR A CB  1 
ATOM   299  O OG1 . THR A 1 39  ? -19.92863 -40.82546 -29.19667 1.000 48.07666  ? 535 THR A OG1 1 
ATOM   300  C CG2 . THR A 1 39  ? -20.36985 -39.31158 -27.36781 1.000 41.56569  ? 535 THR A CG2 1 
ATOM   301  N N   . LYS A 1 40  ? -19.73260 -42.52717 -25.21518 1.000 39.26808  ? 536 LYS A N   1 
ATOM   302  C CA  . LYS A 1 40  ? -20.04788 -42.79810 -23.81566 1.000 38.79884  ? 536 LYS A CA  1 
ATOM   303  C C   . LYS A 1 40  ? -18.79573 -43.10147 -22.99826 1.000 38.16545  ? 536 LYS A C   1 
ATOM   304  O O   . LYS A 1 40  ? -18.62234 -42.57121 -21.89525 1.000 38.08227  ? 536 LYS A O   1 
ATOM   305  C CB  . LYS A 1 40  ? -21.02534 -43.97251 -23.74197 1.000 40.99414  ? 536 LYS A CB  1 
ATOM   306  C CG  . LYS A 1 40  ? -21.43510 -44.38695 -22.33668 1.000 44.20155  ? 536 LYS A CG  1 
ATOM   307  C CD  . LYS A 1 40  ? -21.89966 -43.19370 -21.51737 1.000 38.66259  ? 536 LYS A CD  1 
ATOM   308  C CE  . LYS A 1 40  ? -22.52857 -43.64951 -20.25037 1.000 38.46077  ? 536 LYS A CE  1 
ATOM   309  N NZ  . LYS A 1 40  ? -23.79916 -44.35277 -20.54037 1.000 38.75246  ? 536 LYS A NZ  1 
ATOM   310  N N   . VAL A 1 41  ? -17.92705 -43.97406 -23.51342 1.000 37.91354  ? 537 VAL A N   1 
ATOM   311  C CA  . VAL A 1 41  ? -16.74510 -44.38648 -22.76554 1.000 37.53896  ? 537 VAL A CA  1 
ATOM   312  C C   . VAL A 1 41  ? -15.75715 -43.23712 -22.63249 1.000 37.79322  ? 537 VAL A C   1 
ATOM   313  O O   . VAL A 1 41  ? -15.18601 -43.02143 -21.55622 1.000 39.07021  ? 537 VAL A O   1 
ATOM   314  C CB  . VAL A 1 41  ? -16.09784 -45.61076 -23.43131 1.000 37.47342  ? 537 VAL A CB  1 
ATOM   315  C CG1 . VAL A 1 41  ? -14.74333 -45.89860 -22.81688 1.000 37.39285  ? 537 VAL A CG1 1 
ATOM   316  C CG2 . VAL A 1 41  ? -17.00946 -46.80819 -23.30036 1.000 37.28237  ? 537 VAL A CG2 1 
ATOM   317  N N   . LEU A 1 42  ? -15.55253 -42.46542 -23.70808 1.000 38.16506  ? 538 LEU A N   1 
ATOM   318  C CA  . LEU A 1 42  ? -14.59922 -41.35566 -23.64080 1.000 38.46113  ? 538 LEU A CA  1 
ATOM   319  C C   . LEU A 1 42  ? -15.11083 -40.22558 -22.75383 1.000 38.70630  ? 538 LEU A C   1 
ATOM   320  O O   . LEU A 1 42  ? -14.32642 -39.58891 -22.04705 1.000 38.91162  ? 538 LEU A O   1 
ATOM   321  C CB  . LEU A 1 42  ? -14.28983 -40.82392 -25.03937 1.000 48.01985  ? 538 LEU A CB  1 
ATOM   322  C CG  . LEU A 1 42  ? -13.53091 -41.73394 -26.00440 1.000 48.22667  ? 538 LEU A CG  1 
ATOM   323  C CD1 . LEU A 1 42  ? -13.17608 -40.94749 -27.25367 1.000 39.49611  ? 538 LEU A CD1 1 
ATOM   324  C CD2 . LEU A 1 42  ? -12.28473 -42.34795 -25.34803 1.000 38.79559  ? 538 LEU A CD2 1 
ATOM   325  N N   . GLY A 1 43  ? -16.41251 -39.95409 -22.78385 1.000 45.48875  ? 539 GLY A N   1 
ATOM   326  C CA  . GLY A 1 43  ? -16.97769 -38.98337 -21.85985 1.000 39.28652  ? 539 GLY A CA  1 
ATOM   327  C C   . GLY A 1 43  ? -16.46215 -37.58416 -22.12126 1.000 42.03048  ? 539 GLY A C   1 
ATOM   328  O O   . GLY A 1 43  ? -16.28133 -37.16389 -23.26897 1.000 46.68677  ? 539 GLY A O   1 
ATOM   329  N N   . LYS A 1 44  ? -16.17813 -36.86025 -21.03773 1.000 41.11734  ? 540 LYS A N   1 
ATOM   330  C CA  . LYS A 1 44  ? -15.63275 -35.51157 -21.15397 1.000 47.05723  ? 540 LYS A CA  1 
ATOM   331  C C   . LYS A 1 44  ? -14.21485 -35.50103 -21.72596 1.000 48.64803  ? 540 LYS A C   1 
ATOM   332  O O   . LYS A 1 44  ? -13.73527 -34.44906 -22.16453 1.000 42.37911  ? 540 LYS A O   1 
ATOM   333  C CB  . LYS A 1 44  ? -15.65201 -34.82407 -19.79006 1.000 43.82604  ? 540 LYS A CB  1 
ATOM   334  C CG  . LYS A 1 44  ? -14.74413 -35.49211 -18.76883 1.000 56.00670  ? 540 LYS A CG  1 
ATOM   335  C CD  . LYS A 1 44  ? -15.43984 -35.63412 -17.42037 1.000 70.79708  ? 540 LYS A CD  1 
ATOM   336  C CE  . LYS A 1 44  ? -14.43755 -35.84697 -16.27454 1.000 79.00787  ? 540 LYS A CE  1 
ATOM   337  N NZ  . LYS A 1 44  ? -13.80185 -37.21037 -16.25511 1.000 78.70801  ? 540 LYS A NZ  1 
ATOM   338  N N   . ASN A 1 45  ? -13.54134 -36.64708 -21.76721 1.000 48.25024  ? 541 ASN A N   1 
ATOM   339  C CA  . ASN A 1 45  ? -12.22243 -36.67323 -22.37526 1.000 45.49526  ? 541 ASN A CA  1 
ATOM   340  C C   . ASN A 1 45  ? -12.26318 -36.42679 -23.87373 1.000 48.93013  ? 541 ASN A C   1 
ATOM   341  O O   . ASN A 1 45  ? -11.23065 -36.05800 -24.44215 1.000 51.97703  ? 541 ASN A O   1 
ATOM   342  C CB  . ASN A 1 45  ? -11.52484 -38.00087 -22.08324 1.000 39.86167  ? 541 ASN A CB  1 
ATOM   343  C CG  . ASN A 1 45  ? -11.03837 -38.08077 -20.66949 1.000 44.22342  ? 541 ASN A CG  1 
ATOM   344  O OD1 . ASN A 1 45  ? -10.47957 -37.11658 -20.14746 1.000 47.12375  ? 541 ASN A OD1 1 
ATOM   345  N ND2 . ASN A 1 45  ? -11.26665 -39.21515 -20.02218 1.000 44.13923  ? 541 ASN A ND2 1 
ATOM   346  N N   . MET A 1 46  ? -13.41800 -36.57788 -24.53349 1.000 45.76217  ? 542 MET A N   1 
ATOM   347  C CA  . MET A 1 46  ? -13.39534 -36.32119 -25.97042 1.000 46.29147  ? 542 MET A CA  1 
ATOM   348  C C   . MET A 1 46  ? -13.23696 -34.83548 -26.27808 1.000 41.41652  ? 542 MET A C   1 
ATOM   349  O O   . MET A 1 46  ? -12.75415 -34.48728 -27.35927 1.000 45.18355  ? 542 MET A O   1 
ATOM   350  C CB  . MET A 1 46  ? -14.62649 -36.91481 -26.65142 1.000 47.88390  ? 542 MET A CB  1 
ATOM   351  C CG  . MET A 1 46  ? -15.90008 -36.11476 -26.58550 1.000 62.72323  ? 542 MET A CG  1 
ATOM   352  S SD  . MET A 1 46  ? -17.02335 -36.64793 -27.90686 1.000 71.95970  ? 542 MET A SD  1 
ATOM   353  C CE  . MET A 1 46  ? -16.75723 -38.40166 -27.88955 1.000 42.18269  ? 542 MET A CE  1 
ATOM   354  N N   . ASP A 1 47  ? -13.54918 -33.96186 -25.32409 1.000 43.45501  ? 543 ASP A N   1 
ATOM   355  C CA  . ASP A 1 47  ? -13.29474 -32.53322 -25.44502 1.000 45.01084  ? 543 ASP A CA  1 
ATOM   356  C C   . ASP A 1 47  ? -11.98590 -32.10105 -24.77465 1.000 48.39925  ? 543 ASP A C   1 
ATOM   357  O O   . ASP A 1 47  ? -11.72130 -30.89705 -24.67077 1.000 46.03584  ? 543 ASP A O   1 
ATOM   358  C CB  . ASP A 1 47  ? -14.47748 -31.74954 -24.86287 1.000 56.12374  ? 543 ASP A CB  1 
ATOM   359  C CG  . ASP A 1 47  ? -15.66345 -31.66836 -25.82654 1.000 78.64068  ? 543 ASP A CG  1 
ATOM   360  O OD1 . ASP A 1 47  ? -15.52282 -32.11008 -26.98937 1.000 86.68635  ? 543 ASP A OD1 1 
ATOM   361  O OD2 . ASP A 1 47  ? -16.74182 -31.17694 -25.41779 1.000 87.61583  ? 543 ASP A OD2 1 
ATOM   362  N N   . ALA A 1 48  ? -11.15754 -33.04609 -24.32610 1.000 61.54529  ? 544 ALA A N   1 
ATOM   363  C CA  . ALA A 1 48  ? -9.89666  -32.69957 -23.67917 1.000 57.89327  ? 544 ALA A CA  1 
ATOM   364  C C   . ALA A 1 48  ? -8.82626  -32.33379 -24.70738 1.000 57.38310  ? 544 ALA A C   1 
ATOM   365  O O   . ALA A 1 48  ? -8.70506  -32.96707 -25.76089 1.000 56.89113  ? 544 ALA A O   1 
ATOM   366  C CB  . ALA A 1 48  ? -9.40924  -33.85637 -22.80861 1.000 56.96128  ? 544 ALA A CB  1 
ATOM   367  N N   . ILE A 1 49  ? -8.05085  -31.30389 -24.39742 1.000 57.86823  ? 545 ILE A N   1 
ATOM   368  C CA  . ILE A 1 49  ? -6.93264  -30.90401 -25.24819 1.000 57.76618  ? 545 ILE A CA  1 
ATOM   369  C C   . ILE A 1 49  ? -5.71016  -31.66958 -24.78134 1.000 56.88570  ? 545 ILE A C   1 
ATOM   370  O O   . ILE A 1 49  ? -5.23512  -31.46986 -23.66002 1.000 57.20999  ? 545 ILE A O   1 
ATOM   371  C CB  . ILE A 1 49  ? -6.67258  -29.39041 -25.19809 1.000 59.16087  ? 545 ILE A CB  1 
ATOM   372  C CG1 . ILE A 1 49  ? -7.93096  -28.57854 -25.50766 1.000 60.57319  ? 545 ILE A CG1 1 
ATOM   373  C CG2 . ILE A 1 49  ? -5.54419  -29.02713 -26.14864 1.000 59.37690  ? 545 ILE A CG2 1 
ATOM   374  C CD1 . ILE A 1 49  ? -8.72673  -29.07834 -26.67645 1.000 60.67787  ? 545 ILE A CD1 1 
ATOM   375  N N   . ILE A 1 50  ? -5.20410  -32.54730 -25.62735 1.000 56.20361  ? 546 ILE A N   1 
ATOM   376  C CA  . ILE A 1 50  ? -4.04654  -33.34872 -25.25753 1.000 55.78919  ? 546 ILE A CA  1 
ATOM   377  C C   . ILE A 1 50  ? -2.77647  -32.54441 -25.50256 1.000 58.63987  ? 546 ILE A C   1 
ATOM   378  O O   . ILE A 1 50  ? -2.59548  -31.95119 -26.57230 1.000 57.23945  ? 546 ILE A O   1 
ATOM   379  C CB  . ILE A 1 50  ? -4.03739  -34.66455 -26.03715 1.000 55.13631  ? 546 ILE A CB  1 
ATOM   380  C CG1 . ILE A 1 50  ? -5.36626  -35.37111 -25.81023 1.000 66.80822  ? 546 ILE A CG1 1 
ATOM   381  C CG2 . ILE A 1 50  ? -2.87570  -35.53479 -25.59565 1.000 55.12123  ? 546 ILE A CG2 1 
ATOM   382  C CD1 . ILE A 1 50  ? -5.59516  -36.42746 -26.78167 1.000 67.71278  ? 546 ILE A CD1 1 
ATOM   383  N N   . VAL A 1 51  ? -1.90160  -32.51039 -24.49834 1.000 57.17231  ? 547 VAL A N   1 
ATOM   384  C CA  . VAL A 1 51  ? -0.65896  -31.76603 -24.54410 1.000 58.44328  ? 547 VAL A CA  1 
ATOM   385  C C   . VAL A 1 51  ? 0.46011   -32.68342 -24.07263 1.000 58.88921  ? 547 VAL A C   1 
ATOM   386  O O   . VAL A 1 51  ? 0.22445   -33.76226 -23.52628 1.000 59.12687  ? 547 VAL A O   1 
ATOM   387  C CB  . VAL A 1 51  ? -0.70434  -30.48376 -23.68744 1.000 59.59993  ? 547 VAL A CB  1 
ATOM   388  C CG1 . VAL A 1 51  ? -1.76989  -29.52142 -24.19716 1.000 61.20911  ? 547 VAL A CG1 1 
ATOM   389  C CG2 . VAL A 1 51  ? -0.93438  -30.81650 -22.24374 1.000 59.80867  ? 547 VAL A CG2 1 
ATOM   390  N N   . ASP A 1 52  ? 1.69338   -32.23753 -24.29472 1.000 60.34609  ? 548 ASP A N   1 
ATOM   391  C CA  . ASP A 1 52  ? 2.83846   -33.04200 -23.89665 1.000 61.41046  ? 548 ASP A CA  1 
ATOM   392  C C   . ASP A 1 52  ? 2.99716   -33.03127 -22.38520 1.000 63.54182  ? 548 ASP A C   1 
ATOM   393  O O   . ASP A 1 52  ? 3.03311   -34.08886 -21.74985 1.000 67.85374  ? 548 ASP A O   1 
ATOM   394  C CB  . ASP A 1 52  ? 4.11824   -32.56478 -24.61900 1.000 63.24045  ? 548 ASP A CB  1 
ATOM   395  C CG  . ASP A 1 52  ? 4.49055   -31.09771 -24.32884 1.000 70.35483  ? 548 ASP A CG  1 
ATOM   396  O OD1 . ASP A 1 52  ? 3.58743   -30.29328 -24.03945 1.000 64.98369  ? 548 ASP A OD1 1 
ATOM   397  O OD2 . ASP A 1 52  ? 5.68949   -30.73668 -24.44568 1.000 74.87809  ? 548 ASP A OD2 1 
ATOM   398  N N   . SER A 1 53  ? 2.99374   -31.85208 -21.78292 1.000 65.04605  ? 549 SER A N   1 
ATOM   399  C CA  . SER A 1 53  ? 3.41387   -31.71537 -20.40452 1.000 67.19740  ? 549 SER A CA  1 
ATOM   400  C C   . SER A 1 53  ? 2.40050   -30.85455 -19.66961 1.000 68.88693  ? 549 SER A C   1 
ATOM   401  O O   . SER A 1 53  ? 1.60438   -30.13847 -20.28266 1.000 71.90178  ? 549 SER A O   1 
ATOM   402  C CB  . SER A 1 53  ? 4.81425   -31.10996 -20.33527 1.000 67.75484  ? 549 SER A CB  1 
ATOM   403  O OG  . SER A 1 53  ? 4.73073   -29.69929 -20.33409 1.000 71.34380  ? 549 SER A OG  1 
ATOM   404  N N   . GLU A 1 54  ? 2.44571   -30.92184 -18.33914 1.000 67.07001  ? 550 GLU A N   1 
ATOM   405  C CA  . GLU A 1 54  ? 1.51123   -30.16867 -17.51239 1.000 70.62044  ? 550 GLU A CA  1 
ATOM   406  C C   . GLU A 1 54  ? 1.85754   -28.67847 -17.47407 1.000 72.97200  ? 550 GLU A C   1 
ATOM   407  O O   . GLU A 1 54  ? 0.95738   -27.83961 -17.32692 1.000 72.61996  ? 550 GLU A O   1 
ATOM   408  C CB  . GLU A 1 54  ? 1.47115   -30.79781 -16.11165 1.000 78.55752  ? 550 GLU A CB  1 
ATOM   409  C CG  . GLU A 1 54  ? 0.73827   -30.01040 -15.03900 1.000 91.52578  ? 550 GLU A CG  1 
ATOM   410  C CD  . GLU A 1 54  ? 1.68319   -29.36485 -14.04710 1.000 104.95497 ? 550 GLU A CD  1 
ATOM   411  O OE1 . GLU A 1 54  ? 2.47276   -30.10204 -13.41897 1.000 110.38956 ? 550 GLU A OE1 1 
ATOM   412  O OE2 . GLU A 1 54  ? 1.65200   -28.12211 -13.90864 1.000 108.60745 ? 550 GLU A OE2 1 
ATOM   413  N N   . LYS A 1 55  ? 3.13260   -28.32406 -17.65780 1.000 70.64728  ? 551 LYS A N   1 
ATOM   414  C CA  . LYS A 1 55  ? 3.50137   -26.91175 -17.74231 1.000 81.05550  ? 551 LYS A CA  1 
ATOM   415  C C   . LYS A 1 55  ? 2.87485   -26.24902 -18.96497 1.000 80.71446  ? 551 LYS A C   1 
ATOM   416  O O   . LYS A 1 55  ? 2.31583   -25.14883 -18.87028 1.000 86.83077  ? 551 LYS A O   1 
ATOM   417  C CB  . LYS A 1 55  ? 5.02395   -26.75266 -17.78056 1.000 85.91747  ? 551 LYS A CB  1 
ATOM   418  C CG  . LYS A 1 55  ? 5.52783   -25.32559 -17.50205 1.000 87.39980  ? 551 LYS A CG  1 
ATOM   419  C CD  . LYS A 1 55  ? 6.07773   -24.64272 -18.75053 1.000 89.80309  ? 551 LYS A CD  1 
ATOM   420  C CE  . LYS A 1 55  ? 6.42538   -23.15721 -18.51072 1.000 91.93018  ? 551 LYS A CE  1 
ATOM   421  N NZ  . LYS A 1 55  ? 5.28098   -22.31884 -18.02500 1.000 93.52180  ? 551 LYS A NZ  1 
ATOM   422  N N   . THR A 1 56  ? 2.95585   -26.90406 -20.12676 1.000 73.54963  ? 552 THR A N   1 
ATOM   423  C CA  . THR A 1 56  ? 2.32506   -26.33650 -21.30814 1.000 67.85910  ? 552 THR A CA  1 
ATOM   424  C C   . THR A 1 56  ? 0.81091   -26.33823 -21.19069 1.000 66.40674  ? 552 THR A C   1 
ATOM   425  O O   . THR A 1 56  ? 0.15618   -25.50195 -21.81371 1.000 69.25462  ? 552 THR A O   1 
ATOM   426  C CB  . THR A 1 56  ? 2.75937   -27.08210 -22.56672 1.000 66.66887  ? 552 THR A CB  1 
ATOM   427  O OG1 . THR A 1 56  ? 1.89617   -28.19353 -22.79010 1.000 75.95752  ? 552 THR A OG1 1 
ATOM   428  C CG2 . THR A 1 56  ? 4.17601   -27.57338 -22.41829 1.000 68.10711  ? 552 THR A CG2 1 
ATOM   429  N N   . GLY A 1 57  ? 0.24573   -27.24145 -20.39015 1.000 65.51802  ? 553 GLY A N   1 
ATOM   430  C CA  . GLY A 1 57  ? -1.17123  -27.14967 -20.07868 1.000 67.37773  ? 553 GLY A CA  1 
ATOM   431  C C   . GLY A 1 57  ? -1.50186  -25.87840 -19.32103 1.000 76.74413  ? 553 GLY A C   1 
ATOM   432  O O   . GLY A 1 57  ? -2.44049  -25.15793 -19.66956 1.000 84.13506  ? 553 GLY A O   1 
ATOM   433  N N   . ARG A 1 58  ? -0.71014  -25.57204 -18.28845 1.000 74.50955  ? 554 ARG A N   1 
ATOM   434  C CA  . ARG A 1 58  ? -0.87620  -24.31988 -17.55999 1.000 79.36977  ? 554 ARG A CA  1 
ATOM   435  C C   . ARG A 1 58  ? -0.52141  -23.12332 -18.43886 1.000 78.47858  ? 554 ARG A C   1 
ATOM   436  O O   . ARG A 1 58  ? -1.11966  -22.05073 -18.29583 1.000 76.81654  ? 554 ARG A O   1 
ATOM   437  C CB  . ARG A 1 58  ? -0.03392  -24.37743 -16.27603 1.000 91.57190  ? 554 ARG A CB  1 
ATOM   438  C CG  . ARG A 1 58  ? 0.26888   -23.05760 -15.56498 1.000 107.21831 ? 554 ARG A CG  1 
ATOM   439  C CD  . ARG A 1 58  ? -0.98315  -22.34407 -15.06077 1.000 117.67674 ? 554 ARG A CD  1 
ATOM   440  N NE  . ARG A 1 58  ? -0.70348  -20.93640 -14.77488 1.000 125.34858 ? 554 ARG A NE  1 
ATOM   441  C CZ  . ARG A 1 58  ? -1.53434  -19.92839 -15.03154 1.000 123.51569 ? 554 ARG A CZ  1 
ATOM   442  N NH1 . ARG A 1 58  ? -2.71406  -20.15446 -15.59460 1.000 115.36693 ? 554 ARG A NH1 1 
ATOM   443  N NH2 . ARG A 1 58  ? -1.17898  -18.68660 -14.72733 1.000 126.79532 ? 554 ARG A NH2 1 
ATOM   444  N N   . ASP A 1 59  ? 0.41518   -23.30234 -19.37646 1.000 82.48400  ? 555 ASP A N   1 
ATOM   445  C CA  . ASP A 1 59  ? 0.75526   -22.24025 -20.32143 1.000 86.79556  ? 555 ASP A CA  1 
ATOM   446  C C   . ASP A 1 59  ? -0.41719  -21.90923 -21.23995 1.000 85.86091  ? 555 ASP A C   1 
ATOM   447  O O   . ASP A 1 59  ? -0.65980  -20.73457 -21.55089 1.000 84.30759  ? 555 ASP A O   1 
ATOM   448  C CB  . ASP A 1 59  ? 1.96953   -22.64800 -21.15538 1.000 85.47497  ? 555 ASP A CB  1 
ATOM   449  C CG  . ASP A 1 59  ? 3.26990   -22.11478 -20.59863 1.000 85.06894  ? 555 ASP A CG  1 
ATOM   450  O OD1 . ASP A 1 59  ? 4.32643   -22.39625 -21.20432 1.000 82.84698  ? 555 ASP A OD1 1 
ATOM   451  O OD2 . ASP A 1 59  ? 3.23879   -21.41730 -19.56300 1.000 86.54838  ? 555 ASP A OD2 1 
ATOM   452  N N   . CYS A 1 60  ? -1.14181  -22.93131 -21.70388 1.000 81.69955  ? 556 CYS A N   1 
ATOM   453  C CA  . CYS A 1 60  ? -2.33799  -22.67339 -22.49284 1.000 77.85564  ? 556 CYS A CA  1 
ATOM   454  C C   . CYS A 1 60  ? -3.51014  -22.21384 -21.63982 1.000 83.38386  ? 556 CYS A C   1 
ATOM   455  O O   . CYS A 1 60  ? -4.39429  -21.52452 -22.15651 1.000 79.85076  ? 556 CYS A O   1 
ATOM   456  C CB  . CYS A 1 60  ? -2.73934  -23.90357 -23.30426 1.000 69.34142  ? 556 CYS A CB  1 
ATOM   457  S SG  . CYS A 1 60  ? -1.45887  -24.59337 -24.35542 1.000 71.73169  ? 556 CYS A SG  1 
ATOM   458  N N   . ILE A 1 61  ? -3.54835  -22.58040 -20.35362 1.000 84.53801  ? 557 ILE A N   1 
ATOM   459  C CA  . ILE A 1 61  ? -4.54461  -21.99862 -19.45363 1.000 84.52387  ? 557 ILE A CA  1 
ATOM   460  C C   . ILE A 1 61  ? -4.34427  -20.48944 -19.36502 1.000 92.09095  ? 557 ILE A C   1 
ATOM   461  O O   . ILE A 1 61  ? -5.29661  -19.70846 -19.49460 1.000 93.20271  ? 557 ILE A O   1 
ATOM   462  C CB  . ILE A 1 61  ? -4.47731  -22.66431 -18.06621 1.000 80.52497  ? 557 ILE A CB  1 
ATOM   463  C CG1 . ILE A 1 61  ? -5.06142  -24.08032 -18.10835 1.000 77.05210  ? 557 ILE A CG1 1 
ATOM   464  C CG2 . ILE A 1 61  ? -5.21210  -21.83174 -17.03442 1.000 79.67562  ? 557 ILE A CG2 1 
ATOM   465  C CD1 . ILE A 1 61  ? -6.53951  -24.12817 -18.41179 1.000 79.61599  ? 557 ILE A CD1 1 
ATOM   466  N N   . GLN A 1 62  ? -3.08454  -20.06026 -19.20848 1.000 92.52517  ? 558 GLN A N   1 
ATOM   467  C CA  . GLN A 1 62  ? -2.77666  -18.63793 -19.12032 1.000 93.72674  ? 558 GLN A CA  1 
ATOM   468  C C   . GLN A 1 62  ? -3.08179  -17.91947 -20.42403 1.000 94.68065  ? 558 GLN A C   1 
ATOM   469  O O   . GLN A 1 62  ? -3.44399  -16.73872 -20.40454 1.000 98.87640  ? 558 GLN A O   1 
ATOM   470  C CB  . GLN A 1 62  ? -1.30807  -18.43573 -18.73734 1.000 98.05514  ? 558 GLN A CB  1 
ATOM   471  C CG  . GLN A 1 62  ? -0.91595  -16.97992 -18.48213 1.000 106.97445 ? 558 GLN A CG  1 
ATOM   472  C CD  . GLN A 1 62  ? -1.22272  -16.52505 -17.06088 1.000 120.38810 ? 558 GLN A CD  1 
ATOM   473  O OE1 . GLN A 1 62  ? -2.36883  -16.58635 -16.60203 1.000 124.55183 ? 558 GLN A OE1 1 
ATOM   474  N NE2 . GLN A 1 62  ? -0.19614  -16.04970 -16.36037 1.000 126.12225 ? 558 GLN A NE2 1 
ATOM   475  N N   . TYR A 1 63  ? -2.96712  -18.61506 -21.56079 1.000 92.31750  ? 559 TYR A N   1 
ATOM   476  C CA  . TYR A 1 63  ? -3.27392  -17.98768 -22.84279 1.000 88.86625  ? 559 TYR A CA  1 
ATOM   477  C C   . TYR A 1 63  ? -4.76457  -17.69755 -22.97037 1.000 90.65226  ? 559 TYR A C   1 
ATOM   478  O O   . TYR A 1 63  ? -5.15316  -16.55553 -23.23327 1.000 99.79918  ? 559 TYR A O   1 
ATOM   479  C CB  . TYR A 1 63  ? -2.78980  -18.86335 -23.99834 1.000 86.42535  ? 559 TYR A CB  1 
ATOM   480  C CG  . TYR A 1 63  ? -2.92875  -18.19382 -25.35491 1.000 85.03063  ? 559 TYR A CG  1 
ATOM   481  C CD1 . TYR A 1 63  ? -1.96979  -17.29700 -25.81146 1.000 82.93459  ? 559 TYR A CD1 1 
ATOM   482  C CD2 . TYR A 1 63  ? -4.01898  -18.46120 -26.17895 1.000 83.35357  ? 559 TYR A CD2 1 
ATOM   483  C CE1 . TYR A 1 63  ? -2.09554  -16.68670 -27.04629 1.000 80.91179  ? 559 TYR A CE1 1 
ATOM   484  C CE2 . TYR A 1 63  ? -4.15217  -17.85643 -27.41279 1.000 79.06297  ? 559 TYR A CE2 1 
ATOM   485  C CZ  . TYR A 1 63  ? -3.19189  -16.96956 -27.84110 1.000 79.35855  ? 559 TYR A CZ  1 
ATOM   486  O OH  . TYR A 1 63  ? -3.32816  -16.36757 -29.07324 1.000 81.28293  ? 559 TYR A OH  1 
ATOM   487  N N   . ILE A 1 64  ? -5.61371  -18.71445 -22.76957 1.000 88.35508  ? 560 ILE A N   1 
ATOM   488  C CA  . ILE A 1 64  ? -7.06367  -18.52418 -22.86940 1.000 89.46939  ? 560 ILE A CA  1 
ATOM   489  C C   . ILE A 1 64  ? -7.56319  -17.53986 -21.81332 1.000 96.94989  ? 560 ILE A C   1 
ATOM   490  O O   . ILE A 1 64  ? -8.48390  -16.75181 -22.07019 1.000 92.64056  ? 560 ILE A O   1 
ATOM   491  C CB  . ILE A 1 64  ? -7.79440  -19.87892 -22.77251 1.000 77.88425  ? 560 ILE A CB  1 
ATOM   492  C CG1 . ILE A 1 64  ? -7.11155  -20.92155 -23.65142 1.000 74.34665  ? 560 ILE A CG1 1 
ATOM   493  C CG2 . ILE A 1 64  ? -9.25029  -19.74335 -23.18650 1.000 79.03598  ? 560 ILE A CG2 1 
ATOM   494  C CD1 . ILE A 1 64  ? -7.82282  -22.24616 -23.67765 1.000 69.97990  ? 560 ILE A CD1 1 
ATOM   495  N N   . LYS A 1 65  ? -6.95123  -17.55619 -20.61852 1.000 103.78289 ? 561 LYS A N   1 
ATOM   496  C CA  . LYS A 1 65  ? -7.25472  -16.56479 -19.58215 1.000 110.18441 ? 561 LYS A CA  1 
ATOM   497  C C   . LYS A 1 65  ? -6.97579  -15.13586 -20.05648 1.000 109.83886 ? 561 LYS A C   1 
ATOM   498  O O   . LYS A 1 65  ? -7.63702  -14.19231 -19.60782 1.000 113.00128 ? 561 LYS A O   1 
ATOM   499  C CB  . LYS A 1 65  ? -6.44333  -16.88141 -18.31707 1.000 113.12573 ? 561 LYS A CB  1 
ATOM   500  C CG  . LYS A 1 65  ? -6.70484  -16.01313 -17.07926 1.000 122.85784 ? 561 LYS A CG  1 
ATOM   501  C CD  . LYS A 1 65  ? -5.38299  -15.42764 -16.56487 1.000 128.27403 ? 561 LYS A CD  1 
ATOM   502  C CE  . LYS A 1 65  ? -5.47269  -14.83071 -15.16193 1.000 128.97493 ? 561 LYS A CE  1 
ATOM   503  N NZ  . LYS A 1 65  ? -4.11211  -14.41963 -14.69109 1.000 128.13330 ? 561 LYS A NZ  1 
ATOM   504  N N   . GLU A 1 66  ? -6.02722  -14.96007 -20.98030 1.000 100.90323 ? 562 GLU A N   1 
ATOM   505  C CA  . GLU A 1 66  ? -5.66113  -13.64327 -21.48131 1.000 100.03852 ? 562 GLU A CA  1 
ATOM   506  C C   . GLU A 1 66  ? -6.54137  -13.15962 -22.62699 1.000 102.63967 ? 562 GLU A C   1 
ATOM   507  O O   . GLU A 1 66  ? -6.54364  -11.95681 -22.91572 1.000 106.10599 ? 562 GLU A O   1 
ATOM   508  C CB  . GLU A 1 66  ? -4.20079  -13.63992 -21.95527 1.000 98.86199  ? 562 GLU A CB  1 
ATOM   509  C CG  . GLU A 1 66  ? -3.15928  -13.56459 -20.84937 1.000 101.92619 ? 562 GLU A CG  1 
ATOM   510  C CD  . GLU A 1 66  ? -1.76691  -13.92926 -21.34163 1.000 101.78516 ? 562 GLU A CD  1 
ATOM   511  O OE1 . GLU A 1 66  ? -1.57280  -13.98881 -22.57424 1.000 102.04331 ? 562 GLU A OE1 1 
ATOM   512  O OE2 . GLU A 1 66  ? -0.87040  -14.16633 -20.50099 1.000 101.79367 ? 562 GLU A OE2 1 
ATOM   513  N N   . GLN A 1 67  ? -7.27332  -14.05207 -23.29810 1.000 100.99192 ? 563 GLN A N   1 
ATOM   514  C CA  . GLN A 1 67  ? -8.02949  -13.68274 -24.49040 1.000 103.31571 ? 563 GLN A CA  1 
ATOM   515  C C   . GLN A 1 67  ? -9.53845  -13.70827 -24.27243 1.000 111.63283 ? 563 GLN A C   1 
ATOM   516  O O   . GLN A 1 67  ? -10.28666 -13.81154 -25.25025 1.000 110.84929 ? 563 GLN A O   1 
ATOM   517  C CB  . GLN A 1 67  ? -7.67693  -14.59735 -25.66718 1.000 96.44245  ? 563 GLN A CB  1 
ATOM   518  C CG  . GLN A 1 67  ? -6.22765  -15.00585 -25.76050 1.000 92.93356  ? 563 GLN A CG  1 
ATOM   519  C CD  . GLN A 1 67  ? -5.43372  -14.14441 -26.71347 1.000 96.40358  ? 563 GLN A CD  1 
ATOM   520  O OE1 . GLN A 1 67  ? -5.99299  -13.49460 -27.59477 1.000 96.99254  ? 563 GLN A OE1 1 
ATOM   521  N NE2 . GLN A 1 67  ? -4.11824  -14.12742 -26.53710 1.000 98.96281  ? 563 GLN A NE2 1 
ATOM   522  N N   . ARG A 1 68  ? -10.00004 -13.66443 -23.01625 1.000 119.59616 ? 564 ARG A N   1 
ATOM   523  C CA  . ARG A 1 68  ? -11.40684 -13.69271 -22.59501 1.000 121.39349 ? 564 ARG A CA  1 
ATOM   524  C C   . ARG A 1 68  ? -12.11075 -15.00756 -22.95066 1.000 110.17723 ? 564 ARG A C   1 
ATOM   525  O O   . ARG A 1 68  ? -13.28520 -15.18070 -22.60114 1.000 109.20952 ? 564 ARG A O   1 
ATOM   526  C CB  . ARG A 1 68  ? -12.20505 -12.50216 -23.16826 1.000 133.16297 ? 564 ARG A CB  1 
ATOM   527  C CG  . ARG A 1 68  ? -13.46967 -12.06324 -22.41643 1.000 140.62393 ? 564 ARG A CG  1 
ATOM   528  C CD  . ARG A 1 68  ? -13.24812 -10.83065 -21.55668 1.000 148.65468 ? 564 ARG A CD  1 
ATOM   529  N NE  . ARG A 1 68  ? -13.10539 -11.17072 -20.14388 1.000 151.81268 ? 564 ARG A NE  1 
ATOM   530  C CZ  . ARG A 1 68  ? -12.40056 -10.46214 -19.26762 1.000 156.24797 ? 564 ARG A CZ  1 
ATOM   531  N NH1 . ARG A 1 68  ? -11.76446 -9.36353  -19.65456 1.000 158.89930 ? 564 ARG A NH1 1 
ATOM   532  N NH2 . ARG A 1 68  ? -12.33439 -10.85153 -18.00085 1.000 157.03248 ? 564 ARG A NH2 1 
ATOM   533  N N   . GLY A 1 69  ? -11.42741 -15.95356 -23.59529 1.000 102.02824 ? 565 GLY A N   1 
ATOM   534  C CA  . GLY A 1 69  ? -12.08620 -17.14735 -24.07835 1.000 96.42128  ? 565 GLY A CA  1 
ATOM   535  C C   . GLY A 1 69  ? -12.47014 -18.09460 -22.96132 1.000 88.61100  ? 565 GLY A C   1 
ATOM   536  O O   . GLY A 1 69  ? -11.94353 -18.03973 -21.85201 1.000 86.14679  ? 565 GLY A O   1 
ATOM   537  N N   . GLU A 1 70  ? -13.41905 -18.97526 -23.26818 1.000 97.59961  ? 566 GLU A N   1 
ATOM   538  C CA  . GLU A 1 70  ? -13.95626 -19.86782 -22.24896 1.000 108.89782 ? 566 GLU A CA  1 
ATOM   539  C C   . GLU A 1 70  ? -12.93584 -20.95342 -21.90930 1.000 102.83286 ? 566 GLU A C   1 
ATOM   540  O O   . GLU A 1 70  ? -12.22615 -21.43794 -22.79862 1.000 95.70696  ? 566 GLU A O   1 
ATOM   541  C CB  . GLU A 1 70  ? -15.27076 -20.49703 -22.71825 1.000 117.62563 ? 566 GLU A CB  1 
ATOM   542  C CG  . GLU A 1 70  ? -15.34074 -20.74593 -24.21855 1.000 121.05853 ? 566 GLU A CG  1 
ATOM   543  C CD  . GLU A 1 70  ? -16.76131 -20.74500 -24.75493 1.000 127.14549 ? 566 GLU A CD  1 
ATOM   544  O OE1 . GLU A 1 70  ? -17.06043 -21.57068 -25.64430 1.000 127.95498 ? 566 GLU A OE1 1 
ATOM   545  O OE2 . GLU A 1 70  ? -17.57935 -19.92298 -24.28747 1.000 131.29290 ? 566 GLU A OE2 1 
ATOM   546  N N   . PRO A 1 71  ? -12.82561 -21.33648 -20.63512 1.000 101.97519 ? 567 PRO A N   1 
ATOM   547  C CA  . PRO A 1 71  ? -11.78950 -22.29685 -20.23744 1.000 97.24792  ? 567 PRO A CA  1 
ATOM   548  C C   . PRO A 1 71  ? -11.99925 -23.66572 -20.86918 1.000 84.51799  ? 567 PRO A C   1 
ATOM   549  O O   . PRO A 1 71  ? -13.11519 -24.04885 -21.23149 1.000 77.16459  ? 567 PRO A O   1 
ATOM   550  C CB  . PRO A 1 71  ? -11.92894 -22.35975 -18.70976 1.000 102.81508 ? 567 PRO A CB  1 
ATOM   551  C CG  . PRO A 1 71  ? -12.62850 -21.08618 -18.33528 1.000 107.11801 ? 567 PRO A CG  1 
ATOM   552  C CD  . PRO A 1 71  ? -13.55628 -20.79959 -19.47390 1.000 106.47778 ? 567 PRO A CD  1 
ATOM   553  N N   . GLU A 1 72  ? -10.88923 -24.38469 -21.02518 1.000 78.26562  ? 568 GLU A N   1 
ATOM   554  C CA  . GLU A 1 72  ? -10.84709 -25.72185 -21.59695 1.000 73.02824  ? 568 GLU A CA  1 
ATOM   555  C C   . GLU A 1 72  ? -10.10739 -26.63030 -20.62613 1.000 66.03598  ? 568 GLU A C   1 
ATOM   556  O O   . GLU A 1 72  ? -9.44749  -26.16208 -19.69576 1.000 66.92000  ? 568 GLU A O   1 
ATOM   557  C CB  . GLU A 1 72  ? -10.15586 -25.72514 -22.97508 1.000 72.03887  ? 568 GLU A CB  1 
ATOM   558  C CG  . GLU A 1 72  ? -10.80552 -24.80216 -23.98539 1.000 68.00870  ? 568 GLU A CG  1 
ATOM   559  C CD  . GLU A 1 72  ? -11.21528 -25.51949 -25.26033 1.000 68.48788  ? 568 GLU A CD  1 
ATOM   560  O OE1 . GLU A 1 72  ? -11.61237 -26.70223 -25.18505 1.000 65.98186  ? 568 GLU A OE1 1 
ATOM   561  O OE2 . GLU A 1 72  ? -11.17602 -24.88905 -26.33931 1.000 79.33323  ? 568 GLU A OE2 1 
ATOM   562  N N   . THR A 1 73  ? -10.21011 -27.93914 -20.83658 1.000 64.22546  ? 569 THR A N   1 
ATOM   563  C CA  . THR A 1 73  ? -9.50600  -28.89569 -19.99321 1.000 67.27532  ? 569 THR A CA  1 
ATOM   564  C C   . THR A 1 73  ? -8.35109  -29.54225 -20.75149 1.000 61.50197  ? 569 THR A C   1 
ATOM   565  O O   . THR A 1 73  ? -8.44145  -29.80557 -21.95637 1.000 60.23116  ? 569 THR A O   1 
ATOM   566  C CB  . THR A 1 73  ? -10.45102 -29.97396 -19.46008 1.000 74.94830  ? 569 THR A CB  1 
ATOM   567  O OG1 . THR A 1 73  ? -10.96904 -30.74445 -20.55232 1.000 77.69804  ? 569 THR A OG1 1 
ATOM   568  C CG2 . THR A 1 73  ? -11.59934 -29.33024 -18.68639 1.000 77.21268  ? 569 THR A CG2 1 
ATOM   569  N N   . PHE A 1 74  ? -7.26808  -29.80520 -20.03817 1.000 61.02294  ? 570 PHE A N   1 
ATOM   570  C CA  . PHE A 1 74  ? -6.04594  -30.26872 -20.66460 1.000 59.81998  ? 570 PHE A CA  1 
ATOM   571  C C   . PHE A 1 74  ? -5.62453  -31.59481 -20.05845 1.000 62.80767  ? 570 PHE A C   1 
ATOM   572  O O   . PHE A 1 74  ? -5.67451  -31.78100 -18.83870 1.000 66.79913  ? 570 PHE A O   1 
ATOM   573  C CB  . PHE A 1 74  ? -4.94277  -29.22689 -20.52074 1.000 67.36374  ? 570 PHE A CB  1 
ATOM   574  C CG  . PHE A 1 74  ? -5.18989  -27.98930 -21.33421 1.000 73.85949  ? 570 PHE A CG  1 
ATOM   575  C CD1 . PHE A 1 74  ? -4.65822  -27.86357 -22.61074 1.000 68.15899  ? 570 PHE A CD1 1 
ATOM   576  C CD2 . PHE A 1 74  ? -5.98771  -26.96441 -20.83476 1.000 76.15790  ? 570 PHE A CD2 1 
ATOM   577  C CE1 . PHE A 1 74  ? -4.90631  -26.73686 -23.36288 1.000 69.03848  ? 570 PHE A CE1 1 
ATOM   578  C CE2 . PHE A 1 74  ? -6.23628  -25.83584 -21.57983 1.000 75.68046  ? 570 PHE A CE2 1 
ATOM   579  C CZ  . PHE A 1 74  ? -5.69745  -25.71926 -22.84690 1.000 71.89358  ? 570 PHE A CZ  1 
ATOM   580  N N   . LEU A 1 75  ? -5.24492  -32.52014 -20.93120 1.000 60.12620  ? 571 LEU A N   1 
ATOM   581  C CA  . LEU A 1 75  ? -4.72523  -33.82129 -20.53917 1.000 57.23372  ? 571 LEU A CA  1 
ATOM   582  C C   . LEU A 1 75  ? -3.23615  -33.83454 -20.81837 1.000 66.55792  ? 571 LEU A C   1 
ATOM   583  O O   . LEU A 1 75  ? -2.82618  -34.06883 -21.96755 1.000 56.74484  ? 571 LEU A O   1 
ATOM   584  C CB  . LEU A 1 75  ? -5.42196  -34.93773 -21.31544 1.000 56.01285  ? 571 LEU A CB  1 
ATOM   585  C CG  . LEU A 1 75  ? -6.18354  -35.93108 -20.44914 1.000 61.08568  ? 571 LEU A CG  1 
ATOM   586  C CD1 . LEU A 1 75  ? -6.61541  -37.12993 -21.27201 1.000 55.20890  ? 571 LEU A CD1 1 
ATOM   587  C CD2 . LEU A 1 75  ? -5.30680  -36.34692 -19.29807 1.000 57.18475  ? 571 LEU A CD2 1 
ATOM   588  N N   . PRO A 1 76  ? -2.39024  -33.55720 -19.82542 1.000 63.87339  ? 572 PRO A N   1 
ATOM   589  C CA  . PRO A 1 76  ? -0.94304  -33.69108 -20.03146 1.000 61.22237  ? 572 PRO A CA  1 
ATOM   590  C C   . PRO A 1 76  ? -0.57300  -35.15832 -20.17588 1.000 63.55550  ? 572 PRO A C   1 
ATOM   591  O O   . PRO A 1 76  ? -1.02044  -36.00790 -19.39934 1.000 68.24805  ? 572 PRO A O   1 
ATOM   592  C CB  . PRO A 1 76  ? -0.34130  -33.07547 -18.76572 1.000 65.04805  ? 572 PRO A CB  1 
ATOM   593  C CG  . PRO A 1 76  ? -1.48293  -32.30067 -18.12705 1.000 68.54087  ? 572 PRO A CG  1 
ATOM   594  C CD  . PRO A 1 76  ? -2.71100  -33.05903 -18.47961 1.000 62.45158  ? 572 PRO A CD  1 
ATOM   595  N N   . LEU A 1 77  ? 0.22936   -35.45551 -21.19330 1.000 63.76293  ? 573 LEU A N   1 
ATOM   596  C CA  . LEU A 1 77  ? 0.50210   -36.84162 -21.53768 1.000 58.58909  ? 573 LEU A CA  1 
ATOM   597  C C   . LEU A 1 77  ? 1.62833   -37.42547 -20.69869 1.000 64.02512  ? 573 LEU A C   1 
ATOM   598  O O   . LEU A 1 77  ? 1.45132   -38.50050 -20.13733 1.000 72.34457  ? 573 LEU A O   1 
ATOM   599  C CB  . LEU A 1 77  ? 0.83288   -36.95010 -23.03422 1.000 64.65164  ? 573 LEU A CB  1 
ATOM   600  C CG  . LEU A 1 77  ? 0.30688   -38.11818 -23.86774 1.000 67.59933  ? 573 LEU A CG  1 
ATOM   601  C CD1 . LEU A 1 77  ? -1.19667  -38.24378 -23.68601 1.000 55.82950  ? 573 LEU A CD1 1 
ATOM   602  C CD2 . LEU A 1 77  ? 0.63906   -37.90518 -25.33256 1.000 57.22028  ? 573 LEU A CD2 1 
ATOM   603  N N   . ASP A 1 78  ? 2.73917   -36.69078 -20.53241 1.000 66.09821  ? 574 ASP A N   1 
ATOM   604  C CA  . ASP A 1 78  ? 4.02139   -37.22422 -20.06482 1.000 77.75456  ? 574 ASP A CA  1 
ATOM   605  C C   . ASP A 1 78  ? 3.93864   -38.01941 -18.77125 1.000 80.80112  ? 574 ASP A C   1 
ATOM   606  O O   . ASP A 1 78  ? 4.63712   -39.03261 -18.64391 1.000 90.47480  ? 574 ASP A O   1 
ATOM   607  C CB  . ASP A 1 78  ? 5.02439   -36.09550 -19.89797 1.000 77.89802  ? 574 ASP A CB  1 
ATOM   608  C CG  . ASP A 1 78  ? 5.60122   -35.65002 -21.21576 1.000 92.45400  ? 574 ASP A CG  1 
ATOM   609  O OD1 . ASP A 1 78  ? 5.20345   -36.23354 -22.23626 1.000 97.13293  ? 574 ASP A OD1 1 
ATOM   610  O OD2 . ASP A 1 78  ? 6.43913   -34.71476 -21.23465 1.000 108.47635 ? 574 ASP A OD2 1 
ATOM   611  N N   . TYR A 1 79  ? 3.10321   -37.62055 -17.82078 1.000 73.21723  ? 575 TYR A N   1 
ATOM   612  C CA  . TYR A 1 79  ? 3.01955   -38.36868 -16.57152 1.000 74.49513  ? 575 TYR A CA  1 
ATOM   613  C C   . TYR A 1 79  ? 1.59685   -38.82608 -16.29954 1.000 76.43697  ? 575 TYR A C   1 
ATOM   614  O O   . TYR A 1 79  ? 1.09928   -38.76821 -15.17094 1.000 73.40981  ? 575 TYR A O   1 
ATOM   615  C CB  . TYR A 1 79  ? 3.59283   -37.55229 -15.42046 1.000 73.18684  ? 575 TYR A CB  1 
ATOM   616  C CG  . TYR A 1 79  ? 5.09555   -37.60986 -15.46457 1.000 78.18647  ? 575 TYR A CG  1 
ATOM   617  C CD1 . TYR A 1 79  ? 5.76161   -38.83086 -15.34590 1.000 77.65968  ? 575 TYR A CD1 1 
ATOM   618  C CD2 . TYR A 1 79  ? 5.85218   -36.46268 -15.71015 1.000 73.75130  ? 575 TYR A CD2 1 
ATOM   619  C CE1 . TYR A 1 79  ? 7.14948   -38.90281 -15.41742 1.000 85.25660  ? 575 TYR A CE1 1 
ATOM   620  C CE2 . TYR A 1 79  ? 7.23836   -36.52420 -15.78346 1.000 76.51970  ? 575 TYR A CE2 1 
ATOM   621  C CZ  . TYR A 1 79  ? 7.88152   -37.74746 -15.63771 1.000 88.65426  ? 575 TYR A CZ  1 
ATOM   622  O OH  . TYR A 1 79  ? 9.25576   -37.81885 -15.70918 1.000 93.44700  ? 575 TYR A OH  1 
ATOM   623  N N   . LEU A 1 80  ? 0.93879   -39.31391 -17.34469 1.000 71.19928  ? 576 LEU A N   1 
ATOM   624  C CA  . LEU A 1 80  ? -0.41331  -39.82539 -17.20865 1.000 71.61111  ? 576 LEU A CA  1 
ATOM   625  C C   . LEU A 1 80  ? -0.40890  -41.12463 -16.40694 1.000 78.33484  ? 576 LEU A C   1 
ATOM   626  O O   . LEU A 1 80  ? 0.29965   -42.07892 -16.75239 1.000 74.48867  ? 576 LEU A O   1 
ATOM   627  C CB  . LEU A 1 80  ? -1.03461  -40.03829 -18.58655 1.000 60.94352  ? 576 LEU A CB  1 
ATOM   628  C CG  . LEU A 1 80  ? -2.53890  -39.78184 -18.67581 1.000 58.35822  ? 576 LEU A CG  1 
ATOM   629  C CD1 . LEU A 1 80  ? -2.93706  -38.62424 -17.77900 1.000 59.15979  ? 576 LEU A CD1 1 
ATOM   630  C CD2 . LEU A 1 80  ? -2.94274  -39.50764 -20.12049 1.000 56.68496  ? 576 LEU A CD2 1 
ATOM   631  N N   . GLU A 1 81  ? -1.17740  -41.14030 -15.31605 1.000 77.46879  ? 577 GLU A N   1 
ATOM   632  C CA  . GLU A 1 81  ? -1.47020  -42.37019 -14.59583 1.000 84.38491  ? 577 GLU A CA  1 
ATOM   633  C C   . GLU A 1 81  ? -2.20534  -43.31920 -15.52267 1.000 76.49273  ? 577 GLU A C   1 
ATOM   634  O O   . GLU A 1 81  ? -3.41277  -43.16363 -15.73213 1.000 70.98565  ? 577 GLU A O   1 
ATOM   635  C CB  . GLU A 1 81  ? -2.34148  -42.09732 -13.36981 1.000 98.12481  ? 577 GLU A CB  1 
ATOM   636  C CG  . GLU A 1 81  ? -1.76201  -41.15380 -12.34981 1.000 110.40239 ? 577 GLU A CG  1 
ATOM   637  C CD  . GLU A 1 81  ? -1.53464  -41.84492 -11.03078 1.000 117.96210 ? 577 GLU A CD  1 
ATOM   638  O OE1 . GLU A 1 81  ? -1.81167  -43.06066 -10.95003 1.000 121.54301 ? 577 GLU A OE1 1 
ATOM   639  O OE2 . GLU A 1 81  ? -1.10859  -41.17323 -10.07073 1.000 126.70222 ? 577 GLU A OE2 1 
ATOM   640  N N   . VAL A 1 82  ? -1.51081  -44.29176 -16.09669 1.000 63.89328  ? 578 VAL A N   1 
ATOM   641  C CA  . VAL A 1 82  ? -2.18965  -45.20462 -17.00463 1.000 62.48201  ? 578 VAL A CA  1 
ATOM   642  C C   . VAL A 1 82  ? -1.53466  -46.57322 -16.91845 1.000 75.59687  ? 578 VAL A C   1 
ATOM   643  O O   . VAL A 1 82  ? -0.30907  -46.68676 -16.82071 1.000 86.28015  ? 578 VAL A O   1 
ATOM   644  C CB  . VAL A 1 82  ? -2.22155  -44.63997 -18.44168 1.000 67.87927  ? 578 VAL A CB  1 
ATOM   645  C CG1 . VAL A 1 82  ? -0.85716  -44.58494 -19.05779 1.000 74.29657  ? 578 VAL A CG1 1 
ATOM   646  C CG2 . VAL A 1 82  ? -3.13994  -45.44820 -19.29273 1.000 78.36290  ? 578 VAL A CG2 1 
ATOM   647  N N   . LYS A 1 83  ? -2.37639  -47.61993 -16.87814 1.000 69.75124  ? 579 LYS A N   1 
ATOM   648  C CA  . LYS A 1 83  ? -2.19325  -49.06192 -16.86446 1.000 78.13809  ? 579 LYS A CA  1 
ATOM   649  C C   . LYS A 1 83  ? -2.16245  -49.59472 -18.29564 1.000 80.10955  ? 579 LYS A C   1 
ATOM   650  O O   . LYS A 1 83  ? -2.79693  -49.02542 -19.18840 1.000 81.38803  ? 579 LYS A O   1 
ATOM   651  C CB  . LYS A 1 83  ? -3.32580  -49.72885 -16.08315 1.000 87.25953  ? 579 LYS A CB  1 
ATOM   652  C CG  . LYS A 1 83  ? -3.23452  -49.55598 -14.56340 1.000 102.21197 ? 579 LYS A CG  1 
ATOM   653  C CD  . LYS A 1 83  ? -4.05544  -48.35163 -14.08486 1.000 109.29522 ? 579 LYS A CD  1 
ATOM   654  C CE  . LYS A 1 83  ? -3.78426  -48.01558 -12.61900 1.000 110.19467 ? 579 LYS A CE  1 
ATOM   655  N NZ  . LYS A 1 83  ? -4.62096  -46.87277 -12.13663 1.000 105.29274 ? 579 LYS A NZ  1 
ATOM   656  N N   . PRO A 1 84  ? -1.43837  -50.67196 -18.58362 1.000 83.38065  ? 580 PRO A N   1 
ATOM   657  C CA  . PRO A 1 84  ? -1.38392  -51.15372 -19.96568 1.000 80.04765  ? 580 PRO A CA  1 
ATOM   658  C C   . PRO A 1 84  ? -2.62800  -51.95343 -20.31188 1.000 76.45667  ? 580 PRO A C   1 
ATOM   659  O O   . PRO A 1 84  ? -3.28641  -52.53618 -19.44552 1.000 79.03273  ? 580 PRO A O   1 
ATOM   660  C CB  . PRO A 1 84  ? -0.12681  -52.03583 -19.99451 1.000 85.09136  ? 580 PRO A CB  1 
ATOM   661  C CG  . PRO A 1 84  ? 0.32411   -52.18077 -18.54675 1.000 90.89000  ? 580 PRO A CG  1 
ATOM   662  C CD  . PRO A 1 84  ? -0.72979  -51.58347 -17.66746 1.000 88.59906  ? 580 PRO A CD  1 
ATOM   663  N N   . THR A 1 85  ? -2.94980  -51.95916 -21.60381 1.000 67.88760  ? 581 THR A N   1 
ATOM   664  C CA  . THR A 1 85  ? -4.18598  -52.57269 -22.06565 1.000 66.74231  ? 581 THR A CA  1 
ATOM   665  C C   . THR A 1 85  ? -4.11148  -54.08467 -21.90914 1.000 74.29705  ? 581 THR A C   1 
ATOM   666  O O   . THR A 1 85  ? -3.12717  -54.71262 -22.30964 1.000 72.32928  ? 581 THR A O   1 
ATOM   667  C CB  . THR A 1 85  ? -4.45155  -52.20464 -23.52131 1.000 64.66085  ? 581 THR A CB  1 
ATOM   668  O OG1 . THR A 1 85  ? -4.38559  -50.77873 -23.67439 1.000 65.79558  ? 581 THR A OG1 1 
ATOM   669  C CG2 . THR A 1 85  ? -5.83346  -52.69231 -23.94015 1.000 66.37173  ? 581 THR A CG2 1 
ATOM   670  N N   . ASP A 1 86  ? -5.14947  -54.66727 -21.31150 1.000 76.56745  ? 582 ASP A N   1 
ATOM   671  C CA  . ASP A 1 86  ? -5.15151  -56.09684 -21.03264 1.000 75.75542  ? 582 ASP A CA  1 
ATOM   672  C C   . ASP A 1 86  ? -5.34266  -56.87572 -22.32715 1.000 84.25290  ? 582 ASP A C   1 
ATOM   673  O O   . ASP A 1 86  ? -6.43709  -56.90932 -22.89773 1.000 88.53578  ? 582 ASP A O   1 
ATOM   674  C CB  . ASP A 1 86  ? -6.22634  -56.45146 -20.01688 1.000 69.48919  ? 582 ASP A CB  1 
ATOM   675  C CG  . ASP A 1 86  ? -5.99571  -57.80535 -19.40685 1.000 76.58722  ? 582 ASP A CG  1 
ATOM   676  O OD1 . ASP A 1 86  ? -4.94123  -58.39638 -19.70376 1.000 82.14116  ? 582 ASP A OD1 1 
ATOM   677  O OD2 . ASP A 1 86  ? -6.84587  -58.27911 -18.62543 1.000 85.99492  ? 582 ASP A OD2 1 
ATOM   678  N N   . GLU A 1 87  ? -4.26567  -57.52805 -22.75496 1.000 85.43596  ? 583 GLU A N   1 
ATOM   679  C CA  . GLU A 1 87  ? -4.21169  -58.23043 -24.03044 1.000 85.50215  ? 583 GLU A CA  1 
ATOM   680  C C   . GLU A 1 87  ? -5.15339  -59.42650 -24.05267 1.000 76.38909  ? 583 GLU A C   1 
ATOM   681  O O   . GLU A 1 87  ? -5.78560  -59.70393 -25.07963 1.000 68.29992  ? 583 GLU A O   1 
ATOM   682  C CB  . GLU A 1 87  ? -2.77042  -58.68516 -24.30584 1.000 98.27508  ? 583 GLU A CB  1 
ATOM   683  C CG  . GLU A 1 87  ? -1.64366  -57.77814 -23.73955 1.000 105.08682 ? 583 GLU A CG  1 
ATOM   684  C CD  . GLU A 1 87  ? -1.35100  -57.97723 -22.23860 1.000 112.21919 ? 583 GLU A CD  1 
ATOM   685  O OE1 . GLU A 1 87  ? -1.59339  -59.08604 -21.71423 1.000 115.61319 ? 583 GLU A OE1 1 
ATOM   686  O OE2 . GLU A 1 87  ? -0.89293  -57.01315 -21.58461 1.000 114.19695 ? 583 GLU A OE2 1 
ATOM   687  N N   . LYS A 1 88  ? -5.26294  -60.13760 -22.92444 1.000 78.77009  ? 584 LYS A N   1 
ATOM   688  C CA  . LYS A 1 88  ? -6.01789  -61.38661 -22.86280 1.000 84.55037  ? 584 LYS A CA  1 
ATOM   689  C C   . LYS A 1 88  ? -7.50687  -61.18696 -23.13483 1.000 81.81897  ? 584 LYS A C   1 
ATOM   690  O O   . LYS A 1 88  ? -8.17994  -62.13396 -23.55801 1.000 85.95250  ? 584 LYS A O   1 
ATOM   691  C CB  . LYS A 1 88  ? -5.80651  -62.05812 -21.49407 1.000 91.50401  ? 584 LYS A CB  1 
ATOM   692  C CG  . LYS A 1 88  ? -6.33220  -61.24142 -20.30824 1.000 98.40732  ? 584 LYS A CG  1 
ATOM   693  C CD  . LYS A 1 88  ? -6.53811  -62.07187 -19.03776 1.000 103.25908 ? 584 LYS A CD  1 
ATOM   694  C CE  . LYS A 1 88  ? -7.54091  -61.39366 -18.08814 1.000 94.79906  ? 584 LYS A CE  1 
ATOM   695  N NZ  . LYS A 1 88  ? -8.91245  -62.00198 -18.11939 1.000 85.35959  ? 584 LYS A NZ  1 
ATOM   696  N N   . LEU A 1 89  ? -8.02582  -59.97053 -22.94684 1.000 69.86370  ? 585 LEU A N   1 
ATOM   697  C CA  . LEU A 1 89  ? -9.44253  -59.70697 -23.15707 1.000 65.27051  ? 585 LEU A CA  1 
ATOM   698  C C   . LEU A 1 89  ? -9.85507  -59.77826 -24.62449 1.000 70.31095  ? 585 LEU A C   1 
ATOM   699  O O   . LEU A 1 89  ? -11.05767 -59.84289 -24.90420 1.000 64.70583  ? 585 LEU A O   1 
ATOM   700  C CB  . LEU A 1 89  ? -9.80306  -58.33731 -22.58110 1.000 60.70396  ? 585 LEU A CB  1 
ATOM   701  C CG  . LEU A 1 89  ? -9.53003  -58.16186 -21.08143 1.000 65.96529  ? 585 LEU A CG  1 
ATOM   702  C CD1 . LEU A 1 89  ? -9.84035  -56.74452 -20.62766 1.000 62.41134  ? 585 LEU A CD1 1 
ATOM   703  C CD2 . LEU A 1 89  ? -10.31422 -59.16935 -20.25424 1.000 68.29059  ? 585 LEU A CD2 1 
ATOM   704  N N   . ARG A 1 90  ? -8.90372  -59.78239 -25.56634 1.000 74.87427  ? 586 ARG A N   1 
ATOM   705  C CA  . ARG A 1 90  ? -9.26210  -59.92776 -26.97571 1.000 76.20539  ? 586 ARG A CA  1 
ATOM   706  C C   . ARG A 1 90  ? -9.80798  -61.31588 -27.29426 1.000 78.34045  ? 586 ARG A C   1 
ATOM   707  O O   . ARG A 1 90  ? -10.50401 -61.47806 -28.30340 1.000 75.73840  ? 586 ARG A O   1 
ATOM   708  C CB  . ARG A 1 90  ? -8.05539  -59.62594 -27.86598 1.000 79.26588  ? 586 ARG A CB  1 
ATOM   709  C CG  . ARG A 1 90  ? -7.48265  -58.22862 -27.68878 1.000 74.94546  ? 586 ARG A CG  1 
ATOM   710  C CD  . ARG A 1 90  ? -6.59108  -57.82294 -28.87067 1.000 74.32692  ? 586 ARG A CD  1 
ATOM   711  N NE  . ARG A 1 90  ? -6.28138  -56.39650 -28.83481 1.000 65.20733  ? 586 ARG A NE  1 
ATOM   712  C CZ  . ARG A 1 90  ? -5.07770  -55.88527 -28.59747 1.000 70.73788  ? 586 ARG A CZ  1 
ATOM   713  N NH1 . ARG A 1 90  ? -4.03328  -56.68400 -28.39014 1.000 80.49657  ? 586 ARG A NH1 1 
ATOM   714  N NH2 . ARG A 1 90  ? -4.92040  -54.56487 -28.57192 1.000 68.86462  ? 586 ARG A NH2 1 
ATOM   715  N N   . GLU A 1 91  ? -9.51809  -62.31082 -26.45462 1.000 83.18940  ? 587 GLU A N   1 
ATOM   716  C CA  . GLU A 1 91  ? -10.04202 -63.66004 -26.61408 1.000 86.86759  ? 587 GLU A CA  1 
ATOM   717  C C   . GLU A 1 91  ? -11.42757 -63.83606 -26.00750 1.000 83.54663  ? 587 GLU A C   1 
ATOM   718  O O   . GLU A 1 91  ? -11.94571 -64.95835 -25.98977 1.000 87.03482  ? 587 GLU A O   1 
ATOM   719  C CB  . GLU A 1 91  ? -9.07705  -64.67239 -25.99334 1.000 92.15270  ? 587 GLU A CB  1 
ATOM   720  C CG  . GLU A 1 91  ? -7.88151  -64.98365 -26.87154 1.000 102.07878 ? 587 GLU A CG  1 
ATOM   721  C CD  . GLU A 1 91  ? -6.56864  -64.76101 -26.15540 1.000 110.53506 ? 587 GLU A CD  1 
ATOM   722  O OE1 . GLU A 1 91  ? -6.49454  -65.09104 -24.95217 1.000 115.28280 ? 587 GLU A OE1 1 
ATOM   723  O OE2 . GLU A 1 91  ? -5.61355  -64.26400 -26.79272 1.000 112.40524 ? 587 GLU A OE2 1 
ATOM   724  N N   . LEU A 1 92  ? -12.03777 -62.76523 -25.51401 1.000 72.98682  ? 588 LEU A N   1 
ATOM   725  C CA  . LEU A 1 92  ? -13.36086 -62.85410 -24.91295 1.000 63.65127  ? 588 LEU A CA  1 
ATOM   726  C C   . LEU A 1 92  ? -14.41016 -62.86013 -26.01545 1.000 65.83524  ? 588 LEU A C   1 
ATOM   727  O O   . LEU A 1 92  ? -14.49431 -61.91301 -26.80676 1.000 56.20659  ? 588 LEU A O   1 
ATOM   728  C CB  . LEU A 1 92  ? -13.57988 -61.68784 -23.95528 1.000 57.15377  ? 588 LEU A CB  1 
ATOM   729  C CG  . LEU A 1 92  ? -14.21619 -61.95622 -22.59550 1.000 56.91138  ? 588 LEU A CG  1 
ATOM   730  C CD1 . LEU A 1 92  ? -13.77026 -63.29592 -22.03702 1.000 55.36241  ? 588 LEU A CD1 1 
ATOM   731  C CD2 . LEU A 1 92  ? -13.81982 -60.83053 -21.64970 1.000 50.03624  ? 588 LEU A CD2 1 
ATOM   732  N N   . LYS A 1 93  ? -15.19407 -63.93342 -26.07784 1.000 79.92263  ? 589 LYS A N   1 
ATOM   733  C CA  . LYS A 1 93  ? -16.23230 -64.04357 -27.09162 1.000 81.94056  ? 589 LYS A CA  1 
ATOM   734  C C   . LYS A 1 93  ? -17.34026 -63.03334 -26.81992 1.000 72.66551  ? 589 LYS A C   1 
ATOM   735  O O   . LYS A 1 93  ? -17.76087 -62.83576 -25.67526 1.000 72.18744  ? 589 LYS A O   1 
ATOM   736  C CB  . LYS A 1 93  ? -16.79716 -65.46908 -27.12973 1.000 94.95697  ? 589 LYS A CB  1 
ATOM   737  C CG  . LYS A 1 93  ? -17.37144 -65.96937 -25.79902 1.000 103.97737 ? 589 LYS A CG  1 
ATOM   738  C CD  . LYS A 1 93  ? -18.10839 -67.30192 -25.93599 1.000 107.40520 ? 589 LYS A CD  1 
ATOM   739  C CE  . LYS A 1 93  ? -19.12933 -67.48308 -24.80656 1.000 102.52901 ? 589 LYS A CE  1 
ATOM   740  N NZ  . LYS A 1 93  ? -19.11154 -68.84283 -24.18587 1.000 102.17627 ? 589 LYS A NZ  1 
ATOM   741  N N   . GLY A 1 94  ? -17.79457 -62.37405 -27.88373 1.000 66.50689  ? 590 GLY A N   1 
ATOM   742  C CA  . GLY A 1 94  ? -18.83888 -61.37888 -27.79276 1.000 62.26830  ? 590 GLY A CA  1 
ATOM   743  C C   . GLY A 1 94  ? -18.36088 -59.95219 -27.62630 1.000 59.06503  ? 590 GLY A C   1 
ATOM   744  O O   . GLY A 1 94  ? -19.16864 -59.02650 -27.78108 1.000 55.47195  ? 590 GLY A O   1 
ATOM   745  N N   . ALA A 1 95  ? -17.07805 -59.73833 -27.33116 1.000 58.76263  ? 591 ALA A N   1 
ATOM   746  C CA  . ALA A 1 95  ? -16.58970 -58.41695 -26.96728 1.000 55.64567  ? 591 ALA A CA  1 
ATOM   747  C C   . ALA A 1 95  ? -15.27404 -58.11258 -27.66472 1.000 56.56849  ? 591 ALA A C   1 
ATOM   748  O O   . ALA A 1 95  ? -14.44066 -58.99750 -27.87224 1.000 64.02682  ? 591 ALA A O   1 
ATOM   749  C CB  . ALA A 1 95  ? -16.38606 -58.29723 -25.45680 1.000 52.11675  ? 591 ALA A CB  1 
ATOM   750  N N   . LYS A 1 96  ? -15.09263 -56.84443 -28.01764 1.000 53.53812  ? 592 LYS A N   1 
ATOM   751  C CA  . LYS A 1 96  ? -13.77564 -56.32725 -28.34521 1.000 61.13539  ? 592 LYS A CA  1 
ATOM   752  C C   . LYS A 1 96  ? -13.49475 -55.10679 -27.47752 1.000 59.65948  ? 592 LYS A C   1 
ATOM   753  O O   . LYS A 1 96  ? -14.40495 -54.50526 -26.89596 1.000 59.87190  ? 592 LYS A O   1 
ATOM   754  C CB  . LYS A 1 96  ? -13.62369 -55.98669 -29.83773 1.000 67.58280  ? 592 LYS A CB  1 
ATOM   755  C CG  . LYS A 1 96  ? -14.83358 -55.39119 -30.51049 1.000 68.40340  ? 592 LYS A CG  1 
ATOM   756  C CD  . LYS A 1 96  ? -14.67311 -55.42260 -32.03481 1.000 70.01260  ? 592 LYS A CD  1 
ATOM   757  C CE  . LYS A 1 96  ? -14.78857 -56.84427 -32.58314 1.000 73.23275  ? 592 LYS A CE  1 
ATOM   758  N NZ  . LYS A 1 96  ? -14.80624 -56.89533 -34.08175 1.000 75.45419  ? 592 LYS A NZ  1 
ATOM   759  N N   . LEU A 1 97  ? -12.20764 -54.78071 -27.36908 1.000 52.21255  ? 593 LEU A N   1 
ATOM   760  C CA  . LEU A 1 97  ? -11.76545 -53.66111 -26.55309 1.000 47.54002  ? 593 LEU A CA  1 
ATOM   761  C C   . LEU A 1 97  ? -12.21484 -52.34870 -27.16806 1.000 47.04791  ? 593 LEU A C   1 
ATOM   762  O O   . LEU A 1 97  ? -12.24725 -52.19992 -28.39117 1.000 57.23299  ? 593 LEU A O   1 
ATOM   763  C CB  . LEU A 1 97  ? -10.24347 -53.66819 -26.42293 1.000 50.67552  ? 593 LEU A CB  1 
ATOM   764  C CG  . LEU A 1 97  ? -9.71708  -54.57611 -25.30804 1.000 53.60232  ? 593 LEU A CG  1 
ATOM   765  C CD1 . LEU A 1 97  ? -8.27471  -54.97280 -25.58883 1.000 52.47670  ? 593 LEU A CD1 1 
ATOM   766  C CD2 . LEU A 1 97  ? -9.85668  -53.92555 -23.91968 1.000 47.52787  ? 593 LEU A CD2 1 
ATOM   767  N N   . VAL A 1 98  ? -12.56268 -51.39153 -26.31141 1.000 43.36179  ? 594 VAL A N   1 
ATOM   768  C CA  . VAL A 1 98  ? -13.01700 -50.10471 -26.81498 1.000 42.42620  ? 594 VAL A CA  1 
ATOM   769  C C   . VAL A 1 98  ? -11.87175 -49.37799 -27.49719 1.000 46.54542  ? 594 VAL A C   1 
ATOM   770  O O   . VAL A 1 98  ? -12.05321 -48.78695 -28.57246 1.000 53.38649  ? 594 VAL A O   1 
ATOM   771  C CB  . VAL A 1 98  ? -13.64439 -49.27778 -25.67934 1.000 49.10702  ? 594 VAL A CB  1 
ATOM   772  C CG1 . VAL A 1 98  ? -13.75122 -47.80488 -26.06751 1.000 40.49570  ? 594 VAL A CG1 1 
ATOM   773  C CG2 . VAL A 1 98  ? -15.02459 -49.84585 -25.32822 1.000 46.26241  ? 594 VAL A CG2 1 
ATOM   774  N N   . ILE A 1 99  ? -10.65854 -49.47884 -26.93772 1.000 50.37596  ? 595 ILE A N   1 
ATOM   775  C CA  . ILE A 1 99  ? -9.50869  -48.85396 -27.59334 1.000 53.48149  ? 595 ILE A CA  1 
ATOM   776  C C   . ILE A 1 99  ? -9.22486  -49.50959 -28.95307 1.000 61.69916  ? 595 ILE A C   1 
ATOM   777  O O   . ILE A 1 99  ? -8.86789  -48.81593 -29.91753 1.000 51.41751  ? 595 ILE A O   1 
ATOM   778  C CB  . ILE A 1 99  ? -8.26972  -48.85102 -26.66853 1.000 47.89752  ? 595 ILE A CB  1 
ATOM   779  C CG1 . ILE A 1 99  ? -7.16406  -47.99113 -27.29047 1.000 48.98311  ? 595 ILE A CG1 1 
ATOM   780  C CG2 . ILE A 1 99  ? -7.76908  -50.25887 -26.38550 1.000 48.17678  ? 595 ILE A CG2 1 
ATOM   781  C CD1 . ILE A 1 99  ? -5.97358  -47.71839 -26.39517 1.000 48.72709  ? 595 ILE A CD1 1 
ATOM   782  N N   . ASP A 1 100 ? -9.49368  -50.81954 -29.09864 1.000 62.58003  ? 596 ASP A N   1 
ATOM   783  C CA  . ASP A 1 100 ? -9.24403  -51.55720 -30.34027 1.000 62.64023  ? 596 ASP A CA  1 
ATOM   784  C C   . ASP A 1 100 ? -10.23234 -51.22541 -31.46885 1.000 64.44675  ? 596 ASP A C   1 
ATOM   785  O O   . ASP A 1 100 ? -10.35235 -52.00849 -32.42072 1.000 72.50918  ? 596 ASP A O   1 
ATOM   786  C CB  . ASP A 1 100 ? -9.28251  -53.06490 -30.07929 1.000 62.36390  ? 596 ASP A CB  1 
ATOM   787  C CG  . ASP A 1 100 ? -8.01135  -53.58583 -29.43561 1.000 70.32482  ? 596 ASP A CG  1 
ATOM   788  O OD1 . ASP A 1 100 ? -7.02843  -52.81979 -29.31896 1.000 74.34342  ? 596 ASP A OD1 1 
ATOM   789  O OD2 . ASP A 1 100 ? -7.98982  -54.77928 -29.06425 1.000 70.42434  ? 596 ASP A OD2 1 
ATOM   790  N N   . VAL A 1 101 ? -10.89908 -50.07604 -31.40511 1.000 57.03429  ? 597 VAL A N   1 
ATOM   791  C CA  . VAL A 1 101 ? -12.10069 -49.76292 -32.17314 1.000 56.12717  ? 597 VAL A CA  1 
ATOM   792  C C   . VAL A 1 101 ? -12.05773 -48.25152 -32.38973 1.000 57.21603  ? 597 VAL A C   1 
ATOM   793  O O   . VAL A 1 101 ? -12.90687 -47.65049 -33.06555 1.000 60.87282  ? 597 VAL A O   1 
ATOM   794  C CB  . VAL A 1 101 ? -13.33863 -50.33432 -31.42689 1.000 60.79649  ? 597 VAL A CB  1 
ATOM   795  C CG1 . VAL A 1 101 ? -14.67608 -49.60603 -31.63809 1.000 53.91051  ? 597 VAL A CG1 1 
ATOM   796  C CG2 . VAL A 1 101 ? -13.50207 -51.80290 -31.80633 1.000 67.60584  ? 597 VAL A CG2 1 
ATOM   797  N N   . ILE A 1 102 ? -10.98513 -47.64292 -31.89510 1.000 53.81876  ? 598 ILE A N   1 
ATOM   798  C CA  . ILE A 1 102 ? -10.64670 -46.26488 -32.21208 1.000 63.41375  ? 598 ILE A CA  1 
ATOM   799  C C   . ILE A 1 102 ? -9.33880  -46.24589 -33.00504 1.000 69.49117  ? 598 ILE A C   1 
ATOM   800  O O   . ILE A 1 102 ? -8.39733  -46.98675 -32.68975 1.000 70.45442  ? 598 ILE A O   1 
ATOM   801  C CB  . ILE A 1 102 ? -10.55579 -45.42522 -30.92290 1.000 52.99553  ? 598 ILE A CB  1 
ATOM   802  C CG1 . ILE A 1 102 ? -11.75050 -45.74214 -30.01007 1.000 51.58115  ? 598 ILE A CG1 1 
ATOM   803  C CG2 . ILE A 1 102 ? -10.51800 -43.95208 -31.25252 1.000 54.14624  ? 598 ILE A CG2 1 
ATOM   804  C CD1 . ILE A 1 102 ? -11.75584 -45.01270 -28.66071 1.000 49.99494  ? 598 ILE A CD1 1 
ATOM   805  N N   . ARG A 1 103 ? -9.29726  -45.43206 -34.06245 1.000 58.01219  ? 599 ARG A N   1 
ATOM   806  C CA  . ARG A 1 103 ? -8.05288  -45.08877 -34.74891 1.000 59.60122  ? 599 ARG A CA  1 
ATOM   807  C C   . ARG A 1 103 ? -7.66605  -43.67023 -34.35755 1.000 60.48472  ? 599 ARG A C   1 
ATOM   808  O O   . ARG A 1 103 ? -8.54136  -42.82285 -34.21382 1.000 59.90819  ? 599 ARG A O   1 
ATOM   809  C CB  . ARG A 1 103 ? -8.19317  -45.17544 -36.27480 1.000 68.33943  ? 599 ARG A CB  1 
ATOM   810  C CG  . ARG A 1 103 ? -8.57443  -46.53707 -36.82964 1.000 76.07075  ? 599 ARG A CG  1 
ATOM   811  C CD  . ARG A 1 103 ? -8.48169  -46.58370 -38.36328 1.000 84.74757  ? 599 ARG A CD  1 
ATOM   812  N NE  . ARG A 1 103 ? -9.79380  -46.63665 -39.00949 1.000 88.61785  ? 599 ARG A NE  1 
ATOM   813  C CZ  . ARG A 1 103 ? -10.35190 -47.74769 -39.48823 1.000 85.05953  ? 599 ARG A CZ  1 
ATOM   814  N NH1 . ARG A 1 103 ? -11.54892 -47.69613 -40.06219 1.000 80.51675  ? 599 ARG A NH1 1 
ATOM   815  N NH2 . ARG A 1 103 ? -9.72461  -48.91465 -39.37756 1.000 82.62782  ? 599 ARG A NH2 1 
ATOM   816  N N   . TYR A 1 104 ? -6.35861  -43.40560 -34.21276 1.000 61.87809  ? 600 TYR A N   1 
ATOM   817  C CA  . TYR A 1 104 ? -5.86630  -42.15190 -33.64824 1.000 65.26846  ? 600 TYR A CA  1 
ATOM   818  C C   . TYR A 1 104 ? -4.69300  -41.60098 -34.46414 1.000 70.41883  ? 600 TYR A C   1 
ATOM   819  O O   . TYR A 1 104 ? -3.87339  -42.37873 -34.97073 1.000 63.72490  ? 600 TYR A O   1 
ATOM   820  C CB  . TYR A 1 104 ? -5.46608  -42.35401 -32.16803 1.000 62.76619  ? 600 TYR A CB  1 
ATOM   821  C CG  . TYR A 1 104 ? -4.70569  -43.64109 -31.85147 1.000 69.21116  ? 600 TYR A CG  1 
ATOM   822  C CD1 . TYR A 1 104 ? -5.37530  -44.80634 -31.48954 1.000 66.33798  ? 600 TYR A CD1 1 
ATOM   823  C CD2 . TYR A 1 104 ? -3.31668  -43.67967 -31.90091 1.000 73.52265  ? 600 TYR A CD2 1 
ATOM   824  C CE1 . TYR A 1 104 ? -4.69297  -45.96597 -31.18556 1.000 66.69640  ? 600 TYR A CE1 1 
ATOM   825  C CE2 . TYR A 1 104 ? -2.62271  -44.83841 -31.60951 1.000 70.56386  ? 600 TYR A CE2 1 
ATOM   826  C CZ  . TYR A 1 104 ? -3.31712  -45.98145 -31.24662 1.000 67.41788  ? 600 TYR A CZ  1 
ATOM   827  O OH  . TYR A 1 104 ? -2.64356  -47.14921 -30.94792 1.000 65.93360  ? 600 TYR A OH  1 
ATOM   828  N N   . GLU A 1 105 ? -4.57644  -40.23072 -34.51814 1.000 86.61878  ? 601 GLU A N   1 
ATOM   829  C CA  . GLU A 1 105 ? -3.77555  -39.59463 -35.57694 1.000 102.66546 ? 601 GLU A CA  1 
ATOM   830  C C   . GLU A 1 105 ? -2.25924  -39.79932 -35.37428 1.000 99.85034  ? 601 GLU A C   1 
ATOM   831  O O   . GLU A 1 105 ? -1.63875  -40.47611 -36.20742 1.000 106.72193 ? 601 GLU A O   1 
ATOM   832  C CB  . GLU A 1 105 ? -4.21771  -38.12080 -35.78120 1.000 118.20896 ? 601 GLU A CB  1 
ATOM   833  C CG  . GLU A 1 105 ? -5.60573  -37.70211 -36.30461 1.000 126.25296 ? 601 GLU A CG  1 
ATOM   834  C CD  . GLU A 1 105 ? -6.23502  -38.64100 -37.32363 1.000 129.69832 ? 601 GLU A CD  1 
ATOM   835  O OE1 . GLU A 1 105 ? -5.53280  -39.02834 -38.29087 1.000 136.30908 ? 601 GLU A OE1 1 
ATOM   836  O OE2 . GLU A 1 105 ? -7.43437  -39.00660 -37.17131 1.000 123.96384 ? 601 GLU A OE2 1 
ATOM   837  N N   . PRO A 1 106 ? -1.59661  -39.25980 -34.32766 1.000 83.43349  ? 602 PRO A N   1 
ATOM   838  C CA  . PRO A 1 106 ? -0.20266  -39.66875 -34.08495 1.000 80.41891  ? 602 PRO A CA  1 
ATOM   839  C C   . PRO A 1 106 ? -0.16425  -40.86554 -33.15159 1.000 74.46199  ? 602 PRO A C   1 
ATOM   840  O O   . PRO A 1 106 ? -1.17872  -41.20221 -32.52594 1.000 71.74464  ? 602 PRO A O   1 
ATOM   841  C CB  . PRO A 1 106 ? 0.42434   -38.42560 -33.42218 1.000 68.68465  ? 602 PRO A CB  1 
ATOM   842  C CG  . PRO A 1 106 ? -0.62451  -37.37366 -33.41838 1.000 68.69808  ? 602 PRO A CG  1 
ATOM   843  C CD  . PRO A 1 106 ? -1.88441  -38.16884 -33.39760 1.000 76.00197  ? 602 PRO A CD  1 
ATOM   844  N N   . PRO A 1 107 ? 0.97021   -41.56144 -33.04404 1.000 77.89834  ? 603 PRO A N   1 
ATOM   845  C CA  . PRO A 1 107 ? 1.00623   -42.72151 -32.13800 1.000 74.75345  ? 603 PRO A CA  1 
ATOM   846  C C   . PRO A 1 107 ? 1.16372   -42.35183 -30.66932 1.000 71.19527  ? 603 PRO A C   1 
ATOM   847  O O   . PRO A 1 107 ? 0.88291   -43.20284 -29.81066 1.000 67.68985  ? 603 PRO A O   1 
ATOM   848  C CB  . PRO A 1 107 ? 2.19840   -43.54409 -32.66041 1.000 70.74924  ? 603 PRO A CB  1 
ATOM   849  C CG  . PRO A 1 107 ? 2.54274   -42.93763 -34.00852 1.000 70.15443  ? 603 PRO A CG  1 
ATOM   850  C CD  . PRO A 1 107 ? 2.16170   -41.50259 -33.90933 1.000 74.68726  ? 603 PRO A CD  1 
ATOM   851  N N   . HIS A 1 108 ? 1.56033   -41.10665 -30.36090 1.000 69.38915  ? 604 HIS A N   1 
ATOM   852  C CA  . HIS A 1 108 ? 1.62375   -40.64221 -28.97501 1.000 72.15819  ? 604 HIS A CA  1 
ATOM   853  C C   . HIS A 1 108 ? 0.25644   -40.67317 -28.30366 1.000 70.76813  ? 604 HIS A C   1 
ATOM   854  O O   . HIS A 1 108 ? 0.16084   -40.91935 -27.09553 1.000 67.71332  ? 604 HIS A O   1 
ATOM   855  C CB  . HIS A 1 108 ? 2.16681   -39.21221 -28.90166 1.000 76.98686  ? 604 HIS A CB  1 
ATOM   856  C CG  . HIS A 1 108 ? 3.24177   -38.90327 -29.89509 1.000 92.77970  ? 604 HIS A CG  1 
ATOM   857  N ND1 . HIS A 1 108 ? 2.98135   -38.65925 -31.22677 1.000 98.75943  ? 604 HIS A ND1 1 
ATOM   858  C CD2 . HIS A 1 108 ? 4.58001   -38.76102 -29.74194 1.000 99.39577  ? 604 HIS A CD2 1 
ATOM   859  C CE1 . HIS A 1 108 ? 4.11499   -38.40209 -31.85528 1.000 102.82156 ? 604 HIS A CE1 1 
ATOM   860  N NE2 . HIS A 1 108 ? 5.10008   -38.45547 -30.97668 1.000 102.87656 ? 604 HIS A NE2 1 
ATOM   861  N N   . ILE A 1 109 ? -0.80578  -40.43446 -29.07817 1.000 70.86585  ? 605 ILE A N   1 
ATOM   862  C CA  . ILE A 1 109 ? -2.15973  -40.27481 -28.55906 1.000 62.27216  ? 605 ILE A CA  1 
ATOM   863  C C   . ILE A 1 109 ? -2.69415  -41.55821 -27.93580 1.000 60.62602  ? 605 ILE A C   1 
ATOM   864  O O   . ILE A 1 109 ? -3.59740  -41.49360 -27.08646 1.000 58.80065  ? 605 ILE A O   1 
ATOM   865  C CB  . ILE A 1 109 ? -3.02959  -39.70869 -29.71168 1.000 58.18781  ? 605 ILE A CB  1 
ATOM   866  C CG1 . ILE A 1 109 ? -2.68216  -38.23676 -29.92615 1.000 60.18378  ? 605 ILE A CG1 1 
ATOM   867  C CG2 . ILE A 1 109 ? -4.55409  -39.84109 -29.49440 1.000 56.59325  ? 605 ILE A CG2 1 
ATOM   868  C CD1 . ILE A 1 109 ? -2.49390  -37.44043 -28.65393 1.000 59.34071  ? 605 ILE A CD1 1 
ATOM   869  N N   . LYS A 1 110 ? -2.09712  -42.71385 -28.27016 1.000 63.57793  ? 606 LYS A N   1 
ATOM   870  C CA  . LYS A 1 110 ? -2.54303  -43.99165 -27.71627 1.000 57.52632  ? 606 LYS A CA  1 
ATOM   871  C C   . LYS A 1 110 ? -2.53913  -43.99079 -26.19354 1.000 51.78964  ? 606 LYS A C   1 
ATOM   872  O O   . LYS A 1 110 ? -3.42388  -44.59110 -25.57059 1.000 50.13995  ? 606 LYS A O   1 
ATOM   873  C CB  . LYS A 1 110 ? -1.67513  -45.13534 -28.24083 1.000 56.44130  ? 606 LYS A CB  1 
ATOM   874  C CG  . LYS A 1 110 ? -2.18846  -46.50988 -27.79533 1.000 66.24751  ? 606 LYS A CG  1 
ATOM   875  C CD  . LYS A 1 110 ? -1.15118  -47.61729 -27.86920 1.000 74.41660  ? 606 LYS A CD  1 
ATOM   876  C CE  . LYS A 1 110 ? 0.14398   -47.31104 -27.12731 1.000 82.36372  ? 606 LYS A CE  1 
ATOM   877  N NZ  . LYS A 1 110 ? -0.00030  -46.54586 -25.85312 1.000 87.49187  ? 606 LYS A NZ  1 
ATOM   878  N N   . LYS A 1 111 ? -1.60493  -43.27040 -25.57578 1.000 52.35500  ? 607 LYS A N   1 
ATOM   879  C CA  . LYS A 1 111 ? -1.61986  -43.19927 -24.12066 1.000 50.93614  ? 607 LYS A CA  1 
ATOM   880  C C   . LYS A 1 111 ? -2.80724  -42.39532 -23.60475 1.000 49.48865  ? 607 LYS A C   1 
ATOM   881  O O   . LYS A 1 111 ? -3.33622  -42.70618 -22.53645 1.000 47.90911  ? 607 LYS A O   1 
ATOM   882  C CB  . LYS A 1 111 ? -0.28982  -42.64801 -23.61200 1.000 52.23991  ? 607 LYS A CB  1 
ATOM   883  C CG  . LYS A 1 111 ? -0.21816  -42.40889 -22.11024 1.000 51.14242  ? 607 LYS A CG  1 
ATOM   884  C CD  . LYS A 1 111 ? 1.21225   -42.58304 -21.60834 1.000 60.96451  ? 607 LYS A CD  1 
ATOM   885  C CE  . LYS A 1 111 ? 1.87586   -41.23057 -21.46462 1.000 63.63019  ? 607 LYS A CE  1 
ATOM   886  N NZ  . LYS A 1 111 ? 2.65222   -41.12638 -20.21392 1.000 74.44483  ? 607 LYS A NZ  1 
ATOM   887  N N   . ALA A 1 112 ? -3.27516  -41.39780 -24.35176 1.000 50.23534  ? 608 ALA A N   1 
ATOM   888  C CA  . ALA A 1 112 ? -4.47118  -40.69861 -23.89988 1.000 49.16510  ? 608 ALA A CA  1 
ATOM   889  C C   . ALA A 1 112 ? -5.70726  -41.59524 -23.98883 1.000 47.86662  ? 608 ALA A C   1 
ATOM   890  O O   . ALA A 1 112 ? -6.56749  -41.54912 -23.10144 1.000 46.49001  ? 608 ALA A O   1 
ATOM   891  C CB  . ALA A 1 112 ? -4.66106  -39.40882 -24.69316 1.000 50.76046  ? 608 ALA A CB  1 
ATOM   892  N N   . LEU A 1 113 ? -5.78786  -42.44842 -25.01409 1.000 48.45845  ? 609 LEU A N   1 
ATOM   893  C CA  . LEU A 1 113 ? -6.92674  -43.35259 -25.13215 1.000 47.54329  ? 609 LEU A CA  1 
ATOM   894  C C   . LEU A 1 113 ? -6.87360  -44.45505 -24.08887 1.000 46.26598  ? 609 LEU A C   1 
ATOM   895  O O   . LEU A 1 113 ? -7.91272  -44.82076 -23.52479 1.000 45.04778  ? 609 LEU A O   1 
ATOM   896  C CB  . LEU A 1 113 ? -6.98953  -43.94574 -26.53084 1.000 48.83469  ? 609 LEU A CB  1 
ATOM   897  C CG  . LEU A 1 113 ? -7.42612  -42.85757 -27.50889 1.000 52.68706  ? 609 LEU A CG  1 
ATOM   898  C CD1 . LEU A 1 113 ? -6.99312  -43.21243 -28.88589 1.000 52.06025  ? 609 LEU A CD1 1 
ATOM   899  C CD2 . LEU A 1 113 ? -8.93776  -42.61307 -27.45872 1.000 49.96471  ? 609 LEU A CD2 1 
ATOM   900  N N   . GLN A 1 114 ? -5.67269  -44.99127 -23.82358 1.000 46.56940  ? 610 GLN A N   1 
ATOM   901  C CA  . GLN A 1 114 ? -5.48426  -45.95162 -22.73827 1.000 45.68880  ? 610 GLN A CA  1 
ATOM   902  C C   . GLN A 1 114 ? -5.96797  -45.38880 -21.40951 1.000 45.42897  ? 610 GLN A C   1 
ATOM   903  O O   . GLN A 1 114 ? -6.59297  -46.10437 -20.61648 1.000 45.42946  ? 610 GLN A O   1 
ATOM   904  C CB  . GLN A 1 114 ? -4.01367  -46.33841 -22.62763 1.000 46.82119  ? 610 GLN A CB  1 
ATOM   905  C CG  . GLN A 1 114 ? -3.57741  -47.52126 -23.45058 1.000 55.13578  ? 610 GLN A CG  1 
ATOM   906  C CD  . GLN A 1 114 ? -2.06742  -47.70390 -23.40943 1.000 59.47389  ? 610 GLN A CD  1 
ATOM   907  O OE1 . GLN A 1 114 ? -1.31537  -46.75697 -23.64859 1.000 56.70686  ? 610 GLN A OE1 1 
ATOM   908  N NE2 . GLN A 1 114 ? -1.61708  -48.92080 -23.10800 1.000 59.94560  ? 610 GLN A NE2 1 
ATOM   909  N N   . TYR A 1 115 ? -5.70645  -44.10255 -21.16303 1.000 44.47955  ? 611 TYR A N   1 
ATOM   910  C CA  . TYR A 1 115 ? -6.23506  -43.43238 -19.97881 1.000 43.39342  ? 611 TYR A CA  1 
ATOM   911  C C   . TYR A 1 115 ? -7.76188  -43.37901 -19.99699 1.000 44.04014  ? 611 TYR A C   1 
ATOM   912  O O   . TYR A 1 115 ? -8.41467  -43.67702 -18.99009 1.000 52.17451  ? 611 TYR A O   1 
ATOM   913  C CB  . TYR A 1 115 ? -5.64801  -42.02660 -19.88802 1.000 44.14846  ? 611 TYR A CB  1 
ATOM   914  C CG  . TYR A 1 115 ? -6.24820  -41.14503 -18.82158 1.000 43.35114  ? 611 TYR A CG  1 
ATOM   915  C CD1 . TYR A 1 115 ? -5.79646  -41.20236 -17.50711 1.000 42.80593  ? 611 TYR A CD1 1 
ATOM   916  C CD2 . TYR A 1 115 ? -7.24064  -40.22410 -19.13489 1.000 43.45671  ? 611 TYR A CD2 1 
ATOM   917  C CE1 . TYR A 1 115 ? -6.34321  -40.38313 -16.52265 1.000 42.22855  ? 611 TYR A CE1 1 
ATOM   918  C CE2 . TYR A 1 115 ? -7.79856  -39.40826 -18.15967 1.000 43.62038  ? 611 TYR A CE2 1 
ATOM   919  C CZ  . TYR A 1 115 ? -7.34337  -39.49024 -16.85874 1.000 48.32750  ? 611 TYR A CZ  1 
ATOM   920  O OH  . TYR A 1 115 ? -7.88901  -38.66170 -15.90608 1.000 49.89658  ? 611 TYR A OH  1 
ATOM   921  N N   . ALA A 1 116 ? -8.35334  -43.00126 -21.13415 1.000 43.25644  ? 612 ALA A N   1 
ATOM   922  C CA  . ALA A 1 116 ? -9.79584  -42.79261 -21.17860 1.000 42.90056  ? 612 ALA A CA  1 
ATOM   923  C C   . ALA A 1 116 ? -10.58925 -44.09375 -21.30436 1.000 45.82755  ? 612 ALA A C   1 
ATOM   924  O O   . ALA A 1 116 ? -11.71902 -44.16477 -20.80555 1.000 41.90097  ? 612 ALA A O   1 
ATOM   925  C CB  . ALA A 1 116 ? -10.16091 -41.85821 -22.33370 1.000 44.27202  ? 612 ALA A CB  1 
ATOM   926  N N   . CYS A 1 117 ? -10.05201 -45.11240 -21.98047 1.000 42.91609  ? 613 CYS A N   1 
ATOM   927  C CA  . CYS A 1 117 ? -10.76975 -46.36998 -22.15374 1.000 42.81523  ? 613 CYS A CA  1 
ATOM   928  C C   . CYS A 1 117 ? -10.36754 -47.44530 -21.16024 1.000 49.04921  ? 613 CYS A C   1 
ATOM   929  O O   . CYS A 1 117 ? -11.23611 -48.19161 -20.68415 1.000 43.37591  ? 613 CYS A O   1 
ATOM   930  C CB  . CYS A 1 117 ? -10.58082 -46.93706 -23.56154 1.000 44.05644  ? 613 CYS A CB  1 
ATOM   931  S SG  . CYS A 1 117 ? -10.89164 -45.82288 -24.90152 1.000 45.39178  ? 613 CYS A SG  1 
ATOM   932  N N   . GLY A 1 118 ? -9.07884  -47.54824 -20.84971 1.000 39.20099  ? 614 GLY A N   1 
ATOM   933  C CA  . GLY A 1 118 ? -8.62373  -48.64088 -20.00791 1.000 34.15788  ? 614 GLY A CA  1 
ATOM   934  C C   . GLY A 1 118 ? -8.91373  -49.96204 -20.68530 1.000 41.09127  ? 614 GLY A C   1 
ATOM   935  O O   . GLY A 1 118 ? -8.60493  -50.17048 -21.86252 1.000 47.49502  ? 614 GLY A O   1 
ATOM   936  N N   . ASN A 1 119 ? -9.57724  -50.84618 -19.95402 1.000 44.10817  ? 615 ASN A N   1 
ATOM   937  C CA  . ASN A 1 119 ? -9.93330  -52.16527 -20.44979 1.000 41.53307  ? 615 ASN A CA  1 
ATOM   938  C C   . ASN A 1 119 ? -11.43121 -52.28742 -20.68646 1.000 40.73674  ? 615 ASN A C   1 
ATOM   939  O O   . ASN A 1 119 ? -11.98219 -53.39173 -20.62954 1.000 42.97451  ? 615 ASN A O   1 
ATOM   940  C CB  . ASN A 1 119 ? -9.44964  -53.23251 -19.47339 1.000 32.37995  ? 615 ASN A CB  1 
ATOM   941  C CG  . ASN A 1 119 ? -7.93674  -53.25662 -19.36716 1.000 48.79862  ? 615 ASN A CG  1 
ATOM   942  O OD1 . ASN A 1 119 ? -7.23890  -52.81811 -20.28003 1.000 46.30379  ? 615 ASN A OD1 1 
ATOM   943  N ND2 . ASN A 1 119 ? -7.42490  -53.74715 -18.24981 1.000 50.03158  ? 615 ASN A ND2 1 
ATOM   944  N N   . ALA A 1 120 ? -12.10197 -51.15664 -20.91294 1.000 31.25676  ? 616 ALA A N   1 
ATOM   945  C CA  . ALA A 1 120 ? -13.51477 -51.19169 -21.26061 1.000 29.65204  ? 616 ALA A CA  1 
ATOM   946  C C   . ALA A 1 120 ? -13.71821 -52.00731 -22.52704 1.000 35.18216  ? 616 ALA A C   1 
ATOM   947  O O   . ALA A 1 120 ? -12.87455 -52.00679 -23.42909 1.000 37.26072  ? 616 ALA A O   1 
ATOM   948  C CB  . ALA A 1 120 ? -14.05940 -49.78100 -21.45854 1.000 27.90490  ? 616 ALA A CB  1 
ATOM   949  N N   . LEU A 1 121 ? -14.82871 -52.72782 -22.57342 1.000 31.94445  ? 617 LEU A N   1 
ATOM   950  C CA  . LEU A 1 121 ? -15.15903 -53.60797 -23.68139 1.000 35.56132  ? 617 LEU A CA  1 
ATOM   951  C C   . LEU A 1 121 ? -16.44021 -53.12531 -24.33937 1.000 41.94569  ? 617 LEU A C   1 
ATOM   952  O O   . LEU A 1 121 ? -17.35383 -52.66319 -23.65272 1.000 36.24483  ? 617 LEU A O   1 
ATOM   953  C CB  . LEU A 1 121 ? -15.35220 -55.05129 -23.19130 1.000 34.04410  ? 617 LEU A CB  1 
ATOM   954  C CG  . LEU A 1 121 ? -14.11653 -55.76038 -22.64220 1.000 37.32603  ? 617 LEU A CG  1 
ATOM   955  C CD1 . LEU A 1 121 ? -14.53564 -57.07257 -22.03895 1.000 32.27618  ? 617 LEU A CD1 1 
ATOM   956  C CD2 . LEU A 1 121 ? -13.06671 -55.97821 -23.75568 1.000 38.59757  ? 617 LEU A CD2 1 
ATOM   957  N N   . VAL A 1 122 ? -16.52635 -53.25493 -25.66298 1.000 44.49840  ? 618 VAL A N   1 
ATOM   958  C CA  . VAL A 1 122 ? -17.75465 -52.96212 -26.38827 1.000 32.30861  ? 618 VAL A CA  1 
ATOM   959  C C   . VAL A 1 122 ? -18.34827 -54.27201 -26.90190 1.000 45.03809  ? 618 VAL A C   1 
ATOM   960  O O   . VAL A 1 122 ? -17.63231 -55.11671 -27.45701 1.000 47.09597  ? 618 VAL A O   1 
ATOM   961  C CB  . VAL A 1 122 ? -17.52808 -51.94275 -27.51833 1.000 38.63592  ? 618 VAL A CB  1 
ATOM   962  C CG1 . VAL A 1 122 ? -16.37818 -52.35560 -28.44857 1.000 45.57692  ? 618 VAL A CG1 1 
ATOM   963  C CG2 . VAL A 1 122 ? -18.83335 -51.69486 -28.29051 1.000 39.90701  ? 618 VAL A CG2 1 
ATOM   964  N N   . CYS A 1 123 ? -19.64832 -54.46333 -26.65246 1.000 40.81781  ? 619 CYS A N   1 
ATOM   965  C CA  . CYS A 1 123 ? -20.43196 -55.58141 -27.15780 1.000 41.14130  ? 619 CYS A CA  1 
ATOM   966  C C   . CYS A 1 123 ? -21.53485 -55.06452 -28.06541 1.000 49.58856  ? 619 CYS A C   1 
ATOM   967  O O   . CYS A 1 123 ? -21.88277 -53.87886 -28.05172 1.000 50.99536  ? 619 CYS A O   1 
ATOM   968  C CB  . CYS A 1 123 ? -21.06057 -56.37662 -26.01960 1.000 40.73224  ? 619 CYS A CB  1 
ATOM   969  S SG  . CYS A 1 123 ? -19.95571 -56.50731 -24.66891 1.000 48.79810  ? 619 CYS A SG  1 
ATOM   970  N N   . ASP A 1 124 ? -22.12273 -55.99016 -28.82513 1.000 54.17117  ? 620 ASP A N   1 
ATOM   971  C CA  . ASP A 1 124 ? -23.09777 -55.60922 -29.83740 1.000 63.45372  ? 620 ASP A CA  1 
ATOM   972  C C   . ASP A 1 124 ? -24.48744 -55.39299 -29.26547 1.000 60.65061  ? 620 ASP A C   1 
ATOM   973  O O   . ASP A 1 124 ? -25.29423 -54.69423 -29.88676 1.000 71.70729  ? 620 ASP A O   1 
ATOM   974  C CB  . ASP A 1 124 ? -23.14615 -56.66512 -30.94100 1.000 76.86180  ? 620 ASP A CB  1 
ATOM   975  C CG  . ASP A 1 124 ? -21.96750 -56.56287 -31.88999 1.000 88.72862  ? 620 ASP A CG  1 
ATOM   976  O OD1 . ASP A 1 124 ? -21.54700 -55.42545 -32.19914 1.000 92.38172  ? 620 ASP A OD1 1 
ATOM   977  O OD2 . ASP A 1 124 ? -21.45085 -57.61738 -32.31517 1.000 94.08269  ? 620 ASP A OD2 1 
ATOM   978  N N   . ASN A 1 125 ? -24.78759 -55.95967 -28.10435 1.000 50.24436  ? 621 ASN A N   1 
ATOM   979  C CA  . ASN A 1 125 ? -26.09605 -55.76047 -27.50476 1.000 48.25142  ? 621 ASN A CA  1 
ATOM   980  C C   . ASN A 1 125 ? -25.95925 -55.72738 -25.98825 1.000 45.29113  ? 621 ASN A C   1 
ATOM   981  O O   . ASN A 1 125 ? -24.92846 -56.10412 -25.42456 1.000 43.22739  ? 621 ASN A O   1 
ATOM   982  C CB  . ASN A 1 125 ? -27.08318 -56.84762 -27.94274 1.000 45.42846  ? 621 ASN A CB  1 
ATOM   983  C CG  . ASN A 1 125 ? -26.48692 -58.23496 -27.85606 1.000 50.09748  ? 621 ASN A CG  1 
ATOM   984  O OD1 . ASN A 1 125 ? -26.53499 -58.87791 -26.81108 1.000 52.89744  ? 621 ASN A OD1 1 
ATOM   985  N ND2 . ASN A 1 125 ? -25.91194 -58.70070 -28.95566 1.000 55.29308  ? 621 ASN A ND2 1 
ATOM   986  N N   . VAL A 1 126 ? -27.04193 -55.28558 -25.33681 1.000 46.56538  ? 622 VAL A N   1 
ATOM   987  C CA  . VAL A 1 126 ? -27.03937 -55.06806 -23.89286 1.000 33.08777  ? 622 VAL A CA  1 
ATOM   988  C C   . VAL A 1 126 ? -26.84614 -56.38416 -23.15246 1.000 38.28430  ? 622 VAL A C   1 
ATOM   989  O O   . VAL A 1 126 ? -26.02567 -56.47480 -22.23224 1.000 48.45685  ? 622 VAL A O   1 
ATOM   990  C CB  . VAL A 1 126 ? -28.33991 -54.36063 -23.46268 1.000 36.72097  ? 622 VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 126 ? -28.50698 -54.42984 -21.98110 1.000 29.66029  ? 622 VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 126 ? -28.31434 -52.91439 -23.88028 1.000 42.31301  ? 622 VAL A CG2 1 
ATOM   993  N N   . GLU A 1 127 ? -27.57876 -57.42930 -23.56043 1.000 43.24109  ? 623 GLU A N   1 
ATOM   994  C CA  . GLU A 1 127 ? -27.51594 -58.71114 -22.85935 1.000 42.03864  ? 623 GLU A CA  1 
ATOM   995  C C   . GLU A 1 127 ? -26.12216 -59.32231 -22.91924 1.000 47.40915  ? 623 GLU A C   1 
ATOM   996  O O   . GLU A 1 127 ? -25.69099 -59.97678 -21.96082 1.000 44.81773  ? 623 GLU A O   1 
ATOM   997  C CB  . GLU A 1 127 ? -28.55491 -59.67401 -23.43527 1.000 38.01247  ? 623 GLU A CB  1 
ATOM   998  C CG  . GLU A 1 127 ? -29.97229 -59.38819 -22.94271 1.000 54.37850  ? 623 GLU A CG  1 
ATOM   999  C CD  . GLU A 1 127 ? -30.05498 -59.21448 -21.41851 1.000 60.77897  ? 623 GLU A CD  1 
ATOM   1000 O OE1 . GLU A 1 127 ? -29.80836 -60.20172 -20.69444 1.000 53.72306  ? 623 GLU A OE1 1 
ATOM   1001 O OE2 . GLU A 1 127 ? -30.34673 -58.08274 -20.94815 1.000 62.76856  ? 623 GLU A OE2 1 
ATOM   1002 N N   . ASP A 1 128 ? -25.39532 -59.08357 -24.01619 1.000 47.91993  ? 624 ASP A N   1 
ATOM   1003 C CA  . ASP A 1 128 ? -23.98568 -59.45290 -24.08497 1.000 50.15758  ? 624 ASP A CA  1 
ATOM   1004 C C   . ASP A 1 128 ? -23.15588 -58.64024 -23.09738 1.000 46.51890  ? 624 ASP A C   1 
ATOM   1005 O O   . ASP A 1 128 ? -22.34638 -59.20176 -22.34497 1.000 41.67144  ? 624 ASP A O   1 
ATOM   1006 C CB  . ASP A 1 128 ? -23.46403 -59.24707 -25.50653 1.000 63.13352  ? 624 ASP A CB  1 
ATOM   1007 C CG  . ASP A 1 128 ? -23.73428 -60.43568 -26.41106 1.000 67.17627  ? 624 ASP A CG  1 
ATOM   1008 O OD1 . ASP A 1 128 ? -24.23111 -61.47081 -25.91357 1.000 65.03606  ? 624 ASP A OD1 1 
ATOM   1009 O OD2 . ASP A 1 128 ? -23.44056 -60.32793 -27.62232 1.000 67.43095  ? 624 ASP A OD2 1 
ATOM   1010 N N   . ALA A 1 129 ? -23.34597 -57.31110 -23.09135 1.000 40.02207  ? 625 ALA A N   1 
ATOM   1011 C CA  . ALA A 1 129 ? -22.57502 -56.44369 -22.20135 1.000 37.21628  ? 625 ALA A CA  1 
ATOM   1012 C C   . ALA A 1 129 ? -22.83046 -56.77936 -20.73878 1.000 38.91384  ? 625 ALA A C   1 
ATOM   1013 O O   . ALA A 1 129 ? -21.90909 -56.76358 -19.91334 1.000 34.40011  ? 625 ALA A O   1 
ATOM   1014 C CB  . ALA A 1 129 ? -22.91759 -54.98333 -22.48206 1.000 32.78085  ? 625 ALA A CB  1 
ATOM   1015 N N   . ARG A 1 130 ? -24.07122 -57.12122 -20.41445 1.000 34.62400  ? 626 ARG A N   1 
ATOM   1016 C CA  . ARG A 1 130 ? -24.42516 -57.49813 -19.05517 1.000 34.69552  ? 626 ARG A CA  1 
ATOM   1017 C C   . ARG A 1 130 ? -23.78183 -58.81764 -18.66153 1.000 31.92429  ? 626 ARG A C   1 
ATOM   1018 O O   . ARG A 1 130 ? -23.29705 -58.96610 -17.53356 1.000 34.54126  ? 626 ARG A O   1 
ATOM   1019 C CB  . ARG A 1 130 ? -25.94321 -57.59657 -18.94810 1.000 34.13509  ? 626 ARG A CB  1 
ATOM   1020 C CG  . ARG A 1 130 ? -26.46027 -57.62358 -17.55753 1.000 27.23249  ? 626 ARG A CG  1 
ATOM   1021 C CD  . ARG A 1 130 ? -27.95943 -57.51925 -17.60069 1.000 38.15053  ? 626 ARG A CD  1 
ATOM   1022 N NE  . ARG A 1 130 ? -28.55232 -58.70896 -18.18252 1.000 43.23065  ? 626 ARG A NE  1 
ATOM   1023 C CZ  . ARG A 1 130 ? -28.80842 -59.81499 -17.49310 1.000 45.59843  ? 626 ARG A CZ  1 
ATOM   1024 N NH1 . ARG A 1 130 ? -28.52838 -59.86513 -16.19544 1.000 48.21010  ? 626 ARG A NH1 1 
ATOM   1025 N NH2 . ARG A 1 130 ? -29.36267 -60.86555 -18.09312 1.000 38.36234  ? 626 ARG A NH2 1 
ATOM   1026 N N   . ARG A 1 131 ? -23.76578 -59.78619 -19.58092 1.000 34.30687  ? 627 ARG A N   1 
ATOM   1027 C CA  . ARG A 1 131 ? -23.19443 -61.09527 -19.27346 1.000 40.75772  ? 627 ARG A CA  1 
ATOM   1028 C C   . ARG A 1 131 ? -21.66996 -61.03981 -19.13812 1.000 40.45517  ? 627 ARG A C   1 
ATOM   1029 O O   . ARG A 1 131 ? -21.09452 -61.74094 -18.30273 1.000 33.57771  ? 627 ARG A O   1 
ATOM   1030 C CB  . ARG A 1 131 ? -23.59394 -62.09407 -20.34984 1.000 46.70380  ? 627 ARG A CB  1 
ATOM   1031 C CG  . ARG A 1 131 ? -23.51350 -63.52668 -19.89139 1.000 61.15634  ? 627 ARG A CG  1 
ATOM   1032 C CD  . ARG A 1 131 ? -23.48461 -64.46673 -21.07830 1.000 69.06389  ? 627 ARG A CD  1 
ATOM   1033 N NE  . ARG A 1 131 ? -22.13920 -64.60516 -21.60711 1.000 70.91178  ? 627 ARG A NE  1 
ATOM   1034 C CZ  . ARG A 1 131 ? -21.77287 -64.19797 -22.81476 1.000 73.59869  ? 627 ARG A CZ  1 
ATOM   1035 N NH1 . ARG A 1 131 ? -22.66691 -63.63100 -23.61848 1.000 72.28664  ? 627 ARG A NH1 1 
ATOM   1036 N NH2 . ARG A 1 131 ? -20.51454 -64.35735 -23.21305 1.000 70.80247  ? 627 ARG A NH2 1 
ATOM   1037 N N   . ILE A 1 132 ? -20.99582 -60.23175 -19.95351 1.000 31.55829  ? 628 ILE A N   1 
ATOM   1038 C CA  . ILE A 1 132 ? -19.54068 -60.12690 -19.83680 1.000 36.51608  ? 628 ILE A CA  1 
ATOM   1039 C C   . ILE A 1 132 ? -19.15694 -59.35603 -18.57840 1.000 33.86576  ? 628 ILE A C   1 
ATOM   1040 O O   . ILE A 1 132 ? -18.22124 -59.73823 -17.86348 1.000 34.75866  ? 628 ILE A O   1 
ATOM   1041 C CB  . ILE A 1 132 ? -18.94420 -59.46471 -21.09091 1.000 45.66080  ? 628 ILE A CB  1 
ATOM   1042 C CG1 . ILE A 1 132 ? -19.22868 -60.30774 -22.33403 1.000 53.12878  ? 628 ILE A CG1 1 
ATOM   1043 C CG2 . ILE A 1 132 ? -17.45078 -59.24650 -20.92275 1.000 37.54800  ? 628 ILE A CG2 1 
ATOM   1044 C CD1 . ILE A 1 132 ? -18.66185 -61.68630 -22.26610 1.000 59.64399  ? 628 ILE A CD1 1 
ATOM   1045 N N   . ALA A 1 133 ? -19.88517 -58.26826 -18.28695 1.000 34.48349  ? 629 ALA A N   1 
ATOM   1046 C CA  . ALA A 1 133 ? -19.59605 -57.42461 -17.12859 1.000 27.51696  ? 629 ALA A CA  1 
ATOM   1047 C C   . ALA A 1 133 ? -19.73815 -58.18784 -15.83074 1.000 29.02285  ? 629 ALA A C   1 
ATOM   1048 O O   . ALA A 1 133 ? -18.84718 -58.14743 -14.97648 1.000 38.18933  ? 629 ALA A O   1 
ATOM   1049 C CB  . ALA A 1 133 ? -20.53750 -56.22508 -17.09192 1.000 27.25347  ? 629 ALA A CB  1 
ATOM   1050 N N   . PHE A 1 134 ? -20.87671 -58.85554 -15.64784 1.000 31.22701  ? 630 PHE A N   1 
ATOM   1051 C CA  . PHE A 1 134 ? -21.26358 -59.39408 -14.35714 1.000 28.73256  ? 630 PHE A CA  1 
ATOM   1052 C C   . PHE A 1 134 ? -21.37629 -60.90419 -14.34341 1.000 38.72159  ? 630 PHE A C   1 
ATOM   1053 O O   . PHE A 1 134 ? -21.57193 -61.47800 -13.26554 1.000 36.52070  ? 630 PHE A O   1 
ATOM   1054 C CB  . PHE A 1 134 ? -22.63132 -58.84583 -13.91710 1.000 32.27288  ? 630 PHE A CB  1 
ATOM   1055 C CG  . PHE A 1 134 ? -22.70557 -57.35706 -13.79776 1.000 25.65112  ? 630 PHE A CG  1 
ATOM   1056 C CD1 . PHE A 1 134 ? -21.61325 -56.61711 -13.40072 1.000 26.87725  ? 630 PHE A CD1 1 
ATOM   1057 C CD2 . PHE A 1 134 ? -23.90999 -56.69882 -14.04798 1.000 26.81726  ? 630 PHE A CD2 1 
ATOM   1058 C CE1 . PHE A 1 134 ? -21.69894 -55.22433 -13.29269 1.000 35.44953  ? 630 PHE A CE1 1 
ATOM   1059 C CE2 . PHE A 1 134 ? -24.02461 -55.31886 -13.91892 1.000 24.07584  ? 630 PHE A CE2 1 
ATOM   1060 C CZ  . PHE A 1 134 ? -22.90805 -54.57508 -13.54439 1.000 28.07032  ? 630 PHE A CZ  1 
ATOM   1061 N N   . GLY A 1 135 ? -21.32778 -61.56540 -15.50039 1.000 36.65389  ? 631 GLY A N   1 
ATOM   1062 C CA  . GLY A 1 135 ? -21.64632 -62.97803 -15.49446 1.000 41.32273  ? 631 GLY A CA  1 
ATOM   1063 C C   . GLY A 1 135 ? -20.48878 -63.86828 -15.13007 1.000 45.66144  ? 631 GLY A C   1 
ATOM   1064 O O   . GLY A 1 135 ? -20.70612 -65.02433 -14.76142 1.000 50.03025  ? 631 GLY A O   1 
ATOM   1065 N N   . GLY A 1 136 ? -19.26479 -63.36239 -15.22512 1.000 51.21772  ? 632 GLY A N   1 
ATOM   1066 C CA  . GLY A 1 136 ? -18.09810 -64.14894 -14.89026 1.000 57.19970  ? 632 GLY A CA  1 
ATOM   1067 C C   . GLY A 1 136 ? -17.64672 -63.92354 -13.45989 1.000 58.26957  ? 632 GLY A C   1 
ATOM   1068 O O   . GLY A 1 136 ? -18.23956 -63.17140 -12.68718 1.000 57.17986  ? 632 GLY A O   1 
ATOM   1069 N N   . HIS A 1 137 ? -16.55808 -64.59585 -13.10705 1.000 61.90472  ? 633 HIS A N   1 
ATOM   1070 C CA  . HIS A 1 137 ? -16.02669 -64.42343 -11.76569 1.000 63.54461  ? 633 HIS A CA  1 
ATOM   1071 C C   . HIS A 1 137 ? -15.28156 -63.10879 -11.62256 1.000 54.48280  ? 633 HIS A C   1 
ATOM   1072 O O   . HIS A 1 137 ? -15.30371 -62.50397 -10.54395 1.000 55.81578  ? 633 HIS A O   1 
ATOM   1073 C CB  . HIS A 1 137 ? -15.10189 -65.57754 -11.39414 1.000 73.11287  ? 633 HIS A CB  1 
ATOM   1074 C CG  . HIS A 1 137 ? -14.62826 -65.50775 -9.98142  1.000 74.80686  ? 633 HIS A CG  1 
ATOM   1075 N ND1 . HIS A 1 137 ? -15.46963 -65.72022 -8.90950  1.000 73.76312  ? 633 HIS A ND1 1 
ATOM   1076 C CD2 . HIS A 1 137 ? -13.41845 -65.19591 -9.45955  1.000 74.47073  ? 633 HIS A CD2 1 
ATOM   1077 C CE1 . HIS A 1 137 ? -14.78804 -65.57297 -7.78703  1.000 76.57959  ? 633 HIS A CE1 1 
ATOM   1078 N NE2 . HIS A 1 137 ? -13.54153 -65.25545 -8.09312  1.000 76.22544  ? 633 HIS A NE2 1 
ATOM   1079 N N   . GLN A 1 138 ? -14.61307 -62.66802 -12.68348 1.000 44.98162  ? 634 GLN A N   1 
ATOM   1080 C CA  . GLN A 1 138 ? -14.03010 -61.34153 -12.73385 1.000 44.30350  ? 634 GLN A CA  1 
ATOM   1081 C C   . GLN A 1 138 ? -15.01383 -60.39785 -13.41133 1.000 40.54384  ? 634 GLN A C   1 
ATOM   1082 O O   . GLN A 1 138 ? -15.64311 -60.75557 -14.40812 1.000 48.10209  ? 634 GLN A O   1 
ATOM   1083 C CB  . GLN A 1 138 ? -12.69782 -61.37680 -13.48327 1.000 53.57801  ? 634 GLN A CB  1 
ATOM   1084 C CG  . GLN A 1 138 ? -12.19154 -60.02124 -13.97345 1.000 69.61262  ? 634 GLN A CG  1 
ATOM   1085 C CD  . GLN A 1 138 ? -11.62929 -59.15439 -12.85875 1.000 82.64061  ? 634 GLN A CD  1 
ATOM   1086 O OE1 . GLN A 1 138 ? -11.07960 -59.66349 -11.87306 1.000 91.36441  ? 634 GLN A OE1 1 
ATOM   1087 N NE2 . GLN A 1 138 ? -11.75757 -57.83223 -13.01287 1.000 75.23590  ? 634 GLN A NE2 1 
ATOM   1088 N N   . ARG A 1 139 ? -15.16575 -59.20296 -12.85178 1.000 38.83709  ? 635 ARG A N   1 
ATOM   1089 C CA  . ARG A 1 139 ? -16.02276 -58.19196 -13.45496 1.000 40.24411  ? 635 ARG A CA  1 
ATOM   1090 C C   . ARG A 1 139 ? -15.29196 -57.42420 -14.55665 1.000 43.69779  ? 635 ARG A C   1 
ATOM   1091 O O   . ARG A 1 139 ? -14.07581 -57.24585 -14.51185 1.000 38.46891  ? 635 ARG A O   1 
ATOM   1092 C CB  . ARG A 1 139 ? -16.50279 -57.21568 -12.38931 1.000 33.47114  ? 635 ARG A CB  1 
ATOM   1093 C CG  . ARG A 1 139 ? -17.37826 -57.85184 -11.32334 1.000 29.23437  ? 635 ARG A CG  1 
ATOM   1094 C CD  . ARG A 1 139 ? -18.62210 -57.05855 -11.18488 1.000 27.59882  ? 635 ARG A CD  1 
ATOM   1095 N NE  . ARG A 1 139 ? -19.64077 -57.69781 -10.36727 1.000 36.81313  ? 635 ARG A NE  1 
ATOM   1096 C CZ  . ARG A 1 139 ? -20.46544 -57.00975 -9.58429  1.000 31.57614  ? 635 ARG A CZ  1 
ATOM   1097 N NH1 . ARG A 1 139 ? -20.34171 -55.68517 -9.50095  1.000 26.06434  ? 635 ARG A NH1 1 
ATOM   1098 N NH2 . ARG A 1 139 ? -21.38655 -57.63442 -8.87125  1.000 27.04525  ? 635 ARG A NH2 1 
ATOM   1099 N N   . HIS A 1 140 ? -16.04557 -56.94234 -15.54366 1.000 36.42260  ? 636 HIS A N   1 
ATOM   1100 C CA  . HIS A 1 140 ? -15.47122 -56.12351 -16.60420 1.000 33.00115  ? 636 HIS A CA  1 
ATOM   1101 C C   . HIS A 1 140 ? -16.31299 -54.87472 -16.83256 1.000 37.94780  ? 636 HIS A C   1 
ATOM   1102 O O   . HIS A 1 140 ? -17.53745 -54.87857 -16.67469 1.000 34.09907  ? 636 HIS A O   1 
ATOM   1103 C CB  . HIS A 1 140 ? -15.35238 -56.90378 -17.92671 1.000 35.58841  ? 636 HIS A CB  1 
ATOM   1104 C CG  . HIS A 1 140 ? -14.58060 -58.18360 -17.80444 1.000 40.89201  ? 636 HIS A CG  1 
ATOM   1105 N ND1 . HIS A 1 140 ? -13.20396 -58.22179 -17.74894 1.000 40.12088  ? 636 HIS A ND1 1 
ATOM   1106 C CD2 . HIS A 1 140 ? -14.99706 -59.47029 -17.69597 1.000 42.15079  ? 636 HIS A CD2 1 
ATOM   1107 C CE1 . HIS A 1 140 ? -12.80489 -59.47619 -17.62214 1.000 42.31773  ? 636 HIS A CE1 1 
ATOM   1108 N NE2 . HIS A 1 140 ? -13.87214 -60.25400 -17.58738 1.000 43.37352  ? 636 HIS A NE2 1 
ATOM   1109 N N   . LYS A 1 141 ? -15.65229 -53.79541 -17.21451 1.000 31.93254  ? 637 LYS A N   1 
ATOM   1110 C CA  . LYS A 1 141 ? -16.38023 -52.60126 -17.62125 1.000 32.57889  ? 637 LYS A CA  1 
ATOM   1111 C C   . LYS A 1 141 ? -16.83079 -52.79316 -19.06063 1.000 36.22496  ? 637 LYS A C   1 
ATOM   1112 O O   . LYS A 1 141 ? -15.98511 -52.96227 -19.94767 1.000 40.18680  ? 637 LYS A O   1 
ATOM   1113 C CB  . LYS A 1 141 ? -15.47578 -51.38478 -17.47897 1.000 31.38679  ? 637 LYS A CB  1 
ATOM   1114 C CG  . LYS A 1 141 ? -16.06397 -50.07805 -17.91158 1.000 30.20515  ? 637 LYS A CG  1 
ATOM   1115 C CD  . LYS A 1 141 ? -15.05506 -48.95929 -17.61447 1.000 25.22495  ? 637 LYS A CD  1 
ATOM   1116 C CE  . LYS A 1 141 ? -15.63622 -47.60553 -17.98048 1.000 31.11517  ? 637 LYS A CE  1 
ATOM   1117 N NZ  . LYS A 1 141 ? -14.90322 -46.48911 -17.32326 1.000 37.94819  ? 637 LYS A NZ  1 
ATOM   1118 N N   . THR A 1 142 ? -18.15061 -52.81482 -19.30364 1.000 30.95740  ? 638 THR A N   1 
ATOM   1119 C CA  . THR A 1 142 ? -18.66083 -53.06032 -20.65447 1.000 31.18246  ? 638 THR A CA  1 
ATOM   1120 C C   . THR A 1 142 ? -19.65953 -51.99837 -21.07465 1.000 27.43913  ? 638 THR A C   1 
ATOM   1121 O O   . THR A 1 142 ? -20.37616 -51.40940 -20.25010 1.000 31.20881  ? 638 THR A O   1 
ATOM   1122 C CB  . THR A 1 142 ? -19.35124 -54.44122 -20.83335 1.000 26.83793  ? 638 THR A CB  1 
ATOM   1123 O OG1 . THR A 1 142 ? -20.52806 -54.51227 -20.01273 1.000 39.65908  ? 638 THR A OG1 1 
ATOM   1124 C CG2 . THR A 1 142 ? -18.41009 -55.58235 -20.47918 1.000 27.81222  ? 638 THR A CG2 1 
ATOM   1125 N N   . VAL A 1 143 ? -19.72052 -51.79211 -22.38630 1.000 26.28520  ? 639 VAL A N   1 
ATOM   1126 C CA  . VAL A 1 143 ? -20.65905 -50.86133 -22.98923 1.000 26.36503  ? 639 VAL A CA  1 
ATOM   1127 C C   . VAL A 1 143 ? -21.29605 -51.54261 -24.19364 1.000 36.50484  ? 639 VAL A C   1 
ATOM   1128 O O   . VAL A 1 143 ? -20.63216 -52.28049 -24.93175 1.000 37.27894  ? 639 VAL A O   1 
ATOM   1129 C CB  . VAL A 1 143 ? -19.96882 -49.53679 -23.36146 1.000 26.27839  ? 639 VAL A CB  1 
ATOM   1130 C CG1 . VAL A 1 143 ? -18.81517 -49.76934 -24.32604 1.000 30.47248  ? 639 VAL A CG1 1 
ATOM   1131 C CG2 . VAL A 1 143 ? -20.96589 -48.54884 -23.91867 1.000 26.68659  ? 639 VAL A CG2 1 
ATOM   1132 N N   . ALA A 1 144 ? -22.60404 -51.35567 -24.34505 1.000 37.25380  ? 640 ALA A N   1 
ATOM   1133 C CA  . ALA A 1 144 ? -23.31842 -51.86704 -25.49955 1.000 39.36145  ? 640 ALA A CA  1 
ATOM   1134 C C   . ALA A 1 144 ? -23.41684 -50.77405 -26.55625 1.000 38.22769  ? 640 ALA A C   1 
ATOM   1135 O O   . ALA A 1 144 ? -23.05049 -49.61810 -26.32484 1.000 34.77238  ? 640 ALA A O   1 
ATOM   1136 C CB  . ALA A 1 144 ? -24.70676 -52.37389 -25.09663 1.000 36.92160  ? 640 ALA A CB  1 
ATOM   1137 N N   . LEU A 1 145 ? -23.92148 -51.14393 -27.73560 1.000 40.53016  ? 641 LEU A N   1 
ATOM   1138 C CA  . LEU A 1 145 ? -23.90632 -50.18584 -28.83283 1.000 44.89496  ? 641 LEU A CA  1 
ATOM   1139 C C   . LEU A 1 145 ? -24.86568 -49.03171 -28.59732 1.000 48.78167  ? 641 LEU A C   1 
ATOM   1140 O O   . LEU A 1 145 ? -24.65283 -47.94913 -29.15816 1.000 50.67263  ? 641 LEU A O   1 
ATOM   1141 C CB  . LEU A 1 145 ? -24.23023 -50.87689 -30.15270 1.000 42.63683  ? 641 LEU A CB  1 
ATOM   1142 C CG  . LEU A 1 145 ? -23.20065 -51.87065 -30.68987 1.000 45.68548  ? 641 LEU A CG  1 
ATOM   1143 C CD1 . LEU A 1 145 ? -23.62475 -52.32492 -32.07682 1.000 48.37161  ? 641 LEU A CD1 1 
ATOM   1144 C CD2 . LEU A 1 145 ? -21.78672 -51.27981 -30.71422 1.000 37.68970  ? 641 LEU A CD2 1 
ATOM   1145 N N   . ASP A 1 146 ? -25.89225 -49.21950 -27.75852 1.000 44.27821  ? 642 ASP A N   1 
ATOM   1146 C CA  . ASP A 1 146 ? -26.78852 -48.11017 -27.46523 1.000 33.48926  ? 642 ASP A CA  1 
ATOM   1147 C C   . ASP A 1 146 ? -26.26136 -47.18445 -26.36407 1.000 44.39547  ? 642 ASP A C   1 
ATOM   1148 O O   . ASP A 1 146 ? -27.00601 -46.29957 -25.92588 1.000 43.36937  ? 642 ASP A O   1 
ATOM   1149 C CB  . ASP A 1 146 ? -28.18995 -48.62186 -27.11086 1.000 41.99420  ? 642 ASP A CB  1 
ATOM   1150 C CG  . ASP A 1 146 ? -28.18854 -49.74200 -26.06575 1.000 54.66649  ? 642 ASP A CG  1 
ATOM   1151 O OD1 . ASP A 1 146 ? -27.41895 -49.64921 -25.09258 1.000 57.36744  ? 642 ASP A OD1 1 
ATOM   1152 O OD2 . ASP A 1 146 ? -28.99220 -50.70149 -26.20387 1.000 57.82577  ? 642 ASP A OD2 1 
ATOM   1153 N N   . GLY A 1 147 ? -25.01056 -47.35673 -25.91444 1.000 41.22403  ? 643 GLY A N   1 
ATOM   1154 C CA  . GLY A 1 147 ? -24.43038 -46.52593 -24.86767 1.000 33.07418  ? 643 GLY A CA  1 
ATOM   1155 C C   . GLY A 1 147 ? -24.69719 -46.97784 -23.44141 1.000 31.01711  ? 643 GLY A C   1 
ATOM   1156 O O   . GLY A 1 147 ? -24.23468 -46.32126 -22.49768 1.000 36.89926  ? 643 GLY A O   1 
ATOM   1157 N N   . THR A 1 148 ? -25.43969 -48.05975 -23.24583 1.000 30.43831  ? 644 THR A N   1 
ATOM   1158 C CA  . THR A 1 148 ? -25.64218 -48.59669 -21.90534 1.000 33.28025  ? 644 THR A CA  1 
ATOM   1159 C C   . THR A 1 148 ? -24.32111 -49.15569 -21.39221 1.000 31.81309  ? 644 THR A C   1 
ATOM   1160 O O   . THR A 1 148 ? -23.72549 -50.03410 -22.02809 1.000 38.71672  ? 644 THR A O   1 
ATOM   1161 C CB  . THR A 1 148 ? -26.74045 -49.66054 -21.93505 1.000 27.26436  ? 644 THR A CB  1 
ATOM   1162 O OG1 . THR A 1 148 ? -27.94446 -49.04215 -22.38622 1.000 36.06287  ? 644 THR A OG1 1 
ATOM   1163 C CG2 . THR A 1 148 ? -27.00524 -50.27383 -20.55522 1.000 26.30534  ? 644 THR A CG2 1 
ATOM   1164 N N   . LEU A 1 149 ? -23.84729 -48.60979 -20.27110 1.000 24.77096  ? 645 LEU A N   1 
ATOM   1165 C CA  . LEU A 1 149 ? -22.53397 -48.90797 -19.71346 1.000 30.19512  ? 645 LEU A CA  1 
ATOM   1166 C C   . LEU A 1 149 ? -22.68793 -49.63916 -18.38658 1.000 30.68164  ? 645 LEU A C   1 
ATOM   1167 O O   . LEU A 1 149 ? -23.50013 -49.23655 -17.54865 1.000 28.29851  ? 645 LEU A O   1 
ATOM   1168 C CB  . LEU A 1 149 ? -21.74509 -47.61541 -19.48611 1.000 29.22275  ? 645 LEU A CB  1 
ATOM   1169 C CG  . LEU A 1 149 ? -20.33775 -47.73747 -18.90097 1.000 35.12665  ? 645 LEU A CG  1 
ATOM   1170 C CD1 . LEU A 1 149 ? -19.37194 -48.07493 -20.01151 1.000 33.38826  ? 645 LEU A CD1 1 
ATOM   1171 C CD2 . LEU A 1 149 ? -19.93061 -46.45132 -18.19485 1.000 28.02646  ? 645 LEU A CD2 1 
ATOM   1172 N N   . PHE A 1 150 ? -21.88536 -50.68621 -18.18266 1.000 24.02375  ? 646 PHE A N   1 
ATOM   1173 C CA  . PHE A 1 150 ? -21.87033 -51.45985 -16.94337 1.000 23.34909  ? 646 PHE A CA  1 
ATOM   1174 C C   . PHE A 1 150 ? -20.50872 -51.29370 -16.28154 1.000 28.77101  ? 646 PHE A C   1 
ATOM   1175 O O   . PHE A 1 150 ? -19.49093 -51.68339 -16.85904 1.000 23.82382  ? 646 PHE A O   1 
ATOM   1176 C CB  . PHE A 1 150 ? -22.12475 -52.94374 -17.21239 1.000 23.88418  ? 646 PHE A CB  1 
ATOM   1177 C CG  . PHE A 1 150 ? -23.44562 -53.24519 -17.89830 1.000 28.58573  ? 646 PHE A CG  1 
ATOM   1178 C CD1 . PHE A 1 150 ? -23.61401 -53.03440 -19.27369 1.000 24.89839  ? 646 PHE A CD1 1 
ATOM   1179 C CD2 . PHE A 1 150 ? -24.50776 -53.77504 -17.16499 1.000 31.14109  ? 646 PHE A CD2 1 
ATOM   1180 C CE1 . PHE A 1 150 ? -24.82668 -53.32382 -19.89417 1.000 32.43462  ? 646 PHE A CE1 1 
ATOM   1181 C CE2 . PHE A 1 150 ? -25.73423 -54.07720 -17.77722 1.000 24.97579  ? 646 PHE A CE2 1 
ATOM   1182 C CZ  . PHE A 1 150 ? -25.90047 -53.84213 -19.13894 1.000 25.65592  ? 646 PHE A CZ  1 
ATOM   1183 N N   . GLN A 1 151 ? -20.48054 -50.72935 -15.08443 1.000 23.13074  ? 647 GLN A N   1 
ATOM   1184 C CA  . GLN A 1 151 ? -19.21506 -50.57148 -14.39310 1.000 23.50684  ? 647 GLN A CA  1 
ATOM   1185 C C   . GLN A 1 151 ? -18.92186 -51.79137 -13.52386 1.000 30.63716  ? 647 GLN A C   1 
ATOM   1186 O O   . GLN A 1 151 ? -19.82288 -52.53758 -13.12641 1.000 23.89418  ? 647 GLN A O   1 
ATOM   1187 C CB  . GLN A 1 151 ? -19.23634 -49.32512 -13.51960 1.000 23.49717  ? 647 GLN A CB  1 
ATOM   1188 C CG  . GLN A 1 151 ? -19.67486 -48.08577 -14.23541 1.000 24.83927  ? 647 GLN A CG  1 
ATOM   1189 C CD  . GLN A 1 151 ? -18.49982 -47.22465 -14.64494 1.000 41.07093  ? 647 GLN A CD  1 
ATOM   1190 O OE1 . GLN A 1 151 ? -17.35245 -47.68000 -14.69157 1.000 42.48061  ? 647 GLN A OE1 1 
ATOM   1191 N NE2 . GLN A 1 151 ? -18.77986 -45.96678 -14.94076 1.000 54.18347  ? 647 GLN A NE2 1 
ATOM   1192 N N   . LYS A 1 152 ? -17.63821 -51.95732 -13.19575 1.000 26.22819  ? 648 LYS A N   1 
ATOM   1193 C CA  . LYS A 1 152 ? -17.22492 -53.03855 -12.30641 1.000 25.70964  ? 648 LYS A CA  1 
ATOM   1194 C C   . LYS A 1 152 ? -17.88529 -52.93171 -10.93983 1.000 32.90105  ? 648 LYS A C   1 
ATOM   1195 O O   . LYS A 1 152 ? -18.20667 -53.95829 -10.32192 1.000 26.16145  ? 648 LYS A O   1 
ATOM   1196 C CB  . LYS A 1 152 ? -15.70422 -53.03886 -12.15808 1.000 26.92438  ? 648 LYS A CB  1 
ATOM   1197 C CG  . LYS A 1 152 ? -14.96692 -53.72159 -13.29196 1.000 27.57842  ? 648 LYS A CG  1 
ATOM   1198 C CD  . LYS A 1 152 ? -13.45574 -53.35550 -13.30857 1.000 35.03823  ? 648 LYS A CD  1 
ATOM   1199 C CE  . LYS A 1 152 ? -12.59356 -54.57461 -13.01505 1.000 51.08795  ? 648 LYS A CE  1 
ATOM   1200 N NZ  . LYS A 1 152 ? -11.14044 -54.35014 -13.27324 1.000 56.33901  ? 648 LYS A NZ  1 
ATOM   1201 N N   . SER A 1 153 ? -18.12559 -51.70410 -10.46643 1.000 30.48457  ? 649 SER A N   1 
ATOM   1202 C CA  . SER A 1 153 ? -18.77626 -51.51401 -9.17813  1.000 25.52996  ? 649 SER A CA  1 
ATOM   1203 C C   . SER A 1 153 ? -20.21971 -51.98268 -9.19201  1.000 24.79929  ? 649 SER A C   1 
ATOM   1204 O O   . SER A 1 153 ? -20.79065 -52.17212 -8.11870  1.000 28.54648  ? 649 SER A O   1 
ATOM   1205 C CB  . SER A 1 153 ? -18.76115 -50.05134 -8.77159  1.000 25.63314  ? 649 SER A CB  1 
ATOM   1206 O OG  . SER A 1 153 ? -19.57686 -49.31674 -9.67962  1.000 24.69719  ? 649 SER A OG  1 
ATOM   1207 N N   . GLY A 1 154 ? -20.80820 -52.17041 -10.36735 1.000 24.06564  ? 650 GLY A N   1 
ATOM   1208 C CA  . GLY A 1 154 ? -22.17726 -52.61409 -10.50834 1.000 23.63550  ? 650 GLY A CA  1 
ATOM   1209 C C   . GLY A 1 154 ? -23.11412 -51.52685 -10.96822 1.000 23.11571  ? 650 GLY A C   1 
ATOM   1210 O O   . GLY A 1 154 ? -24.25110 -51.82544 -11.33470 1.000 22.94831  ? 650 GLY A O   1 
ATOM   1211 N N   . VAL A 1 155 ? -22.65425 -50.27424 -10.93126 1.000 23.15558  ? 651 VAL A N   1 
ATOM   1212 C CA  . VAL A 1 155 ? -23.38669 -49.13112 -11.46092 1.000 27.97876  ? 651 VAL A CA  1 
ATOM   1213 C C   . VAL A 1 155 ? -23.65055 -49.29195 -12.96151 1.000 22.78341  ? 651 VAL A C   1 
ATOM   1214 O O   . VAL A 1 155 ? -22.78377 -49.73509 -13.72312 1.000 22.72601  ? 651 VAL A O   1 
ATOM   1215 C CB  . VAL A 1 155 ? -22.57456 -47.85903 -11.16206 1.000 31.04642  ? 651 VAL A CB  1 
ATOM   1216 C CG1 . VAL A 1 155 ? -23.12430 -46.66114 -11.91694 1.000 23.64229  ? 651 VAL A CG1 1 
ATOM   1217 C CG2 . VAL A 1 155 ? -22.54001 -47.60737 -9.66251  1.000 24.11716  ? 651 VAL A CG2 1 
ATOM   1218 N N   . ILE A 1 156 ? -24.87995 -48.98113 -13.38066 1.000 22.91313  ? 652 ILE A N   1 
ATOM   1219 C CA  . ILE A 1 156 ? -25.29683 -49.04944 -14.77901 1.000 23.08208  ? 652 ILE A CA  1 
ATOM   1220 C C   . ILE A 1 156 ? -25.81104 -47.67498 -15.17931 1.000 23.61217  ? 652 ILE A C   1 
ATOM   1221 O O   . ILE A 1 156 ? -26.50064 -47.00922 -14.39355 1.000 28.74188  ? 652 ILE A O   1 
ATOM   1222 C CB  . ILE A 1 156 ? -26.38980 -50.12613 -14.97739 1.000 27.63812  ? 652 ILE A CB  1 
ATOM   1223 C CG1 . ILE A 1 156 ? -25.89239 -51.50048 -14.51925 1.000 29.37913  ? 652 ILE A CG1 1 
ATOM   1224 C CG2 . ILE A 1 156 ? -26.90310 -50.19091 -16.43374 1.000 24.40512  ? 652 ILE A CG2 1 
ATOM   1225 C CD1 . ILE A 1 156 ? -26.92001 -52.57657 -14.69464 1.000 23.52929  ? 652 ILE A CD1 1 
ATOM   1226 N N   A SER A 1 157 ? -25.47373 -47.23769 -16.39227 0.188 27.28747  ? 653 SER A N   1 
ATOM   1227 N N   B SER A 1 157 ? -25.50572 -47.26157 -16.40106 0.812 23.90916  ? 653 SER A N   1 
ATOM   1228 C CA  A SER A 1 157 ? -25.94240 -45.95180 -16.89445 0.188 29.69889  ? 653 SER A CA  1 
ATOM   1229 C CA  B SER A 1 157 ? -25.95351 -45.96413 -16.89144 0.812 32.47237  ? 653 SER A CA  1 
ATOM   1230 C C   A SER A 1 157 ? -26.33668 -46.06889 -18.36113 0.188 28.95745  ? 653 SER A C   1 
ATOM   1231 C C   B SER A 1 157 ? -26.31102 -46.04918 -18.37277 0.812 30.01228  ? 653 SER A C   1 
ATOM   1232 O O   A SER A 1 157 ? -25.90173 -46.98047 -19.06953 0.188 26.60562  ? 653 SER A O   1 
ATOM   1233 O O   B SER A 1 157 ? -25.81489 -46.91134 -19.10762 0.812 25.22530  ? 653 SER A O   1 
ATOM   1234 C CB  A SER A 1 157 ? -24.88177 -44.85408 -16.73403 0.188 28.24573  ? 653 SER A CB  1 
ATOM   1235 C CB  B SER A 1 157 ? -24.87243 -44.89848 -16.67686 0.812 27.40154  ? 653 SER A CB  1 
ATOM   1236 O OG  A SER A 1 157 ? -25.34045 -43.63582 -17.29768 0.188 30.41568  ? 653 SER A OG  1 
ATOM   1237 O OG  B SER A 1 157 ? -23.84221 -45.09116 -17.61879 0.812 24.58131  ? 653 SER A OG  1 
ATOM   1238 N N   . GLY A 1 158 ? -27.15808 -45.12854 -18.81699 1.000 26.62061  ? 654 GLY A N   1 
ATOM   1239 C CA  . GLY A 1 158 ? -27.51659 -45.11209 -20.22267 1.000 27.69404  ? 654 GLY A CA  1 
ATOM   1240 C C   . GLY A 1 158 ? -28.43003 -43.96120 -20.58483 1.000 30.03689  ? 654 GLY A C   1 
ATOM   1241 O O   . GLY A 1 158 ? -28.68636 -43.04500 -19.78810 1.000 30.76350  ? 654 GLY A O   1 
ATOM   1242 N N   . GLY A 1 159 ? -28.94188 -44.04939 -21.81194 1.000 31.88889  ? 655 GLY A N   1 
ATOM   1243 C CA  . GLY A 1 159 ? -29.82515 -43.04755 -22.39148 1.000 35.02445  ? 655 GLY A CA  1 
ATOM   1244 C C   . GLY A 1 159 ? -29.38489 -42.75971 -23.81552 1.000 40.12988  ? 655 GLY A C   1 
ATOM   1245 O O   . GLY A 1 159 ? -28.46176 -41.96237 -24.04471 1.000 33.85394  ? 655 GLY A O   1 
ATOM   1246 N N   . ALA A 1 160 ? -30.00802 -43.43253 -24.78279 1.000 53.53160  ? 656 ALA A N   1 
ATOM   1247 C CA  . ALA A 1 160 ? -29.39156 -43.51457 -26.09730 1.000 54.33427  ? 656 ALA A CA  1 
ATOM   1248 C C   . ALA A 1 160 ? -29.61036 -42.26136 -26.93858 1.000 55.23013  ? 656 ALA A C   1 
ATOM   1249 O O   . ALA A 1 160 ? -28.76538 -41.94134 -27.77792 1.000 57.20759  ? 656 ALA A O   1 
ATOM   1250 C CB  . ALA A 1 160 ? -29.89702 -44.74522 -26.84299 1.000 53.64774  ? 656 ALA A CB  1 
ATOM   1251 N N   . SER A 1 161 ? -30.70946 -41.53636 -26.75141 1.000 54.93512  ? 657 SER A N   1 
ATOM   1252 C CA  . SER A 1 161 ? -30.91474 -40.40813 -27.64410 1.000 57.77750  ? 657 SER A CA  1 
ATOM   1253 C C   . SER A 1 161 ? -30.03619 -39.22738 -27.24426 1.000 57.16742  ? 657 SER A C   1 
ATOM   1254 O O   . SER A 1 161 ? -29.63159 -38.44292 -28.10840 1.000 60.07489  ? 657 SER A O   1 
ATOM   1255 C CB  . SER A 1 161 ? -32.39490 -40.00628 -27.69369 1.000 55.44660  ? 657 SER A CB  1 
ATOM   1256 O OG  . SER A 1 161 ? -32.67357 -38.89848 -26.85445 1.000 57.01657  ? 657 SER A OG  1 
ATOM   1257 N N   . ASP A 1 162 ? -29.69425 -39.10211 -25.96345 1.000 56.98187  ? 658 ASP A N   1 
ATOM   1258 C CA  . ASP A 1 162 ? -28.76998 -38.04414 -25.56712 1.000 58.27433  ? 658 ASP A CA  1 
ATOM   1259 C C   . ASP A 1 162 ? -27.35245 -38.34659 -26.03833 1.000 59.12442  ? 658 ASP A C   1 
ATOM   1260 O O   . ASP A 1 162 ? -26.59334 -37.42595 -26.36296 1.000 60.48491  ? 658 ASP A O   1 
ATOM   1261 C CB  . ASP A 1 162 ? -28.80231 -37.84908 -24.04757 1.000 57.96870  ? 658 ASP A CB  1 
ATOM   1262 C CG  . ASP A 1 162 ? -29.88544 -36.85677 -23.59528 1.000 62.35517  ? 658 ASP A CG  1 
ATOM   1263 O OD1 . ASP A 1 162 ? -30.91651 -36.67625 -24.29918 1.000 63.93415  ? 658 ASP A OD1 1 
ATOM   1264 O OD2 . ASP A 1 162 ? -29.70064 -36.25704 -22.51470 1.000 58.62142  ? 658 ASP A OD2 1 
ATOM   1265 N N   . LEU A 1 163 ? -26.99362 -39.62774 -26.10907 1.000 58.42228  ? 659 LEU A N   1 
ATOM   1266 C CA  . LEU A 1 163 ? -25.68326 -40.02714 -26.60343 1.000 59.20322  ? 659 LEU A CA  1 
ATOM   1267 C C   . LEU A 1 163 ? -25.60653 -40.00423 -28.12613 1.000 59.76408  ? 659 LEU A C   1 
ATOM   1268 O O   . LEU A 1 163 ? -24.52065 -39.80911 -28.68142 1.000 74.83193  ? 659 LEU A O   1 
ATOM   1269 C CB  . LEU A 1 163 ? -25.33650 -41.42125 -26.07700 1.000 58.38147  ? 659 LEU A CB  1 
ATOM   1270 C CG  . LEU A 1 163 ? -25.09252 -41.49784 -24.57436 1.000 58.16488  ? 659 LEU A CG  1 
ATOM   1271 C CD1 . LEU A 1 163 ? -25.05386 -42.95283 -24.12764 1.000 58.13383  ? 659 LEU A CD1 1 
ATOM   1272 C CD2 . LEU A 1 163 ? -23.80530 -40.79512 -24.21331 1.000 59.56334  ? 659 LEU A CD2 1 
ATOM   1273 N N   . LYS A 1 164 ? -26.73026 -40.21821 -28.81512 1.000 59.13214  ? 660 LYS A N   1 
ATOM   1274 C CA  . LYS A 1 164 ? -26.74196 -40.09843 -30.26937 1.000 59.83338  ? 660 LYS A CA  1 
ATOM   1275 C C   . LYS A 1 164 ? -26.55654 -38.64832 -30.69764 1.000 63.42008  ? 660 LYS A C   1 
ATOM   1276 O O   . LYS A 1 164 ? -25.82293 -38.36133 -31.65435 1.000 62.33123  ? 660 LYS A O   1 
ATOM   1277 C CB  . LYS A 1 164 ? -28.04453 -40.66069 -30.83658 1.000 58.94940  ? 660 LYS A CB  1 
ATOM   1278 C CG  . LYS A 1 164 ? -28.17424 -40.49918 -32.34689 1.000 63.94505  ? 660 LYS A CG  1 
ATOM   1279 C CD  . LYS A 1 164 ? -28.99854 -41.60386 -32.98191 1.000 63.69537  ? 660 LYS A CD  1 
ATOM   1280 C CE  . LYS A 1 164 ? -30.39788 -41.12335 -33.30361 1.000 64.62654  ? 660 LYS A CE  1 
ATOM   1281 N NZ  . LYS A 1 164 ? -30.38657 -40.01123 -34.30233 1.000 71.98123  ? 660 LYS A NZ  1 
ATOM   1282 N N   . ALA A 1 165 ? -27.18432 -37.72109 -29.97114 1.000 61.23795  ? 661 ALA A N   1 
ATOM   1283 C CA  . ALA A 1 165 ? -27.07356 -36.30176 -30.28145 1.000 62.65786  ? 661 ALA A CA  1 
ATOM   1284 C C   . ALA A 1 165 ? -25.65322 -35.76302 -30.12972 1.000 65.85940  ? 661 ALA A C   1 
ATOM   1285 O O   . ALA A 1 165 ? -25.34166 -34.71528 -30.70293 1.000 79.24125  ? 661 ALA A O   1 
ATOM   1286 C CB  . ALA A 1 165 ? -28.02796 -35.49690 -29.39914 1.000 62.43111  ? 661 ALA A CB  1 
ATOM   1287 N N   . LYS A 1 166 ? -24.77871 -36.43113 -29.38192 1.000 66.36085  ? 662 LYS A N   1 
ATOM   1288 C CA  . LYS A 1 166 ? -23.38061 -36.01962 -29.35092 1.000 79.65197  ? 662 LYS A CA  1 
ATOM   1289 C C   . LYS A 1 166 ? -22.43296 -37.02513 -29.97898 1.000 72.88305  ? 662 LYS A C   1 
ATOM   1290 O O   . LYS A 1 166 ? -21.23219 -36.75534 -30.04343 1.000 79.41185  ? 662 LYS A O   1 
ATOM   1291 C CB  . LYS A 1 166 ? -22.93242 -35.70152 -27.92525 1.000 86.09533  ? 662 LYS A CB  1 
ATOM   1292 C CG  . LYS A 1 166 ? -23.89578 -34.77222 -27.21238 1.000 94.90639  ? 662 LYS A CG  1 
ATOM   1293 C CD  . LYS A 1 166 ? -23.65340 -34.68787 -25.71551 1.000 94.06578  ? 662 LYS A CD  1 
ATOM   1294 C CE  . LYS A 1 166 ? -23.05449 -35.94886 -25.13985 1.000 91.91582  ? 662 LYS A CE  1 
ATOM   1295 N NZ  . LYS A 1 166 ? -23.34392 -36.04724 -23.68450 1.000 89.00024  ? 662 LYS A NZ  1 
ATOM   1296 N N   . ALA A 1 167 ? -22.93007 -38.16790 -30.44837 1.000 65.58596  ? 663 ALA A N   1 
ATOM   1297 C CA  . ALA A 1 167 ? -22.13504 -38.99235 -31.34859 1.000 66.55594  ? 663 ALA A CA  1 
ATOM   1298 C C   . ALA A 1 167 ? -22.12025 -38.44036 -32.77450 1.000 72.26547  ? 663 ALA A C   1 
ATOM   1299 O O   . ALA A 1 167 ? -21.17366 -38.70884 -33.52585 1.000 65.86423  ? 663 ALA A O   1 
ATOM   1300 C CB  . ALA A 1 167 ? -22.64532 -40.43512 -31.34157 1.000 62.70890  ? 663 ALA A CB  1 
ATOM   1301 N N   . ARG A 1 168 ? -23.12498 -37.64398 -33.15732 1.000 71.21821  ? 664 ARG A N   1 
ATOM   1302 C CA  . ARG A 1 168 ? -23.09486 -36.99035 -34.46260 1.000 73.42063  ? 664 ARG A CA  1 
ATOM   1303 C C   . ARG A 1 168 ? -21.96602 -35.97496 -34.55650 1.000 75.87161  ? 664 ARG A C   1 
ATOM   1304 O O   . ARG A 1 168 ? -21.62132 -35.54549 -35.66182 1.000 69.99958  ? 664 ARG A O   1 
ATOM   1305 C CB  . ARG A 1 168 ? -24.43426 -36.30423 -34.75287 1.000 74.85327  ? 664 ARG A CB  1 
ATOM   1306 C CG  . ARG A 1 168 ? -24.66094 -35.05143 -33.91942 1.000 77.88761  ? 664 ARG A CG  1 
ATOM   1307 C CD  . ARG A 1 168 ? -26.07940 -34.52119 -34.03789 1.000 81.65275  ? 664 ARG A CD  1 
ATOM   1308 N NE  . ARG A 1 168 ? -26.49605 -33.85019 -32.80646 1.000 88.42248  ? 664 ARG A NE  1 
ATOM   1309 C CZ  . ARG A 1 168 ? -26.43974 -32.53575 -32.59431 1.000 96.23238  ? 664 ARG A CZ  1 
ATOM   1310 N NH1 . ARG A 1 168 ? -26.84283 -32.04457 -31.42451 1.000 88.79207  ? 664 ARG A NH1 1 
ATOM   1311 N NH2 . ARG A 1 168 ? -25.98400 -31.71354 -33.54028 1.000 101.45911 ? 664 ARG A NH2 1 
ATOM   1312 N N   . ARG A 1 169 ? -21.37782 -35.59306 -33.41953 1.000 83.02532  ? 665 ARG A N   1 
ATOM   1313 C CA  . ARG A 1 169 ? -20.20954 -34.73095 -33.43167 1.000 69.78432  ? 665 ARG A CA  1 
ATOM   1314 C C   . ARG A 1 169 ? -19.01656 -35.38521 -34.11261 1.000 70.28509  ? 665 ARG A C   1 
ATOM   1315 O O   . ARG A 1 169 ? -18.15902 -34.67379 -34.64375 1.000 71.74838  ? 665 ARG A O   1 
ATOM   1316 C CB  . ARG A 1 169 ? -19.85600 -34.32189 -32.01025 1.000 69.82367  ? 665 ARG A CB  1 
ATOM   1317 C CG  . ARG A 1 169 ? -19.25808 -32.96022 -31.96376 1.000 75.71038  ? 665 ARG A CG  1 
ATOM   1318 C CD  . ARG A 1 169 ? -19.66824 -32.18615 -30.74556 1.000 71.64510  ? 665 ARG A CD  1 
ATOM   1319 N NE  . ARG A 1 169 ? -19.17762 -32.82031 -29.53241 1.000 80.11282  ? 665 ARG A NE  1 
ATOM   1320 C CZ  . ARG A 1 169 ? -17.98342 -32.60748 -28.98475 1.000 77.72810  ? 665 ARG A CZ  1 
ATOM   1321 N NH1 . ARG A 1 169 ? -17.66319 -33.25213 -27.86804 1.000 73.98204  ? 665 ARG A NH1 1 
ATOM   1322 N NH2 . ARG A 1 169 ? -17.11398 -31.77041 -29.54040 1.000 73.67978  ? 665 ARG A NH2 1 
ATOM   1323 N N   . TRP A 1 170 ? -18.96756 -36.72078 -34.13532 1.000 69.17849  ? 666 TRP A N   1 
ATOM   1324 C CA  . TRP A 1 170 ? -17.89626 -37.44097 -34.81327 1.000 69.63540  ? 666 TRP A CA  1 
ATOM   1325 C C   . TRP A 1 170 ? -17.89022 -37.19015 -36.31077 1.000 75.77520  ? 666 TRP A C   1 
ATOM   1326 O O   . TRP A 1 170 ? -16.82083 -37.19516 -36.93131 1.000 81.75916  ? 666 TRP A O   1 
ATOM   1327 C CB  . TRP A 1 170 ? -18.02677 -38.93432 -34.56391 1.000 68.31090  ? 666 TRP A CB  1 
ATOM   1328 C CG  . TRP A 1 170 ? -17.56424 -39.34047 -33.21911 1.000 74.98812  ? 666 TRP A CG  1 
ATOM   1329 C CD1 . TRP A 1 170 ? -18.33601 -39.81922 -32.19915 1.000 67.46793  ? 666 TRP A CD1 1 
ATOM   1330 C CD2 . TRP A 1 170 ? -16.21838 -39.30590 -32.71860 1.000 72.54250  ? 666 TRP A CD2 1 
ATOM   1331 N NE1 . TRP A 1 170 ? -17.55670 -40.08560 -31.09997 1.000 66.60233  ? 666 TRP A NE1 1 
ATOM   1332 C CE2 . TRP A 1 170 ? -16.25411 -39.78757 -31.39262 1.000 68.92973  ? 666 TRP A CE2 1 
ATOM   1333 C CE3 . TRP A 1 170 ? -14.99334 -38.91275 -33.25765 1.000 70.10907  ? 666 TRP A CE3 1 
ATOM   1334 C CZ2 . TRP A 1 170 ? -15.11563 -39.89567 -30.60704 1.000 68.61488  ? 666 TRP A CZ2 1 
ATOM   1335 C CZ3 . TRP A 1 170 ? -13.86774 -39.02321 -32.47816 1.000 70.72372  ? 666 TRP A CZ3 1 
ATOM   1336 C CH2 . TRP A 1 170 ? -13.93593 -39.50973 -31.16193 1.000 78.99833  ? 666 TRP A CH2 1 
ATOM   1337 N N   . ASP A 1 171 ? -19.06160 -36.99768 -36.91269 1.000 84.14094  ? 667 ASP A N   1 
ATOM   1338 C CA  . ASP A 1 171 ? -19.12981 -36.80588 -38.35067 1.000 85.05918  ? 667 ASP A CA  1 
ATOM   1339 C C   . ASP A 1 171 ? -19.15868 -35.34003 -38.76340 1.000 86.87847  ? 667 ASP A C   1 
ATOM   1340 O O   . ASP A 1 171 ? -18.72961 -35.02627 -39.87543 1.000 88.64855  ? 667 ASP A O   1 
ATOM   1341 C CB  . ASP A 1 171 ? -20.35266 -37.53389 -38.92650 1.000 83.98861  ? 667 ASP A CB  1 
ATOM   1342 C CG  . ASP A 1 171 ? -20.21487 -39.05766 -38.87550 1.000 84.58578  ? 667 ASP A CG  1 
ATOM   1343 O OD1 . ASP A 1 171 ? -19.07937 -39.57690 -38.98261 1.000 82.53241  ? 667 ASP A OD1 1 
ATOM   1344 O OD2 . ASP A 1 171 ? -21.25618 -39.73946 -38.75174 1.000 85.12697  ? 667 ASP A OD2 1 
ATOM   1345 N N   . GLU A 1 172 ? -19.61333 -34.43472 -37.89296 1.000 86.96285  ? 668 GLU A N   1 
ATOM   1346 C CA  . GLU A 1 172 ? -19.72529 -33.03068 -38.27616 1.000 88.94512  ? 668 GLU A CA  1 
ATOM   1347 C C   . GLU A 1 172 ? -18.38878 -32.29741 -38.22049 1.000 91.20261  ? 668 GLU A C   1 
ATOM   1348 O O   . GLU A 1 172 ? -18.20201 -31.31931 -38.94918 1.000 113.52676 ? 668 GLU A O   1 
ATOM   1349 C CB  . GLU A 1 172 ? -20.74409 -32.31422 -37.38733 1.000 91.70033  ? 668 GLU A CB  1 
ATOM   1350 C CG  . GLU A 1 172 ? -20.31581 -32.22709 -35.94663 1.000 106.85998 ? 668 GLU A CG  1 
ATOM   1351 C CD  . GLU A 1 172 ? -21.18182 -31.32679 -35.10443 1.000 116.84663 ? 668 GLU A CD  1 
ATOM   1352 O OE1 . GLU A 1 172 ? -20.63813 -30.35207 -34.54110 1.000 123.33133 ? 668 GLU A OE1 1 
ATOM   1353 O OE2 . GLU A 1 172 ? -22.39643 -31.60288 -34.99301 1.000 116.10988 ? 668 GLU A OE2 1 
ATOM   1354 N N   . LYS A 1 173 ? -17.45367 -32.73097 -37.37394 1.000 91.15411  ? 669 LYS A N   1 
ATOM   1355 C CA  . LYS A 1 173 ? -16.16178 -32.05938 -37.32124 1.000 96.93537  ? 669 LYS A CA  1 
ATOM   1356 C C   . LYS A 1 173 ? -15.27930 -32.46504 -38.48945 1.000 104.30425 ? 669 LYS A C   1 
ATOM   1357 O O   . LYS A 1 173 ? -14.30275 -31.75992 -38.78581 1.000 106.99498 ? 669 LYS A O   1 
ATOM   1358 C CB  . LYS A 1 173 ? -15.44569 -32.35618 -36.00381 1.000 99.90965  ? 669 LYS A CB  1 
ATOM   1359 C CG  . LYS A 1 173 ? -15.31817 -33.82545 -35.74086 1.000 101.17344 ? 669 LYS A CG  1 
ATOM   1360 C CD  . LYS A 1 173 ? -13.91638 -34.30418 -35.95291 1.000 100.63729 ? 669 LYS A CD  1 
ATOM   1361 C CE  . LYS A 1 173 ? -13.96749 -35.75055 -36.30313 1.000 93.24169  ? 669 LYS A CE  1 
ATOM   1362 N NZ  . LYS A 1 173 ? -12.60497 -36.32220 -36.28880 1.000 94.09151  ? 669 LYS A NZ  1 
ATOM   1363 N N   . ALA A 1 174 ? -15.58106 -33.60659 -39.12008 1.000 102.85566 ? 670 ALA A N   1 
ATOM   1364 C CA  . ALA A 1 174 ? -15.01097 -33.93735 -40.42039 1.000 104.04301 ? 670 ALA A CA  1 
ATOM   1365 C C   . ALA A 1 174 ? -15.23955 -32.77955 -41.37915 1.000 102.99430 ? 670 ALA A C   1 
ATOM   1366 O O   . ALA A 1 174 ? -16.32835 -32.20031 -41.40268 1.000 97.12452  ? 670 ALA A O   1 
ATOM   1367 C CB  . ALA A 1 174 ? -15.63865 -35.21910 -40.96798 1.000 99.90935  ? 670 ALA A CB  1 
ATOM   1368 N N   . VAL A 1 175 ? -14.19394 -32.46426 -42.15498 1.000 112.57098 ? 671 VAL A N   1 
ATOM   1369 C CA  . VAL A 1 175 ? -13.93212 -31.21051 -42.86867 1.000 126.13508 ? 671 VAL A CA  1 
ATOM   1370 C C   . VAL A 1 175 ? -15.17896 -30.50846 -43.40988 1.000 125.68961 ? 671 VAL A C   1 
ATOM   1371 O O   . VAL A 1 175 ? -16.09236 -31.14923 -43.95149 1.000 133.13464 ? 671 VAL A O   1 
ATOM   1372 C CB  . VAL A 1 175 ? -12.88782 -31.48210 -43.98224 1.000 133.07790 ? 671 VAL A CB  1 
ATOM   1373 C CG1 . VAL A 1 175 ? -11.77090 -32.35041 -43.44068 1.000 132.45805 ? 671 VAL A CG1 1 
ATOM   1374 C CG2 . VAL A 1 175 ? -13.48631 -32.17173 -45.22582 1.000 133.54527 ? 671 VAL A CG2 1 
ATOM   1375 N N   . ASP A 1 176 ? -15.28094 -29.19652 -43.19748 1.000 114.02558 ? 672 ASP A N   1 
ATOM   1376 C CA  . ASP A 1 176 ? -16.31582 -28.50046 -43.94176 1.000 113.93473 ? 672 ASP A CA  1 
ATOM   1377 C C   . ASP A 1 176 ? -15.79127 -28.33021 -45.35584 1.000 118.76772 ? 672 ASP A C   1 
ATOM   1378 O O   . ASP A 1 176 ? -14.85632 -27.56050 -45.60325 1.000 121.90478 ? 672 ASP A O   1 
ATOM   1379 C CB  . ASP A 1 176 ? -16.72224 -27.16373 -43.32728 1.000 115.00802 ? 672 ASP A CB  1 
ATOM   1380 C CG  . ASP A 1 176 ? -17.93795 -26.52901 -44.05000 1.000 119.18493 ? 672 ASP A CG  1 
ATOM   1381 O OD1 . ASP A 1 176 ? -18.40218 -25.44858 -43.62977 1.000 123.39049 ? 672 ASP A OD1 1 
ATOM   1382 O OD2 . ASP A 1 176 ? -18.45561 -27.10693 -45.03418 1.000 118.79245 ? 672 ASP A OD2 1 
ATOM   1383 N N   . LYS A 1 177 ? -16.41740 -29.06089 -46.27793 1.000 117.81221 ? 673 LYS A N   1 
ATOM   1384 C CA  . LYS A 1 177 ? -16.12843 -29.01515 -47.70428 1.000 121.88544 ? 673 LYS A CA  1 
ATOM   1385 C C   . LYS A 1 177 ? -16.15821 -27.60427 -48.29027 1.000 118.25250 ? 673 LYS A C   1 
ATOM   1386 O O   . LYS A 1 177 ? -15.62735 -27.38923 -49.38278 1.000 120.03639 ? 673 LYS A O   1 
ATOM   1387 C CB  . LYS A 1 177 ? -17.14817 -29.92659 -48.40148 1.000 126.25003 ? 673 LYS A CB  1 
ATOM   1388 C CG  . LYS A 1 177 ? -18.56174 -29.85244 -47.79069 1.000 121.32348 ? 673 LYS A CG  1 
ATOM   1389 C CD  . LYS A 1 177 ? -19.49070 -30.97674 -48.26437 1.000 112.32407 ? 673 LYS A CD  1 
ATOM   1390 C CE  . LYS A 1 177 ? -19.52215 -31.09786 -49.78728 1.000 109.59739 ? 673 LYS A CE  1 
ATOM   1391 N NZ  . LYS A 1 177 ? -20.74510 -31.79273 -50.27559 1.000 108.68912 ? 673 LYS A NZ  1 
ATOM   1392 N N   . LEU A 1 178 ? -16.75259 -26.64459 -47.58858 1.000 115.36316 ? 674 LEU A N   1 
ATOM   1393 C CA  . LEU A 1 178 ? -16.90074 -25.28484 -48.06142 1.000 118.51663 ? 674 LEU A CA  1 
ATOM   1394 C C   . LEU A 1 178 ? -16.04674 -24.32989 -47.22779 1.000 119.97965 ? 674 LEU A C   1 
ATOM   1395 O O   . LEU A 1 178 ? -14.81943 -24.32992 -47.32362 1.000 122.52413 ? 674 LEU A O   1 
ATOM   1396 C CB  . LEU A 1 178 ? -18.37445 -24.88026 -48.00130 1.000 116.93282 ? 674 LEU A CB  1 
ATOM   1397 C CG  . LEU A 1 178 ? -19.29715 -25.11972 -49.20408 1.000 118.00016 ? 674 LEU A CG  1 
ATOM   1398 C CD1 . LEU A 1 178 ? -19.12983 -26.49424 -49.84040 1.000 117.31061 ? 674 LEU A CD1 1 
ATOM   1399 C CD2 . LEU A 1 178 ? -20.73748 -24.92369 -48.77649 1.000 115.90104 ? 674 LEU A CD2 1 
ATOM   1400 N N   A ALA B 2 16  ? -26.44665 -29.82647 -20.37343 0.444 71.00551  ? 500 ALA B N   1 
ATOM   1401 N N   B ALA B 2 16  ? -29.10823 -25.65216 -10.89372 0.556 61.65469  ? 500 ALA B N   1 
ATOM   1402 C CA  A ALA B 2 16  ? -26.20017 -31.25051 -20.18234 0.444 65.78722  ? 500 ALA B CA  1 
ATOM   1403 C CA  B ALA B 2 16  ? -28.01688 -26.35694 -10.24026 0.556 65.24941  ? 500 ALA B CA  1 
ATOM   1404 C C   A ALA B 2 16  ? -26.59764 -31.68598 -18.77846 0.444 58.97927  ? 500 ALA B C   1 
ATOM   1405 C C   B ALA B 2 16  ? -27.96262 -27.81199 -10.68847 0.556 66.68155  ? 500 ALA B C   1 
ATOM   1406 O O   A ALA B 2 16  ? -27.78488 -31.79388 -18.49733 0.444 57.70616  ? 500 ALA B O   1 
ATOM   1407 O O   B ALA B 2 16  ? -26.87941 -28.35039 -10.91845 0.556 70.82477  ? 500 ALA B O   1 
ATOM   1408 C CB  A ALA B 2 16  ? -24.73533 -31.58126 -20.45180 0.444 69.27941  ? 500 ALA B CB  1 
ATOM   1409 C CB  B ALA B 2 16  ? -28.15460 -26.27157 -8.72520  0.556 66.17106  ? 500 ALA B CB  1 
ATOM   1410 N N   A THR B 2 17  ? -25.58131 -31.87812 -17.92277 0.444 59.91388  ? 501 THR B N   1 
ATOM   1411 N N   B THR B 2 17  ? -29.12264 -28.45656 -10.80879 0.556 58.80090  ? 501 THR B N   1 
ATOM   1412 C CA  A THR B 2 17  ? -25.61950 -32.51515 -16.60158 0.444 53.14903  ? 501 THR B CA  1 
ATOM   1413 C CA  B THR B 2 17  ? -29.16010 -29.84673 -11.24062 0.556 54.75784  ? 501 THR B CA  1 
ATOM   1414 C C   A THR B 2 17  ? -26.91111 -32.31579 -15.81797 0.444 47.61079  ? 501 THR B C   1 
ATOM   1415 C C   B THR B 2 17  ? -29.23239 -29.90973 -12.75840 0.556 46.46133  ? 501 THR B C   1 
ATOM   1416 O O   A THR B 2 17  ? -27.60883 -33.28865 -15.52519 0.444 42.55327  ? 501 THR B O   1 
ATOM   1417 O O   B THR B 2 17  ? -30.05793 -29.22668 -13.37050 0.556 41.58731  ? 501 THR B O   1 
ATOM   1418 C CB  A THR B 2 17  ? -24.43710 -32.01509 -15.75927 0.444 49.79378  ? 501 THR B CB  1 
ATOM   1419 C CB  B THR B 2 17  ? -30.34502 -30.61137 -10.64723 0.556 48.86996  ? 501 THR B CB  1 
ATOM   1420 O OG1 A THR B 2 17  ? -23.20881 -32.47487 -16.33838 0.444 51.40818  ? 501 THR B OG1 1 
ATOM   1421 O OG1 B THR B 2 17  ? -30.58029 -30.20171 -9.29334  0.556 45.74220  ? 501 THR B OG1 1 
ATOM   1422 C CG2 A THR B 2 17  ? -24.53032 -32.51513 -14.31895 0.444 35.30948  ? 501 THR B CG2 1 
ATOM   1423 C CG2 B THR B 2 17  ? -30.03388 -32.09417 -10.68351 0.556 43.64053  ? 501 THR B CG2 1 
ATOM   1424 N N   A GLY B 2 18  ? -27.26365 -31.06253 -15.52410 0.444 52.48277  ? 502 GLY B N   1 
ATOM   1425 N N   B GLY B 2 18  ? -28.39407 -30.76299 -13.34700 0.556 48.84307  ? 502 GLY B N   1 
ATOM   1426 C CA  A GLY B 2 18  ? -28.41417 -30.80745 -14.66992 0.444 51.89492  ? 502 GLY B CA  1 
ATOM   1427 C CA  B GLY B 2 18  ? -28.31906 -30.85857 -14.79265 0.556 51.79760  ? 502 GLY B CA  1 
ATOM   1428 C C   A GLY B 2 18  ? -29.74079 -31.12496 -15.33417 0.444 56.88744  ? 502 GLY B C   1 
ATOM   1429 C C   B GLY B 2 18  ? -29.61397 -31.32772 -15.42941 0.556 56.91660  ? 502 GLY B C   1 
ATOM   1430 O O   A GLY B 2 18  ? -30.63821 -31.69163 -14.70362 0.444 59.33265  ? 502 GLY B O   1 
ATOM   1431 O O   B GLY B 2 18  ? -30.34732 -32.15710 -14.88734 0.556 59.46254  ? 502 GLY B O   1 
ATOM   1432 N N   . LYS B 2 19  ? -29.88430 -30.77269 -16.61396 1.000 59.90391  ? 503 LYS B N   1 
ATOM   1433 C CA  . LYS B 2 19  ? -31.13968 -31.02906 -17.30787 1.000 65.65971  ? 503 LYS B CA  1 
ATOM   1434 C C   . LYS B 2 19  ? -31.22587 -32.46610 -17.80405 1.000 58.25570  ? 503 LYS B C   1 
ATOM   1435 O O   . LYS B 2 19  ? -32.30668 -33.06471 -17.78758 1.000 70.16933  ? 503 LYS B O   1 
ATOM   1436 C CB  . LYS B 2 19  ? -31.30549 -30.05038 -18.47539 1.000 71.15698  ? 503 LYS B CB  1 
ATOM   1437 C CG  . LYS B 2 19  ? -32.48734 -29.10322 -18.31126 1.000 81.83154  ? 503 LYS B CG  1 
ATOM   1438 C CD  . LYS B 2 19  ? -33.78039 -29.73311 -18.82753 1.000 88.66604  ? 503 LYS B CD  1 
ATOM   1439 C CE  . LYS B 2 19  ? -34.97959 -28.80746 -18.64332 1.000 88.43172  ? 503 LYS B CE  1 
ATOM   1440 N NZ  . LYS B 2 19  ? -36.20987 -29.37181 -19.28107 1.000 87.35034  ? 503 LYS B NZ  1 
ATOM   1441 N N   . ALA B 2 20  ? -30.10252 -33.03208 -18.25205 1.000 43.48085  ? 504 ALA B N   1 
ATOM   1442 C CA  . ALA B 2 20  ? -30.09786 -34.41839 -18.70414 1.000 45.71197  ? 504 ALA B CA  1 
ATOM   1443 C C   . ALA B 2 20  ? -30.46714 -35.37715 -17.57056 1.000 45.35053  ? 504 ALA B C   1 
ATOM   1444 O O   . ALA B 2 20  ? -31.08538 -36.41771 -17.81471 1.000 37.09172  ? 504 ALA B O   1 
ATOM   1445 C CB  . ALA B 2 20  ? -28.72800 -34.77848 -19.29768 1.000 33.42370  ? 504 ALA B CB  1 
ATOM   1446 N N   . ILE B 2 21  ? -30.12237 -35.03267 -16.32948 1.000 39.04035  ? 505 ILE B N   1 
ATOM   1447 C CA  . ILE B 2 21  ? -30.55661 -35.82933 -15.18935 1.000 34.87325  ? 505 ILE B CA  1 
ATOM   1448 C C   . ILE B 2 21  ? -32.05265 -35.65000 -14.96496 1.000 34.22820  ? 505 ILE B C   1 
ATOM   1449 O O   . ILE B 2 21  ? -32.79363 -36.62471 -14.78589 1.000 37.02460  ? 505 ILE B O   1 
ATOM   1450 C CB  . ILE B 2 21  ? -29.73753 -35.45304 -13.93937 1.000 39.52216  ? 505 ILE B CB  1 
ATOM   1451 C CG1 . ILE B 2 21  ? -28.35280 -36.09363 -13.98429 1.000 31.28992  ? 505 ILE B CG1 1 
ATOM   1452 C CG2 . ILE B 2 21  ? -30.44773 -35.86437 -12.66455 1.000 36.65474  ? 505 ILE B CG2 1 
ATOM   1453 C CD1 . ILE B 2 21  ? -27.35401 -35.41675 -13.05007 1.000 31.89920  ? 505 ILE B CD1 1 
ATOM   1454 N N   . LEU B 2 22  ? -32.52828 -34.40385 -15.01204 1.000 41.05094  ? 506 LEU B N   1 
ATOM   1455 C CA  . LEU B 2 22  ? -33.95000 -34.15165 -14.79560 1.000 30.31743  ? 506 LEU B CA  1 
ATOM   1456 C C   . LEU B 2 22  ? -34.79832 -34.75190 -15.90743 1.000 32.64358  ? 506 LEU B C   1 
ATOM   1457 O O   . LEU B 2 22  ? -35.87474 -35.30532 -15.64668 1.000 36.25914  ? 506 LEU B O   1 
ATOM   1458 C CB  . LEU B 2 22  ? -34.20245 -32.65716 -14.67118 1.000 45.74662  ? 506 LEU B CB  1 
ATOM   1459 C CG  . LEU B 2 22  ? -34.26512 -32.08497 -13.25092 1.000 56.35493  ? 506 LEU B CG  1 
ATOM   1460 C CD1 . LEU B 2 22  ? -33.20281 -32.64157 -12.33687 1.000 53.15585  ? 506 LEU B CD1 1 
ATOM   1461 C CD2 . LEU B 2 22  ? -34.16422 -30.56341 -13.30440 1.000 58.95800  ? 506 LEU B CD2 1 
ATOM   1462 N N   . ASN B 2 23  ? -34.31273 -34.69193 -17.14473 1.000 30.50080  ? 507 ASN B N   1 
ATOM   1463 C CA  . ASN B 2 23  ? -35.00099 -35.37424 -18.23246 1.000 40.17236  ? 507 ASN B CA  1 
ATOM   1464 C C   . ASN B 2 23  ? -35.02517 -36.87449 -18.01941 1.000 41.70791  ? 507 ASN B C   1 
ATOM   1465 O O   . ASN B 2 23  ? -36.02025 -37.53223 -18.33646 1.000 29.15128  ? 507 ASN B O   1 
ATOM   1466 C CB  . ASN B 2 23  ? -34.33357 -35.04011 -19.56048 1.000 50.37032  ? 507 ASN B CB  1 
ATOM   1467 C CG  . ASN B 2 23  ? -34.52353 -33.59003 -19.93504 1.000 47.34535  ? 507 ASN B CG  1 
ATOM   1468 O OD1 . ASN B 2 23  ? -35.60462 -33.03754 -19.74603 1.000 47.07924  ? 507 ASN B OD1 1 
ATOM   1469 N ND2 . ASN B 2 23  ? -33.46925 -32.95812 -20.43365 1.000 44.21512  ? 507 ASN B ND2 1 
ATOM   1470 N N   . GLY B 2 24  ? -33.93982 -37.42752 -17.47135 1.000 41.68131  ? 508 GLY B N   1 
ATOM   1471 C CA  . GLY B 2 24  ? -33.89453 -38.85368 -17.23442 1.000 29.86667  ? 508 GLY B CA  1 
ATOM   1472 C C   . GLY B 2 24  ? -34.90487 -39.29066 -16.19431 1.000 33.14180  ? 508 GLY B C   1 
ATOM   1473 O O   . GLY B 2 24  ? -35.54423 -40.33175 -16.34201 1.000 27.69047  ? 508 GLY B O   1 
ATOM   1474 N N   . ILE B 2 25  ? -35.06035 -38.49250 -15.13836 1.000 28.14053  ? 509 ILE B N   1 
ATOM   1475 C CA  . ILE B 2 25  ? -36.06124 -38.75683 -14.11280 1.000 27.60700  ? 509 ILE B CA  1 
ATOM   1476 C C   . ILE B 2 25  ? -37.45417 -38.78586 -14.73135 1.000 27.45120  ? 509 ILE B C   1 
ATOM   1477 O O   . ILE B 2 25  ? -38.23930 -39.71317 -14.49091 1.000 30.16311  ? 509 ILE B O   1 
ATOM   1478 C CB  . ILE B 2 25  ? -35.95196 -37.70326 -12.99497 1.000 27.86740  ? 509 ILE B CB  1 
ATOM   1479 C CG1 . ILE B 2 25  ? -34.61808 -37.85966 -12.25980 1.000 28.00490  ? 509 ILE B CG1 1 
ATOM   1480 C CG2 . ILE B 2 25  ? -37.12507 -37.78010 -12.04911 1.000 27.51943  ? 509 ILE B CG2 1 
ATOM   1481 C CD1 . ILE B 2 25  ? -34.41827 -36.90712 -11.07144 1.000 28.35071  ? 509 ILE B CD1 1 
ATOM   1482 N N   A ASP B 2 26  ? -37.75922 -37.79917 -15.57535 0.640 32.93068  ? 510 ASP B N   1 
ATOM   1483 N N   B ASP B 2 26  ? -37.75149 -37.78760 -15.56690 0.360 31.29027  ? 510 ASP B N   1 
ATOM   1484 C CA  A ASP B 2 26  ? -39.08855 -37.71299 -16.17113 0.640 27.91488  ? 510 ASP B CA  1 
ATOM   1485 C CA  B ASP B 2 26  ? -39.06559 -37.66994 -16.19062 0.360 27.93894  ? 510 ASP B CA  1 
ATOM   1486 C C   A ASP B 2 26  ? -39.31209 -38.81256 -17.20271 0.640 28.75544  ? 510 ASP B C   1 
ATOM   1487 C C   B ASP B 2 26  ? -39.30759 -38.78494 -17.20388 0.360 28.28651  ? 510 ASP B C   1 
ATOM   1488 O O   A ASP B 2 26  ? -40.40351 -39.38956 -17.28078 0.640 27.44190  ? 510 ASP B O   1 
ATOM   1489 O O   B ASP B 2 26  ? -40.40863 -39.34408 -17.27091 0.360 27.45375  ? 510 ASP B O   1 
ATOM   1490 C CB  A ASP B 2 26  ? -39.27629 -36.33546 -16.79885 0.640 36.55875  ? 510 ASP B CB  1 
ATOM   1491 C CB  B ASP B 2 26  ? -39.18395 -36.29549 -16.85106 0.360 35.44479  ? 510 ASP B CB  1 
ATOM   1492 C CG  A ASP B 2 26  ? -39.45250 -35.25171 -15.76059 0.640 41.37038  ? 510 ASP B CG  1 
ATOM   1493 C CG  B ASP B 2 26  ? -40.36601 -36.19518 -17.78542 0.360 31.16762  ? 510 ASP B CG  1 
ATOM   1494 O OD1 A ASP B 2 26  ? -39.47173 -35.59216 -14.55066 0.640 38.20048  ? 510 ASP B OD1 1 
ATOM   1495 O OD1 B ASP B 2 26  ? -41.50194 -36.03962 -17.29549 0.360 28.63680  ? 510 ASP B OD1 1 
ATOM   1496 O OD2 A ASP B 2 26  ? -39.56676 -34.06746 -16.15498 0.640 47.36871  ? 510 ASP B OD2 1 
ATOM   1497 O OD2 B ASP B 2 26  ? -40.15515 -36.27793 -19.01138 0.360 30.15785  ? 510 ASP B OD2 1 
ATOM   1498 N N   . SER B 2 27  ? -38.28996 -39.12677 -17.99505 1.000 29.37451  ? 511 SER B N   1 
ATOM   1499 C CA  . SER B 2 27  ? -38.42472 -40.22301 -18.94703 1.000 32.11621  ? 511 SER B CA  1 
ATOM   1500 C C   . SER B 2 27  ? -38.62679 -41.56565 -18.24525 1.000 34.88152  ? 511 SER B C   1 
ATOM   1501 O O   . SER B 2 27  ? -39.38543 -42.41238 -18.73240 1.000 34.34980  ? 511 SER B O   1 
ATOM   1502 C CB  . SER B 2 27  ? -37.19462 -40.26948 -19.84029 1.000 28.48828  ? 511 SER B CB  1 
ATOM   1503 O OG  . SER B 2 27  ? -36.89456 -38.99978 -20.37956 1.000 36.83332  ? 511 SER B OG  1 
ATOM   1504 N N   . ILE B 2 28  ? -37.97767 -41.76537 -17.08909 1.000 34.61293  ? 512 ILE B N   1 
ATOM   1505 C CA  . ILE B 2 28  ? -38.15905 -43.00309 -16.34399 1.000 26.47823  ? 512 ILE B CA  1 
ATOM   1506 C C   . ILE B 2 28  ? -39.54401 -43.03307 -15.70827 1.000 42.08885  ? 512 ILE B C   1 
ATOM   1507 O O   . ILE B 2 28  ? -40.21042 -44.08297 -15.67595 1.000 25.86746  ? 512 ILE B O   1 
ATOM   1508 C CB  . ILE B 2 28  ? -37.03738 -43.16785 -15.29795 1.000 30.16912  ? 512 ILE B CB  1 
ATOM   1509 C CG1 . ILE B 2 28  ? -35.80578 -43.81684 -15.92042 1.000 26.62998  ? 512 ILE B CG1 1 
ATOM   1510 C CG2 . ILE B 2 28  ? -37.50195 -44.00693 -14.10723 1.000 25.85104  ? 512 ILE B CG2 1 
ATOM   1511 C CD1 . ILE B 2 28  ? -34.78218 -44.15770 -14.90233 1.000 26.53590  ? 512 ILE B CD1 1 
ATOM   1512 N N   . ASN B 2 29  ? -39.99983 -41.87849 -15.20160 1.000 26.26668  ? 513 ASN B N   1 
ATOM   1513 C CA  . ASN B 2 29  ? -41.37307 -41.76911 -14.72343 1.000 26.12805  ? 513 ASN B CA  1 
ATOM   1514 C C   . ASN B 2 29  ? -42.36472 -42.13173 -15.82186 1.000 31.04057  ? 513 ASN B C   1 
ATOM   1515 O O   . ASN B 2 29  ? -43.34177 -42.84791 -15.57014 1.000 26.02078  ? 513 ASN B O   1 
ATOM   1516 C CB  . ASN B 2 29  ? -41.62652 -40.36799 -14.18702 1.000 26.43608  ? 513 ASN B CB  1 
ATOM   1517 C CG  . ASN B 2 29  ? -41.05512 -40.17866 -12.79772 1.000 36.07412  ? 513 ASN B CG  1 
ATOM   1518 O OD1 . ASN B 2 29  ? -40.60450 -41.14287 -12.16713 1.000 33.09840  ? 513 ASN B OD1 1 
ATOM   1519 N ND2 . ASN B 2 29  ? -41.08828 -38.94224 -12.29615 1.000 32.94242  ? 513 ASN B ND2 1 
ATOM   1520 N N   . LYS B 2 30  ? -42.06722 -41.73805 -17.06529 1.000 29.47567  ? 514 LYS B N   1 
ATOM   1521 C CA  . LYS B 2 30  ? -42.91272 -42.11066 -18.19672 1.000 30.79443  ? 514 LYS B CA  1 
ATOM   1522 C C   . LYS B 2 30  ? -42.92415 -43.62204 -18.42377 1.000 28.08154  ? 514 LYS B C   1 
ATOM   1523 O O   . LYS B 2 30  ? -43.99784 -44.22456 -18.55009 1.000 27.42974  ? 514 LYS B O   1 
ATOM   1524 C CB  . LYS B 2 30  ? -42.43921 -41.38595 -19.44884 1.000 35.08472  ? 514 LYS B CB  1 
ATOM   1525 C CG  . LYS B 2 30  ? -43.28895 -40.22009 -19.83597 1.000 42.01305  ? 514 LYS B CG  1 
ATOM   1526 C CD  . LYS B 2 30  ? -42.44705 -38.98215 -20.12372 1.000 51.65566  ? 514 LYS B CD  1 
ATOM   1527 C CE  . LYS B 2 30  ? -43.32542 -37.73935 -20.34811 1.000 55.17083  ? 514 LYS B CE  1 
ATOM   1528 N NZ  . LYS B 2 30  ? -42.53253 -36.56898 -20.81099 1.000 54.10800  ? 514 LYS B NZ  1 
ATOM   1529 N N   . VAL B 2 31  ? -41.73725 -44.24865 -18.47545 1.000 33.51225  ? 515 VAL B N   1 
ATOM   1530 C CA  . VAL B 2 31  ? -41.63042 -45.69575 -18.70400 1.000 26.40097  ? 515 VAL B CA  1 
ATOM   1531 C C   . VAL B 2 31  ? -42.39028 -46.48163 -17.63444 1.000 34.09574  ? 515 VAL B C   1 
ATOM   1532 O O   . VAL B 2 31  ? -43.08465 -47.46447 -17.93374 1.000 25.97442  ? 515 VAL B O   1 
ATOM   1533 C CB  . VAL B 2 31  ? -40.14697 -46.12145 -18.75708 1.000 35.92575  ? 515 VAL B CB  1 
ATOM   1534 C CG1 . VAL B 2 31  ? -40.00000 -47.65819 -18.79173 1.000 26.39573  ? 515 VAL B CG1 1 
ATOM   1535 C CG2 . VAL B 2 31  ? -39.46610 -45.51436 -19.94076 1.000 27.07353  ? 515 VAL B CG2 1 
ATOM   1536 N N   . LEU B 2 32  ? -42.27322 -46.06621 -16.37348 1.000 25.65812  ? 516 LEU B N   1 
ATOM   1537 C CA  . LEU B 2 32  ? -42.88419 -46.84701 -15.30461 1.000 25.33888  ? 516 LEU B CA  1 
ATOM   1538 C C   . LEU B 2 32  ? -44.39624 -46.68650 -15.29453 1.000 34.43834  ? 516 LEU B C   1 
ATOM   1539 O O   . LEU B 2 32  ? -45.12365 -47.64714 -15.01653 1.000 25.35762  ? 516 LEU B O   1 
ATOM   1540 C CB  . LEU B 2 32  ? -42.30223 -46.44476 -13.96146 1.000 25.11929  ? 516 LEU B CB  1 
ATOM   1541 C CG  . LEU B 2 32  ? -40.96300 -47.11876 -13.69060 1.000 25.01416  ? 516 LEU B CG  1 
ATOM   1542 C CD1 . LEU B 2 32  ? -40.17560 -46.15450 -12.90030 1.000 44.41014  ? 516 LEU B CD1 1 
ATOM   1543 C CD2 . LEU B 2 32  ? -41.17763 -48.38157 -12.91316 1.000 33.35655  ? 516 LEU B CD2 1 
ATOM   1544 N N   . ASP B 2 33  ? -44.87850 -45.47334 -15.58883 1.000 26.12230  ? 517 ASP B N   1 
ATOM   1545 C CA  . ASP B 2 33  ? -46.31317 -45.23494 -15.65810 1.000 31.81683  ? 517 ASP B CA  1 
ATOM   1546 C C   . ASP B 2 33  ? -46.94583 -46.04274 -16.78472 1.000 31.66453  ? 517 ASP B C   1 
ATOM   1547 O O   . ASP B 2 33  ? -47.99759 -46.67386 -16.58972 1.000 26.50023  ? 517 ASP B O   1 
ATOM   1548 C CB  . ASP B 2 33  ? -46.58142 -43.74613 -15.83304 1.000 29.80818  ? 517 ASP B CB  1 
ATOM   1549 C CG  . ASP B 2 33  ? -48.06484 -43.41074 -15.72980 1.000 46.61218  ? 517 ASP B CG  1 
ATOM   1550 O OD1 . ASP B 2 33  ? -48.65641 -43.67818 -14.66018 1.000 45.08206  ? 517 ASP B OD1 1 
ATOM   1551 O OD2 . ASP B 2 33  ? -48.63421 -42.89554 -16.72244 1.000 50.27892  ? 517 ASP B OD2 1 
ATOM   1552 N N   . HIS B 2 34  ? -46.29049 -46.05765 -17.95390 1.000 26.27600  ? 518 HIS B N   1 
ATOM   1553 C CA  . HIS B 2 34  ? -46.71083 -46.90753 -19.06679 1.000 28.76908  ? 518 HIS B CA  1 
ATOM   1554 C C   . HIS B 2 34  ? -46.79135 -48.38132 -18.66031 1.000 33.75402  ? 518 HIS B C   1 
ATOM   1555 O O   . HIS B 2 34  ? -47.77797 -49.05994 -18.96760 1.000 37.63127  ? 518 HIS B O   1 
ATOM   1556 C CB  . HIS B 2 34  ? -45.75169 -46.72555 -20.23880 1.000 26.90018  ? 518 HIS B CB  1 
ATOM   1557 C CG  . HIS B 2 34  ? -45.94148 -47.72210 -21.33385 1.000 34.86087  ? 518 HIS B CG  1 
ATOM   1558 N ND1 . HIS B 2 34  ? -46.91491 -47.58449 -22.29756 1.000 43.75611  ? 518 HIS B ND1 1 
ATOM   1559 C CD2 . HIS B 2 34  ? -45.27493 -48.86245 -21.63014 1.000 41.71194  ? 518 HIS B CD2 1 
ATOM   1560 C CE1 . HIS B 2 34  ? -46.84884 -48.60385 -23.13549 1.000 46.86671  ? 518 HIS B CE1 1 
ATOM   1561 N NE2 . HIS B 2 34  ? -45.86448 -49.39608 -22.75041 1.000 45.36349  ? 518 HIS B NE2 1 
ATOM   1562 N N   . PHE B 2 35  ? -45.76659 -48.89143 -17.96451 1.000 26.08251  ? 519 PHE B N   1 
ATOM   1563 C CA  . PHE B 2 35  ? -45.82658 -50.25978 -17.45461 1.000 36.17266  ? 519 PHE B CA  1 
ATOM   1564 C C   . PHE B 2 35  ? -47.00481 -50.42629 -16.49804 1.000 37.26926  ? 519 PHE B C   1 
ATOM   1565 O O   . PHE B 2 35  ? -47.68512 -51.46344 -16.49952 1.000 26.04979  ? 519 PHE B O   1 
ATOM   1566 C CB  . PHE B 2 35  ? -44.52376 -50.63479 -16.72768 1.000 25.85946  ? 519 PHE B CB  1 
ATOM   1567 C CG  . PHE B 2 35  ? -43.32030 -50.80910 -17.62442 1.000 31.36181  ? 519 PHE B CG  1 
ATOM   1568 C CD1 . PHE B 2 35  ? -43.45052 -50.92769 -18.99510 1.000 32.91740  ? 519 PHE B CD1 1 
ATOM   1569 C CD2 . PHE B 2 35  ? -42.04682 -50.85775 -17.07569 1.000 25.70324  ? 519 PHE B CD2 1 
ATOM   1570 C CE1 . PHE B 2 35  ? -42.32536 -51.09709 -19.80344 1.000 33.06203  ? 519 PHE B CE1 1 
ATOM   1571 C CE2 . PHE B 2 35  ? -40.92655 -51.01438 -17.88030 1.000 31.21211  ? 519 PHE B CE2 1 
ATOM   1572 C CZ  . PHE B 2 35  ? -41.06233 -51.15079 -19.24317 1.000 26.50953  ? 519 PHE B CZ  1 
ATOM   1573 N N   . ARG B 2 36  ? -47.25844 -49.40492 -15.67934 1.000 25.71755  ? 520 ARG B N   1 
ATOM   1574 C CA  . ARG B 2 36  ? -48.32142 -49.49276 -14.68751 1.000 25.74285  ? 520 ARG B CA  1 
ATOM   1575 C C   . ARG B 2 36  ? -49.68893 -49.50201 -15.35557 1.000 26.16612  ? 520 ARG B C   1 
ATOM   1576 O O   . ARG B 2 36  ? -50.54995 -50.30222 -14.99417 1.000 26.90938  ? 520 ARG B O   1 
ATOM   1577 C CB  . ARG B 2 36  ? -48.21307 -48.33425 -13.68757 1.000 25.60854  ? 520 ARG B CB  1 
ATOM   1578 C CG  . ARG B 2 36  ? -49.23746 -48.36490 -12.55335 1.000 25.74799  ? 520 ARG B CG  1 
ATOM   1579 C CD  . ARG B 2 36  ? -49.34760 -46.99979 -11.91137 1.000 30.03173  ? 520 ARG B CD  1 
ATOM   1580 N NE  . ARG B 2 36  ? -50.14473 -47.01707 -10.68594 1.000 32.20420  ? 520 ARG B NE  1 
ATOM   1581 C CZ  . ARG B 2 36  ? -50.46884 -45.92504 -9.98783  1.000 33.42514  ? 520 ARG B CZ  1 
ATOM   1582 N NH1 . ARG B 2 36  ? -50.07637 -44.72650 -10.40147 1.000 26.35293  ? 520 ARG B NH1 1 
ATOM   1583 N NH2 . ARG B 2 36  ? -51.19127 -46.03187 -8.86991  1.000 33.87101  ? 520 ARG B NH2 1 
ATOM   1584 N N   . ARG B 2 37  ? -49.89388 -48.64358 -16.34555 1.000 26.40048  ? 521 ARG B N   1 
ATOM   1585 C CA  . ARG B 2 37  ? -51.20466 -48.56343 -16.98120 1.000 34.45887  ? 521 ARG B CA  1 
ATOM   1586 C C   . ARG B 2 37  ? -51.48803 -49.79417 -17.83756 1.000 37.05992  ? 521 ARG B C   1 
ATOM   1587 O O   . ARG B 2 37  ? -52.65327 -50.16677 -18.00627 1.000 43.41689  ? 521 ARG B O   1 
ATOM   1588 C CB  . ARG B 2 37  ? -51.29873 -47.28819 -17.82525 1.000 27.12932  ? 521 ARG B CB  1 
ATOM   1589 C CG  . ARG B 2 37  ? -51.35710 -45.99147 -17.00820 1.000 40.41406  ? 521 ARG B CG  1 
ATOM   1590 C CD  . ARG B 2 37  ? -51.55663 -44.73185 -17.89920 1.000 40.81752  ? 521 ARG B CD  1 
ATOM   1591 N NE  . ARG B 2 37  ? -50.31418 -44.25542 -18.51718 1.000 55.55837  ? 521 ARG B NE  1 
ATOM   1592 C CZ  . ARG B 2 37  ? -49.92475 -44.53217 -19.76679 1.000 58.37768  ? 521 ARG B CZ  1 
ATOM   1593 N NH1 . ARG B 2 37  ? -48.76601 -44.05318 -20.23542 1.000 32.26143  ? 521 ARG B NH1 1 
ATOM   1594 N NH2 . ARG B 2 37  ? -50.68783 -45.28785 -20.55547 1.000 64.77048  ? 521 ARG B NH2 1 
ATOM   1595 N N   . LYS B 2 38  ? -50.45081 -50.44964 -18.37466 1.000 29.12987  ? 522 LYS B N   1 
ATOM   1596 C CA  . LYS B 2 38  ? -50.67305 -51.56725 -19.28193 1.000 27.46938  ? 522 LYS B CA  1 
ATOM   1597 C C   . LYS B 2 38  ? -50.62871 -52.90522 -18.57531 1.000 27.40084  ? 522 LYS B C   1 
ATOM   1598 O O   . LYS B 2 38  ? -50.82856 -53.93781 -19.21940 1.000 53.47740  ? 522 LYS B O   1 
ATOM   1599 C CB  . LYS B 2 38  ? -49.67049 -51.54726 -20.44242 1.000 27.62839  ? 522 LYS B CB  1 
ATOM   1600 C CG  . LYS B 2 38  ? -49.71544 -50.27439 -21.27663 1.000 37.31913  ? 522 LYS B CG  1 
ATOM   1601 C CD  . LYS B 2 38  ? -51.08312 -50.09371 -21.96406 1.000 56.00329  ? 522 LYS B CD  1 
ATOM   1602 C CE  . LYS B 2 38  ? -51.00775 -49.29294 -23.27563 1.000 57.41668  ? 522 LYS B CE  1 
ATOM   1603 N NZ  . LYS B 2 38  ? -51.63228 -47.93584 -23.15609 1.000 59.83354  ? 522 LYS B NZ  1 
ATOM   1604 N N   . GLY B 2 39  ? -50.39410 -52.90564 -17.26844 1.000 28.39150  ? 523 GLY B N   1 
ATOM   1605 C CA  . GLY B 2 39  ? -50.32738 -54.13185 -16.49569 1.000 20.09162  ? 523 GLY B CA  1 
ATOM   1606 C C   . GLY B 2 39  ? -49.21639 -55.07473 -16.91265 1.000 25.40451  ? 523 GLY B C   1 
ATOM   1607 O O   . GLY B 2 39  ? -49.42663 -56.29345 -16.95035 1.000 27.15289  ? 523 GLY B O   1 
ATOM   1608 N N   . ILE B 2 40  ? -48.03085 -54.54477 -17.23062 1.000 24.03847  ? 524 ILE B N   1 
ATOM   1609 C CA  . ILE B 2 40  ? -46.90861 -55.37196 -17.67160 1.000 18.60021  ? 524 ILE B CA  1 
ATOM   1610 C C   . ILE B 2 40  ? -45.68775 -55.05595 -16.82664 1.000 15.69063  ? 524 ILE B C   1 
ATOM   1611 O O   . ILE B 2 40  ? -45.61760 -54.01672 -16.16444 1.000 23.92731  ? 524 ILE B O   1 
ATOM   1612 C CB  . ILE B 2 40  ? -46.57612 -55.15530 -19.15671 1.000 19.24285  ? 524 ILE B CB  1 
ATOM   1613 C CG1 . ILE B 2 40  ? -46.25011 -53.67957 -19.39387 1.000 19.09238  ? 524 ILE B CG1 1 
ATOM   1614 C CG2 . ILE B 2 40  ? -47.75440 -55.57985 -20.02876 1.000 19.45044  ? 524 ILE B CG2 1 
ATOM   1615 C CD1 . ILE B 2 40  ? -45.82480 -53.37220 -20.81560 1.000 20.25419  ? 524 ILE B CD1 1 
ATOM   1616 N N   . ASN B 2 41  ? -44.72445 -55.98287 -16.85896 1.000 19.69155  ? 525 ASN B N   1 
ATOM   1617 C CA  . ASN B 2 41  ? -43.40813 -55.83515 -16.21969 1.000 18.47253  ? 525 ASN B CA  1 
ATOM   1618 C C   . ASN B 2 41  ? -43.51969 -55.50679 -14.73321 1.000 15.51716  ? 525 ASN B C   1 
ATOM   1619 O O   . ASN B 2 41  ? -42.87622 -54.58011 -14.21621 1.000 15.33054  ? 525 ASN B O   1 
ATOM   1620 C CB  . ASN B 2 41  ? -42.57235 -54.79184 -16.95262 1.000 20.68300  ? 525 ASN B CB  1 
ATOM   1621 C CG  . ASN B 2 41  ? -42.25053 -55.22758 -18.33301 1.000 22.74071  ? 525 ASN B CG  1 
ATOM   1622 O OD1 . ASN B 2 41  ? -42.00576 -56.41539 -18.55958 1.000 26.65994  ? 525 ASN B OD1 1 
ATOM   1623 N ND2 . ASN B 2 41  ? -42.29865 -54.30198 -19.28724 1.000 25.09259  ? 525 ASN B ND2 1 
ATOM   1624 N N   . GLN B 2 42  ? -44.36498 -56.27960 -14.04926 1.000 17.86495  ? 526 GLN B N   1 
ATOM   1625 C CA  . GLN B 2 42  ? -44.55453 -56.11151 -12.61112 1.000 20.22847  ? 526 GLN B CA  1 
ATOM   1626 C C   . GLN B 2 42  ? -43.23163 -56.17102 -11.85837 1.000 22.37451  ? 526 GLN B C   1 
ATOM   1627 O O   . GLN B 2 42  ? -43.02341 -55.42731 -10.88669 1.000 23.17361  ? 526 GLN B O   1 
ATOM   1628 C CB  . GLN B 2 42  ? -45.52496 -57.18162 -12.09633 1.000 23.86425  ? 526 GLN B CB  1 
ATOM   1629 C CG  . GLN B 2 42  ? -46.03021 -56.93486 -10.69980 1.000 36.94935  ? 526 GLN B CG  1 
ATOM   1630 C CD  . GLN B 2 42  ? -46.81037 -55.63165 -10.57501 1.000 42.50247  ? 526 GLN B CD  1 
ATOM   1631 O OE1 . GLN B 2 42  ? -47.68112 -55.33739 -11.39971 1.000 52.41096  ? 526 GLN B OE1 1 
ATOM   1632 N NE2 . GLN B 2 42  ? -46.49490 -54.83998 -9.53970  1.000 23.41674  ? 526 GLN B NE2 1 
ATOM   1633 N N   . HIS B 2 43  ? -42.29988 -57.00369 -12.32056 1.000 21.71270  ? 527 HIS B N   1 
ATOM   1634 C CA  . HIS B 2 43  ? -41.01938 -57.08642 -11.62779 1.000 19.12224  ? 527 HIS B CA  1 
ATOM   1635 C C   . HIS B 2 43  ? -40.20866 -55.79701 -11.75154 1.000 15.57399  ? 527 HIS B C   1 
ATOM   1636 O O   . HIS B 2 43  ? -39.43373 -55.46708 -10.83817 1.000 12.69736  ? 527 HIS B O   1 
ATOM   1637 C CB  . HIS B 2 43  ? -40.22046 -58.28568 -12.13711 1.000 18.03266  ? 527 HIS B CB  1 
ATOM   1638 C CG  . HIS B 2 43  ? -39.59891 -58.09071 -13.48491 1.000 21.75987  ? 527 HIS B CG  1 
ATOM   1639 N ND1 . HIS B 2 43  ? -40.33979 -58.05891 -14.65031 1.000 26.31607  ? 527 HIS B ND1 1 
ATOM   1640 C CD2 . HIS B 2 43  ? -38.30103 -57.98863 -13.86134 1.000 22.80758  ? 527 HIS B CD2 1 
ATOM   1641 C CE1 . HIS B 2 43  ? -39.52863 -57.90265 -15.68389 1.000 21.91286  ? 527 HIS B CE1 1 
ATOM   1642 N NE2 . HIS B 2 43  ? -38.28426 -57.87007 -15.23300 1.000 29.03395  ? 527 HIS B NE2 1 
ATOM   1643 N N   . VAL B 2 44  ? -40.36438 -55.06099 -12.85219 1.000 12.83436  ? 528 VAL B N   1 
ATOM   1644 C CA  . VAL B 2 44  ? -39.73056 -53.74671 -12.96476 1.000 13.94900  ? 528 VAL B CA  1 
ATOM   1645 C C   . VAL B 2 44  ? -40.36310 -52.76534 -11.98480 1.000 20.99406  ? 528 VAL B C   1 
ATOM   1646 O O   . VAL B 2 44  ? -39.65820 -52.07153 -11.23521 1.000 24.40288  ? 528 VAL B O   1 
ATOM   1647 C CB  . VAL B 2 44  ? -39.83037 -53.22549 -14.41141 1.000 15.94391  ? 528 VAL B CB  1 
ATOM   1648 C CG1 . VAL B 2 44  ? -39.45030 -51.76261 -14.46523 1.000 14.92974  ? 528 VAL B CG1 1 
ATOM   1649 C CG2 . VAL B 2 44  ? -38.94328 -54.05419 -15.33040 1.000 14.76229  ? 528 VAL B CG2 1 
ATOM   1650 N N   . GLN B 2 45  ? -41.70567 -52.69566 -11.98658 1.000 22.32970  ? 529 GLN B N   1 
ATOM   1651 C CA  . GLN B 2 45  ? -42.44524 -51.84623 -11.05632 1.000 13.36128  ? 529 GLN B CA  1 
ATOM   1652 C C   . GLN B 2 45  ? -42.08271 -52.14870 -9.60519  1.000 12.14032  ? 529 GLN B C   1 
ATOM   1653 O O   . GLN B 2 45  ? -41.78549 -51.23439 -8.82924  1.000 13.41143  ? 529 GLN B O   1 
ATOM   1654 C CB  . GLN B 2 45  ? -43.94751 -52.03767 -11.25984 1.000 13.14466  ? 529 GLN B CB  1 
ATOM   1655 C CG  . GLN B 2 45  ? -44.50437 -51.43012 -12.52550 1.000 22.33415  ? 529 GLN B CG  1 
ATOM   1656 C CD  . GLN B 2 45  ? -46.00890 -51.58867 -12.59250 1.000 20.32115  ? 529 GLN B CD  1 
ATOM   1657 O OE1 . GLN B 2 45  ? -46.75095 -50.87020 -11.90956 1.000 24.78014  ? 529 GLN B OE1 1 
ATOM   1658 N NE2 . GLN B 2 45  ? -46.47222 -52.54463 -13.39975 1.000 20.34898  ? 529 GLN B NE2 1 
ATOM   1659 N N   . ASN B 2 46  ? -42.11662 -53.43009 -9.21632  1.000 12.25056  ? 530 ASN B N   1 
ATOM   1660 C CA  . ASN B 2 46  ? -41.73184 -53.80639 -7.86293  1.000 15.28673  ? 530 ASN B CA  1 
ATOM   1661 C C   . ASN B 2 46  ? -40.29347 -53.43339 -7.57393  1.000 14.10463  ? 530 ASN B C   1 
ATOM   1662 O O   . ASN B 2 46  ? -39.96549 -53.04575 -6.44685  1.000 18.95393  ? 530 ASN B O   1 
ATOM   1663 C CB  . ASN B 2 46  ? -41.89257 -55.30495 -7.66497  1.000 13.32467  ? 530 ASN B CB  1 
ATOM   1664 C CG  . ASN B 2 46  ? -43.31403 -55.74884 -7.79435  1.000 25.63783  ? 530 ASN B CG  1 
ATOM   1665 O OD1 . ASN B 2 46  ? -44.23451 -54.93008 -7.76500  1.000 14.50690  ? 530 ASN B OD1 1 
ATOM   1666 N ND2 . ASN B 2 46  ? -43.51291 -57.06113 -7.92595  1.000 15.06516  ? 530 ASN B ND2 1 
ATOM   1667 N N   . GLY B 2 47  ? -39.40548 -53.59324 -8.56901  1.000 11.91155  ? 531 GLY B N   1 
ATOM   1668 C CA  . GLY B 2 47  ? -37.97573 -53.40447 -8.41820  1.000 12.10424  ? 531 GLY B CA  1 
ATOM   1669 C C   . GLY B 2 47  ? -37.48629 -51.98048 -8.54906  1.000 17.48270  ? 531 GLY B C   1 
ATOM   1670 O O   . GLY B 2 47  ? -36.28418 -51.75004 -8.39114  1.000 21.15320  ? 531 GLY B O   1 
ATOM   1671 N N   . TYR B 2 48  ? -38.36413 -51.00850 -8.79656  1.000 11.70262  ? 532 TYR B N   1 
ATOM   1672 C CA  . TYR B 2 48  ? -37.95584 -49.61868 -8.95573  1.000 13.31637  ? 532 TYR B CA  1 
ATOM   1673 C C   . TYR B 2 48  ? -38.23195 -48.85919 -7.66577  1.000 12.16743  ? 532 TYR B C   1 
ATOM   1674 O O   . TYR B 2 48  ? -39.39020 -48.71783 -7.26692  1.000 12.60139  ? 532 TYR B O   1 
ATOM   1675 C CB  . TYR B 2 48  ? -38.69556 -48.94719 -10.12384 1.000 17.95296  ? 532 TYR B CB  1 
ATOM   1676 C CG  . TYR B 2 48  ? -38.25716 -47.53150 -10.24624 1.000 13.44228  ? 532 TYR B CG  1 
ATOM   1677 C CD1 . TYR B 2 48  ? -37.06384 -47.23152 -10.87077 1.000 20.24388  ? 532 TYR B CD1 1 
ATOM   1678 C CD2 . TYR B 2 48  ? -38.99050 -46.49447 -9.66543  1.000 17.36041  ? 532 TYR B CD2 1 
ATOM   1679 C CE1 . TYR B 2 48  ? -36.61265 -45.93739 -10.94796 1.000 25.72782  ? 532 TYR B CE1 1 
ATOM   1680 C CE2 . TYR B 2 48  ? -38.54248 -45.19828 -9.73369  1.000 21.83558  ? 532 TYR B CE2 1 
ATOM   1681 C CZ  . TYR B 2 48  ? -37.35125 -44.92002 -10.37078 1.000 25.72290  ? 532 TYR B CZ  1 
ATOM   1682 O OH  . TYR B 2 48  ? -36.88370 -43.62163 -10.41940 1.000 17.65183  ? 532 TYR B OH  1 
ATOM   1683 N N   . HIS B 2 49  ? -37.19774 -48.27018 -7.07571  1.000 14.54957  ? 533 HIS B N   1 
ATOM   1684 C CA  . HIS B 2 49  ? -37.34457 -47.65620 -5.76432  1.000 16.40154  ? 533 HIS B CA  1 
ATOM   1685 C C   . HIS B 2 49  ? -37.16627 -46.13877 -5.75802  1.000 16.72831  ? 533 HIS B C   1 
ATOM   1686 O O   . HIS B 2 49  ? -37.27260 -45.51869 -4.68921  1.000 16.60746  ? 533 HIS B O   1 
ATOM   1687 C CB  . HIS B 2 49  ? -36.36338 -48.31880 -4.79309  1.000 12.90623  ? 533 HIS B CB  1 
ATOM   1688 C CG  . HIS B 2 49  ? -36.52054 -49.80127 -4.73741  1.000 16.23650  ? 533 HIS B CG  1 
ATOM   1689 N ND1 . HIS B 2 49  ? -37.69824 -50.40685 -4.34874  1.000 13.46116  ? 533 HIS B ND1 1 
ATOM   1690 C CD2 . HIS B 2 49  ? -35.67479 -50.80699 -5.07280  1.000 12.84109  ? 533 HIS B CD2 1 
ATOM   1691 C CE1 . HIS B 2 49  ? -37.56329 -51.71940 -4.42329  1.000 12.91303  ? 533 HIS B CE1 1 
ATOM   1692 N NE2 . HIS B 2 49  ? -36.34931 -51.99021 -4.86203  1.000 12.97315  ? 533 HIS B NE2 1 
ATOM   1693 N N   . GLY B 2 50  ? -36.91063 -45.51872 -6.90193  1.000 14.21098  ? 534 GLY B N   1 
ATOM   1694 C CA  . GLY B 2 50  ? -36.77837 -44.07928 -6.92928  1.000 25.48233  ? 534 GLY B CA  1 
ATOM   1695 C C   . GLY B 2 50  ? -35.35065 -43.63317 -6.72401  1.000 25.42785  ? 534 GLY B C   1 
ATOM   1696 O O   . GLY B 2 50  ? -34.41524 -44.42964 -6.60912  1.000 22.47411  ? 534 GLY B O   1 
ATOM   1697 N N   . ILE B 2 51  ? -35.16934 -42.31556 -6.69719  1.000 29.18486  ? 535 ILE B N   1 
ATOM   1698 C CA  . ILE B 2 51  ? -33.81683 -41.79497 -6.62151  1.000 28.31037  ? 535 ILE B CA  1 
ATOM   1699 C C   . ILE B 2 51  ? -33.34838 -41.78172 -5.17139  1.000 21.77784  ? 535 ILE B C   1 
ATOM   1700 O O   . ILE B 2 51  ? -34.15537 -41.86776 -4.23507  1.000 19.40491  ? 535 ILE B O   1 
ATOM   1701 C CB  . ILE B 2 51  ? -33.71145 -40.41015 -7.26796  1.000 21.24444  ? 535 ILE B CB  1 
ATOM   1702 C CG1 . ILE B 2 51  ? -34.74112 -39.45811 -6.67552  1.000 28.01140  ? 535 ILE B CG1 1 
ATOM   1703 C CG2 . ILE B 2 51  ? -33.86862 -40.54591 -8.76089  1.000 22.32536  ? 535 ILE B CG2 1 
ATOM   1704 C CD1 . ILE B 2 51  ? -34.47156 -38.01513 -7.05283  1.000 25.12948  ? 535 ILE B CD1 1 
ATOM   1705 N N   . VAL B 2 52  ? -32.02049 -41.69687 -4.99733  1.000 19.44502  ? 536 VAL B N   1 
ATOM   1706 C CA  . VAL B 2 52  ? -31.40225 -41.76412 -3.67079  1.000 27.83654  ? 536 VAL B CA  1 
ATOM   1707 C C   . VAL B 2 52  ? -32.00036 -40.72535 -2.73611  1.000 21.13208  ? 536 VAL B C   1 
ATOM   1708 O O   . VAL B 2 52  ? -32.31381 -41.01974 -1.57778  1.000 20.03953  ? 536 VAL B O   1 
ATOM   1709 C CB  . VAL B 2 52  ? -29.87017 -41.60658 -3.78660  1.000 24.80507  ? 536 VAL B CB  1 
ATOM   1710 C CG1 . VAL B 2 52  ? -29.22925 -41.34694 -2.42634  1.000 21.64472  ? 536 VAL B CG1 1 
ATOM   1711 C CG2 . VAL B 2 52  ? -29.28161 -42.86439 -4.35957  1.000 22.40867  ? 536 VAL B CG2 1 
ATOM   1712 N N   . MET B 2 53  ? -32.23139 -39.51794 -3.25578  1.000 22.82404  ? 537 MET B N   1 
ATOM   1713 C CA  . MET B 2 53  ? -32.76697 -38.40222 -2.47662  1.000 23.52563  ? 537 MET B CA  1 
ATOM   1714 C C   . MET B 2 53  ? -34.14100 -38.69926 -1.86628  1.000 26.94738  ? 537 MET B C   1 
ATOM   1715 O O   . MET B 2 53  ? -34.47882 -38.16343 -0.80895  1.000 31.79742  ? 537 MET B O   1 
ATOM   1716 C CB  . MET B 2 53  ? -32.85752 -37.18923 -3.38639  1.000 32.41448  ? 537 MET B CB  1 
ATOM   1717 C CG  . MET B 2 53  ? -32.68247 -35.88668 -2.66813  1.000 55.79631  ? 537 MET B CG  1 
ATOM   1718 S SD  . MET B 2 53  ? -33.67968 -34.60889 -3.42649  1.000 55.38396  ? 537 MET B SD  1 
ATOM   1719 C CE  . MET B 2 53  ? -33.54522 -35.07217 -5.13560  1.000 42.03155  ? 537 MET B CE  1 
ATOM   1720 N N   . ASN B 2 54  ? -34.95108 -39.53401 -2.50350  1.000 23.32038  ? 538 ASN B N   1 
ATOM   1721 C CA  . ASN B 2 54  ? -36.28024 -39.81440 -1.98698  1.000 25.27623  ? 538 ASN B CA  1 
ATOM   1722 C C   . ASN B 2 54  ? -36.30896 -41.05915 -1.12091  1.000 32.67741  ? 538 ASN B C   1 
ATOM   1723 O O   . ASN B 2 54  ? -37.39092 -41.52162 -0.74508  1.000 30.26250  ? 538 ASN B O   1 
ATOM   1724 C CB  . ASN B 2 54  ? -37.27279 -39.94652 -3.13412  1.000 21.49732  ? 538 ASN B CB  1 
ATOM   1725 C CG  . ASN B 2 54  ? -37.48468 -38.63370 -3.86746  1.000 24.37464  ? 538 ASN B CG  1 
ATOM   1726 O OD1 . ASN B 2 54  ? -37.36351 -37.54949 -3.28305  1.000 27.06542  ? 538 ASN B OD1 1 
ATOM   1727 N ND2 . ASN B 2 54  ? -37.80050 -38.72298 -5.15423  1.000 23.70498  ? 538 ASN B ND2 1 
ATOM   1728 N N   . ASN B 2 55  ? -35.14785 -41.60451 -0.77486  1.000 30.44702  ? 539 ASN B N   1 
ATOM   1729 C CA  . ASN B 2 55  ? -35.11040 -42.82467 0.01513   1.000 18.91410  ? 539 ASN B CA  1 
ATOM   1730 C C   . ASN B 2 55  ? -34.34765 -42.65530 1.31670   1.000 21.24297  ? 539 ASN B C   1 
ATOM   1731 O O   . ASN B 2 55  ? -33.98388 -43.65146 1.94297   1.000 22.48936  ? 539 ASN B O   1 
ATOM   1732 C CB  . ASN B 2 55  ? -34.54560 -43.97348 -0.82859  1.000 22.61828  ? 539 ASN B CB  1 
ATOM   1733 C CG  . ASN B 2 55  ? -35.59665 -44.51910 -1.81616  1.000 17.86739  ? 539 ASN B CG  1 
ATOM   1734 O OD1 . ASN B 2 55  ? -36.56791 -45.14255 -1.39737  1.000 25.88829  ? 539 ASN B OD1 1 
ATOM   1735 N ND2 . ASN B 2 55  ? -35.42004 -44.24674 -3.11202  1.000 15.77755  ? 539 ASN B ND2 1 
ATOM   1736 N N   . PHE B 2 56  ? -34.10803 -41.42049 1.76207   1.000 25.71110  ? 540 PHE B N   1 
ATOM   1737 C CA  . PHE B 2 56  ? -33.52523 -41.25048 3.08739   1.000 24.74103  ? 540 PHE B CA  1 
ATOM   1738 C C   . PHE B 2 56  ? -33.99652 -39.93059 3.65228   1.000 24.79750  ? 540 PHE B C   1 
ATOM   1739 O O   . PHE B 2 56  ? -34.44572 -39.06099 2.91883   1.000 25.51228  ? 540 PHE B O   1 
ATOM   1740 C CB  . PHE B 2 56  ? -31.97434 -41.31506 3.08528   1.000 22.53110  ? 540 PHE B CB  1 
ATOM   1741 C CG  . PHE B 2 56  ? -31.30981 -40.07857 2.55202   1.000 23.46578  ? 540 PHE B CG  1 
ATOM   1742 C CD1 . PHE B 2 56  ? -30.90527 -39.06014 3.40172   1.000 25.42747  ? 540 PHE B CD1 1 
ATOM   1743 C CD2 . PHE B 2 56  ? -31.07729 -39.94082 1.20494   1.000 24.80668  ? 540 PHE B CD2 1 
ATOM   1744 C CE1 . PHE B 2 56  ? -30.30590 -37.91994 2.90344   1.000 28.05601  ? 540 PHE B CE1 1 
ATOM   1745 C CE2 . PHE B 2 56  ? -30.47144 -38.80580 0.69912   1.000 28.05032  ? 540 PHE B CE2 1 
ATOM   1746 C CZ  . PHE B 2 56  ? -30.07469 -37.80059 1.54792   1.000 31.05445  ? 540 PHE B CZ  1 
ATOM   1747 N N   . GLU B 2 57  ? -33.86432 -39.78931 4.96567   1.000 26.47104  ? 541 GLU B N   1 
ATOM   1748 C CA  . GLU B 2 57  ? -33.99546 -38.50985 5.64064   1.000 29.04561  ? 541 GLU B CA  1 
ATOM   1749 C C   . GLU B 2 57  ? -32.76459 -38.31294 6.52704   1.000 33.19064  ? 541 GLU B C   1 
ATOM   1750 O O   . GLU B 2 57  ? -32.10338 -39.28169 6.92197   1.000 30.60452  ? 541 GLU B O   1 
ATOM   1751 C CB  . GLU B 2 57  ? -35.28433 -38.43634 6.48977   1.000 31.22196  ? 541 GLU B CB  1 
ATOM   1752 C CG  . GLU B 2 57  ? -36.57182 -38.85705 5.78855   1.000 53.06786  ? 541 GLU B CG  1 
ATOM   1753 C CD  . GLU B 2 57  ? -37.21606 -37.71622 4.99088   1.000 71.69518  ? 541 GLU B CD  1 
ATOM   1754 O OE1 . GLU B 2 57  ? -37.53467 -37.92212 3.78947   1.000 70.26069  ? 541 GLU B OE1 1 
ATOM   1755 O OE2 . GLU B 2 57  ? -37.40448 -36.61513 5.56908   1.000 83.72273  ? 541 GLU B OE2 1 
ATOM   1756 N N   . CYS B 2 58  ? -32.44964 -37.05464 6.83390   1.000 34.86022  ? 542 CYS B N   1 
ATOM   1757 C CA  . CYS B 2 58  ? -31.50480 -36.75445 7.90755   1.000 38.50698  ? 542 CYS B CA  1 
ATOM   1758 C C   . CYS B 2 58  ? -31.87137 -35.41174 8.51986   1.000 36.83233  ? 542 CYS B C   1 
ATOM   1759 O O   . CYS B 2 58  ? -32.73535 -34.69508 8.01626   1.000 42.31932  ? 542 CYS B O   1 
ATOM   1760 C CB  . CYS B 2 58  ? -30.05526 -36.71476 7.41941   1.000 41.14721  ? 542 CYS B CB  1 
ATOM   1761 S SG  . CYS B 2 58  ? -29.77864 -35.43283 6.12465   1.000 39.79267  ? 542 CYS B SG  1 
ATOM   1762 N N   . GLU B 2 59  ? -31.20906 -35.07093 9.61678   1.000 52.16209  ? 543 GLU B N   1 
ATOM   1763 C CA  . GLU B 2 59  ? -31.50273 -33.79619 10.25164  1.000 44.17919  ? 543 GLU B CA  1 
ATOM   1764 C C   . GLU B 2 59  ? -30.99563 -32.65212 9.37878   1.000 50.63301  ? 543 GLU B C   1 
ATOM   1765 O O   . GLU B 2 59  ? -29.99103 -32.80934 8.67756   1.000 59.31651  ? 543 GLU B O   1 
ATOM   1766 C CB  . GLU B 2 59  ? -30.90238 -33.73593 11.64922  1.000 44.51543  ? 543 GLU B CB  1 
ATOM   1767 C CG  . GLU B 2 59  ? -31.38533 -34.87849 12.54167  1.000 53.45134  ? 543 GLU B CG  1 
ATOM   1768 C CD  . GLU B 2 59  ? -32.83501 -34.73204 13.02196  1.000 74.25287  ? 543 GLU B CD  1 
ATOM   1769 O OE1 . GLU B 2 59  ? -33.29010 -35.62820 13.76196  1.000 84.28718  ? 543 GLU B OE1 1 
ATOM   1770 O OE2 . GLU B 2 59  ? -33.51435 -33.72862 12.70076  1.000 80.52900  ? 543 GLU B OE2 1 
ATOM   1771 N N   . PRO B 2 60  ? -31.70921 -31.51898 9.34677   1.000 52.51335  ? 544 PRO B N   1 
ATOM   1772 C CA  . PRO B 2 60  ? -31.35048 -30.44229 8.40637   1.000 48.97706  ? 544 PRO B CA  1 
ATOM   1773 C C   . PRO B 2 60  ? -29.96933 -29.87495 8.60788   1.000 43.53927  ? 544 PRO B C   1 
ATOM   1774 O O   . PRO B 2 60  ? -29.42024 -29.31703 7.64995   1.000 43.91057  ? 544 PRO B O   1 
ATOM   1775 C CB  . PRO B 2 60  ? -32.42627 -29.38468 8.66208   1.000 45.06232  ? 544 PRO B CB  1 
ATOM   1776 C CG  . PRO B 2 60  ? -33.59499 -30.17951 9.12959   1.000 45.13083  ? 544 PRO B CG  1 
ATOM   1777 C CD  . PRO B 2 60  ? -33.02576 -31.28108 9.96723   1.000 48.44679  ? 544 PRO B CD  1 
ATOM   1778 N N   . ALA B 2 61  ? -29.37580 -30.03493 9.79978   1.000 43.73961  ? 545 ALA B N   1 
ATOM   1779 C CA  . ALA B 2 61  ? -27.99507 -29.60011 10.01420  1.000 44.35497  ? 545 ALA B CA  1 
ATOM   1780 C C   . ALA B 2 61  ? -27.02940 -30.30627 9.07537   1.000 51.31194  ? 545 ALA B C   1 
ATOM   1781 O O   . ALA B 2 61  ? -25.99318 -29.73399 8.70328   1.000 53.26970  ? 545 ALA B O   1 
ATOM   1782 C CB  . ALA B 2 61  ? -27.56662 -29.84268 11.46504  1.000 44.24786  ? 545 ALA B CB  1 
ATOM   1783 N N   . PHE B 2 62  ? -27.35684 -31.53160 8.66230   1.000 45.85272  ? 546 PHE B N   1 
ATOM   1784 C CA  . PHE B 2 62  ? -26.44526 -32.31601 7.85054   1.000 40.38559  ? 546 PHE B CA  1 
ATOM   1785 C C   . PHE B 2 62  ? -26.67799 -32.14765 6.36588   1.000 39.95763  ? 546 PHE B C   1 
ATOM   1786 O O   . PHE B 2 62  ? -25.88117 -32.68007 5.58644   1.000 39.19407  ? 546 PHE B O   1 
ATOM   1787 C CB  . PHE B 2 62  ? -26.54775 -33.77660 8.24086   1.000 39.55618  ? 546 PHE B CB  1 
ATOM   1788 C CG  . PHE B 2 62  ? -26.28694 -34.00192 9.68096   1.000 40.09849  ? 546 PHE B CG  1 
ATOM   1789 C CD1 . PHE B 2 62  ? -27.30967 -34.36463 10.54139  1.000 44.35105  ? 546 PHE B CD1 1 
ATOM   1790 C CD2 . PHE B 2 62  ? -25.01800 -33.78492 10.19280  1.000 41.23104  ? 546 PHE B CD2 1 
ATOM   1791 C CE1 . PHE B 2 62  ? -27.05889 -34.55420 11.88406  1.000 48.17519  ? 546 PHE B CE1 1 
ATOM   1792 C CE2 . PHE B 2 62  ? -24.75890 -33.96944 11.52562  1.000 45.66676  ? 546 PHE B CE2 1 
ATOM   1793 C CZ  . PHE B 2 62  ? -25.77621 -34.35106 12.37734  1.000 46.71272  ? 546 PHE B CZ  1 
ATOM   1794 N N   . TYR B 2 63  ? -27.71149 -31.37985 5.98297   1.000 40.61364  ? 547 TYR B N   1 
ATOM   1795 C CA  . TYR B 2 63  ? -28.10575 -31.20431 4.58341   1.000 46.07334  ? 547 TYR B CA  1 
ATOM   1796 C C   . TYR B 2 63  ? -26.93209 -30.80161 3.70761   1.000 46.82733  ? 547 TYR B C   1 
ATOM   1797 O O   . TYR B 2 63  ? -26.70674 -31.39235 2.65381   1.000 45.10786  ? 547 TYR B O   1 
ATOM   1798 C CB  . TYR B 2 63  ? -29.20184 -30.14227 4.46407   1.000 59.52387  ? 547 TYR B CB  1 
ATOM   1799 C CG  . TYR B 2 63  ? -30.61919 -30.61702 4.71004   1.000 66.19167  ? 547 TYR B CG  1 
ATOM   1800 C CD1 . TYR B 2 63  ? -30.91718 -31.96265 4.76452   1.000 67.13376  ? 547 TYR B CD1 1 
ATOM   1801 C CD2 . TYR B 2 63  ? -31.66355 -29.70551 4.88263   1.000 66.96684  ? 547 TYR B CD2 1 
ATOM   1802 C CE1 . TYR B 2 63  ? -32.20840 -32.39976 4.99077   1.000 65.43603  ? 547 TYR B CE1 1 
ATOM   1803 C CE2 . TYR B 2 63  ? -32.95668 -30.13372 5.10444   1.000 62.18151  ? 547 TYR B CE2 1 
ATOM   1804 C CZ  . TYR B 2 63  ? -33.22310 -31.48140 5.15732   1.000 61.22690  ? 547 TYR B CZ  1 
ATOM   1805 O OH  . TYR B 2 63  ? -34.50291 -31.92813 5.38327   1.000 64.54008  ? 547 TYR B OH  1 
ATOM   1806 N N   . THR B 2 64  ? -26.13827 -29.82927 4.15302   1.000 54.97039  ? 548 THR B N   1 
ATOM   1807 C CA  . THR B 2 64  ? -25.10401 -29.29528 3.27474   1.000 52.30631  ? 548 THR B CA  1 
ATOM   1808 C C   . THR B 2 64  ? -24.00187 -30.31505 3.01485   1.000 46.59320  ? 548 THR B C   1 
ATOM   1809 O O   . THR B 2 64  ? -23.58306 -30.50948 1.86605   1.000 39.88212  ? 548 THR B O   1 
ATOM   1810 C CB  . THR B 2 64  ? -24.52666 -28.01230 3.85938   1.000 57.97069  ? 548 THR B CB  1 
ATOM   1811 O OG1 . THR B 2 64  ? -25.59962 -27.18700 4.32947   1.000 65.61127  ? 548 THR B OG1 1 
ATOM   1812 C CG2 . THR B 2 64  ? -23.73307 -27.27281 2.79735   1.000 47.66402  ? 548 THR B CG2 1 
ATOM   1813 N N   . CYS B 2 65  ? -23.51768 -30.98610 4.06021   1.000 43.54561  ? 549 CYS B N   1 
ATOM   1814 C CA  . CYS B 2 65  ? -22.41334 -31.91362 3.82627   1.000 44.85531  ? 549 CYS B CA  1 
ATOM   1815 C C   . CYS B 2 65  ? -22.87802 -33.19508 3.13257   1.000 49.71576  ? 549 CYS B C   1 
ATOM   1816 O O   . CYS B 2 65  ? -22.10173 -33.79535 2.37099   1.000 40.88531  ? 549 CYS B O   1 
ATOM   1817 C CB  . CYS B 2 65  ? -21.67873 -32.16532 5.14197   1.000 49.36698  ? 549 CYS B CB  1 
ATOM   1818 S SG  . CYS B 2 65  ? -22.65149 -33.00286 6.40425   1.000 49.25226  ? 549 CYS B SG  1 
ATOM   1819 N N   . VAL B 2 66  ? -24.15256 -33.57733 3.30589   1.000 53.65844  ? 550 VAL B N   1 
ATOM   1820 C CA  . VAL B 2 66  ? -24.70675 -34.71416 2.56547   1.000 36.86249  ? 550 VAL B CA  1 
ATOM   1821 C C   . VAL B 2 66  ? -24.83637 -34.39186 1.07693   1.000 36.78915  ? 550 VAL B C   1 
ATOM   1822 O O   . VAL B 2 66  ? -24.45967 -35.19976 0.21997   1.000 41.70877  ? 550 VAL B O   1 
ATOM   1823 C CB  . VAL B 2 66  ? -26.06327 -35.14245 3.15590   1.000 36.75786  ? 550 VAL B CB  1 
ATOM   1824 C CG1 . VAL B 2 66  ? -26.75613 -36.15774 2.24604   1.000 36.96642  ? 550 VAL B CG1 1 
ATOM   1825 C CG2 . VAL B 2 66  ? -25.87981 -35.74357 4.53923   1.000 36.77424  ? 550 VAL B CG2 1 
ATOM   1826 N N   . GLU B 2 67  ? -25.37921 -33.21707 0.73984   1.000 40.25354  ? 551 GLU B N   1 
ATOM   1827 C CA  . GLU B 2 67  ? -25.51750 -32.85946 -0.67390  1.000 41.04257  ? 551 GLU B CA  1 
ATOM   1828 C C   . GLU B 2 67  ? -24.15863 -32.66716 -1.33190  1.000 38.95384  ? 551 GLU B C   1 
ATOM   1829 O O   . GLU B 2 67  ? -23.95675 -33.12095 -2.46529  1.000 42.62668  ? 551 GLU B O   1 
ATOM   1830 C CB  . GLU B 2 67  ? -26.40926 -31.62159 -0.83771  1.000 55.35501  ? 551 GLU B CB  1 
ATOM   1831 C CG  . GLU B 2 67  ? -27.79095 -31.79592 -0.15781  1.000 80.34112  ? 551 GLU B CG  1 
ATOM   1832 C CD  . GLU B 2 67  ? -28.88928 -30.82598 -0.60168  1.000 96.94608  ? 551 GLU B CD  1 
ATOM   1833 O OE1 . GLU B 2 67  ? -28.58857 -29.86586 -1.34813  1.000 101.89461 ? 551 GLU B OE1 1 
ATOM   1834 O OE2 . GLU B 2 67  ? -30.05309 -31.00550 -0.15549  1.000 98.88340  ? 551 GLU B OE2 1 
ATOM   1835 N N   . VAL B 2 68  ? -23.19103 -32.07573 -0.61386  1.000 48.27145  ? 552 VAL B N   1 
ATOM   1836 C CA  . VAL B 2 68  ? -21.84374 -31.91659 -1.16666  1.000 40.13545  ? 552 VAL B CA  1 
ATOM   1837 C C   . VAL B 2 68  ? -21.17054 -33.27815 -1.36968  1.000 40.03380  ? 552 VAL B C   1 
ATOM   1838 O O   . VAL B 2 68  ? -20.54424 -33.51855 -2.41284  1.000 42.72768  ? 552 VAL B O   1 
ATOM   1839 C CB  . VAL B 2 68  ? -20.98954 -30.97656 -0.28704  1.000 50.64788  ? 552 VAL B CB  1 
ATOM   1840 C CG1 . VAL B 2 68  ? -19.51709 -30.99045 -0.72897  1.000 44.93187  ? 552 VAL B CG1 1 
ATOM   1841 C CG2 . VAL B 2 68  ? -21.49437 -29.54092 -0.36417  1.000 40.57953  ? 552 VAL B CG2 1 
ATOM   1842 N N   . THR B 2 69  ? -21.31986 -34.20878 -0.41280  1.000 37.02006  ? 553 THR B N   1 
ATOM   1843 C CA  . THR B 2 69  ? -20.72854 -35.53318 -0.60977  1.000 36.27742  ? 553 THR B CA  1 
ATOM   1844 C C   . THR B 2 69  ? -21.39954 -36.29865 -1.74484  1.000 37.89984  ? 553 THR B C   1 
ATOM   1845 O O   . THR B 2 69  ? -20.71902 -36.95236 -2.54410  1.000 45.14553  ? 553 THR B O   1 
ATOM   1846 C CB  . THR B 2 69  ? -20.80201 -36.37586 0.66207   1.000 46.99505  ? 553 THR B CB  1 
ATOM   1847 O OG1 . THR B 2 69  ? -20.23422 -35.66158 1.76243   1.000 50.65066  ? 553 THR B OG1 1 
ATOM   1848 C CG2 . THR B 2 69  ? -20.03513 -37.66228 0.45546   1.000 35.44913  ? 553 THR B CG2 1 
ATOM   1849 N N   . ALA B 2 70  ? -22.73216 -36.25950 -1.82485  1.000 39.68748  ? 554 ALA B N   1 
ATOM   1850 C CA  . ALA B 2 70  ? -23.41192 -37.09875 -2.81080  1.000 42.66488  ? 554 ALA B CA  1 
ATOM   1851 C C   . ALA B 2 70  ? -23.20298 -36.58041 -4.22921  1.000 41.82848  ? 554 ALA B C   1 
ATOM   1852 O O   . ALA B 2 70  ? -22.95998 -37.37312 -5.14646  1.000 34.62648  ? 554 ALA B O   1 
ATOM   1853 C CB  . ALA B 2 70  ? -24.90579 -37.20458 -2.49263  1.000 34.52466  ? 554 ALA B CB  1 
ATOM   1854 N N   . GLY B 2 71  ? -23.26810 -35.25635 -4.42068  1.000 41.29894  ? 555 GLY B N   1 
ATOM   1855 C CA  . GLY B 2 71  ? -23.23014 -34.69588 -5.76505  1.000 36.50718  ? 555 GLY B CA  1 
ATOM   1856 C C   . GLY B 2 71  ? -24.41770 -35.18948 -6.56917  1.000 40.18079  ? 555 GLY B C   1 
ATOM   1857 O O   . GLY B 2 71  ? -25.55174 -35.22218 -6.08392  1.000 38.14018  ? 555 GLY B O   1 
ATOM   1858 N N   . ASN B 2 72  ? -24.15476 -35.63561 -7.79729  1.000 36.06131  ? 556 ASN B N   1 
ATOM   1859 C CA  . ASN B 2 72  ? -25.21590 -36.11008 -8.67153  1.000 40.45064  ? 556 ASN B CA  1 
ATOM   1860 C C   . ASN B 2 72  ? -25.73857 -37.48871 -8.29339  1.000 37.49068  ? 556 ASN B C   1 
ATOM   1861 O O   . ASN B 2 72  ? -26.75740 -37.91679 -8.84762  1.000 36.63689  ? 556 ASN B O   1 
ATOM   1862 C CB  . ASN B 2 72  ? -24.72713 -36.13760 -10.11899 1.000 49.58834  ? 556 ASN B CB  1 
ATOM   1863 C CG  . ASN B 2 72  ? -24.65126 -34.74851 -10.73715 1.000 55.54172  ? 556 ASN B CG  1 
ATOM   1864 O OD1 . ASN B 2 72  ? -25.25476 -33.78907 -10.23716 1.000 48.00245  ? 556 ASN B OD1 1 
ATOM   1865 N ND2 . ASN B 2 72  ? -23.88357 -34.63023 -11.81696 1.000 58.43181  ? 556 ASN B ND2 1 
ATOM   1866 N N   . ARG B 2 73  ? -25.07548 -38.19705 -7.37766  1.000 37.23742  ? 557 ARG B N   1 
ATOM   1867 C CA  . ARG B 2 73  ? -25.54198 -39.52177 -6.98671  1.000 34.97524  ? 557 ARG B CA  1 
ATOM   1868 C C   . ARG B 2 73  ? -26.80291 -39.44684 -6.14252  1.000 36.03950  ? 557 ARG B C   1 
ATOM   1869 O O   . ARG B 2 73  ? -27.46875 -40.46806 -5.94964  1.000 32.50962  ? 557 ARG B O   1 
ATOM   1870 C CB  . ARG B 2 73  ? -24.41745 -40.26493 -6.26250  1.000 32.79412  ? 557 ARG B CB  1 
ATOM   1871 C CG  . ARG B 2 73  ? -23.08494 -40.02988 -6.94382  1.000 45.60775  ? 557 ARG B CG  1 
ATOM   1872 C CD  . ARG B 2 73  ? -22.04778 -41.10903 -6.66859  1.000 52.50011  ? 557 ARG B CD  1 
ATOM   1873 N NE  . ARG B 2 73  ? -21.52923 -41.08348 -5.30373  1.000 61.37732  ? 557 ARG B NE  1 
ATOM   1874 C CZ  . ARG B 2 73  ? -20.64884 -40.19919 -4.83435  1.000 64.34949  ? 557 ARG B CZ  1 
ATOM   1875 N NH1 . ARG B 2 73  ? -20.17723 -39.23762 -5.62264  1.000 65.32589  ? 557 ARG B NH1 1 
ATOM   1876 N NH2 . ARG B 2 73  ? -20.23511 -40.28003 -3.56495  1.000 56.71538  ? 557 ARG B NH2 1 
ATOM   1877 N N   . LEU B 2 74  ? -27.15475 -38.24492 -5.68067  1.000 33.89108  ? 558 LEU B N   1 
ATOM   1878 C CA  . LEU B 2 74  ? -28.46092 -37.98323 -5.09924  1.000 34.15287  ? 558 LEU B CA  1 
ATOM   1879 C C   . LEU B 2 74  ? -29.58456 -38.37303 -6.05481  1.000 34.11115  ? 558 LEU B C   1 
ATOM   1880 O O   . LEU B 2 74  ? -30.65708 -38.80407 -5.61688  1.000 33.98575  ? 558 LEU B O   1 
ATOM   1881 C CB  . LEU B 2 74  ? -28.53878 -36.50026 -4.74604  1.000 35.27335  ? 558 LEU B CB  1 
ATOM   1882 C CG  . LEU B 2 74  ? -29.12009 -36.06496 -3.40665  1.000 43.69844  ? 558 LEU B CG  1 
ATOM   1883 C CD1 . LEU B 2 74  ? -28.74976 -37.04894 -2.31668  1.000 35.03073  ? 558 LEU B CD1 1 
ATOM   1884 C CD2 . LEU B 2 74  ? -28.63967 -34.66738 -3.05213  1.000 36.64257  ? 558 LEU B CD2 1 
ATOM   1885 N N   . PHE B 2 75  ? -29.33441 -38.29017 -7.36074  1.000 34.27810  ? 559 PHE B N   1 
ATOM   1886 C CA  . PHE B 2 75  ? -30.32102 -38.59292 -8.38481  1.000 34.40392  ? 559 PHE B CA  1 
ATOM   1887 C C   . PHE B 2 75  ? -30.04356 -39.90655 -9.10584  1.000 33.52692  ? 559 PHE B C   1 
ATOM   1888 O O   . PHE B 2 75  ? -30.56367 -40.11749 -10.20088 1.000 33.70983  ? 559 PHE B O   1 
ATOM   1889 C CB  . PHE B 2 75  ? -30.38152 -37.43928 -9.38322  1.000 35.53697  ? 559 PHE B CB  1 
ATOM   1890 C CG  . PHE B 2 75  ? -30.29964 -36.07808 -8.73664  1.000 42.20967  ? 559 PHE B CG  1 
ATOM   1891 C CD1 . PHE B 2 75  ? -29.08678 -35.42596 -8.59523  1.000 43.91762  ? 559 PHE B CD1 1 
ATOM   1892 C CD2 . PHE B 2 75  ? -31.43340 -35.46016 -8.25720  1.000 38.39540  ? 559 PHE B CD2 1 
ATOM   1893 C CE1 . PHE B 2 75  ? -29.01780 -34.19130 -7.97917  1.000 45.51688  ? 559 PHE B CE1 1 
ATOM   1894 C CE2 . PHE B 2 75  ? -31.36025 -34.21697 -7.65965  1.000 38.27717  ? 559 PHE B CE2 1 
ATOM   1895 C CZ  . PHE B 2 75  ? -30.16246 -33.59370 -7.51140  1.000 38.45556  ? 559 PHE B CZ  1 
ATOM   1896 N N   . TYR B 2 76  ? -29.20012 -40.77678 -8.54396  1.000 20.49498  ? 560 TYR B N   1 
ATOM   1897 C CA  . TYR B 2 76  ? -29.10417 -42.13491 -9.06489  1.000 20.26023  ? 560 TYR B CA  1 
ATOM   1898 C C   . TYR B 2 76  ? -30.37251 -42.90941 -8.70521  1.000 21.29093  ? 560 TYR B C   1 
ATOM   1899 O O   . TYR B 2 76  ? -30.97762 -42.69738 -7.64847  1.000 19.15932  ? 560 TYR B O   1 
ATOM   1900 C CB  . TYR B 2 76  ? -27.89297 -42.85668 -8.49042  1.000 22.56221  ? 560 TYR B CB  1 
ATOM   1901 C CG  . TYR B 2 76  ? -26.54931 -42.45532 -9.06735  1.000 27.92001  ? 560 TYR B CG  1 
ATOM   1902 C CD1 . TYR B 2 76  ? -26.41971 -41.38712 -9.95478  1.000 30.02886  ? 560 TYR B CD1 1 
ATOM   1903 C CD2 . TYR B 2 76  ? -25.41789 -43.15640 -8.72666  1.000 24.43781  ? 560 TYR B CD2 1 
ATOM   1904 C CE1 . TYR B 2 76  ? -25.16462 -41.03531 -10.48032 1.000 29.42903  ? 560 TYR B CE1 1 
ATOM   1905 C CE2 . TYR B 2 76  ? -24.16232 -42.82080 -9.23860  1.000 28.86391  ? 560 TYR B CE2 1 
ATOM   1906 C CZ  . TYR B 2 76  ? -24.04192 -41.76977 -10.10957 1.000 33.49089  ? 560 TYR B CZ  1 
ATOM   1907 O OH  . TYR B 2 76  ? -22.79677 -41.46935 -10.59694 1.000 39.28926  ? 560 TYR B OH  1 
ATOM   1908 N N   . HIS B 2 77  ? -30.77243 -43.82729 -9.57720  1.000 21.71475  ? 561 HIS B N   1 
ATOM   1909 C CA  . HIS B 2 77  ? -32.01040 -44.57921 -9.36816  1.000 22.66650  ? 561 HIS B CA  1 
ATOM   1910 C C   . HIS B 2 77  ? -31.70665 -45.90776 -8.68885  1.000 17.59060  ? 561 HIS B C   1 
ATOM   1911 O O   . HIS B 2 77  ? -30.91121 -46.69212 -9.20498  1.000 17.33435  ? 561 HIS B O   1 
ATOM   1912 C CB  . HIS B 2 77  ? -32.70982 -44.81254 -10.69891 1.000 18.28741  ? 561 HIS B CB  1 
ATOM   1913 C CG  . HIS B 2 77  ? -33.10779 -43.54592 -11.37488 1.000 29.00303  ? 561 HIS B CG  1 
ATOM   1914 N ND1 . HIS B 2 77  ? -34.40316 -43.06755 -11.35405 1.000 20.53287  ? 561 HIS B ND1 1 
ATOM   1915 C CD2 . HIS B 2 77  ? -32.36919 -42.62825 -12.04349 1.000 19.46303  ? 561 HIS B CD2 1 
ATOM   1916 C CE1 . HIS B 2 77  ? -34.44484 -41.91867 -12.00366 1.000 21.81989  ? 561 HIS B CE1 1 
ATOM   1917 N NE2 . HIS B 2 77  ? -33.22574 -41.62973 -12.42627 1.000 24.34620  ? 561 HIS B NE2 1 
ATOM   1918 N N   . ILE B 2 78  ? -32.34734 -46.16427 -7.55070  1.000 17.46633  ? 562 ILE B N   1 
ATOM   1919 C CA  . ILE B 2 78  ? -32.13717 -47.39582 -6.80056  1.000 16.95802  ? 562 ILE B CA  1 
ATOM   1920 C C   . ILE B 2 78  ? -33.08057 -48.46527 -7.34038  1.000 17.99071  ? 562 ILE B C   1 
ATOM   1921 O O   . ILE B 2 78  ? -34.30059 -48.26467 -7.39500  1.000 17.02833  ? 562 ILE B O   1 
ATOM   1922 C CB  . ILE B 2 78  ? -32.35753 -47.17224 -5.29704  1.000 21.05625  ? 562 ILE B CB  1 
ATOM   1923 C CG1 . ILE B 2 78  ? -31.34237 -46.15875 -4.74235  1.000 17.77150  ? 562 ILE B CG1 1 
ATOM   1924 C CG2 . ILE B 2 78  ? -32.24176 -48.47900 -4.54111  1.000 16.63894  ? 562 ILE B CG2 1 
ATOM   1925 C CD1 . ILE B 2 78  ? -31.60401 -45.76696 -3.28661  1.000 17.92096  ? 562 ILE B CD1 1 
ATOM   1926 N N   . VAL B 2 79  ? -32.51635 -49.60320 -7.76037  1.000 16.35455  ? 563 VAL B N   1 
ATOM   1927 C CA  . VAL B 2 79  ? -33.29693 -50.68658 -8.34399  1.000 16.27700  ? 563 VAL B CA  1 
ATOM   1928 C C   . VAL B 2 79  ? -32.84723 -52.00275 -7.75226  1.000 15.93542  ? 563 VAL B C   1 
ATOM   1929 O O   . VAL B 2 79  ? -31.74495 -52.12275 -7.21143  1.000 15.74785  ? 563 VAL B O   1 
ATOM   1930 C CB  . VAL B 2 79  ? -33.18753 -50.75640 -9.88011  1.000 19.92848  ? 563 VAL B CB  1 
ATOM   1931 C CG1 . VAL B 2 79  ? -33.98554 -49.63392 -10.51772 1.000 16.96401  ? 563 VAL B CG1 1 
ATOM   1932 C CG2 . VAL B 2 79  ? -31.72127 -50.72265 -10.33442 1.000 16.47504  ? 563 VAL B CG2 1 
ATOM   1933 N N   . ASP B 2 80  ? -33.72527 -53.00562 -7.87729  1.000 19.21997  ? 564 ASP B N   1 
ATOM   1934 C CA  . ASP B 2 80  ? -33.45740 -54.33863 -7.31861  1.000 15.80448  ? 564 ASP B CA  1 
ATOM   1935 C C   . ASP B 2 80  ? -32.26975 -54.99818 -7.99347  1.000 15.71160  ? 564 ASP B C   1 
ATOM   1936 O O   . ASP B 2 80  ? -31.49170 -55.70674 -7.34694  1.000 15.52821  ? 564 ASP B O   1 
ATOM   1937 C CB  . ASP B 2 80  ? -34.66794 -55.24628 -7.52351  1.000 23.58815  ? 564 ASP B CB  1 
ATOM   1938 C CG  . ASP B 2 80  ? -35.70474 -55.17623 -6.39740  1.000 31.43480  ? 564 ASP B CG  1 
ATOM   1939 O OD1 . ASP B 2 80  ? -35.43983 -54.58559 -5.32223  1.000 19.05286  ? 564 ASP B OD1 1 
ATOM   1940 O OD2 . ASP B 2 80  ? -36.80979 -55.74213 -6.61860  1.000 39.15717  ? 564 ASP B OD2 1 
ATOM   1941 N N   . SER B 2 81  ? -32.11223 -54.78912 -9.29877  1.000 17.56916  ? 565 SER B N   1 
ATOM   1942 C CA  . SER B 2 81  ? -31.23983 -55.66468 -10.06721 1.000 21.16349  ? 565 SER B CA  1 
ATOM   1943 C C   . SER B 2 81  ? -30.84360 -55.00588 -11.37462 1.000 25.52964  ? 565 SER B C   1 
ATOM   1944 O O   . SER B 2 81  ? -31.41748 -53.99910 -11.78738 1.000 26.62769  ? 565 SER B O   1 
ATOM   1945 C CB  . SER B 2 81  ? -31.92265 -56.99796 -10.36180 1.000 18.13863  ? 565 SER B CB  1 
ATOM   1946 O OG  . SER B 2 81  ? -32.95105 -56.78433 -11.32884 1.000 29.47347  ? 565 SER B OG  1 
ATOM   1947 N N   . ASP B 2 82  ? -29.86652 -55.63255 -12.03970 1.000 18.70373  ? 566 ASP B N   1 
ATOM   1948 C CA  . ASP B 2 82  ? -29.43698 -55.19767 -13.36341 1.000 19.86941  ? 566 ASP B CA  1 
ATOM   1949 C C   . ASP B 2 82  ? -30.48837 -55.50722 -14.41910 1.000 20.22373  ? 566 ASP B C   1 
ATOM   1950 O O   . ASP B 2 82  ? -30.61201 -54.76251 -15.40564 1.000 24.21524  ? 566 ASP B O   1 
ATOM   1951 C CB  . ASP B 2 82  ? -28.08508 -55.83770 -13.72074 1.000 17.93630  ? 566 ASP B CB  1 
ATOM   1952 C CG  . ASP B 2 82  ? -28.09014 -57.35527 -13.64004 1.000 27.26538  ? 566 ASP B CG  1 
ATOM   1953 O OD1 . ASP B 2 82  ? -28.73452 -57.94789 -12.74125 1.000 31.99148  ? 566 ASP B OD1 1 
ATOM   1954 O OD2 . ASP B 2 82  ? -27.39534 -57.97206 -14.47071 1.000 33.56738  ? 566 ASP B OD2 1 
ATOM   1955 N N   A GLU B 2 83  ? -31.24677 -56.59406 -14.24067 0.533 25.64537  ? 567 GLU B N   1 
ATOM   1956 N N   B GLU B 2 83  ? -31.22588 -56.60136 -14.22892 0.467 24.90817  ? 567 GLU B N   1 
ATOM   1957 C CA  A GLU B 2 83  ? -32.35189 -56.90290 -15.14585 0.533 18.68589  ? 567 GLU B CA  1 
ATOM   1958 C CA  B GLU B 2 83  ? -32.35994 -56.94264 -15.07911 0.467 18.65894  ? 567 GLU B CA  1 
ATOM   1959 C C   A GLU B 2 83  ? -33.39356 -55.78561 -15.14246 0.533 26.17023  ? 567 GLU B C   1 
ATOM   1960 C C   B GLU B 2 83  ? -33.38245 -55.81016 -15.12446 0.467 25.98639  ? 567 GLU B C   1 
ATOM   1961 O O   A GLU B 2 83  ? -33.93266 -55.42093 -16.19922 0.533 28.04504  ? 567 GLU B O   1 
ATOM   1962 O O   B GLU B 2 83  ? -33.90817 -55.47232 -16.19495 0.467 27.81193  ? 567 GLU B O   1 
ATOM   1963 C CB  A GLU B 2 83  ? -32.99102 -58.24750 -14.75329 0.533 19.60126  ? 567 GLU B CB  1 
ATOM   1964 C CB  B GLU B 2 83  ? -33.00121 -58.22212 -14.53682 0.467 19.59798  ? 567 GLU B CB  1 
ATOM   1965 C CG  A GLU B 2 83  ? -34.34082 -58.54577 -15.45157 0.533 23.85194  ? 567 GLU B CG  1 
ATOM   1966 C CG  B GLU B 2 83  ? -33.42677 -59.23322 -15.56639 0.467 23.84595  ? 567 GLU B CG  1 
ATOM   1967 C CD  A GLU B 2 83  ? -35.09815 -59.79007 -14.93093 0.533 26.43347  ? 567 GLU B CD  1 
ATOM   1968 C CD  B GLU B 2 83  ? -32.33750 -60.22337 -15.88709 0.467 29.03765  ? 567 GLU B CD  1 
ATOM   1969 O OE1 A GLU B 2 83  ? -35.84796 -60.38520 -15.73184 0.533 30.31329  ? 567 GLU B OE1 1 
ATOM   1970 O OE1 B GLU B 2 83  ? -31.73819 -60.06816 -16.96329 0.467 34.48900  ? 567 GLU B OE1 1 
ATOM   1971 O OE2 A GLU B 2 83  ? -34.98418 -60.16575 -13.74433 0.533 19.55061  ? 567 GLU B OE2 1 
ATOM   1972 O OE2 B GLU B 2 83  ? -32.07945 -61.14928 -15.08077 0.467 25.86969  ? 567 GLU B OE2 1 
ATOM   1973 N N   . VAL B 2 84  ? -33.67183 -55.20936 -13.96696 1.000 22.39171  ? 568 VAL B N   1 
ATOM   1974 C CA  . VAL B 2 84  ? -34.63227 -54.11090 -13.89780 1.000 18.45692  ? 568 VAL B CA  1 
ATOM   1975 C C   . VAL B 2 84  ? -34.08929 -52.87613 -14.60462 1.000 29.50785  ? 568 VAL B C   1 
ATOM   1976 O O   . VAL B 2 84  ? -34.82862 -52.18801 -15.32282 1.000 18.58389  ? 568 VAL B O   1 
ATOM   1977 C CB  . VAL B 2 84  ? -34.97669 -53.81796 -12.43041 1.000 19.84387  ? 568 VAL B CB  1 
ATOM   1978 C CG1 . VAL B 2 84  ? -35.74555 -52.46666 -12.28158 1.000 17.70557  ? 568 VAL B CG1 1 
ATOM   1979 C CG2 . VAL B 2 84  ? -35.73784 -55.01524 -11.82412 1.000 17.68874  ? 568 VAL B CG2 1 
ATOM   1980 N N   . SER B 2 85  ? -32.78302 -52.60106 -14.43510 1.000 17.78171  ? 569 SER B N   1 
ATOM   1981 C CA  . SER B 2 85  ? -32.14451 -51.47400 -15.10831 1.000 26.16110  ? 569 SER B CA  1 
ATOM   1982 C C   . SER B 2 85  ? -32.25568 -51.60271 -16.61300 1.000 21.57162  ? 569 SER B C   1 
ATOM   1983 O O   . SER B 2 85  ? -32.64292 -50.65684 -17.29961 1.000 20.94856  ? 569 SER B O   1 
ATOM   1984 C CB  . SER B 2 85  ? -30.65824 -51.38219 -14.73396 1.000 18.58937  ? 569 SER B CB  1 
ATOM   1985 O OG  . SER B 2 85  ? -30.47593 -51.53494 -13.35419 1.000 21.99864  ? 569 SER B OG  1 
ATOM   1986 N N   . THR B 2 86  ? -31.89661 -52.76409 -17.14986 1.000 19.14819  ? 570 THR B N   1 
ATOM   1987 C CA  . THR B 2 86  ? -31.84707 -52.85976 -18.59600 1.000 25.06553  ? 570 THR B CA  1 
ATOM   1988 C C   . THR B 2 86  ? -33.24141 -52.96897 -19.20635 1.000 29.43065  ? 570 THR B C   1 
ATOM   1989 O O   . THR B 2 86  ? -33.42301 -52.58054 -20.36273 1.000 26.28231  ? 570 THR B O   1 
ATOM   1990 C CB  . THR B 2 86  ? -30.95627 -54.03222 -19.00558 1.000 23.33207  ? 570 THR B CB  1 
ATOM   1991 O OG1 . THR B 2 86  ? -31.45651 -55.23077 -18.41745 1.000 21.16025  ? 570 THR B OG1 1 
ATOM   1992 C CG2 . THR B 2 86  ? -29.53793 -53.80229 -18.52739 1.000 20.25889  ? 570 THR B CG2 1 
ATOM   1993 N N   . LYS B 2 87  ? -34.23548 -53.45670 -18.45121 1.000 20.27393  ? 571 LYS B N   1 
ATOM   1994 C CA  . LYS B 2 87  ? -35.61048 -53.42942 -18.93555 1.000 20.93723  ? 571 LYS B CA  1 
ATOM   1995 C C   . LYS B 2 87  ? -36.14161 -52.00857 -18.97814 1.000 24.46192  ? 571 LYS B C   1 
ATOM   1996 O O   . LYS B 2 87  ? -36.84519 -51.62898 -19.92205 1.000 24.28233  ? 571 LYS B O   1 
ATOM   1997 C CB  . LYS B 2 87  ? -36.51647 -54.28433 -18.05697 1.000 28.21193  ? 571 LYS B CB  1 
ATOM   1998 C CG  . LYS B 2 87  ? -37.37257 -55.28062 -18.81783 1.000 32.70758  ? 571 LYS B CG  1 
ATOM   1999 C CD  . LYS B 2 87  ? -38.34331 -54.60917 -19.76311 1.000 43.43705  ? 571 LYS B CD  1 
ATOM   2000 C CE  . LYS B 2 87  ? -38.97520 -55.63118 -20.70140 1.000 54.44894  ? 571 LYS B CE  1 
ATOM   2001 N NZ  . LYS B 2 87  ? -39.69470 -54.98469 -21.84412 1.000 53.51553  ? 571 LYS B NZ  1 
ATOM   2002 N N   . ILE B 2 88  ? -35.86033 -51.21437 -17.94225 1.000 20.18204  ? 572 ILE B N   1 
ATOM   2003 C CA  . ILE B 2 88  ? -36.20528 -49.79891 -18.02080 1.000 23.36962  ? 572 ILE B CA  1 
ATOM   2004 C C   . ILE B 2 88  ? -35.51086 -49.15515 -19.20852 1.000 29.74213  ? 572 ILE B C   1 
ATOM   2005 O O   . ILE B 2 88  ? -36.14625 -48.45242 -19.99082 1.000 22.29443  ? 572 ILE B O   1 
ATOM   2006 C CB  . ILE B 2 88  ? -35.86427 -49.06415 -16.71357 1.000 23.06132  ? 572 ILE B CB  1 
ATOM   2007 C CG1 . ILE B 2 88  ? -36.78537 -49.54197 -15.58651 1.000 19.42165  ? 572 ILE B CG1 1 
ATOM   2008 C CG2 . ILE B 2 88  ? -36.02911 -47.54389 -16.92739 1.000 21.03427  ? 572 ILE B CG2 1 
ATOM   2009 C CD1 . ILE B 2 88  ? -36.38371 -49.08838 -14.24518 1.000 18.80686  ? 572 ILE B CD1 1 
ATOM   2010 N N   . LEU B 2 89  ? -34.22048 -49.46109 -19.41693 1.000 22.47991  ? 573 LEU B N   1 
ATOM   2011 C CA  . LEU B 2 89  ? -33.47336 -48.81221 -20.49076 1.000 22.86265  ? 573 LEU B CA  1 
ATOM   2012 C C   . LEU B 2 89  ? -33.92839 -49.27325 -21.86869 1.000 31.51444  ? 573 LEU B C   1 
ATOM   2013 O O   . LEU B 2 89  ? -33.88101 -48.48802 -22.82351 1.000 33.66672  ? 573 LEU B O   1 
ATOM   2014 C CB  . LEU B 2 89  ? -31.97114 -49.04888 -20.32465 1.000 20.98052  ? 573 LEU B CB  1 
ATOM   2015 C CG  . LEU B 2 89  ? -31.26216 -47.97516 -19.49258 1.000 35.22315  ? 573 LEU B CG  1 
ATOM   2016 C CD1 . LEU B 2 89  ? -29.85753 -48.40976 -19.13420 1.000 28.70622  ? 573 LEU B CD1 1 
ATOM   2017 C CD2 . LEU B 2 89  ? -31.22517 -46.62314 -20.21317 1.000 34.45868  ? 573 LEU B CD2 1 
ATOM   2018 N N   . MET B 2 90  ? -34.37062 -50.52196 -21.99578 1.000 22.37903  ? 574 MET B N   1 
ATOM   2019 C CA  . MET B 2 90  ? -34.83483 -51.00000 -23.29163 1.000 29.15870  ? 574 MET B CA  1 
ATOM   2020 C C   . MET B 2 90  ? -36.07930 -50.23873 -23.74827 1.000 29.72641  ? 574 MET B C   1 
ATOM   2021 O O   . MET B 2 90  ? -36.18776 -49.86154 -24.92170 1.000 40.71709  ? 574 MET B O   1 
ATOM   2022 C CB  . MET B 2 90  ? -35.10237 -52.50378 -23.22743 1.000 38.73698  ? 574 MET B CB  1 
ATOM   2023 C CG  . MET B 2 90  ? -35.93449 -53.04354 -24.38756 1.000 45.98786  ? 574 MET B CG  1 
ATOM   2024 S SD  . MET B 2 90  ? -36.19193 -54.81951 -24.20960 1.000 54.70845  ? 574 MET B SD  1 
ATOM   2025 C CE  . MET B 2 90  ? -34.65139 -55.45357 -24.87413 1.000 58.92916  ? 574 MET B CE  1 
ATOM   2026 N N   . GLU B 2 91  ? -36.99337 -49.93999 -22.82578 1.000 24.96764  ? 575 GLU B N   1 
ATOM   2027 C CA  . GLU B 2 91  ? -38.16956 -49.16365 -23.19617 1.000 26.07262  ? 575 GLU B CA  1 
ATOM   2028 C C   . GLU B 2 91  ? -37.85319 -47.67123 -23.26793 1.000 30.67193  ? 575 GLU B C   1 
ATOM   2029 O O   . GLU B 2 91  ? -38.42399 -46.95701 -24.10021 1.000 28.06792  ? 575 GLU B O   1 
ATOM   2030 C CB  . GLU B 2 91  ? -39.30998 -49.43151 -22.21679 1.000 36.50158  ? 575 GLU B CB  1 
ATOM   2031 C CG  . GLU B 2 91  ? -40.60352 -48.70905 -22.58812 1.000 56.24353  ? 575 GLU B CG  1 
ATOM   2032 C CD  . GLU B 2 91  ? -41.50489 -49.52366 -23.50325 1.000 64.80309  ? 575 GLU B CD  1 
ATOM   2033 O OE1 . GLU B 2 91  ? -42.46989 -48.93955 -24.05336 1.000 68.90852  ? 575 GLU B OE1 1 
ATOM   2034 O OE2 . GLU B 2 91  ? -41.25711 -50.74272 -23.65467 1.000 61.62012  ? 575 GLU B OE2 1 
ATOM   2035 N N   . PHE B 2 92  ? -36.95503 -47.19713 -22.39394 1.000 25.87981  ? 576 PHE B N   1 
ATOM   2036 C CA  . PHE B 2 92  ? -36.43495 -45.82877 -22.44705 1.000 32.47777  ? 576 PHE B CA  1 
ATOM   2037 C C   . PHE B 2 92  ? -35.92476 -45.49600 -23.84664 1.000 34.33897  ? 576 PHE B C   1 
ATOM   2038 O O   . PHE B 2 92  ? -36.28046 -44.46152 -24.42726 1.000 30.11916  ? 576 PHE B O   1 
ATOM   2039 C CB  . PHE B 2 92  ? -35.30592 -45.71190 -21.41486 1.000 22.33629  ? 576 PHE B CB  1 
ATOM   2040 C CG  . PHE B 2 92  ? -34.82928 -44.31455 -21.10825 1.000 22.32273  ? 576 PHE B CG  1 
ATOM   2041 C CD1 . PHE B 2 92  ? -35.14444 -43.72758 -19.89533 1.000 21.87977  ? 576 PHE B CD1 1 
ATOM   2042 C CD2 . PHE B 2 92  ? -33.96134 -43.64247 -21.95977 1.000 29.03442  ? 576 PHE B CD2 1 
ATOM   2043 C CE1 . PHE B 2 92  ? -34.65011 -42.47932 -19.55004 1.000 23.84980  ? 576 PHE B CE1 1 
ATOM   2044 C CE2 . PHE B 2 92  ? -33.46773 -42.37890 -21.62745 1.000 30.44905  ? 576 PHE B CE2 1 
ATOM   2045 C CZ  . PHE B 2 92  ? -33.83165 -41.79255 -20.41916 1.000 26.62460  ? 576 PHE B CZ  1 
ATOM   2046 N N   . ASN B 2 93  ? -35.11425 -46.39865 -24.41179 1.000 27.38253  ? 577 ASN B N   1 
ATOM   2047 C CA  . ASN B 2 93  ? -34.47414 -46.16673 -25.69515 1.000 37.02142  ? 577 ASN B CA  1 
ATOM   2048 C C   . ASN B 2 93  ? -35.40524 -46.47686 -26.85403 1.000 49.19772  ? 577 ASN B C   1 
ATOM   2049 O O   . ASN B 2 93  ? -35.23771 -45.91158 -27.94286 1.000 57.47773  ? 577 ASN B O   1 
ATOM   2050 C CB  . ASN B 2 93  ? -33.20721 -47.01430 -25.80924 1.000 25.18454  ? 577 ASN B CB  1 
ATOM   2051 C CG  . ASN B 2 93  ? -32.10167 -46.51440 -24.92710 1.000 37.36469  ? 577 ASN B CG  1 
ATOM   2052 O OD1 . ASN B 2 93  ? -32.15191 -45.38006 -24.41133 1.000 25.66552  ? 577 ASN B OD1 1 
ATOM   2053 N ND2 . ASN B 2 93  ? -31.06442 -47.34279 -24.76043 1.000 37.65128  ? 577 ASN B ND2 1 
ATOM   2054 N N   . LYS B 2 94  ? -36.35366 -47.39589 -26.65182 1.000 42.42859  ? 578 LYS B N   1 
ATOM   2055 C CA  . LYS B 2 94  ? -37.37761 -47.62880 -27.66411 1.000 39.64282  ? 578 LYS B CA  1 
ATOM   2056 C C   . LYS B 2 94  ? -38.14498 -46.34616 -27.95810 1.000 40.00956  ? 578 LYS B C   1 
ATOM   2057 O O   . LYS B 2 94  ? -38.31472 -45.96882 -29.12470 1.000 44.05603  ? 578 LYS B O   1 
ATOM   2058 C CB  . LYS B 2 94  ? -38.31985 -48.73175 -27.19740 1.000 39.59288  ? 578 LYS B CB  1 
ATOM   2059 C CG  . LYS B 2 94  ? -39.34088 -49.18555 -28.21052 1.000 48.35450  ? 578 LYS B CG  1 
ATOM   2060 C CD  . LYS B 2 94  ? -40.15960 -50.31248 -27.59699 1.000 59.31462  ? 578 LYS B CD  1 
ATOM   2061 C CE  . LYS B 2 94  ? -41.38570 -50.66741 -28.41878 1.000 71.67979  ? 578 LYS B CE  1 
ATOM   2062 N NZ  . LYS B 2 94  ? -42.20107 -51.69135 -27.69188 1.000 78.18347  ? 578 LYS B NZ  1 
ATOM   2063 N N   . MET B 2 95  ? -38.52969 -45.61482 -26.90906 1.000 33.42361  ? 579 MET B N   1 
ATOM   2064 C CA  . MET B 2 95  ? -39.29898 -44.38292 -27.04208 1.000 33.01103  ? 579 MET B CA  1 
ATOM   2065 C C   . MET B 2 95  ? -38.44922 -43.15082 -27.35272 1.000 32.86766  ? 579 MET B C   1 
ATOM   2066 O O   . MET B 2 95  ? -39.01564 -42.04897 -27.41454 1.000 31.95347  ? 579 MET B O   1 
ATOM   2067 C CB  . MET B 2 95  ? -40.10920 -44.14653 -25.75808 1.000 35.78166  ? 579 MET B CB  1 
ATOM   2068 C CG  . MET B 2 95  ? -41.35096 -45.05965 -25.60009 1.000 44.36156  ? 579 MET B CG  1 
ATOM   2069 S SD  . MET B 2 95  ? -41.81391 -45.24324 -23.84799 1.000 64.40953  ? 579 MET B SD  1 
ATOM   2070 C CE  . MET B 2 95  ? -43.52052 -45.84106 -23.94064 1.000 68.65984  ? 579 MET B CE  1 
ATOM   2071 N N   . ASN B 2 96  ? -37.12771 -43.30245 -27.53664 1.000 32.49034  ? 580 ASN B N   1 
ATOM   2072 C CA  . ASN B 2 96  ? -36.21597 -42.18819 -27.86098 1.000 39.43834  ? 580 ASN B CA  1 
ATOM   2073 C C   . ASN B 2 96  ? -36.30411 -41.07995 -26.81768 1.000 40.88399  ? 580 ASN B C   1 
ATOM   2074 O O   . ASN B 2 96  ? -36.37758 -39.88834 -27.14160 1.000 46.53056  ? 580 ASN B O   1 
ATOM   2075 C CB  . ASN B 2 96  ? -36.47197 -41.61850 -29.26008 1.000 34.03410  ? 580 ASN B CB  1 
ATOM   2076 C CG  . ASN B 2 96  ? -36.18490 -42.61613 -30.35554 1.000 45.23380  ? 580 ASN B CG  1 
ATOM   2077 O OD1 . ASN B 2 96  ? -35.03512 -42.78545 -30.76491 1.000 49.95842  ? 580 ASN B OD1 1 
ATOM   2078 N ND2 . ASN B 2 96  ? -37.23037 -43.28014 -30.84743 1.000 46.63326  ? 580 ASN B ND2 1 
ATOM   2079 N N   . LEU B 2 97  ? -36.30056 -41.48942 -25.55576 1.000 31.27688  ? 581 LEU B N   1 
ATOM   2080 C CA  . LEU B 2 97  ? -36.60587 -40.55938 -24.48872 1.000 30.72797  ? 581 LEU B CA  1 
ATOM   2081 C C   . LEU B 2 97  ? -35.36470 -39.76325 -24.12137 1.000 27.16220  ? 581 LEU B C   1 
ATOM   2082 O O   . LEU B 2 97  ? -34.24641 -40.26893 -24.21495 1.000 25.33297  ? 581 LEU B O   1 
ATOM   2083 C CB  . LEU B 2 97  ? -37.13950 -41.30505 -23.26766 1.000 31.54250  ? 581 LEU B CB  1 
ATOM   2084 C CG  . LEU B 2 97  ? -38.55518 -41.87739 -23.39572 1.000 34.25918  ? 581 LEU B CG  1 
ATOM   2085 C CD1 . LEU B 2 97  ? -38.91840 -42.65874 -22.14730 1.000 34.79935  ? 581 LEU B CD1 1 
ATOM   2086 C CD2 . LEU B 2 97  ? -39.58750 -40.78303 -23.67238 1.000 27.71953  ? 581 LEU B CD2 1 
ATOM   2087 N N   . PRO B 2 98  ? -35.53708 -38.50843 -23.72748 1.000 33.71802  ? 582 PRO B N   1 
ATOM   2088 C CA  . PRO B 2 98  ? -34.37887 -37.69216 -23.37184 1.000 30.55267  ? 582 PRO B CA  1 
ATOM   2089 C C   . PRO B 2 98  ? -33.81730 -38.08824 -22.02140 1.000 31.46119  ? 582 PRO B C   1 
ATOM   2090 O O   . PRO B 2 98  ? -34.53497 -38.54269 -21.13465 1.000 30.52240  ? 582 PRO B O   1 
ATOM   2091 C CB  . PRO B 2 98  ? -34.95537 -36.27682 -23.31593 1.000 26.79320  ? 582 PRO B CB  1 
ATOM   2092 C CG  . PRO B 2 98  ? -36.38382 -36.49018 -22.89767 1.000 26.68839  ? 582 PRO B CG  1 
ATOM   2093 C CD  . PRO B 2 98  ? -36.79265 -37.73395 -23.66052 1.000 26.98208  ? 582 PRO B CD  1 
ATOM   2094 N N   . GLY B 2 99  ? -32.51858 -37.88458 -21.85959 1.000 29.92831  ? 583 GLY B N   1 
ATOM   2095 C CA  . GLY B 2 99  ? -31.92944 -37.81969 -20.54067 1.000 24.99051  ? 583 GLY B CA  1 
ATOM   2096 C C   . GLY B 2 99  ? -30.74206 -38.74433 -20.39297 1.000 33.50123  ? 583 GLY B C   1 
ATOM   2097 O O   . GLY B 2 99  ? -30.39253 -39.52208 -21.28775 1.000 31.88363  ? 583 GLY B O   1 
ATOM   2098 N N   . GLU B 2 100 ? -30.09790 -38.62083 -19.23507 1.000 32.24566  ? 584 GLU B N   1 
ATOM   2099 C CA  . GLU B 2 100 ? -29.09427 -39.56834 -18.77075 1.000 48.02721  ? 584 GLU B CA  1 
ATOM   2100 C C   . GLU B 2 100 ? -29.58528 -40.17126 -17.46526 1.000 38.36348  ? 584 GLU B C   1 
ATOM   2101 O O   . GLU B 2 100 ? -30.06525 -39.44226 -16.58772 1.000 41.18256  ? 584 GLU B O   1 
ATOM   2102 C CB  . GLU B 2 100 ? -27.72986 -38.90160 -18.56313 1.000 63.91863  ? 584 GLU B CB  1 
ATOM   2103 C CG  . GLU B 2 100 ? -26.58139 -39.88917 -18.68482 1.000 81.32173  ? 584 GLU B CG  1 
ATOM   2104 C CD  . GLU B 2 100 ? -25.27740 -39.41132 -18.06987 1.000 92.03889  ? 584 GLU B CD  1 
ATOM   2105 O OE1 . GLU B 2 100 ? -24.21613 -39.61692 -18.70545 1.000 90.97279  ? 584 GLU B OE1 1 
ATOM   2106 O OE2 . GLU B 2 100 ? -25.31284 -38.85454 -16.94915 1.000 96.69249  ? 584 GLU B OE2 1 
ATOM   2107 N N   . VAL B 2 101 ? -29.50927 -41.49453 -17.34405 1.000 35.23151  ? 585 VAL B N   1 
ATOM   2108 C CA  . VAL B 2 101 ? -29.94752 -42.15117 -16.11801 1.000 30.33383  ? 585 VAL B CA  1 
ATOM   2109 C C   . VAL B 2 101 ? -28.82430 -43.03379 -15.61051 1.000 28.03095  ? 585 VAL B C   1 
ATOM   2110 O O   . VAL B 2 101 ? -28.05845 -43.60316 -16.39286 1.000 28.02212  ? 585 VAL B O   1 
ATOM   2111 C CB  . VAL B 2 101 ? -31.24241 -42.96529 -16.30914 1.000 31.43736  ? 585 VAL B CB  1 
ATOM   2112 C CG1 . VAL B 2 101 ? -32.41244 -42.01443 -16.48897 1.000 20.82994  ? 585 VAL B CG1 1 
ATOM   2113 C CG2 . VAL B 2 101 ? -31.12237 -43.92907 -17.48913 1.000 20.50749  ? 585 VAL B CG2 1 
ATOM   2114 N N   . THR B 2 102 ? -28.69726 -43.10202 -14.28754 1.000 20.83833  ? 586 THR B N   1 
ATOM   2115 C CA  . THR B 2 102 ? -27.72300 -43.97278 -13.64980 1.000 24.78815  ? 586 THR B CA  1 
ATOM   2116 C C   . THR B 2 102 ? -28.42969 -44.80516 -12.59055 1.000 18.97049  ? 586 THR B C   1 
ATOM   2117 O O   . THR B 2 102 ? -29.23386 -44.27328 -11.80975 1.000 20.48972  ? 586 THR B O   1 
ATOM   2118 C CB  . THR B 2 102 ? -26.59044 -43.15523 -13.04421 1.000 26.68959  ? 586 THR B CB  1 
ATOM   2119 O OG1 . THR B 2 102 ? -26.01554 -42.33319 -14.06196 1.000 23.67820  ? 586 THR B OG1 1 
ATOM   2120 C CG2 . THR B 2 102 ? -25.51002 -44.05783 -12.50458 1.000 25.79824  ? 586 THR B CG2 1 
ATOM   2121 N N   . PHE B 2 103 ? -28.15163 -46.10692 -12.57351 1.000 19.32966  ? 587 PHE B N   1 
ATOM   2122 C CA  . PHE B 2 103 ? -28.85337 -47.03350 -11.69295 1.000 25.43662  ? 587 PHE B CA  1 
ATOM   2123 C C   . PHE B 2 103 ? -27.92367 -47.56366 -10.61859 1.000 25.14709  ? 587 PHE B C   1 
ATOM   2124 O O   . PHE B 2 103 ? -26.74380 -47.81898 -10.87656 1.000 18.65132  ? 587 PHE B O   1 
ATOM   2125 C CB  . PHE B 2 103 ? -29.43446 -48.20936 -12.47243 1.000 17.64286  ? 587 PHE B CB  1 
ATOM   2126 C CG  . PHE B 2 103 ? -30.54116 -47.82211 -13.41099 1.000 21.85456  ? 587 PHE B CG  1 
ATOM   2127 C CD1 . PHE B 2 103 ? -31.85636 -47.77160 -12.96921 1.000 20.49679  ? 587 PHE B CD1 1 
ATOM   2128 C CD2 . PHE B 2 103 ? -30.26465 -47.50393 -14.72953 1.000 18.45531  ? 587 PHE B CD2 1 
ATOM   2129 C CE1 . PHE B 2 103 ? -32.85730 -47.42953 -13.82065 1.000 25.20144  ? 587 PHE B CE1 1 
ATOM   2130 C CE2 . PHE B 2 103 ? -31.26471 -47.16264 -15.58641 1.000 29.28756  ? 587 PHE B CE2 1 
ATOM   2131 C CZ  . PHE B 2 103 ? -32.56782 -47.11404 -15.13072 1.000 18.61184  ? 587 PHE B CZ  1 
ATOM   2132 N N   . LEU B 2 104 ? -28.46625 -47.74790 -9.41334  1.000 17.24203  ? 588 LEU B N   1 
ATOM   2133 C CA  . LEU B 2 104 ? -27.75674 -48.43927 -8.33544  1.000 20.44513  ? 588 LEU B CA  1 
ATOM   2134 C C   . LEU B 2 104 ? -28.43253 -49.78223 -8.13114  1.000 16.46645  ? 588 LEU B C   1 
ATOM   2135 O O   . LEU B 2 104 ? -29.42572 -49.87282 -7.39779  1.000 16.24012  ? 588 LEU B O   1 
ATOM   2136 C CB  . LEU B 2 104 ? -27.78691 -47.62505 -7.04889  1.000 17.15788  ? 588 LEU B CB  1 
ATOM   2137 C CG  . LEU B 2 104 ? -26.96940 -46.35654 -6.99667  1.000 17.85796  ? 588 LEU B CG  1 
ATOM   2138 C CD1 . LEU B 2 104 ? -27.32237 -45.63609 -5.70870  1.000 18.19882  ? 588 LEU B CD1 1 
ATOM   2139 C CD2 . LEU B 2 104 ? -25.46247 -46.62466 -7.09189  1.000 18.19322  ? 588 LEU B CD2 1 
ATOM   2140 N N   . PRO B 2 105 ? -27.96863 -50.84507 -8.77119  1.000 16.40175  ? 589 PRO B N   1 
ATOM   2141 C CA  . PRO B 2 105 ? -28.70963 -52.11499 -8.70519  1.000 16.06149  ? 589 PRO B CA  1 
ATOM   2142 C C   . PRO B 2 105 ? -28.26832 -52.94500 -7.51613  1.000 15.79406  ? 589 PRO B C   1 
ATOM   2143 O O   . PRO B 2 105 ? -27.13075 -53.41591 -7.48805  1.000 15.91993  ? 589 PRO B O   1 
ATOM   2144 C CB  . PRO B 2 105 ? -28.38426 -52.79855 -10.04385 1.000 16.33669  ? 589 PRO B CB  1 
ATOM   2145 C CG  . PRO B 2 105 ? -27.37824 -51.91045 -10.73176 1.000 16.81042  ? 589 PRO B CG  1 
ATOM   2146 C CD  . PRO B 2 105 ? -26.84959 -50.92335 -9.71517  1.000 16.82402  ? 589 PRO B CD  1 
ATOM   2147 N N   . LEU B 2 106 ? -29.18445 -53.14298 -6.55550  1.000 15.54153  ? 590 LEU B N   1 
ATOM   2148 C CA  . LEU B 2 106 ? -28.82130 -53.66169 -5.23299  1.000 16.95793  ? 590 LEU B CA  1 
ATOM   2149 C C   . LEU B 2 106 ? -28.14083 -55.02487 -5.32078  1.000 18.69196  ? 590 LEU B C   1 
ATOM   2150 O O   . LEU B 2 106 ? -27.19584 -55.29170 -4.57395  1.000 28.15596  ? 590 LEU B O   1 
ATOM   2151 C CB  . LEU B 2 106 ? -30.06576 -53.73516 -4.33367  1.000 15.27550  ? 590 LEU B CB  1 
ATOM   2152 C CG  . LEU B 2 106 ? -30.67899 -52.36095 -4.00022  1.000 15.75903  ? 590 LEU B CG  1 
ATOM   2153 C CD1 . LEU B 2 106 ? -32.06146 -52.47724 -3.40825  1.000 15.59560  ? 590 LEU B CD1 1 
ATOM   2154 C CD2 . LEU B 2 106 ? -29.76094 -51.51937 -3.09811  1.000 15.72555  ? 590 LEU B CD2 1 
ATOM   2155 N N   . ASN B 2 107 ? -28.56430 -55.88360 -6.26316  1.000 16.86821  ? 591 ASN B N   1 
ATOM   2156 C CA  . ASN B 2 107 ? -27.97051 -57.21713 -6.30597  1.000 18.92414  ? 591 ASN B CA  1 
ATOM   2157 C C   . ASN B 2 107 ? -26.58619 -57.24458 -6.96359  1.000 17.63483  ? 591 ASN B C   1 
ATOM   2158 O O   . ASN B 2 107 ? -25.95859 -58.29870 -6.99181  1.000 28.67477  ? 591 ASN B O   1 
ATOM   2159 C CB  . ASN B 2 107 ? -28.92044 -58.20399 -7.00122  1.000 15.57995  ? 591 ASN B CB  1 
ATOM   2160 C CG  . ASN B 2 107 ? -28.96087 -58.04134 -8.51219  1.000 33.01563  ? 591 ASN B CG  1 
ATOM   2161 O OD1 . ASN B 2 107 ? -28.60415 -57.00100 -9.05809  1.000 39.07073  ? 591 ASN B OD1 1 
ATOM   2162 N ND2 . ASN B 2 107 ? -29.44159 -59.06938 -9.19496  1.000 33.83998  ? 591 ASN B ND2 1 
ATOM   2163 N N   . LYS B 2 108 ? -26.09774 -56.13160 -7.50728  1.000 16.36166  ? 592 LYS B N   1 
ATOM   2164 C CA  . LYS B 2 108 ? -24.79334 -56.11036 -8.16405  1.000 16.74707  ? 592 LYS B CA  1 
ATOM   2165 C C   . LYS B 2 108 ? -23.75905 -55.23452 -7.47562  1.000 19.52609  ? 592 LYS B C   1 
ATOM   2166 O O   . LYS B 2 108 ? -22.56125 -55.38407 -7.77246  1.000 17.77148  ? 592 LYS B O   1 
ATOM   2167 C CB  . LYS B 2 108 ? -24.93090 -55.62011 -9.61490  1.000 24.93812  ? 592 LYS B CB  1 
ATOM   2168 C CG  . LYS B 2 108 ? -25.67324 -56.56261 -10.53589 1.000 17.26672  ? 592 LYS B CG  1 
ATOM   2169 C CD  . LYS B 2 108 ? -24.89388 -57.86772 -10.63634 1.000 26.79872  ? 592 LYS B CD  1 
ATOM   2170 C CE  . LYS B 2 108 ? -25.81518 -59.01634 -11.01341 1.000 28.83704  ? 592 LYS B CE  1 
ATOM   2171 N NZ  . LYS B 2 108 ? -25.09385 -60.32624 -10.94291 1.000 39.06850  ? 592 LYS B NZ  1 
ATOM   2172 N N   . LEU B 2 109 ? -24.17574 -54.29449 -6.61285  1.000 20.80233  ? 593 LEU B N   1 
ATOM   2173 C CA  . LEU B 2 109 ? -23.21808 -53.37123 -5.99554  1.000 20.98304  ? 593 LEU B CA  1 
ATOM   2174 C C   . LEU B 2 109 ? -22.22460 -54.14239 -5.14703  1.000 28.15267  ? 593 LEU B C   1 
ATOM   2175 O O   . LEU B 2 109 ? -22.62263 -54.87660 -4.23701  1.000 39.04868  ? 593 LEU B O   1 
ATOM   2176 C CB  . LEU B 2 109 ? -23.94609 -52.34266 -5.13974  1.000 16.86185  ? 593 LEU B CB  1 
ATOM   2177 C CG  . LEU B 2 109 ? -24.86416 -51.40410 -5.92958  1.000 36.79248  ? 593 LEU B CG  1 
ATOM   2178 C CD1 . LEU B 2 109 ? -25.66011 -50.52686 -4.98708  1.000 19.25833  ? 593 LEU B CD1 1 
ATOM   2179 C CD2 . LEU B 2 109 ? -24.08324 -50.55295 -6.93721  1.000 17.42702  ? 593 LEU B CD2 1 
ATOM   2180 N N   . ASP B 2 110 ? -20.93614 -54.02282 -5.47320  1.000 28.11026  ? 594 ASP B N   1 
ATOM   2181 C CA  . ASP B 2 110 ? -19.91494 -54.85015 -4.82788  1.000 37.68829  ? 594 ASP B CA  1 
ATOM   2182 C C   . ASP B 2 110 ? -19.24008 -54.14319 -3.66418  1.000 31.84468  ? 594 ASP B C   1 
ATOM   2183 O O   . ASP B 2 110 ? -18.17979 -54.58998 -3.21282  1.000 49.99095  ? 594 ASP B O   1 
ATOM   2184 C CB  . ASP B 2 110 ? -18.86293 -55.33969 -5.84710  1.000 54.61715  ? 594 ASP B CB  1 
ATOM   2185 C CG  . ASP B 2 110 ? -17.91709 -54.23017 -6.35965  1.000 73.93025  ? 594 ASP B CG  1 
ATOM   2186 O OD1 . ASP B 2 110 ? -16.91753 -54.60405 -7.01969  1.000 81.59608  ? 594 ASP B OD1 1 
ATOM   2187 O OD2 . ASP B 2 110 ? -18.15915 -53.01194 -6.16296  1.000 75.10120  ? 594 ASP B OD2 1 
ATOM   2188 N N   . VAL B 2 111 ? -19.83831 -53.04526 -3.20306  1.000 41.57819  ? 595 VAL B N   1 
ATOM   2189 C CA  . VAL B 2 111 ? -19.35473 -52.28215 -2.06410  1.000 46.17143  ? 595 VAL B CA  1 
ATOM   2190 C C   . VAL B 2 111 ? -19.24947 -53.17917 -0.83418  1.000 50.91762  ? 595 VAL B C   1 
ATOM   2191 O O   . VAL B 2 111 ? -20.09363 -54.05543 -0.59753  1.000 60.59074  ? 595 VAL B O   1 
ATOM   2192 C CB  . VAL B 2 111 ? -20.30547 -51.08307 -1.85434  1.000 44.80873  ? 595 VAL B CB  1 
ATOM   2193 C CG1 . VAL B 2 111 ? -21.77435 -51.54031 -1.70684  1.000 33.27700  ? 595 VAL B CG1 1 
ATOM   2194 C CG2 . VAL B 2 111 ? -19.86459 -50.16556 -0.70453  1.000 38.51227  ? 595 VAL B CG2 1 
ATOM   2195 N N   A ARG B 2 112 ? -18.18901 -52.98043 -0.06051  0.546 51.76582  ? 596 ARG B N   1 
ATOM   2196 N N   B ARG B 2 112 ? -18.19383 -52.97485 -0.05538  0.454 52.09023  ? 596 ARG B N   1 
ATOM   2197 C CA  A ARG B 2 112 ? -17.94530 -53.72945 1.16173   0.546 56.62921  ? 596 ARG B CA  1 
ATOM   2198 C CA  B ARG B 2 112 ? -17.95618 -53.73126 1.16298   0.454 56.45428  ? 596 ARG B CA  1 
ATOM   2199 C C   A ARG B 2 112 ? -18.07423 -52.81562 2.37547   0.546 56.24559  ? 596 ARG B C   1 
ATOM   2200 C C   B ARG B 2 112 ? -18.02863 -52.81437 2.37929   0.454 56.40350  ? 596 ARG B C   1 
ATOM   2201 O O   A ARG B 2 112 ? -18.11015 -51.58762 2.26459   0.546 52.76382  ? 596 ARG B O   1 
ATOM   2202 O O   B ARG B 2 112 ? -17.98739 -51.58603 2.27201   0.454 53.62168  ? 596 ARG B O   1 
ATOM   2203 C CB  A ARG B 2 112 ? -16.56046 -54.38384 1.12208   0.546 61.92610  ? 596 ARG B CB  1 
ATOM   2204 C CB  B ARG B 2 112 ? -16.60231 -54.44641 1.09422   0.454 62.05653  ? 596 ARG B CB  1 
ATOM   2205 C CG  A ARG B 2 112 ? -16.50144 -55.63154 0.25634   0.546 65.62524  ? 596 ARG B CG  1 
ATOM   2206 C CG  B ARG B 2 112 ? -16.65303 -55.72683 0.27576   0.454 65.29367  ? 596 ARG B CG  1 
ATOM   2207 C CD  A ARG B 2 112 ? -17.04707 -56.84799 1.00079   0.546 66.13052  ? 596 ARG B CD  1 
ATOM   2208 C CD  B ARG B 2 112 ? -15.29986 -56.11362 -0.29681  0.454 70.24428  ? 596 ARG B CD  1 
ATOM   2209 N NE  A ARG B 2 112 ? -16.70572 -58.09470 0.32353   0.546 61.88145  ? 596 ARG B NE  1 
ATOM   2210 N NE  B ARG B 2 112 ? -14.50330 -54.95863 -0.69511  0.454 69.79399  ? 596 ARG B NE  1 
ATOM   2211 C CZ  A ARG B 2 112 ? -15.55105 -58.73356 0.46972   0.546 66.84708  ? 596 ARG B CZ  1 
ATOM   2212 C CZ  B ARG B 2 112 ? -14.27703 -54.60967 -1.95634  0.454 69.45739  ? 596 ARG B CZ  1 
ATOM   2213 N NH1 A ARG B 2 112 ? -14.61864 -58.25093 1.28174   0.546 71.10944  ? 596 ARG B NH1 1 
ATOM   2214 N NH1 B ARG B 2 112 ? -14.79902 -55.32195 -2.94616  0.454 69.23527  ? 596 ARG B NH1 1 
ATOM   2215 N NH2 A ARG B 2 112 ? -15.32981 -59.86007 -0.19478  0.5   70.65821  ? 596 ARG B NH2 1 
ATOM   2216 N NH2 B ARG B 2 112 ? -13.53243 -53.54631 -2.22819  0.454 68.60208  ? 596 ARG B NH2 1 
ATOM   2217 N N   . ASP B 2 113 ? -18.14916 -53.43571 3.54915   1.000 60.60971  ? 597 ASP B N   1 
ATOM   2218 C CA  . ASP B 2 113 ? -18.26636 -52.68686 4.79289   1.000 66.55103  ? 597 ASP B CA  1 
ATOM   2219 C C   . ASP B 2 113 ? -16.93264 -52.05205 5.17009   1.000 66.78854  ? 597 ASP B C   1 
ATOM   2220 O O   . ASP B 2 113 ? -15.86306 -52.62547 4.94335   1.000 68.77056  ? 597 ASP B O   1 
ATOM   2221 C CB  . ASP B 2 113 ? -18.75709 -53.60083 5.91705   1.000 78.56513  ? 597 ASP B CB  1 
ATOM   2222 C CG  . ASP B 2 113 ? -20.24817 -53.89210 5.82179   1.000 84.65719  ? 597 ASP B CG  1 
ATOM   2223 O OD1 . ASP B 2 113 ? -21.04403 -52.97129 6.09726   1.000 83.22500  ? 597 ASP B OD1 1 
ATOM   2224 O OD2 . ASP B 2 113 ? -20.62619 -55.03301 5.46912   1.000 87.03056  ? 597 ASP B OD2 1 
ATOM   2225 N N   . THR B 2 114 ? -17.00709 -50.86204 5.75712   1.000 63.94717  ? 598 THR B N   1 
ATOM   2226 C CA  . THR B 2 114 ? -15.84432 -50.04842 6.08521   1.000 58.51553  ? 598 THR B CA  1 
ATOM   2227 C C   . THR B 2 114 ? -15.64705 -50.00802 7.59527   1.000 58.43192  ? 598 THR B C   1 
ATOM   2228 O O   . THR B 2 114 ? -16.59161 -49.72778 8.34173   1.000 59.40739  ? 598 THR B O   1 
ATOM   2229 C CB  . THR B 2 114 ? -16.02354 -48.62546 5.54675   1.000 51.81769  ? 598 THR B CB  1 
ATOM   2230 O OG1 . THR B 2 114 ? -16.09683 -48.66328 4.11356   1.000 45.51318  ? 598 THR B OG1 1 
ATOM   2231 C CG2 . THR B 2 114 ? -14.87012 -47.70975 6.00112   1.000 51.58630  ? 598 THR B CG2 1 
ATOM   2232 N N   . ALA B 2 115 ? -14.42204 -50.26941 8.04157   1.000 59.43954  ? 599 ALA B N   1 
ATOM   2233 C CA  . ALA B 2 115 ? -14.05844 -50.07539 9.44199   1.000 58.16168  ? 599 ALA B CA  1 
ATOM   2234 C C   . ALA B 2 115 ? -13.83749 -48.58669 9.70630   1.000 60.94656  ? 599 ALA B C   1 
ATOM   2235 O O   . ALA B 2 115 ? -12.87675 -47.99095 9.20426   1.000 65.53558  ? 599 ALA B O   1 
ATOM   2236 C CB  . ALA B 2 115 ? -12.81424 -50.88802 9.78263   1.000 63.12870  ? 599 ALA B CB  1 
ATOM   2237 N N   . TYR B 2 116 ? -14.72975 -47.97695 10.50862  1.000 55.99878  ? 600 TYR B N   1 
ATOM   2238 C CA  . TYR B 2 116 ? -14.56203 -46.57134 10.84223  1.000 55.51098  ? 600 TYR B CA  1 
ATOM   2239 C C   . TYR B 2 116 ? -13.68097 -46.40562 12.07453  1.000 64.00019  ? 600 TYR B C   1 
ATOM   2240 O O   . TYR B 2 116 ? -13.70479 -47.24196 12.98576  1.000 67.31745  ? 600 TYR B O   1 
ATOM   2241 C CB  . TYR B 2 116 ? -15.92059 -45.91981 11.08343  1.000 53.12589  ? 600 TYR B CB  1 
ATOM   2242 C CG  . TYR B 2 116 ? -16.80609 -46.04382 9.87508   1.000 50.18995  ? 600 TYR B CG  1 
ATOM   2243 C CD1 . TYR B 2 116 ? -16.52753 -45.31696 8.71729   1.000 53.04311  ? 600 TYR B CD1 1 
ATOM   2244 C CD2 . TYR B 2 116 ? -17.89105 -46.91513 9.86384   1.000 48.76970  ? 600 TYR B CD2 1 
ATOM   2245 C CE1 . TYR B 2 116 ? -17.31899 -45.43783 7.58449   1.000 53.22432  ? 600 TYR B CE1 1 
ATOM   2246 C CE2 . TYR B 2 116 ? -18.69405 -47.04188 8.73002   1.000 45.85494  ? 600 TYR B CE2 1 
ATOM   2247 C CZ  . TYR B 2 116 ? -18.39462 -46.29784 7.59568   1.000 44.11635  ? 600 TYR B CZ  1 
ATOM   2248 O OH  . TYR B 2 116 ? -19.16286 -46.40518 6.46822   1.000 46.18997  ? 600 TYR B OH  1 
ATOM   2249 N N   . PRO B 2 117 ? -12.89244 -45.33631 12.12705  1.000 68.10987  ? 601 PRO B N   1 
ATOM   2250 C CA  . PRO B 2 117 ? -12.03104 -45.12565 13.29200  1.000 69.09076  ? 601 PRO B CA  1 
ATOM   2251 C C   . PRO B 2 117 ? -12.82285 -44.67260 14.50667  1.000 76.72914  ? 601 PRO B C   1 
ATOM   2252 O O   . PRO B 2 117 ? -13.85955 -44.01128 14.40003  1.000 74.98789  ? 601 PRO B O   1 
ATOM   2253 C CB  . PRO B 2 117 ? -11.07381 -44.02739 12.82516  1.000 65.63976  ? 601 PRO B CB  1 
ATOM   2254 C CG  . PRO B 2 117 ? -11.88361 -43.24567 11.82884  1.000 64.94834  ? 601 PRO B CG  1 
ATOM   2255 C CD  . PRO B 2 117 ? -12.71854 -44.27558 11.11421  1.000 64.80949  ? 601 PRO B CD  1 
ATOM   2256 N N   . GLU B 2 118 ? -12.31580 -45.05656 15.67214  1.000 86.63579  ? 602 GLU B N   1 
ATOM   2257 C CA  . GLU B 2 118 ? -12.78115 -44.50864 16.93670  1.000 86.06017  ? 602 GLU B CA  1 
ATOM   2258 C C   . GLU B 2 118 ? -12.29072 -43.07294 17.06818  1.000 77.03359  ? 602 GLU B C   1 
ATOM   2259 O O   . GLU B 2 118 ? -11.08657 -42.82093 16.95467  1.000 74.08266  ? 602 GLU B O   1 
ATOM   2260 C CB  . GLU B 2 118 ? -12.23923 -45.36060 18.08684  1.000 97.21889  ? 602 GLU B CB  1 
ATOM   2261 C CG  . GLU B 2 118 ? -13.11731 -45.46757 19.32574  1.000 109.62416 ? 602 GLU B CG  1 
ATOM   2262 C CD  . GLU B 2 118 ? -14.40878 -46.22942 19.07791  1.000 117.88167 ? 602 GLU B CD  1 
ATOM   2263 O OE1 . GLU B 2 118 ? -14.43393 -47.09965 18.17855  1.000 119.20351 ? 602 GLU B OE1 1 
ATOM   2264 O OE2 . GLU B 2 118 ? -15.39300 -45.97821 19.80662  1.000 120.72034 ? 602 GLU B OE2 1 
ATOM   2265 N N   . THR B 2 119 ? -13.21323 -42.13510 17.30976  1.000 74.31104  ? 603 THR B N   1 
ATOM   2266 C CA  . THR B 2 119 ? -12.85005 -40.72483 17.42100  1.000 71.01525  ? 603 THR B CA  1 
ATOM   2267 C C   . THR B 2 119 ? -13.98601 -39.91693 18.04306  1.000 77.61939  ? 603 THR B C   1 
ATOM   2268 O O   . THR B 2 119 ? -15.16900 -40.21108 17.83610  1.000 75.26714  ? 603 THR B O   1 
ATOM   2269 C CB  . THR B 2 119 ? -12.48704 -40.12990 16.05088  1.000 66.16693  ? 603 THR B CB  1 
ATOM   2270 O OG1 . THR B 2 119 ? -12.31154 -38.71483 16.16462  1.000 66.72686  ? 603 THR B OG1 1 
ATOM   2271 C CG2 . THR B 2 119 ? -13.57172 -40.41822 15.03761  1.000 62.38650  ? 603 THR B CG2 1 
ATOM   2272 N N   . ASN B 2 120 ? -13.60179 -38.88149 18.80250  1.000 78.89195  ? 604 ASN B N   1 
ATOM   2273 C CA  . ASN B 2 120 ? -14.53647 -37.85304 19.25213  1.000 84.72209  ? 604 ASN B CA  1 
ATOM   2274 C C   . ASN B 2 120 ? -14.74928 -36.77212 18.20683  1.000 80.71766  ? 604 ASN B C   1 
ATOM   2275 O O   . ASN B 2 120 ? -15.72735 -36.02000 18.29167  1.000 84.76897  ? 604 ASN B O   1 
ATOM   2276 C CB  . ASN B 2 120 ? -14.02811 -37.17713 20.52625  1.000 90.73031  ? 604 ASN B CB  1 
ATOM   2277 C CG  . ASN B 2 120 ? -13.52854 -38.16060 21.54486  1.000 100.09365 ? 604 ASN B CG  1 
ATOM   2278 O OD1 . ASN B 2 120 ? -14.31426 -38.85291 22.18662  1.000 105.37670 ? 604 ASN B OD1 1 
ATOM   2279 N ND2 . ASN B 2 120 ? -12.20908 -38.22717 21.70871  1.000 101.34996 ? 604 ASN B ND2 1 
ATOM   2280 N N   . ASP B 2 121 ? -13.84816 -36.68145 17.23996  1.000 67.43445  ? 605 ASP B N   1 
ATOM   2281 C CA  . ASP B 2 121 ? -13.78516 -35.59327 16.28259  1.000 69.28260  ? 605 ASP B CA  1 
ATOM   2282 C C   . ASP B 2 121 ? -14.63692 -35.82144 15.03821  1.000 66.83270  ? 605 ASP B C   1 
ATOM   2283 O O   . ASP B 2 121 ? -14.82877 -34.87922 14.26256  1.000 63.10003  ? 605 ASP B O   1 
ATOM   2284 C CB  . ASP B 2 121 ? -12.32832 -35.38787 15.85937  1.000 76.54734  ? 605 ASP B CB  1 
ATOM   2285 C CG  . ASP B 2 121 ? -11.43491 -34.89578 16.99985  1.000 88.49539  ? 605 ASP B CG  1 
ATOM   2286 O OD1 . ASP B 2 121 ? -11.97503 -34.45218 18.04021  1.000 100.89677 ? 605 ASP B OD1 1 
ATOM   2287 O OD2 . ASP B 2 121 ? -10.18706 -34.99007 16.86900  1.000 79.66580  ? 605 ASP B OD2 1 
ATOM   2288 N N   . ALA B 2 122 ? -15.13233 -37.03774 14.80656  1.000 56.74971  ? 606 ALA B N   1 
ATOM   2289 C CA  . ALA B 2 122 ? -15.74380 -37.34690 13.51923  1.000 55.13793  ? 606 ALA B CA  1 
ATOM   2290 C C   . ALA B 2 122 ? -16.86085 -38.36652 13.67600  1.000 51.45971  ? 606 ALA B C   1 
ATOM   2291 O O   . ALA B 2 122 ? -16.90989 -39.12984 14.64573  1.000 55.37189  ? 606 ALA B O   1 
ATOM   2292 C CB  . ALA B 2 122 ? -14.70806 -37.86213 12.51065  1.000 56.91743  ? 606 ALA B CB  1 
ATOM   2293 N N   . ILE B 2 123 ? -17.75049 -38.37318 12.68689  1.000 46.66087  ? 607 ILE B N   1 
ATOM   2294 C CA  . ILE B 2 123 ? -18.87528 -39.29944 12.63858  1.000 46.96688  ? 607 ILE B CA  1 
ATOM   2295 C C   . ILE B 2 123 ? -18.95635 -39.87678 11.22346  1.000 44.98970  ? 607 ILE B C   1 
ATOM   2296 O O   . ILE B 2 123 ? -18.67345 -39.17053 10.23814  1.000 43.27566  ? 607 ILE B O   1 
ATOM   2297 C CB  . ILE B 2 123 ? -20.17737 -38.60466 13.10074  1.000 48.54590  ? 607 ILE B CB  1 
ATOM   2298 C CG1 . ILE B 2 123 ? -21.11955 -39.60716 13.73520  1.000 57.30992  ? 607 ILE B CG1 1 
ATOM   2299 C CG2 . ILE B 2 123 ? -20.96093 -37.89555 11.97390  1.000 47.07377  ? 607 ILE B CG2 1 
ATOM   2300 C CD1 . ILE B 2 123 ? -20.48824 -40.36081 14.86583  1.000 63.20146  ? 607 ILE B CD1 1 
ATOM   2301 N N   . PRO B 2 124 ? -19.25764 -41.16477 11.06850  1.000 45.95410  ? 608 PRO B N   1 
ATOM   2302 C CA  . PRO B 2 124 ? -19.56792 -41.68289 9.72801   1.000 37.66088  ? 608 PRO B CA  1 
ATOM   2303 C C   . PRO B 2 124 ? -20.86059 -41.06323 9.23550   1.000 37.35608  ? 608 PRO B C   1 
ATOM   2304 O O   . PRO B 2 124 ? -21.86408 -41.04986 9.95645   1.000 44.26399  ? 608 PRO B O   1 
ATOM   2305 C CB  . PRO B 2 124 ? -19.70980 -43.19490 9.94724   1.000 39.32027  ? 608 PRO B CB  1 
ATOM   2306 C CG  . PRO B 2 124 ? -18.95322 -43.46629 11.22632  1.000 31.77913  ? 608 PRO B CG  1 
ATOM   2307 C CD  . PRO B 2 124 ? -19.16814 -42.23700 12.06998  1.000 33.12509  ? 608 PRO B CD  1 
ATOM   2308 N N   . MET B 2 125 ? -20.82318 -40.51593 8.00683   1.000 27.11563  ? 609 MET B N   1 
ATOM   2309 C CA  . MET B 2 125 ? -21.99132 -39.81096 7.49284   1.000 31.98982  ? 609 MET B CA  1 
ATOM   2310 C C   . MET B 2 125 ? -23.17774 -40.74057 7.35701   1.000 34.46178  ? 609 MET B C   1 
ATOM   2311 O O   . MET B 2 125 ? -24.31580 -40.32119 7.59148   1.000 31.88964  ? 609 MET B O   1 
ATOM   2312 C CB  . MET B 2 125 ? -21.69419 -39.16951 6.14777   1.000 30.85645  ? 609 MET B CB  1 
ATOM   2313 C CG  . MET B 2 125 ? -22.89362 -38.35268 5.57202   1.000 25.20033  ? 609 MET B CG  1 
ATOM   2314 S SD  . MET B 2 125 ? -22.40259 -37.45885 4.07455   1.000 43.75658  ? 609 MET B SD  1 
ATOM   2315 C CE  . MET B 2 125 ? -21.53452 -38.81400 3.39452   1.000 53.95645  ? 609 MET B CE  1 
ATOM   2316 N N   . ILE B 2 126 ? -22.92201 -42.01812 7.04899   1.000 32.35282  ? 610 ILE B N   1 
ATOM   2317 C CA  . ILE B 2 126 ? -23.99455 -42.98583 6.90967   1.000 32.35033  ? 610 ILE B CA  1 
ATOM   2318 C C   . ILE B 2 126 ? -24.68288 -43.21902 8.24173   1.000 36.66391  ? 610 ILE B C   1 
ATOM   2319 O O   . ILE B 2 126 ? -25.83546 -43.66507 8.27560   1.000 36.34029  ? 610 ILE B O   1 
ATOM   2320 C CB  . ILE B 2 126 ? -23.45412 -44.29853 6.30661   1.000 28.20688  ? 610 ILE B CB  1 
ATOM   2321 C CG1 . ILE B 2 126 ? -24.58770 -45.10983 5.67510   1.000 21.50888  ? 610 ILE B CG1 1 
ATOM   2322 C CG2 . ILE B 2 126 ? -22.74795 -45.12110 7.35980   1.000 22.51368  ? 610 ILE B CG2 1 
ATOM   2323 C CD1 . ILE B 2 126 ? -24.12732 -46.20653 4.77162   1.000 30.34030  ? 610 ILE B CD1 1 
ATOM   2324 N N   . SER B 2 127 ? -24.02427 -42.89243 9.35481   1.000 38.82103  ? 611 SER B N   1 
ATOM   2325 C CA  . SER B 2 127 ? -24.70469 -43.07262 10.62733  1.000 37.87010  ? 611 SER B CA  1 
ATOM   2326 C C   . SER B 2 127 ? -25.77726 -42.01414 10.86610  1.000 32.18990  ? 611 SER B C   1 
ATOM   2327 O O   . SER B 2 127 ? -26.62886 -42.21361 11.73604  1.000 27.13234  ? 611 SER B O   1 
ATOM   2328 C CB  . SER B 2 127 ? -23.67525 -43.09954 11.75366  1.000 30.75019  ? 611 SER B CB  1 
ATOM   2329 O OG  . SER B 2 127 ? -23.55018 -41.83063 12.36320  1.000 53.57068  ? 611 SER B OG  1 
ATOM   2330 N N   . LYS B 2 128 ? -25.77078 -40.92256 10.09615  1.000 30.10160  ? 612 LYS B N   1 
ATOM   2331 C CA  . LYS B 2 128 ? -26.75067 -39.85566 10.21344  1.000 33.50140  ? 612 LYS B CA  1 
ATOM   2332 C C   . LYS B 2 128 ? -27.85698 -39.94693 9.17122   1.000 30.25591  ? 612 LYS B C   1 
ATOM   2333 O O   . LYS B 2 128 ? -28.75591 -39.10722 9.18039   1.000 30.76717  ? 612 LYS B O   1 
ATOM   2334 C CB  . LYS B 2 128 ? -26.07478 -38.47622 10.09459  1.000 36.89941  ? 612 LYS B CB  1 
ATOM   2335 C CG  . LYS B 2 128 ? -24.92076 -38.18033 11.07587  1.000 43.67587  ? 612 LYS B CG  1 
ATOM   2336 C CD  . LYS B 2 128 ? -25.22189 -38.64548 12.49926  1.000 43.74147  ? 612 LYS B CD  1 
ATOM   2337 C CE  . LYS B 2 128 ? -26.23848 -37.77555 13.20387  1.000 46.18578  ? 612 LYS B CE  1 
ATOM   2338 N NZ  . LYS B 2 128 ? -26.06738 -37.87098 14.68607  1.000 61.36076  ? 612 LYS B NZ  1 
ATOM   2339 N N   . LEU B 2 129 ? -27.80673 -40.91539 8.25981   1.000 25.06193  ? 613 LEU B N   1 
ATOM   2340 C CA  . LEU B 2 129 ? -28.84132 -41.06579 7.24744   1.000 24.14332  ? 613 LEU B CA  1 
ATOM   2341 C C   . LEU B 2 129 ? -29.84452 -42.10165 7.71832   1.000 21.39453  ? 613 LEU B C   1 
ATOM   2342 O O   . LEU B 2 129 ? -29.45636 -43.19268 8.15221   1.000 20.77016  ? 613 LEU B O   1 
ATOM   2343 C CB  . LEU B 2 129 ? -28.24267 -41.46888 5.90515   1.000 19.00260  ? 613 LEU B CB  1 
ATOM   2344 C CG  . LEU B 2 129 ? -27.10755 -40.56513 5.43027   1.000 21.48261  ? 613 LEU B CG  1 
ATOM   2345 C CD1 . LEU B 2 129 ? -26.69115 -41.01759 4.05377   1.000 19.32825  ? 613 LEU B CD1 1 
ATOM   2346 C CD2 . LEU B 2 129 ? -27.55538 -39.07762 5.41203   1.000 24.10552  ? 613 LEU B CD2 1 
ATOM   2347 N N   . ARG B 2 130 ? -31.12271 -41.73429 7.68939   1.000 22.99804  ? 614 ARG B N   1 
ATOM   2348 C CA  . ARG B 2 130 ? -32.21029 -42.64538 8.02273   1.000 24.78217  ? 614 ARG B CA  1 
ATOM   2349 C C   . ARG B 2 130 ? -32.75904 -43.21715 6.72434   1.000 17.18003  ? 614 ARG B C   1 
ATOM   2350 O O   . ARG B 2 130 ? -33.36708 -42.48649 5.94200   1.000 20.17214  ? 614 ARG B O   1 
ATOM   2351 C CB  . ARG B 2 130 ? -33.31564 -41.92097 8.78406   1.000 24.03301  ? 614 ARG B CB  1 
ATOM   2352 C CG  . ARG B 2 130 ? -32.90393 -41.38343 10.13778  1.000 24.29020  ? 614 ARG B CG  1 
ATOM   2353 C CD  . ARG B 2 130 ? -34.12875 -40.92155 10.92190  1.000 23.47579  ? 614 ARG B CD  1 
ATOM   2354 N NE  . ARG B 2 130 ? -34.72508 -39.70845 10.37890  1.000 30.58437  ? 614 ARG B NE  1 
ATOM   2355 C CZ  . ARG B 2 130 ? -34.32751 -38.48140 10.70258  1.000 42.74011  ? 614 ARG B CZ  1 
ATOM   2356 N NH1 . ARG B 2 130 ? -34.92942 -37.41303 10.17564  1.000 47.82124  ? 614 ARG B NH1 1 
ATOM   2357 N NH2 . ARG B 2 130 ? -33.31075 -38.32738 11.54306  1.000 35.43681  ? 614 ARG B NH2 1 
ATOM   2358 N N   . TYR B 2 131 ? -32.55364 -44.51262 6.50009   1.000 15.90816  ? 615 TYR B N   1 
ATOM   2359 C CA  . TYR B 2 131 ? -33.02762 -45.20302 5.31230   1.000 17.73416  ? 615 TYR B CA  1 
ATOM   2360 C C   . TYR B 2 131 ? -33.38672 -46.63339 5.70311   1.000 17.04673  ? 615 TYR B C   1 
ATOM   2361 O O   . TYR B 2 131 ? -32.88790 -47.16157 6.70030   1.000 14.47372  ? 615 TYR B O   1 
ATOM   2362 C CB  . TYR B 2 131 ? -31.96241 -45.19177 4.20444   1.000 15.18211  ? 615 TYR B CB  1 
ATOM   2363 C CG  . TYR B 2 131 ? -30.64628 -45.83449 4.61927   1.000 14.56004  ? 615 TYR B CG  1 
ATOM   2364 C CD1 . TYR B 2 131 ? -29.64053 -45.07650 5.21040   1.000 15.65037  ? 615 TYR B CD1 1 
ATOM   2365 C CD2 . TYR B 2 131 ? -30.41536 -47.20833 4.43965   1.000 19.05841  ? 615 TYR B CD2 1 
ATOM   2366 C CE1 . TYR B 2 131 ? -28.45821 -45.64379 5.59586   1.000 16.33250  ? 615 TYR B CE1 1 
ATOM   2367 C CE2 . TYR B 2 131 ? -29.21326 -47.79939 4.85308   1.000 14.99589  ? 615 TYR B CE2 1 
ATOM   2368 C CZ  . TYR B 2 131 ? -28.25009 -46.99519 5.42314   1.000 18.21337  ? 615 TYR B CZ  1 
ATOM   2369 O OH  . TYR B 2 131 ? -27.05681 -47.52961 5.83012   1.000 30.97904  ? 615 TYR B OH  1 
ATOM   2370 N N   . ASN B 2 132 ? -34.22836 -47.27776 4.88947   1.000 18.88635  ? 616 ASN B N   1 
ATOM   2371 C CA  . ASN B 2 132 ? -34.58700 -48.67056 5.16382   1.000 12.67581  ? 616 ASN B CA  1 
ATOM   2372 C C   . ASN B 2 132 ? -33.40912 -49.59071 4.83330   1.000 12.81697  ? 616 ASN B C   1 
ATOM   2373 O O   . ASN B 2 132 ? -32.74112 -49.40603 3.80798   1.000 12.62244  ? 616 ASN B O   1 
ATOM   2374 C CB  . ASN B 2 132 ? -35.81792 -49.07831 4.36332   1.000 11.96447  ? 616 ASN B CB  1 
ATOM   2375 C CG  . ASN B 2 132 ? -36.32161 -50.46845 4.72665   1.000 11.95085  ? 616 ASN B CG  1 
ATOM   2376 O OD1 . ASN B 2 132 ? -35.73669 -51.46402 4.29946   1.000 11.97177  ? 616 ASN B OD1 1 
ATOM   2377 N ND2 . ASN B 2 132 ? -37.41982 -50.55144 5.49103   1.000 12.17812  ? 616 ASN B ND2 1 
ATOM   2378 N N   . PRO B 2 133 ? -33.12896 -50.58819 5.67576   1.000 13.48290  ? 617 PRO B N   1 
ATOM   2379 C CA  . PRO B 2 133 ? -31.93849 -51.42929 5.46180   1.000 24.85058  ? 617 PRO B CA  1 
ATOM   2380 C C   . PRO B 2 133 ? -31.93903 -52.19757 4.15923   1.000 25.05725  ? 617 PRO B C   1 
ATOM   2381 O O   . PRO B 2 133 ? -30.87982 -52.68348 3.77663   1.000 14.26808  ? 617 PRO B O   1 
ATOM   2382 C CB  . PRO B 2 133 ? -31.95510 -52.39013 6.65851   1.000 15.27157  ? 617 PRO B CB  1 
ATOM   2383 C CG  . PRO B 2 133 ? -32.66021 -51.63973 7.71124   1.000 15.52510  ? 617 PRO B CG  1 
ATOM   2384 C CD  . PRO B 2 133 ? -33.67535 -50.75244 7.03103   1.000 14.25719  ? 617 PRO B CD  1 
ATOM   2385 N N   A ARG B 2 134 ? -33.08428 -52.32024 3.48193   0.486 16.05338  ? 618 ARG B N   1 
ATOM   2386 N N   B ARG B 2 134 ? -33.06500 -52.30400 3.45109   0.514 16.14393  ? 618 ARG B N   1 
ATOM   2387 C CA  A ARG B 2 134 ? -33.10244 -52.87637 2.13259   0.486 17.08619  ? 618 ARG B CA  1 
ATOM   2388 C CA  B ARG B 2 134 ? -33.02789 -52.94516 2.14155   0.514 16.77369  ? 618 ARG B CA  1 
ATOM   2389 C C   A ARG B 2 134 ? -32.13270 -52.14784 1.20738   0.486 17.39734  ? 618 ARG B C   1 
ATOM   2390 C C   B ARG B 2 134 ? -32.26333 -52.12359 1.10159   0.514 17.64625  ? 618 ARG B C   1 
ATOM   2391 O O   A ARG B 2 134 ? -31.42520 -52.77569 0.41409   0.486 20.83158  ? 618 ARG B O   1 
ATOM   2392 O O   B ARG B 2 134 ? -31.84792 -52.67934 0.08354   0.514 20.72219  ? 618 ARG B O   1 
ATOM   2393 C CB  A ARG B 2 134 ? -34.52135 -52.80971 1.56897   0.486 11.91362  ? 618 ARG B CB  1 
ATOM   2394 C CB  B ARG B 2 134 ? -34.45703 -53.24417 1.66668   0.514 12.09780  ? 618 ARG B CB  1 
ATOM   2395 C CG  A ARG B 2 134 ? -34.70512 -53.67475 0.34475   0.486 22.35949  ? 618 ARG B CG  1 
ATOM   2396 C CG  B ARG B 2 134 ? -35.22255 -52.07889 1.11965   0.514 11.47071  ? 618 ARG B CG  1 
ATOM   2397 C CD  A ARG B 2 134 ? -35.59970 -53.01088 -0.66628  0.486 21.56955  ? 618 ARG B CD  1 
ATOM   2398 C CD  B ARG B 2 134 ? -36.74661 -52.32055 1.23173   0.514 18.98773  ? 618 ARG B CD  1 
ATOM   2399 N NE  A ARG B 2 134 ? -36.97635 -53.40568 -0.44501  0.486 22.45505  ? 618 ARG B NE  1 
ATOM   2400 N NE  B ARG B 2 134 ? -37.36555 -51.19378 1.90913   0.514 25.81227  ? 618 ARG B NE  1 
ATOM   2401 C CZ  A ARG B 2 134 ? -37.57468 -54.38120 -1.11083  0.486 25.83370  ? 618 ARG B CZ  1 
ATOM   2402 C CZ  B ARG B 2 134 ? -38.22629 -50.34756 1.35016   0.514 26.21859  ? 618 ARG B CZ  1 
ATOM   2403 N NH1 A ARG B 2 134 ? -38.83368 -54.68788 -0.83787  0.486 11.78984  ? 618 ARG B NH1 1 
ATOM   2404 N NH1 B ARG B 2 134 ? -38.71067 -49.30732 2.06390   0.514 11.14327  ? 618 ARG B NH1 1 
ATOM   2405 N NH2 A ARG B 2 134 ? -36.91692 -55.02814 -2.06087  0.486 21.64921  ? 618 ARG B NH2 1 
ATOM   2406 N NH2 B ARG B 2 134 ? -38.60127 -50.55744 0.08835   0.514 14.85940  ? 618 ARG B NH2 1 
ATOM   2407 N N   . PHE B 2 135 ? -32.05216 -50.82627 1.33210   1.000 19.72435  ? 619 PHE B N   1 
ATOM   2408 C CA  . PHE B 2 135 ? -31.23925 -49.99183 0.45332   1.000 17.86131  ? 619 PHE B CA  1 
ATOM   2409 C C   . PHE B 2 135 ? -29.79243 -49.85348 0.93451   1.000 23.64054  ? 619 PHE B C   1 
ATOM   2410 O O   . PHE B 2 135 ? -29.06415 -48.98271 0.44109   1.000 21.70363  ? 619 PHE B O   1 
ATOM   2411 C CB  . PHE B 2 135 ? -31.87871 -48.60499 0.30084   1.000 12.50901  ? 619 PHE B CB  1 
ATOM   2412 C CG  . PHE B 2 135 ? -33.34293 -48.64940 -0.09124  1.000 12.03103  ? 619 PHE B CG  1 
ATOM   2413 C CD1 . PHE B 2 135 ? -33.76941 -49.44756 -1.13924  1.000 16.67889  ? 619 PHE B CD1 1 
ATOM   2414 C CD2 . PHE B 2 135 ? -34.27862 -47.92026 0.59860   1.000 11.93178  ? 619 PHE B CD2 1 
ATOM   2415 C CE1 . PHE B 2 135 ? -35.08838 -49.51199 -1.48552  1.000 20.11523  ? 619 PHE B CE1 1 
ATOM   2416 C CE2 . PHE B 2 135 ? -35.61369 -47.97379 0.25555   1.000 14.46364  ? 619 PHE B CE2 1 
ATOM   2417 C CZ  . PHE B 2 135 ? -36.01816 -48.76160 -0.79968  1.000 12.24559  ? 619 PHE B CZ  1 
ATOM   2418 N N   . ASP B 2 136 ? -29.35431 -50.72045 1.84701   1.000 21.80693  ? 620 ASP B N   1 
ATOM   2419 C CA  . ASP B 2 136 ? -28.04968 -50.56911 2.50144   1.000 23.32567  ? 620 ASP B CA  1 
ATOM   2420 C C   . ASP B 2 136 ? -26.86525 -50.54297 1.51923   1.000 20.71869  ? 620 ASP B C   1 
ATOM   2421 O O   . ASP B 2 136 ? -25.95134 -49.71887 1.65985   1.000 16.51676  ? 620 ASP B O   1 
ATOM   2422 C CB  . ASP B 2 136 ? -27.86851 -51.69675 3.51784   1.000 31.96067  ? 620 ASP B CB  1 
ATOM   2423 C CG  . ASP B 2 136 ? -26.95899 -51.30443 4.65358   1.000 52.84676  ? 620 ASP B CG  1 
ATOM   2424 O OD1 . ASP B 2 136 ? -25.87546 -51.91454 4.75652   1.000 52.55200  ? 620 ASP B OD1 1 
ATOM   2425 O OD2 . ASP B 2 136 ? -27.31653 -50.38451 5.42555   1.000 61.08449  ? 620 ASP B OD2 1 
ATOM   2426 N N   . LYS B 2 137 ? -26.83572 -51.45259 0.53778   1.000 23.22185  ? 621 LYS B N   1 
ATOM   2427 C CA  . LYS B 2 137 ? -25.72275 -51.43696 -0.41935  1.000 24.83514  ? 621 LYS B CA  1 
ATOM   2428 C C   . LYS B 2 137 ? -25.69318 -50.14949 -1.23852  1.000 22.66916  ? 621 LYS B C   1 
ATOM   2429 O O   . LYS B 2 137 ? -24.61392 -49.66684 -1.59734  1.000 17.73449  ? 621 LYS B O   1 
ATOM   2430 C CB  . LYS B 2 137 ? -25.81154 -52.64052 -1.35234  1.000 18.48526  ? 621 LYS B CB  1 
ATOM   2431 C CG  . LYS B 2 137 ? -25.25437 -53.88224 -0.74237  1.000 25.94444  ? 621 LYS B CG  1 
ATOM   2432 C CD  . LYS B 2 137 ? -25.58221 -55.08889 -1.57609  1.000 39.28837  ? 621 LYS B CD  1 
ATOM   2433 C CE  . LYS B 2 137 ? -24.91308 -56.29990 -0.97595  1.000 55.23090  ? 621 LYS B CE  1 
ATOM   2434 N NZ  . LYS B 2 137 ? -23.64293 -55.90340 -0.28359  1.000 61.08965  ? 621 LYS B NZ  1 
ATOM   2435 N N   . ALA B 2 138 ? -26.86417 -49.56867 -1.51875  1.000 15.77404  ? 622 ALA B N   1 
ATOM   2436 C CA  . ALA B 2 138 ? -26.90315 -48.31737 -2.25562  1.000 15.93450  ? 622 ALA B CA  1 
ATOM   2437 C C   . ALA B 2 138 ? -26.34494 -47.18501 -1.41847  1.000 16.19198  ? 622 ALA B C   1 
ATOM   2438 O O   . ALA B 2 138 ? -25.57856 -46.35864 -1.92001  1.000 17.08576  ? 622 ALA B O   1 
ATOM   2439 C CB  . ALA B 2 138 ? -28.33690 -48.00071 -2.71224  1.000 15.19166  ? 622 ALA B CB  1 
ATOM   2440 N N   . PHE B 2 139 ? -26.69248 -47.12620 -0.13863  1.000 15.70698  ? 623 PHE B N   1 
ATOM   2441 C CA  . PHE B 2 139 ? -26.19648 -46.00538 0.65336   1.000 24.60465  ? 623 PHE B CA  1 
ATOM   2442 C C   . PHE B 2 139 ? -24.74940 -46.21853 1.08897   1.000 31.93323  ? 623 PHE B C   1 
ATOM   2443 O O   . PHE B 2 139 ? -24.02909 -45.24247 1.30824   1.000 31.25201  ? 623 PHE B O   1 
ATOM   2444 C CB  . PHE B 2 139 ? -27.11994 -45.75999 1.85442   1.000 15.75910  ? 623 PHE B CB  1 
ATOM   2445 C CG  . PHE B 2 139 ? -28.40439 -45.09193 1.47307   1.000 23.32029  ? 623 PHE B CG  1 
ATOM   2446 C CD1 . PHE B 2 139 ? -29.49738 -45.83746 1.08249   1.000 14.26901  ? 623 PHE B CD1 1 
ATOM   2447 C CD2 . PHE B 2 139 ? -28.49617 -43.70377 1.45601   1.000 19.59379  ? 623 PHE B CD2 1 
ATOM   2448 C CE1 . PHE B 2 139 ? -30.66175 -45.22274 0.69860   1.000 17.30931  ? 623 PHE B CE1 1 
ATOM   2449 C CE2 . PHE B 2 139 ? -29.65512 -43.07648 1.05608   1.000 23.74811  ? 623 PHE B CE2 1 
ATOM   2450 C CZ  . PHE B 2 139 ? -30.74380 -43.83323 0.67187   1.000 21.08675  ? 623 PHE B CZ  1 
ATOM   2451 N N   . LYS B 2 140 ? -24.29339 -47.46795 1.21781   1.000 24.87265  ? 624 LYS B N   1 
ATOM   2452 C CA  . LYS B 2 140 ? -22.87569 -47.67532 1.50189   1.000 25.00709  ? 624 LYS B CA  1 
ATOM   2453 C C   . LYS B 2 140 ? -22.04127 -47.31500 0.28563   1.000 29.32512  ? 624 LYS B C   1 
ATOM   2454 O O   . LYS B 2 140 ? -20.94504 -46.76680 0.41563   1.000 27.28655  ? 624 LYS B O   1 
ATOM   2455 C CB  . LYS B 2 140 ? -22.61332 -49.12636 1.92758   1.000 25.80047  ? 624 LYS B CB  1 
ATOM   2456 C CG  . LYS B 2 140 ? -22.87286 -49.41336 3.41122   1.000 30.63592  ? 624 LYS B CG  1 
ATOM   2457 C CD  . LYS B 2 140 ? -23.06203 -50.88488 3.71322   1.000 40.99994  ? 624 LYS B CD  1 
ATOM   2458 C CE  . LYS B 2 140 ? -21.91752 -51.75862 3.16607   1.000 62.83655  ? 624 LYS B CE  1 
ATOM   2459 N NZ  . LYS B 2 140 ? -22.16111 -53.24596 3.25491   1.000 64.59474  ? 624 LYS B NZ  1 
ATOM   2460 N N   . HIS B 2 141 ? -22.56409 -47.58432 -0.90940  1.000 28.86505  ? 625 HIS B N   1 
ATOM   2461 C CA  . HIS B 2 141 ? -21.86527 -47.19155 -2.12937  1.000 23.32506  ? 625 HIS B CA  1 
ATOM   2462 C C   . HIS B 2 141 ? -21.68615 -45.68041 -2.21901  1.000 29.62028  ? 625 HIS B C   1 
ATOM   2463 O O   . HIS B 2 141 ? -20.60953 -45.20626 -2.57427  1.000 22.19142  ? 625 HIS B O   1 
ATOM   2464 C CB  . HIS B 2 141 ? -22.63054 -47.69306 -3.34961  1.000 22.64476  ? 625 HIS B CB  1 
ATOM   2465 C CG  . HIS B 2 141 ? -21.98994 -47.32182 -4.64490  1.000 30.97615  ? 625 HIS B CG  1 
ATOM   2466 N ND1 . HIS B 2 141 ? -21.11063 -48.15588 -5.30164  1.000 36.35115  ? 625 HIS B ND1 1 
ATOM   2467 C CD2 . HIS B 2 141 ? -22.09638 -46.20700 -5.40636  1.000 31.20945  ? 625 HIS B CD2 1 
ATOM   2468 C CE1 . HIS B 2 141 ? -20.70127 -47.56953 -6.41303  1.000 33.53318  ? 625 HIS B CE1 1 
ATOM   2469 N NE2 . HIS B 2 141 ? -21.28152 -46.38427 -6.49726  1.000 34.21541  ? 625 HIS B NE2 1 
ATOM   2470 N N   . VAL B 2 142 ? -22.74318 -44.90945 -1.93602  1.000 22.20873  ? 626 VAL B N   1 
ATOM   2471 C CA  . VAL B 2 142 ? -22.65891 -43.46224 -2.08610  1.000 26.50464  ? 626 VAL B CA  1 
ATOM   2472 C C   . VAL B 2 142 ? -21.90628 -42.84188 -0.91370  1.000 29.30720  ? 626 VAL B C   1 
ATOM   2473 O O   . VAL B 2 142 ? -20.99774 -42.02629 -1.10386  1.000 30.24397  ? 626 VAL B O   1 
ATOM   2474 C CB  . VAL B 2 142 ? -24.06387 -42.83748 -2.24247  1.000 29.77893  ? 626 VAL B CB  1 
ATOM   2475 C CG1 . VAL B 2 142 ? -23.94374 -41.31912 -2.31193  1.000 30.48704  ? 626 VAL B CG1 1 
ATOM   2476 C CG2 . VAL B 2 142 ? -24.78967 -43.34676 -3.49970  1.000 19.65140  ? 626 VAL B CG2 1 
ATOM   2477 N N   . PHE B 2 143 ? -22.27026 -43.21125 0.31684   1.000 29.21526  ? 627 PHE B N   1 
ATOM   2478 C CA  . PHE B 2 143 ? -21.81584 -42.48715 1.49688   1.000 21.55178  ? 627 PHE B CA  1 
ATOM   2479 C C   . PHE B 2 143 ? -20.91479 -43.29459 2.42594   1.000 27.28312  ? 627 PHE B C   1 
ATOM   2480 O O   . PHE B 2 143 ? -20.44893 -42.74328 3.43457   1.000 23.20664  ? 627 PHE B O   1 
ATOM   2481 C CB  . PHE B 2 143 ? -23.01413 -41.98433 2.30570   1.000 20.79929  ? 627 PHE B CB  1 
ATOM   2482 C CG  . PHE B 2 143 ? -24.04180 -41.22476 1.50533   1.000 32.98573  ? 627 PHE B CG  1 
ATOM   2483 C CD1 . PHE B 2 143 ? -23.89225 -39.86238 1.25325   1.000 35.71440  ? 627 PHE B CD1 1 
ATOM   2484 C CD2 . PHE B 2 143 ? -25.19092 -41.85383 1.04864   1.000 32.25993  ? 627 PHE B CD2 1 
ATOM   2485 C CE1 . PHE B 2 143 ? -24.85593 -39.13584 0.56276   1.000 37.55167  ? 627 PHE B CE1 1 
ATOM   2486 C CE2 . PHE B 2 143 ? -26.17338 -41.13380 0.36234   1.000 30.37638  ? 627 PHE B CE2 1 
ATOM   2487 C CZ  . PHE B 2 143 ? -25.99817 -39.77433 0.11072   1.000 34.11375  ? 627 PHE B CZ  1 
ATOM   2488 N N   . GLY B 2 144 ? -20.62738 -44.55968 2.11496   1.000 39.85715  ? 628 GLY B N   1 
ATOM   2489 C CA  . GLY B 2 144 ? -19.96111 -45.41396 3.07881   1.000 41.99752  ? 628 GLY B CA  1 
ATOM   2490 C C   . GLY B 2 144 ? -18.54166 -45.01728 3.45528   1.000 44.72643  ? 628 GLY B C   1 
ATOM   2491 O O   . GLY B 2 144 ? -18.06531 -45.44023 4.51069   1.000 46.69818  ? 628 GLY B O   1 
ATOM   2492 N N   . LYS B 2 145 ? -17.85663 -44.20782 2.64943   1.000 45.17989  ? 629 LYS B N   1 
ATOM   2493 C CA  . LYS B 2 145 ? -16.44614 -43.93071 2.92641   1.000 61.26884  ? 629 LYS B CA  1 
ATOM   2494 C C   . LYS B 2 145 ? -16.18390 -42.48718 3.35118   1.000 48.76756  ? 629 LYS B C   1 
ATOM   2495 O O   . LYS B 2 145 ? -15.10660 -41.94744 3.09315   1.000 50.80484  ? 629 LYS B O   1 
ATOM   2496 C CB  . LYS B 2 145 ? -15.58520 -44.30170 1.71989   1.000 49.18888  ? 629 LYS B CB  1 
ATOM   2497 C CG  . LYS B 2 145 ? -15.18506 -45.77496 1.72174   1.000 59.54300  ? 629 LYS B CG  1 
ATOM   2498 C CD  . LYS B 2 145 ? -14.56244 -46.21672 0.40128   1.000 68.78723  ? 629 LYS B CD  1 
ATOM   2499 C CE  . LYS B 2 145 ? -14.19009 -47.70119 0.43865   1.000 74.73022  ? 629 LYS B CE  1 
ATOM   2500 N NZ  . LYS B 2 145 ? -13.86677 -48.18672 1.81966   1.000 77.36872  ? 629 LYS B NZ  1 
ATOM   2501 N N   . THR B 2 146 ? -17.13372 -41.86274 4.04167   1.000 47.50082  ? 630 THR B N   1 
ATOM   2502 C CA  . THR B 2 146 ? -17.06500 -40.43798 4.33486   1.000 48.20198  ? 630 THR B CA  1 
ATOM   2503 C C   . THR B 2 146 ? -17.27405 -40.19644 5.82123   1.000 49.15606  ? 630 THR B C   1 
ATOM   2504 O O   . THR B 2 146 ? -18.19936 -40.75094 6.41971   1.000 47.98001  ? 630 THR B O   1 
ATOM   2505 C CB  . THR B 2 146 ? -18.10405 -39.66294 3.51420   1.000 46.10529  ? 630 THR B CB  1 
ATOM   2506 O OG1 . THR B 2 146 ? -17.88867 -39.89204 2.12162   1.000 45.51055  ? 630 THR B OG1 1 
ATOM   2507 C CG2 . THR B 2 146 ? -18.00381 -38.18599 3.75842   1.000 47.92401  ? 630 THR B CG2 1 
ATOM   2508 N N   . LEU B 2 147 ? -16.39936 -39.38145 6.41013   1.000 51.56762  ? 631 LEU B N   1 
ATOM   2509 C CA  . LEU B 2 147 ? -16.49633 -38.94992 7.79605   1.000 52.97397  ? 631 LEU B CA  1 
ATOM   2510 C C   . LEU B 2 147 ? -16.96454 -37.50140 7.83932   1.000 58.88564  ? 631 LEU B C   1 
ATOM   2511 O O   . LEU B 2 147 ? -16.54508 -36.68301 7.01185   1.000 61.26504  ? 631 LEU B O   1 
ATOM   2512 C CB  . LEU B 2 147 ? -15.14327 -39.07641 8.50770   1.000 56.04765  ? 631 LEU B CB  1 
ATOM   2513 C CG  . LEU B 2 147 ? -14.47835 -40.45575 8.64607   1.000 60.25159  ? 631 LEU B CG  1 
ATOM   2514 C CD1 . LEU B 2 147 ? -13.31835 -40.43068 9.62462   1.000 60.34026  ? 631 LEU B CD1 1 
ATOM   2515 C CD2 . LEU B 2 147 ? -15.48137 -41.48883 9.08127   1.000 55.55437  ? 631 LEU B CD2 1 
ATOM   2516 N N   . ILE B 2 148 ? -17.83730 -37.18632 8.79526   1.000 53.04656  ? 632 ILE B N   1 
ATOM   2517 C CA  . ILE B 2 148 ? -18.24195 -35.80966 9.05930   1.000 53.99197  ? 632 ILE B CA  1 
ATOM   2518 C C   . ILE B 2 148 ? -17.46568 -35.32199 10.27186  1.000 61.16679  ? 632 ILE B C   1 
ATOM   2519 O O   . ILE B 2 148 ? -17.65720 -35.83563 11.37865  1.000 61.23210  ? 632 ILE B O   1 
ATOM   2520 C CB  . ILE B 2 148 ? -19.75305 -35.68123 9.30211   1.000 57.70781  ? 632 ILE B CB  1 
ATOM   2521 C CG1 . ILE B 2 148 ? -20.56104 -36.03556 8.05594   1.000 50.76158  ? 632 ILE B CG1 1 
ATOM   2522 C CG2 . ILE B 2 148 ? -20.08948 -34.26075 9.71583   1.000 56.78291  ? 632 ILE B CG2 1 
ATOM   2523 C CD1 . ILE B 2 148 ? -22.06017 -36.04719 8.30529   1.000 50.28310  ? 632 ILE B CD1 1 
ATOM   2524 N N   . CYS B 2 149 ? -16.61476 -34.31515 10.07540  1.000 59.22803  ? 633 CYS B N   1 
ATOM   2525 C CA  . CYS B 2 149 ? -15.65785 -33.86683 11.07778  1.000 62.43136  ? 633 CYS B CA  1 
ATOM   2526 C C   . CYS B 2 149 ? -16.02892 -32.49830 11.64869  1.000 64.39658  ? 633 CYS B C   1 
ATOM   2527 O O   . CYS B 2 149 ? -16.78369 -31.71977 11.05464  1.000 69.97096  ? 633 CYS B O   1 
ATOM   2528 C CB  . CYS B 2 149 ? -14.24117 -33.82916 10.48796  1.000 64.05578  ? 633 CYS B CB  1 
ATOM   2529 S SG  . CYS B 2 149 ? -13.74651 -35.33953 9.57585   1.000 64.25004  ? 633 CYS B SG  1 
ATOM   2530 N N   . ARG B 2 150 ? -15.48387 -32.22520 12.83416  1.000 67.51414  ? 634 ARG B N   1 
ATOM   2531 C CA  . ARG B 2 150 ? -15.79705 -30.99655 13.56055  1.000 79.72025  ? 634 ARG B CA  1 
ATOM   2532 C C   . ARG B 2 150 ? -15.25617 -29.75799 12.84772  1.000 84.06959  ? 634 ARG B C   1 
ATOM   2533 O O   . ARG B 2 150 ? -15.92280 -28.71004 12.80411  1.000 86.90423  ? 634 ARG B O   1 
ATOM   2534 C CB  . ARG B 2 150 ? -15.22235 -31.08851 14.97347  1.000 85.81681  ? 634 ARG B CB  1 
ATOM   2535 C CG  . ARG B 2 150 ? -15.98481 -30.28224 15.99990  1.000 89.72238  ? 634 ARG B CG  1 
ATOM   2536 C CD  . ARG B 2 150 ? -15.65670 -30.76272 17.39716  1.000 92.25134  ? 634 ARG B CD  1 
ATOM   2537 N NE  . ARG B 2 150 ? -16.00303 -32.16882 17.58591  1.000 88.37436  ? 634 ARG B NE  1 
ATOM   2538 C CZ  . ARG B 2 150 ? -17.21960 -32.59542 17.90618  1.000 91.48803  ? 634 ARG B CZ  1 
ATOM   2539 N NH1 . ARG B 2 150 ? -17.45034 -33.89293 18.06772  1.000 93.88384  ? 634 ARG B NH1 1 
ATOM   2540 N NH2 . ARG B 2 150 ? -18.21003 -31.72262 18.06022  1.000 93.21114  ? 634 ARG B NH2 1 
ATOM   2541 N N   . SER B 2 151 ? -14.04809 -29.86967 12.28297  1.000 72.36223  ? 635 SER B N   1 
ATOM   2542 C CA  . SER B 2 151 ? -13.29516 -28.76648 11.70505  1.000 77.61111  ? 635 SER B CA  1 
ATOM   2543 C C   . SER B 2 151 ? -12.55901 -29.22893 10.45385  1.000 80.48435  ? 635 SER B C   1 
ATOM   2544 O O   . SER B 2 151 ? -12.45005 -30.42686 10.17980  1.000 80.36542  ? 635 SER B O   1 
ATOM   2545 C CB  . SER B 2 151 ? -12.34493 -28.18154 12.74724  1.000 78.78393  ? 635 SER B CB  1 
ATOM   2546 O OG  . SER B 2 151 ? -11.12688 -28.81823 12.73512  1.000 79.56764  ? 635 SER B OG  1 
ATOM   2547 N N   . MET B 2 152 ? -12.07065 -28.25744 9.67156   1.000 76.05405  ? 636 MET B N   1 
ATOM   2548 C CA  . MET B 2 152 ? -11.24864 -28.58525 8.50977   1.000 80.50035  ? 636 MET B CA  1 
ATOM   2549 C C   . MET B 2 152 ? -9.81063  -28.85232 8.90200   1.000 86.10620  ? 636 MET B C   1 
ATOM   2550 O O   . MET B 2 152 ? -9.06382  -29.48549 8.13733   1.000 87.18631  ? 636 MET B O   1 
ATOM   2551 C CB  . MET B 2 152 ? -11.26832 -27.45676 7.48260   1.000 90.31494  ? 636 MET B CB  1 
ATOM   2552 C CG  . MET B 2 152 ? -12.63904 -26.86677 7.31105   1.000 105.21778 ? 636 MET B CG  1 
ATOM   2553 S SD  . MET B 2 152 ? -12.95060 -25.65994 8.61500   1.000 121.08500 ? 636 MET B SD  1 
ATOM   2554 C CE  . MET B 2 152 ? -14.72617 -25.48699 8.47120   1.000 118.40597 ? 636 MET B CE  1 
ATOM   2555 N N   . GLU B 2 153 ? -9.39591  -28.30019 10.04602  1.000 99.72090  ? 637 GLU B N   1 
ATOM   2556 C CA  . GLU B 2 153 ? -8.21395  -28.77938 10.76879  1.000 106.39445 ? 637 GLU B CA  1 
ATOM   2557 C C   . GLU B 2 153 ? -8.24047  -30.29969 10.93252  1.000 95.03185  ? 637 GLU B C   1 
ATOM   2558 O O   . GLU B 2 153 ? -7.34850  -31.01029 10.45989  1.000 87.15987  ? 637 GLU B O   1 
ATOM   2559 C CB  . GLU B 2 153 ? -8.17030  -28.07276 12.13262  1.000 116.94555 ? 637 GLU B CB  1 
ATOM   2560 C CG  . GLU B 2 153 ? -7.13999  -28.40836 13.20654  1.000 126.96999 ? 637 GLU B CG  1 
ATOM   2561 C CD  . GLU B 2 153 ? -5.71438  -28.02356 12.85480  1.000 134.48471 ? 637 GLU B CD  1 
ATOM   2562 O OE1 . GLU B 2 153 ? -5.02950  -27.48895 13.76321  1.000 138.27269 ? 637 GLU B OE1 1 
ATOM   2563 O OE2 . GLU B 2 153 ? -5.21837  -28.29985 11.74271  1.000 136.11692 ? 637 GLU B OE2 1 
ATOM   2564 N N   . VAL B 2 154 ? -9.30255  -30.82302 11.53676  1.000 90.71067  ? 638 VAL B N   1 
ATOM   2565 C CA  . VAL B 2 154 ? -9.30598  -32.22992 11.89140  1.000 88.26003  ? 638 VAL B CA  1 
ATOM   2566 C C   . VAL B 2 154 ? -9.60607  -33.13622 10.70259  1.000 79.00635  ? 638 VAL B C   1 
ATOM   2567 O O   . VAL B 2 154 ? -9.22971  -34.31051 10.73409  1.000 77.96978  ? 638 VAL B O   1 
ATOM   2568 C CB  . VAL B 2 154 ? -10.27296 -32.43628 13.06989  1.000 90.42145  ? 638 VAL B CB  1 
ATOM   2569 C CG1 . VAL B 2 154 ? -11.73296 -32.34965 12.63421  1.000 82.19850  ? 638 VAL B CG1 1 
ATOM   2570 C CG2 . VAL B 2 154 ? -9.94748  -33.75487 13.78840  1.000 95.22267  ? 638 VAL B CG2 1 
ATOM   2571 N N   . SER B 2 155 ? -10.23365 -32.62430 9.64132   1.000 74.92074  ? 639 SER B N   1 
ATOM   2572 C CA  . SER B 2 155 ? -10.48739 -33.45207 8.45933   1.000 77.07307  ? 639 SER B CA  1 
ATOM   2573 C C   . SER B 2 155 ? -9.18902  -33.87255 7.77477   1.000 75.12154  ? 639 SER B C   1 
ATOM   2574 O O   . SER B 2 155 ? -9.05503  -35.02670 7.34265   1.000 70.08413  ? 639 SER B O   1 
ATOM   2575 C CB  . SER B 2 155 ? -11.38748 -32.70718 7.46970   1.000 80.15201  ? 639 SER B CB  1 
ATOM   2576 O OG  . SER B 2 155 ? -12.38488 -31.95852 8.14157   1.000 86.42352  ? 639 SER B OG  1 
ATOM   2577 N N   . THR B 2 156 ? -8.21591  -32.95601 7.68960   1.000 78.50359  ? 640 THR B N   1 
ATOM   2578 C CA  . THR B 2 156 ? -6.95658  -33.26378 7.01544   1.000 76.61916  ? 640 THR B CA  1 
ATOM   2579 C C   . THR B 2 156 ? -6.16974  -34.32174 7.77293   1.000 77.76041  ? 640 THR B C   1 
ATOM   2580 O O   . THR B 2 156 ? -5.58876  -35.22382 7.15826   1.000 78.49540  ? 640 THR B O   1 
ATOM   2581 C CB  . THR B 2 156 ? -6.11192  -31.99842 6.83962   1.000 86.40462  ? 640 THR B CB  1 
ATOM   2582 O OG1 . THR B 2 156 ? -6.97071  -30.87569 6.60584   1.000 87.43903  ? 640 THR B OG1 1 
ATOM   2583 C CG2 . THR B 2 156 ? -5.14040  -32.15456 5.66245   1.000 81.96611  ? 640 THR B CG2 1 
ATOM   2584 N N   . GLN B 2 157 ? -6.16076  -34.24641 9.10582   1.000 78.72265  ? 641 GLN B N   1 
ATOM   2585 C CA  . GLN B 2 157 ? -5.45051  -35.25859 9.87485   1.000 80.14063  ? 641 GLN B CA  1 
ATOM   2586 C C   . GLN B 2 157 ? -6.17638  -36.59534 9.82320   1.000 77.44039  ? 641 GLN B C   1 
ATOM   2587 O O   . GLN B 2 157 ? -5.53716  -37.64738 9.71993   1.000 80.07137  ? 641 GLN B O   1 
ATOM   2588 C CB  . GLN B 2 157 ? -5.25325  -34.79319 11.31783  1.000 84.17370  ? 641 GLN B CB  1 
ATOM   2589 C CG  . GLN B 2 157 ? -4.29932  -33.59340 11.46421  1.000 93.76908  ? 641 GLN B CG  1 
ATOM   2590 C CD  . GLN B 2 157 ? -2.92239  -33.82545 10.82906  1.000 106.11314 ? 641 GLN B CD  1 
ATOM   2591 O OE1 . GLN B 2 157 ? -2.50864  -33.09729 9.91935   1.000 108.91157 ? 641 GLN B OE1 1 
ATOM   2592 N NE2 . GLN B 2 157 ? -2.20885  -34.83605 11.31406  1.000 111.84841 ? 641 GLN B NE2 1 
ATOM   2593 N N   . LEU B 2 158 ? -7.51101  -36.57773 9.85260   1.000 74.32483  ? 642 LEU B N   1 
ATOM   2594 C CA  . LEU B 2 158 ? -8.25668  -37.82972 9.83374   1.000 71.95434  ? 642 LEU B CA  1 
ATOM   2595 C C   . LEU B 2 158 ? -8.20392  -38.51034 8.47610   1.000 70.60154  ? 642 LEU B C   1 
ATOM   2596 O O   . LEU B 2 158 ? -8.20638  -39.74482 8.40682   1.000 70.23194  ? 642 LEU B O   1 
ATOM   2597 C CB  . LEU B 2 158 ? -9.70593  -37.58426 10.23972  1.000 69.26979  ? 642 LEU B CB  1 
ATOM   2598 C CG  . LEU B 2 158 ? -9.92729  -37.67139 11.74825  1.000 70.45735  ? 642 LEU B CG  1 
ATOM   2599 C CD1 . LEU B 2 158 ? -11.15327 -36.88655 12.16036  1.000 68.90977  ? 642 LEU B CD1 1 
ATOM   2600 C CD2 . LEU B 2 158 ? -10.03660 -39.11938 12.18735  1.000 70.31644  ? 642 LEU B CD2 1 
ATOM   2601 N N   . ALA B 2 159 ? -8.15127  -37.73207 7.39574   1.000 70.22747  ? 643 ALA B N   1 
ATOM   2602 C CA  . ALA B 2 159 ? -8.07701  -38.32989 6.06897   1.000 69.28251  ? 643 ALA B CA  1 
ATOM   2603 C C   . ALA B 2 159 ? -6.74256  -39.03344 5.84987   1.000 91.02890  ? 643 ALA B C   1 
ATOM   2604 O O   . ALA B 2 159 ? -6.70445  -40.13510 5.28704   1.000 85.81520  ? 643 ALA B O   1 
ATOM   2605 C CB  . ALA B 2 159 ? -8.30441  -37.26294 5.00340   1.000 68.75844  ? 643 ALA B CB  1 
ATOM   2606 N N   . ARG B 2 160 ? -5.63963  -38.42327 6.29945   1.000 88.10839  ? 644 ARG B N   1 
ATOM   2607 C CA  . ARG B 2 160 ? -4.31986  -39.00592 6.11233   1.000 93.34221  ? 644 ARG B CA  1 
ATOM   2608 C C   . ARG B 2 160 ? -3.94233  -40.00661 7.19932   1.000 98.87531  ? 644 ARG B C   1 
ATOM   2609 O O   . ARG B 2 160 ? -2.90085  -40.66350 7.07509   1.000 114.74455 ? 644 ARG B O   1 
ATOM   2610 C CB  . ARG B 2 160 ? -3.25303  -37.90160 6.01901   1.000 103.49417 ? 644 ARG B CB  1 
ATOM   2611 C CG  . ARG B 2 160 ? -2.97082  -37.14889 7.30494   1.000 114.01397 ? 644 ARG B CG  1 
ATOM   2612 C CD  . ARG B 2 160 ? -1.47966  -37.14697 7.61929   1.000 125.34989 ? 644 ARG B CD  1 
ATOM   2613 N NE  . ARG B 2 160 ? -1.09600  -38.39980 8.26364   1.000 133.37918 ? 644 ARG B NE  1 
ATOM   2614 C CZ  . ARG B 2 160 ? -1.20289  -38.63345 9.56915   1.000 139.71323 ? 644 ARG B CZ  1 
ATOM   2615 N NH1 . ARG B 2 160 ? -0.84379  -39.80859 10.07304  1.000 142.19238 ? 644 ARG B NH1 1 
ATOM   2616 N NH2 . ARG B 2 160 ? -1.66546  -37.68617 10.37478  1.000 141.21796 ? 644 ARG B NH2 1 
ATOM   2617 N N   . ALA B 2 161 ? -4.75200  -40.14723 8.25199   1.000 86.45048  ? 645 ALA B N   1 
ATOM   2618 C CA  . ALA B 2 161 ? -4.53625  -41.20980 9.23188   1.000 84.75530  ? 645 ALA B CA  1 
ATOM   2619 C C   . ALA B 2 161 ? -5.31935  -42.47507 8.88481   1.000 83.53908  ? 645 ALA B C   1 
ATOM   2620 O O   . ALA B 2 161 ? -4.76453  -43.57835 8.91977   1.000 84.83676  ? 645 ALA B O   1 
ATOM   2621 C CB  . ALA B 2 161 ? -4.90330  -40.72546 10.63880  1.000 80.50824  ? 645 ALA B CB  1 
ATOM   2622 N N   . PHE B 2 162 ? -6.60431  -42.32400 8.56078   1.000 83.65240  ? 646 PHE B N   1 
ATOM   2623 C CA  . PHE B 2 162 ? -7.46987  -43.39893 8.08628   1.000 85.41617  ? 646 PHE B CA  1 
ATOM   2624 C C   . PHE B 2 162 ? -7.91549  -42.98025 6.70533   1.000 93.73400  ? 646 PHE B C   1 
ATOM   2625 O O   . PHE B 2 162 ? -8.62738  -41.97793 6.56067   1.000 112.49431 ? 646 PHE B O   1 
ATOM   2626 C CB  . PHE B 2 162 ? -8.66388  -43.61268 9.00606   1.000 81.89947  ? 646 PHE B CB  1 
ATOM   2627 C CG  . PHE B 2 162 ? -8.30716  -43.54376 10.44683  1.000 89.58985  ? 646 PHE B CG  1 
ATOM   2628 C CD1 . PHE B 2 162 ? -7.87496  -44.67997 11.10204  1.000 93.76570  ? 646 PHE B CD1 1 
ATOM   2629 C CD2 . PHE B 2 162 ? -8.37624  -42.34400 11.14833  1.000 94.20100  ? 646 PHE B CD2 1 
ATOM   2630 C CE1 . PHE B 2 162 ? -7.52364  -44.63500 12.42111  1.000 101.49473 ? 646 PHE B CE1 1 
ATOM   2631 C CE2 . PHE B 2 162 ? -8.01540  -42.29259 12.47567  1.000 98.47919  ? 646 PHE B CE2 1 
ATOM   2632 C CZ  . PHE B 2 162 ? -7.59169  -43.44189 13.11137  1.000 103.16223 ? 646 PHE B CZ  1 
ATOM   2633 N N   . THR B 2 163 ? -7.47967  -43.73047 5.69896   1.000 85.85509  ? 647 THR B N   1 
ATOM   2634 C CA  . THR B 2 163 ? -7.60361  -43.22236 4.34376   1.000 88.68310  ? 647 THR B CA  1 
ATOM   2635 C C   . THR B 2 163 ? -9.05626  -43.21294 3.90018   1.000 80.11075  ? 647 THR B C   1 
ATOM   2636 O O   . THR B 2 163 ? -9.57309  -44.19974 3.37604   1.000 84.14242  ? 647 THR B O   1 
ATOM   2637 C CB  . THR B 2 163 ? -6.71720  -44.00084 3.38789   1.000 103.25215 ? 647 THR B CB  1 
ATOM   2638 O OG1 . THR B 2 163 ? -5.44461  -44.18781 4.00933   1.000 111.16703 ? 647 THR B OG1 1 
ATOM   2639 C CG2 . THR B 2 163 ? -6.55555  -43.22411 2.13270   1.000 104.11137 ? 647 THR B CG2 1 
ATOM   2640 N N   . MET B 2 164 ? -9.70921  -42.07612 4.13659   1.000 67.39586  ? 648 MET B N   1 
ATOM   2641 C CA  . MET B 2 164 ? -11.15006 -41.91087 4.04930   1.000 64.31996  ? 648 MET B CA  1 
ATOM   2642 C C   . MET B 2 164 ? -11.42949 -40.44464 3.77088   1.000 59.72356  ? 648 MET B C   1 
ATOM   2643 O O   . MET B 2 164 ? -10.77826 -39.56985 4.35032   1.000 62.15876  ? 648 MET B O   1 
ATOM   2644 C CB  . MET B 2 164 ? -11.82122 -42.32909 5.35240   1.000 59.38188  ? 648 MET B CB  1 
ATOM   2645 C CG  . MET B 2 164 ? -12.76292 -43.46873 5.20112   1.000 61.22816  ? 648 MET B CG  1 
ATOM   2646 S SD  . MET B 2 164 ? -13.44507 -43.83291 6.80662   1.000 63.63972  ? 648 MET B SD  1 
ATOM   2647 C CE  . MET B 2 164 ? -12.36479 -45.17038 7.32052   1.000 70.24932  ? 648 MET B CE  1 
ATOM   2648 N N   . ASP B 2 165 ? -12.36882 -40.18415 2.86772   1.000 57.64915  ? 649 ASP B N   1 
ATOM   2649 C CA  . ASP B 2 165 ? -12.79551 -38.81418 2.61430   1.000 61.00610  ? 649 ASP B CA  1 
ATOM   2650 C C   . ASP B 2 165 ? -13.37148 -38.19478 3.88384   1.000 59.87849  ? 649 ASP B C   1 
ATOM   2651 O O   . ASP B 2 165 ? -14.09058 -38.84207 4.65113   1.000 55.56320  ? 649 ASP B O   1 
ATOM   2652 C CB  . ASP B 2 165 ? -13.84864 -38.76936 1.49784   1.000 58.04551  ? 649 ASP B CB  1 
ATOM   2653 C CG  . ASP B 2 165 ? -13.33904 -39.32142 0.17420   1.000 57.34775  ? 649 ASP B CG  1 
ATOM   2654 O OD1 . ASP B 2 165 ? -12.14811 -39.12051 -0.14486  1.000 60.94946  ? 649 ASP B OD1 1 
ATOM   2655 O OD2 . ASP B 2 165 ? -14.13979 -39.95013 -0.55339  1.000 57.00888  ? 649 ASP B OD2 1 
ATOM   2656 N N   . CYS B 2 166 ? -13.04736 -36.93418 4.10749   1.000 60.18521  ? 650 CYS B N   1 
ATOM   2657 C CA  . CYS B 2 166 ? -13.58031 -36.20176 5.23965   1.000 61.06374  ? 650 CYS B CA  1 
ATOM   2658 C C   . CYS B 2 166 ? -14.29361 -34.95130 4.75301   1.000 58.74517  ? 650 CYS B C   1 
ATOM   2659 O O   . CYS B 2 166 ? -14.04695 -34.46308 3.64745   1.000 58.30581  ? 650 CYS B O   1 
ATOM   2660 C CB  . CYS B 2 166 ? -12.46914 -35.85469 6.21582   1.000 63.35967  ? 650 CYS B CB  1 
ATOM   2661 S SG  . CYS B 2 166 ? -11.84761 -37.35580 6.96039   1.000 61.91955  ? 650 CYS B SG  1 
ATOM   2662 N N   . ILE B 2 167 ? -15.20831 -34.45225 5.58289   1.000 58.35922  ? 651 ILE B N   1 
ATOM   2663 C CA  . ILE B 2 167 ? -16.04003 -33.31727 5.20492   1.000 57.07274  ? 651 ILE B CA  1 
ATOM   2664 C C   . ILE B 2 167 ? -16.59131 -32.69305 6.48036   1.000 57.99180  ? 651 ILE B C   1 
ATOM   2665 O O   . ILE B 2 167 ? -16.83455 -33.38372 7.47258   1.000 57.41111  ? 651 ILE B O   1 
ATOM   2666 C CB  . ILE B 2 167 ? -17.15441 -33.74786 4.20849   1.000 54.33141  ? 651 ILE B CB  1 
ATOM   2667 C CG1 . ILE B 2 167 ? -17.76278 -32.52144 3.51969   1.000 61.52793  ? 651 ILE B CG1 1 
ATOM   2668 C CG2 . ILE B 2 167 ? -18.21267 -34.61411 4.87608   1.000 51.51915  ? 651 ILE B CG2 1 
ATOM   2669 C CD1 . ILE B 2 167 ? -18.69903 -32.84608 2.38195   1.000 52.00021  ? 651 ILE B CD1 1 
ATOM   2670 N N   . THR B 2 168 ? -16.74538 -31.37261 6.46807   1.000 66.48820  ? 652 THR B N   1 
ATOM   2671 C CA  . THR B 2 168 ? -17.27540 -30.64376 7.61133   1.000 65.22416  ? 652 THR B CA  1 
ATOM   2672 C C   . THR B 2 168 ? -18.73197 -30.27541 7.36729   1.000 62.06967  ? 652 THR B C   1 
ATOM   2673 O O   . THR B 2 168 ? -19.24356 -30.35694 6.24867   1.000 58.06692  ? 652 THR B O   1 
ATOM   2674 C CB  . THR B 2 168 ? -16.45891 -29.37629 7.89343   1.000 73.05514  ? 652 THR B CB  1 
ATOM   2675 O OG1 . THR B 2 168 ? -16.84339 -28.34543 6.97375   1.000 82.42246  ? 652 THR B OG1 1 
ATOM   2676 C CG2 . THR B 2 168 ? -14.96577 -29.64780 7.75984   1.000 74.09309  ? 652 THR B CG2 1 
ATOM   2677 N N   . LEU B 2 169 ? -19.38822 -29.82475 8.43935   1.000 59.46849  ? 653 LEU B N   1 
ATOM   2678 C CA  . LEU B 2 169 ? -20.80225 -29.47799 8.38287   1.000 60.09541  ? 653 LEU B CA  1 
ATOM   2679 C C   . LEU B 2 169 ? -21.08924 -28.29431 7.47551   1.000 61.52139  ? 653 LEU B C   1 
ATOM   2680 O O   . LEU B 2 169 ? -22.23500 -28.13004 7.04781   1.000 62.59556  ? 653 LEU B O   1 
ATOM   2681 C CB  . LEU B 2 169 ? -21.31713 -29.17367 9.78677   1.000 66.66314  ? 653 LEU B CB  1 
ATOM   2682 C CG  . LEU B 2 169 ? -21.85227 -30.36009 10.58386  1.000 76.14931  ? 653 LEU B CG  1 
ATOM   2683 C CD1 . LEU B 2 169 ? -22.81624 -29.86817 11.63224  1.000 76.95744  ? 653 LEU B CD1 1 
ATOM   2684 C CD2 . LEU B 2 169 ? -22.54535 -31.34775 9.66530   1.000 79.80482  ? 653 LEU B CD2 1 
ATOM   2685 N N   . GLU B 2 170 ? -20.08873 -27.46677 7.18250   1.000 61.72012  ? 654 GLU B N   1 
ATOM   2686 C CA  . GLU B 2 170 ? -20.25728 -26.31947 6.30260   1.000 69.42211  ? 654 GLU B CA  1 
ATOM   2687 C C   . GLU B 2 170 ? -19.88492 -26.63267 4.86135   1.000 68.19007  ? 654 GLU B C   1 
ATOM   2688 O O   . GLU B 2 170 ? -20.02385 -25.76096 3.99581   1.000 70.02572  ? 654 GLU B O   1 
ATOM   2689 C CB  . GLU B 2 170 ? -19.43164 -25.12357 6.81490   1.000 70.00027  ? 654 GLU B CB  1 
ATOM   2690 C CG  . GLU B 2 170 ? -19.76660 -24.70128 8.25045   1.000 67.39075  ? 654 GLU B CG  1 
ATOM   2691 C CD  . GLU B 2 170 ? -18.96552 -25.47413 9.28838   1.000 74.97062  ? 654 GLU B CD  1 
ATOM   2692 O OE1 . GLU B 2 170 ? -19.50614 -25.77883 10.37972  1.000 69.88450  ? 654 GLU B OE1 1 
ATOM   2693 O OE2 . GLU B 2 170 ? -17.78884 -25.78552 9.00467   1.000 80.29195  ? 654 GLU B OE2 1 
ATOM   2694 N N   . GLY B 2 171 ? -19.40459 -27.84428 4.58674   1.000 63.64813  ? 655 GLY B N   1 
ATOM   2695 C CA  . GLY B 2 171 ? -19.15348 -28.29439 3.23218   1.000 64.83050  ? 655 GLY B CA  1 
ATOM   2696 C C   . GLY B 2 171 ? -17.69871 -28.47838 2.84507   1.000 67.04186  ? 655 GLY B C   1 
ATOM   2697 O O   . GLY B 2 171 ? -17.44073 -29.02258 1.76204   1.000 67.43362  ? 655 GLY B O   1 
ATOM   2698 N N   . ASP B 2 172 ? -16.74049 -28.04367 3.66967   1.000 71.15116  ? 656 ASP B N   1 
ATOM   2699 C CA  . ASP B 2 172 ? -15.33270 -28.13873 3.29374   1.000 72.96658  ? 656 ASP B CA  1 
ATOM   2700 C C   . ASP B 2 172 ? -14.86494 -29.58575 3.35817   1.000 70.83005  ? 656 ASP B C   1 
ATOM   2701 O O   . ASP B 2 172 ? -15.12047 -30.28330 4.34271   1.000 69.43692  ? 656 ASP B O   1 
ATOM   2702 C CB  . ASP B 2 172 ? -14.47038 -27.27322 4.20936   1.000 76.96825  ? 656 ASP B CB  1 
ATOM   2703 C CG  . ASP B 2 172 ? -15.01745 -25.86895 4.37966   1.000 80.79944  ? 656 ASP B CG  1 
ATOM   2704 O OD1 . ASP B 2 172 ? -15.66987 -25.60283 5.41263   1.000 78.65904  ? 656 ASP B OD1 1 
ATOM   2705 O OD2 . ASP B 2 172 ? -14.78424 -25.02718 3.48501   1.000 87.33533  ? 656 ASP B OD2 1 
ATOM   2706 N N   . GLN B 2 173 ? -14.16764 -30.03633 2.31574   1.000 72.26839  ? 657 GLN B N   1 
ATOM   2707 C CA  . GLN B 2 173 ? -13.77363 -31.43331 2.19222   1.000 70.36075  ? 657 GLN B CA  1 
ATOM   2708 C C   . GLN B 2 173 ? -12.26055 -31.60210 2.20978   1.000 74.20530  ? 657 GLN B C   1 
ATOM   2709 O O   . GLN B 2 173 ? -11.50708 -30.69727 1.83311   1.000 78.76361  ? 657 GLN B O   1 
ATOM   2710 C CB  . GLN B 2 173 ? -14.29385 -32.05982 0.89582   1.000 68.59451  ? 657 GLN B CB  1 
ATOM   2711 C CG  . GLN B 2 173 ? -15.68741 -31.67540 0.49468   1.000 66.64552  ? 657 GLN B CG  1 
ATOM   2712 C CD  . GLN B 2 173 ? -15.97271 -32.09071 -0.92480  1.000 66.77359  ? 657 GLN B CD  1 
ATOM   2713 O OE1 . GLN B 2 173 ? -16.36000 -31.27228 -1.75975  1.000 74.42372  ? 657 GLN B OE1 1 
ATOM   2714 N NE2 . GLN B 2 173 ? -15.76599 -33.36748 -1.21484  1.000 65.01737  ? 657 GLN B NE2 1 
ATOM   2715 N N   . VAL B 2 174 ? -11.82909 -32.78796 2.63855   1.000 72.92766  ? 658 VAL B N   1 
ATOM   2716 C CA  . VAL B 2 174 ? -10.46662 -33.26619 2.43939   1.000 76.22231  ? 658 VAL B CA  1 
ATOM   2717 C C   . VAL B 2 174 ? -10.56090 -34.68432 1.89425   1.000 73.26588  ? 658 VAL B C   1 
ATOM   2718 O O   . VAL B 2 174 ? -11.27189 -35.52266 2.46031   1.000 69.81641  ? 658 VAL B O   1 
ATOM   2719 C CB  . VAL B 2 174 ? -9.62979  -33.22567 3.73527   1.000 79.23725  ? 658 VAL B CB  1 
ATOM   2720 C CG1 . VAL B 2 174 ? -8.28138  -33.88199 3.51836   1.000 82.76198  ? 658 VAL B CG1 1 
ATOM   2721 C CG2 . VAL B 2 174 ? -9.42507  -31.78797 4.21110   1.000 83.08940  ? 658 VAL B CG2 1 
ATOM   2722 N N   . SER B 2 175 ? -9.86031  -34.94498 0.78963   1.000 79.81640  ? 659 SER B N   1 
ATOM   2723 C CA  . SER B 2 175 ? -9.93202  -36.22615 0.09940   1.000 72.95876  ? 659 SER B CA  1 
ATOM   2724 C C   . SER B 2 175 ? -9.12786  -37.29552 0.82787   1.000 73.25145  ? 659 SER B C   1 
ATOM   2725 O O   . SER B 2 175 ? -8.27851  -37.01144 1.67513   1.000 76.56655  ? 659 SER B O   1 
ATOM   2726 C CB  . SER B 2 175 ? -9.41257  -36.10518 -1.33665  1.000 77.68590  ? 659 SER B CB  1 
ATOM   2727 O OG  . SER B 2 175 ? -10.05152 -37.03444 -2.19788  1.000 79.71181  ? 659 SER B OG  1 
ATOM   2728 N N   . HIS B 2 176 ? -9.39982  -38.55051 0.46938   1.000 91.94845  ? 660 HIS B N   1 
ATOM   2729 C CA  . HIS B 2 176 ? -8.59238  -39.63310 1.00863   1.000 91.22740  ? 660 HIS B CA  1 
ATOM   2730 C C   . HIS B 2 176 ? -7.19578  -39.62982 0.39986   1.000 99.39908  ? 660 HIS B C   1 
ATOM   2731 O O   . HIS B 2 176 ? -6.23688  -40.02705 1.06722   1.000 108.25283 ? 660 HIS B O   1 
ATOM   2732 C CB  . HIS B 2 176 ? -9.29952  -40.98436 0.82030   1.000 82.56189  ? 660 HIS B CB  1 
ATOM   2733 C CG  . HIS B 2 176 ? -9.39687  -41.45884 -0.60165  1.000 85.65652  ? 660 HIS B CG  1 
ATOM   2734 N ND1 . HIS B 2 176 ? -10.47390 -41.16974 -1.41448  1.000 85.14976  ? 660 HIS B ND1 1 
ATOM   2735 C CD2 . HIS B 2 176 ? -8.58906  -42.26716 -1.32926  1.000 87.77893  ? 660 HIS B CD2 1 
ATOM   2736 C CE1 . HIS B 2 176 ? -10.30935 -41.75090 -2.59012  1.000 82.54266  ? 660 HIS B CE1 1 
ATOM   2737 N NE2 . HIS B 2 176 ? -9.17158  -42.42083 -2.56573  1.000 85.62051  ? 660 HIS B NE2 1 
ATOM   2738 N N   . ARG B 2 177 ? -7.04570  -39.14320 -0.83600  1.000 97.64059  ? 661 ARG B N   1 
ATOM   2739 C CA  . ARG B 2 177 ? -5.70943  -39.03433 -1.41512  1.000 108.57460 ? 661 ARG B CA  1 
ATOM   2740 C C   . ARG B 2 177 ? -4.99307  -37.77126 -0.95577  1.000 119.28648 ? 661 ARG B C   1 
ATOM   2741 O O   . ARG B 2 177 ? -3.75914  -37.75864 -0.88737  1.000 126.18568 ? 661 ARG B O   1 
ATOM   2742 C CB  . ARG B 2 177 ? -5.77374  -39.10452 -2.94514  1.000 110.98470 ? 661 ARG B CB  1 
ATOM   2743 C CG  . ARG B 2 177 ? -6.56886  -40.30291 -3.50702  1.000 112.90722 ? 661 ARG B CG  1 
ATOM   2744 C CD  . ARG B 2 177 ? -5.70224  -41.54654 -3.85997  1.000 120.87513 ? 661 ARG B CD  1 
ATOM   2745 N NE  . ARG B 2 177 ? -5.00948  -42.14031 -2.71406  1.000 127.28452 ? 661 ARG B NE  1 
ATOM   2746 C CZ  . ARG B 2 177 ? -3.97990  -42.98800 -2.80652  1.000 131.49882 ? 661 ARG B CZ  1 
ATOM   2747 N NH1 . ARG B 2 177 ? -3.50839  -43.35778 -3.99328  1.000 134.07148 ? 661 ARG B NH1 1 
ATOM   2748 N NH2 . ARG B 2 177 ? -3.42037  -43.46808 -1.69977  1.000 133.59815 ? 661 ARG B NH2 1 
ATOM   2749 N N   . GLY B 2 178 ? -5.73614  -36.71928 -0.61434  1.000 124.58344 ? 662 GLY B N   1 
ATOM   2750 C CA  . GLY B 2 178 ? -5.13489  -35.50238 -0.09974  1.000 130.42416 ? 662 GLY B CA  1 
ATOM   2751 C C   . GLY B 2 178 ? -5.43670  -34.27008 -0.92902  1.000 133.12037 ? 662 GLY B C   1 
ATOM   2752 O O   . GLY B 2 178 ? -4.64183  -33.32620 -0.95298  1.000 139.28239 ? 662 GLY B O   1 
ATOM   2753 N N   . ALA B 2 179 ? -6.58250  -34.26348 -1.60824  1.000 127.24462 ? 663 ALA B N   1 
ATOM   2754 C CA  . ALA B 2 179 ? -7.00324  -33.15615 -2.45550  1.000 125.53638 ? 663 ALA B CA  1 
ATOM   2755 C C   . ALA B 2 179 ? -8.11455  -32.35678 -1.78047  1.000 118.04867 ? 663 ALA B C   1 
ATOM   2756 O O   . ALA B 2 179 ? -8.94158  -32.90844 -1.04793  1.000 98.79551  ? 663 ALA B O   1 
ATOM   2757 C CB  . ALA B 2 179 ? -7.48049  -33.66262 -3.82205  1.000 119.58800 ? 663 ALA B CB  1 
ATOM   2758 N N   . LEU B 2 180 ? -8.12511  -31.04615 -2.03271  1.000 127.46683 ? 664 LEU B N   1 
ATOM   2759 C CA  . LEU B 2 180 ? -9.13326  -30.15347 -1.45082  1.000 123.80305 ? 664 LEU B CA  1 
ATOM   2760 C C   . LEU B 2 180 ? -9.87533  -29.38139 -2.54577  1.000 125.40618 ? 664 LEU B C   1 
ATOM   2761 O O   . LEU B 2 180 ? -11.05877 -29.05793 -2.40383  1.000 119.33044 ? 664 LEU B O   1 
ATOM   2762 C CB  . LEU B 2 180 ? -8.48194  -29.18484 -0.44689  1.000 120.54211 ? 664 LEU B CB  1 
ATOM   2763 C CG  . LEU B 2 180 ? -9.37983  -28.31446 0.44736   1.000 111.63093 ? 664 LEU B CG  1 
ATOM   2764 C CD1 . LEU B 2 180 ? -8.77265  -28.19489 1.83380   1.000 105.22256 ? 664 LEU B CD1 1 
ATOM   2765 C CD2 . LEU B 2 180 ? -9.60822  -26.91986 -0.12968  1.000 119.12003 ? 664 LEU B CD2 1 
HETATM 2766 O O   . HOH C 3 .   ? -12.63923 -38.37667 -35.42716 1.000 38.01854  ? 701 HOH A O   1 
HETATM 2767 O O   . HOH C 3 .   ? -21.17850 -58.49454 -28.73110 1.000 56.34681  ? 702 HOH A O   1 
HETATM 2768 O O   . HOH C 3 .   ? -12.24422 -29.48841 -32.18726 1.000 45.80884  ? 703 HOH A O   1 
HETATM 2769 O O   . HOH C 3 .   ? -9.67005  -39.32415 -37.97965 1.000 67.81147  ? 704 HOH A O   1 
HETATM 2770 O O   . HOH C 3 .   ? -19.64700 -40.69562 -20.74418 1.000 49.88774  ? 705 HOH A O   1 
HETATM 2771 O O   . HOH C 3 .   ? -17.72867 -61.04498 -15.66769 1.000 37.14253  ? 706 HOH A O   1 
HETATM 2772 O O   . HOH C 3 .   ? -32.26543 -35.93071 -26.22183 1.000 61.02690  ? 707 HOH A O   1 
HETATM 2773 O O   . HOH C 3 .   ? -12.91115 -32.37697 -21.05774 1.000 48.63835  ? 708 HOH A O   1 
HETATM 2774 O O   . HOH C 3 .   ? -5.17083  -48.23514 -18.87579 1.000 52.69837  ? 709 HOH A O   1 
HETATM 2775 O O   . HOH C 3 .   ? -12.72951 -53.65849 -18.20815 1.000 28.11514  ? 710 HOH A O   1 
HETATM 2776 O O   . HOH C 3 .   ? 4.87861   -30.17465 -17.35683 1.000 57.50453  ? 711 HOH A O   1 
HETATM 2777 O O   . HOH C 3 .   ? -10.13170 -50.21496 -17.52507 1.000 55.44888  ? 712 HOH A O   1 
HETATM 2778 O O   . HOH C 3 .   ? -22.15491 -47.14353 -30.31181 1.000 52.09988  ? 713 HOH A O   1 
HETATM 2779 O O   . HOH C 3 .   ? -11.76228 -56.14899 -17.23615 1.000 42.48044  ? 714 HOH A O   1 
HETATM 2780 O O   . HOH C 3 .   ? -7.92504  -30.05528 -32.60851 1.000 54.54539  ? 715 HOH A O   1 
HETATM 2781 O O   . HOH C 3 .   ? -29.27897 -57.21384 -25.51985 1.000 57.72882  ? 716 HOH A O   1 
HETATM 2782 O O   . HOH C 3 .   ? -31.45360 -49.79573 -26.24426 1.000 59.77758  ? 717 HOH A O   1 
HETATM 2783 O O   . HOH C 3 .   ? -25.31038 -42.16260 -20.39742 1.000 41.00404  ? 718 HOH A O   1 
HETATM 2784 O O   . HOH C 3 .   ? -27.75209 -40.43532 -21.94565 1.000 34.03575  ? 719 HOH A O   1 
HETATM 2785 O O   . HOH C 3 .   ? -7.85722  -41.60127 -37.79955 1.000 61.02136  ? 720 HOH A O   1 
HETATM 2786 O O   . HOH C 3 .   ? -2.39326  -17.13052 -34.30233 1.000 58.64983  ? 721 HOH A O   1 
HETATM 2787 O O   . HOH C 3 .   ? -19.53780 -63.90441 -18.87183 1.000 48.86794  ? 722 HOH A O   1 
HETATM 2788 O O   . HOH C 3 .   ? -20.72194 -48.69921 -38.82348 1.000 63.40816  ? 723 HOH A O   1 
HETATM 2789 O O   . HOH C 3 .   ? -16.32823 -49.85587 -11.43142 1.000 26.20381  ? 724 HOH A O   1 
HETATM 2790 O O   . HOH C 3 .   ? 1.95016   -45.12192 -16.58313 1.000 52.57394  ? 725 HOH A O   1 
HETATM 2791 O O   . HOH C 3 .   ? -10.56719 -50.68287 -24.18497 1.000 32.06470  ? 726 HOH A O   1 
HETATM 2792 O O   . HOH C 3 .   ? -27.03241 -61.68475 -20.23853 1.000 38.10929  ? 727 HOH A O   1 
HETATM 2793 O O   . HOH C 3 .   ? 1.45791   -28.09795 -31.61366 1.000 45.38759  ? 728 HOH A O   1 
HETATM 2794 O O   . HOH C 3 .   ? -2.23316  -38.69284 -14.50281 1.000 90.83163  ? 729 HOH A O   1 
HETATM 2795 O O   . HOH C 3 .   ? -15.75754 -50.08751 -14.06560 1.000 19.80840  ? 730 HOH A O   1 
HETATM 2796 O O   . HOH C 3 .   ? -7.32743  -45.09709 -16.84089 1.000 51.75728  ? 731 HOH A O   1 
HETATM 2797 O O   . HOH C 3 .   ? -5.97305  -44.04087 -14.95823 1.000 56.17741  ? 732 HOH A O   1 
HETATM 2798 O O   . HOH C 3 .   ? -18.95998 -46.56387 -9.75231  1.000 32.28934  ? 733 HOH A O   1 
HETATM 2799 O O   . HOH C 3 .   ? -28.53648 -46.51239 -23.49937 1.000 30.04845  ? 734 HOH A O   1 
HETATM 2800 O O   . HOH C 3 .   ? -19.54569 -31.54849 -25.27021 1.000 50.92919  ? 735 HOH A O   1 
HETATM 2801 O O   . HOH C 3 .   ? -10.47448 -62.26129 -15.76745 1.000 61.73983  ? 736 HOH A O   1 
HETATM 2802 O O   . HOH C 3 .   ? -20.54555 -51.07483 -5.48966  1.000 37.60140  ? 737 HOH A O   1 
HETATM 2803 O O   . HOH C 3 .   ? -22.56233 -47.20916 -15.75801 1.000 38.75429  ? 738 HOH A O   1 
HETATM 2804 O O   . HOH C 3 .   ? -10.01627 -36.76291 -37.43721 1.000 58.00524  ? 739 HOH A O   1 
HETATM 2805 O O   . HOH C 3 .   ? -30.43710 -37.75867 -30.78675 1.000 72.80273  ? 740 HOH A O   1 
HETATM 2806 O O   . HOH C 3 .   ? -9.85771  -51.74769 -13.23454 1.000 68.28619  ? 741 HOH A O   1 
HETATM 2807 O O   . HOH C 3 .   ? -7.20648  -28.92542 -17.24904 1.000 52.33202  ? 742 HOH A O   1 
HETATM 2808 O O   . HOH C 3 .   ? -24.89733 -48.61729 -33.46788 1.000 52.80014  ? 743 HOH A O   1 
HETATM 2809 O O   . HOH C 3 .   ? -20.92417 -44.35378 -13.72445 1.000 43.19933  ? 744 HOH A O   1 
HETATM 2810 O O   . HOH C 3 .   ? -25.49647 -47.04122 -31.89984 1.000 54.44989  ? 745 HOH A O   1 
HETATM 2811 O O   . HOH C 3 .   ? -26.71564 -52.48445 -28.39991 1.000 51.33760  ? 746 HOH A O   1 
HETATM 2812 O O   . HOH C 3 .   ? -10.29919 -42.57168 -16.88055 1.000 57.28154  ? 747 HOH A O   1 
HETATM 2813 O O   . HOH C 3 .   ? -23.55100 -45.16848 -33.05987 1.000 57.27343  ? 748 HOH A O   1 
HETATM 2814 O O   . HOH C 3 .   ? -28.93521 -53.99979 -27.38586 1.000 49.57716  ? 749 HOH A O   1 
HETATM 2815 O O   . HOH C 3 .   ? -5.60992  -49.04634 -21.40375 1.000 53.71890  ? 750 HOH A O   1 
HETATM 2816 O O   . HOH C 3 .   ? -14.89257 -45.28444 -14.43393 1.000 45.36044  ? 751 HOH A O   1 
HETATM 2817 O O   . HOH C 3 .   ? -4.12734  -45.57986 -34.74075 1.000 41.92515  ? 752 HOH A O   1 
HETATM 2818 O O   . HOH C 3 .   ? -19.33858 -60.84989 -10.80359 1.000 52.54512  ? 753 HOH A O   1 
HETATM 2819 O O   . HOH C 3 .   ? -10.94700 -40.39253 -17.04532 1.000 41.19616  ? 754 HOH A O   1 
HETATM 2820 O O   . HOH C 3 .   ? -14.07059 -58.30288 -9.94036  1.000 39.91064  ? 755 HOH A O   1 
HETATM 2821 O O   . HOH C 3 .   ? -22.21540 -60.66274 -8.03236  1.000 74.60033  ? 756 HOH A O   1 
HETATM 2822 O O   . HOH C 3 .   ? -18.13887 -34.58151 -23.94989 1.000 66.00607  ? 757 HOH A O   1 
HETATM 2823 O O   . HOH C 3 .   ? -29.71456 -33.86856 -32.21085 1.000 55.24328  ? 758 HOH A O   1 
HETATM 2824 O O   . HOH C 3 .   ? -2.01909  -46.58228 -34.19217 1.000 61.71595  ? 759 HOH A O   1 
HETATM 2825 O O   . HOH C 3 .   ? -16.71841 -43.65393 -18.21084 1.000 42.11445  ? 760 HOH A O   1 
HETATM 2826 O O   . HOH C 3 .   ? 2.76836   -48.70842 -25.66094 1.000 59.88345  ? 761 HOH A O   1 
HETATM 2827 O O   . HOH C 3 .   ? -1.49074  -50.39381 -31.72790 1.000 71.71943  ? 762 HOH A O   1 
HETATM 2828 O O   . HOH C 3 .   ? -9.73474  -55.96908 -16.28858 1.000 57.79877  ? 763 HOH A O   1 
HETATM 2829 O O   . HOH C 3 .   ? -16.49391 -47.03820 -11.12987 1.000 47.08687  ? 764 HOH A O   1 
HETATM 2830 O O   . HOH C 3 .   ? -32.07648 -52.71802 -25.63863 1.000 49.56468  ? 765 HOH A O   1 
HETATM 2831 O O   . HOH C 3 .   ? -17.19893 -30.93113 -33.20180 1.000 63.72160  ? 766 HOH A O   1 
HETATM 2832 O O   . HOH C 3 .   ? -25.57551 -38.68694 -22.25998 1.000 42.88462  ? 767 HOH A O   1 
HETATM 2833 O O   . HOH C 3 .   ? -19.69297 -52.77587 -42.40172 1.000 66.88358  ? 768 HOH A O   1 
HETATM 2834 O O   . HOH C 3 .   ? -26.08403 -36.25079 -21.01091 1.000 51.37697  ? 769 HOH A O   1 
HETATM 2835 O O   . HOH C 3 .   ? -12.45658 -43.58874 -16.58225 1.000 57.35346  ? 770 HOH A O   1 
HETATM 2836 O O   . HOH C 3 .   ? -19.31624 -59.55834 -6.14482  1.000 79.58090  ? 771 HOH A O   1 
HETATM 2837 O O   . HOH C 3 .   ? 0.40176   -47.74096 -33.52331 1.000 58.75678  ? 772 HOH A O   1 
HETATM 2838 O O   . HOH C 3 .   ? -4.42274  -38.09600 -13.80580 1.000 62.34247  ? 773 HOH A O   1 
HETATM 2839 O O   . HOH C 3 .   ? -6.08043  -54.10814 -33.17917 1.000 46.74925  ? 774 HOH A O   1 
HETATM 2840 O O   . HOH C 3 .   ? -11.99551 -51.79759 -16.62578 1.000 32.97533  ? 775 HOH A O   1 
HETATM 2841 O O   . HOH C 3 .   ? -18.95914 -42.46584 -17.37962 1.000 67.13291  ? 776 HOH A O   1 
HETATM 2842 O O   . HOH C 3 .   ? -6.02263  -43.60342 -38.62895 1.000 63.02459  ? 777 HOH A O   1 
HETATM 2843 O O   . HOH C 3 .   ? -5.96412  -41.10699 -12.75726 1.000 58.20441  ? 778 HOH A O   1 
HETATM 2844 O O   . HOH C 3 .   ? -12.96401 -50.33572 -14.74199 1.000 41.82904  ? 779 HOH A O   1 
HETATM 2845 O O   . HOH C 3 .   ? -4.81633  -53.45188 -14.35724 1.000 57.46841  ? 780 HOH A O   1 
HETATM 2846 O O   . HOH C 3 .   ? 6.984     -28.669   -35.787   1.000 48.16689  ? 781 HOH A O   1 
HETATM 2847 O O   . HOH C 3 .   ? -4.36683  -34.98058 -15.24742 1.000 53.09342  ? 782 HOH A O   1 
HETATM 2848 O O   . HOH C 3 .   ? -4.07913  -51.94851 -33.38828 1.000 64.45756  ? 783 HOH A O   1 
HETATM 2849 O O   . HOH C 3 .   ? -10.76575 -54.33978 -7.94322  1.000 53.98974  ? 784 HOH A O   1 
HETATM 2850 O O   . HOH C 3 .   ? 4.58543   -46.65107 -31.79567 1.000 53.93710  ? 785 HOH A O   1 
HETATM 2851 O O   . HOH C 3 .   ? -16.47182 -13.51733 -34.37740 1.000 57.22503  ? 786 HOH A O   1 
HETATM 2852 O O   . HOH D 3 .   ? -38.65514 -56.81935 -5.93066  1.000 49.77854  ? 701 HOH B O   1 
HETATM 2853 O O   . HOH D 3 .   ? -2.67257  -32.23817 -0.89230  1.000 57.55148  ? 702 HOH B O   1 
HETATM 2854 O O   . HOH D 3 .   ? -39.07328 -37.11760 -20.85302 1.000 50.39983  ? 703 HOH B O   1 
HETATM 2855 O O   . HOH D 3 .   ? -4.887    -29.103   15.439    1.000 62.15121  ? 704 HOH B O   1 
HETATM 2856 O O   . HOH D 3 .   ? -42.98101 -34.30148 -17.95336 1.000 49.63645  ? 705 HOH B O   1 
HETATM 2857 O O   . HOH D 3 .   ? -38.34004 -30.28214 -19.97992 1.000 60.31915  ? 706 HOH B O   1 
HETATM 2858 O O   . HOH D 3 .   ? -34.73427 -58.95184 -11.64698 1.000 36.84645  ? 707 HOH B O   1 
HETATM 2859 O O   . HOH D 3 .   ? -33.102   -60.687   -18.903   1.000 49.82117  ? 708 HOH B O   1 
HETATM 2860 O O   . HOH D 3 .   ? -5.01180  -41.86980 -0.27489  1.000 81.11740  ? 709 HOH B O   1 
HETATM 2861 O O   . HOH D 3 .   ? -22.42334 -36.51232 -12.43256 1.000 55.23432  ? 710 HOH B O   1 
HETATM 2862 O O   . HOH D 3 .   ? -30.73122 -30.17460 11.84870  1.000 51.12345  ? 711 HOH B O   1 
HETATM 2863 O O   . HOH D 3 .   ? -30.93977 -33.23928 0.46104   1.000 49.10466  ? 712 HOH B O   1 
HETATM 2864 O O   . HOH D 3 .   ? -38.64632 -46.45020 -1.89949  1.000 40.38575  ? 713 HOH B O   1 
HETATM 2865 O O   . HOH D 3 .   ? -45.82210 -51.53366 -24.08797 1.000 58.46217  ? 714 HOH B O   1 
HETATM 2866 O O   . HOH D 3 .   ? -48.11324 -43.94421 -11.78681 1.000 39.51187  ? 715 HOH B O   1 
HETATM 2867 O O   . HOH D 3 .   ? -15.50880 -53.00729 -8.38382  1.000 63.02678  ? 716 HOH B O   1 
HETATM 2868 O O   . HOH D 3 .   ? -31.28417 -40.17603 -23.57607 1.000 43.67469  ? 717 HOH B O   1 
HETATM 2869 O O   . HOH D 3 .   ? -45.97469 -48.89951 -10.46803 1.000 30.66200  ? 718 HOH B O   1 
HETATM 2870 O O   . HOH D 3 .   ? -21.58431 -55.63692 -1.98807  1.000 41.38540  ? 719 HOH B O   1 
HETATM 2871 O O   . HOH D 3 .   ? -33.20386 -42.37445 -25.31490 1.000 28.95031  ? 720 HOH B O   1 
HETATM 2872 O O   . HOH D 3 .   ? -37.81311 -41.07722 -6.24860  1.000 23.94863  ? 721 HOH B O   1 
HETATM 2873 O O   . HOH D 3 .   ? -18.38281 -48.92147 2.90557   1.000 48.27371  ? 722 HOH B O   1 
HETATM 2874 O O   . HOH D 3 .   ? -30.34400 -62.94167 -14.30030 1.000 41.42072  ? 723 HOH B O   1 
HETATM 2875 O O   . HOH D 3 .   ? -31.47391 -33.96912 -21.79645 1.000 42.45274  ? 724 HOH B O   1 
HETATM 2876 O O   . HOH D 3 .   ? -43.31677 -37.92142 -17.04756 1.000 59.87166  ? 725 HOH B O   1 
HETATM 2877 O O   . HOH D 3 .   ? -28.83801 -53.22922 0.22248   1.000 11.83110  ? 726 HOH B O   1 
HETATM 2878 O O   . HOH D 3 .   ? -36.61789 -30.18974 -21.75392 1.000 78.28645  ? 727 HOH B O   1 
HETATM 2879 O O   . HOH D 3 .   ? -19.96915 -42.98564 6.01719   1.000 31.20227  ? 728 HOH B O   1 
HETATM 2880 O O   . HOH D 3 .   ? -37.53625 -45.11361 1.07396   1.000 24.88269  ? 729 HOH B O   1 
HETATM 2881 O O   . HOH D 3 .   ? -26.16758 -61.25413 -8.69891  1.000 60.10768  ? 730 HOH B O   1 
HETATM 2882 O O   . HOH D 3 .   ? -51.819   -57.093   -17.817   1.000 41.38324  ? 731 HOH B O   1 
HETATM 2883 O O   . HOH D 3 .   ? -35.35981 -45.81042 2.95684   1.000 12.14999  ? 732 HOH B O   1 
HETATM 2884 O O   . HOH D 3 .   ? -38.13037 -33.32170 -18.86610 1.000 55.89405  ? 733 HOH B O   1 
HETATM 2885 O O   . HOH D 3 .   ? -37.59909 -34.33464 -13.08410 1.000 48.99870  ? 734 HOH B O   1 
HETATM 2886 O O   . HOH D 3 .   ? -24.05552 -30.31175 6.62602   1.000 52.81059  ? 735 HOH B O   1 
HETATM 2887 O O   . HOH D 3 .   ? -24.57679 -56.76009 -4.24510  1.000 37.69594  ? 736 HOH B O   1 
HETATM 2888 O O   . HOH D 3 .   ? -29.11685 -50.56245 7.46135   1.000 27.26337  ? 737 HOH B O   1 
HETATM 2889 O O   . HOH D 3 .   ? -37.80466 -41.17925 -11.23529 1.000 21.87629  ? 738 HOH B O   1 
HETATM 2890 O O   . HOH D 3 .   ? -18.06703 -57.15989 -2.28290  1.000 52.87201  ? 739 HOH B O   1 
HETATM 2891 O O   . HOH D 3 .   ? -13.19866 -55.03159 -5.15091  1.000 51.98994  ? 740 HOH B O   1 
HETATM 2892 O O   . HOH D 3 .   ? -18.64032 -42.04204 0.59554   1.000 38.78522  ? 741 HOH B O   1 
HETATM 2893 O O   . HOH D 3 .   ? -39.52421 -42.79410 -1.91681  1.000 39.65461  ? 742 HOH B O   1 
HETATM 2894 O O   . HOH D 3 .   ? -29.81078 -55.21262 3.86697   1.000 37.85145  ? 743 HOH B O   1 
HETATM 2895 O O   . HOH D 3 .   ? -42.05255 -48.51762 -8.27434  1.000 37.23832  ? 744 HOH B O   1 
HETATM 2896 O O   . HOH D 3 .   ? -44.13635 -43.35024 -12.94413 1.000 36.19625  ? 745 HOH B O   1 
HETATM 2897 O O   . HOH D 3 .   ? -30.96645 -45.63377 8.53003   1.000 48.21888  ? 746 HOH B O   1 
HETATM 2898 O O   . HOH D 3 .   ? -32.02946 -57.01139 -4.91667  1.000 34.45090  ? 747 HOH B O   1 
HETATM 2899 O O   . HOH D 3 .   ? -29.67937 -37.39715 11.22947  1.000 46.69941  ? 748 HOH B O   1 
HETATM 2900 O O   . HOH D 3 .   ? -32.18025 -55.38115 -0.77376  1.000 29.17839  ? 749 HOH B O   1 
HETATM 2901 O O   . HOH D 3 .   ? -38.28859 -57.06732 -8.67470  1.000 26.39433  ? 750 HOH B O   1 
HETATM 2902 O O   . HOH D 3 .   ? -22.40982 -24.17618 4.08528   1.000 68.61138  ? 751 HOH B O   1 
HETATM 2903 O O   . HOH D 3 .   ? -23.34393 -41.49494 -14.68601 1.000 46.34333  ? 752 HOH B O   1 
HETATM 2904 O O   . HOH D 3 .   ? -46.17212 -42.68300 -19.61334 1.000 50.71157  ? 753 HOH B O   1 
HETATM 2905 O O   . HOH D 3 .   ? -30.787   -48.519   8.107     1.000 29.17939  ? 754 HOH B O   1 
HETATM 2906 O O   . HOH D 3 .   ? -27.59075 -39.95100 -14.37190 1.000 41.00271  ? 755 HOH B O   1 
HETATM 2907 O O   . HOH D 3 .   ? -13.90293 -50.96754 2.56297   1.000 66.35438  ? 756 HOH B O   1 
HETATM 2908 O O   . HOH D 3 .   ? -36.71566 -58.24269 -17.64722 1.000 39.39895  ? 757 HOH B O   1 
HETATM 2909 O O   . HOH D 3 .   ? -16.78515 -38.15045 0.05127   1.000 58.39167  ? 758 HOH B O   1 
HETATM 2910 O O   . HOH D 3 .   ? -41.17586 -41.01173 -9.29622  1.000 53.05460  ? 759 HOH B O   1 
HETATM 2911 O O   . HOH D 3 .   ? -29.66581 -40.64201 -13.02270 1.000 27.85225  ? 760 HOH B O   1 
HETATM 2912 O O   . HOH D 3 .   ? -38.55950 -35.24965 3.12810   1.000 60.38001  ? 761 HOH B O   1 
HETATM 2913 O O   . HOH D 3 .   ? -26.18908 -60.74354 -13.65872 1.000 42.39899  ? 762 HOH B O   1 
HETATM 2914 O O   . HOH D 3 .   ? -31.93242 -39.61297 -14.28400 1.000 25.68662  ? 763 HOH B O   1 
HETATM 2915 O O   . HOH D 3 .   ? -31.58469 -52.68128 -22.70959 1.000 41.76842  ? 764 HOH B O   1 
HETATM 2916 O O   . HOH D 3 .   ? -22.78662 -39.53410 -12.89930 1.000 62.61171  ? 765 HOH B O   1 
HETATM 2917 O O   . HOH D 3 .   ? -24.92430 -54.36282 2.83526   1.000 51.54155  ? 766 HOH B O   1 
HETATM 2918 O O   . HOH D 3 .   ? -20.72793 -43.53404 -11.34291 1.000 38.67221  ? 767 HOH B O   1 
HETATM 2919 O O   . HOH D 3 .   ? -42.312   -36.988   -14.269   1.000 33.49980  ? 768 HOH B O   1 
HETATM 2920 O O   . HOH D 3 .   ? -39.90951 -34.89365 -11.59257 1.000 45.62865  ? 769 HOH B O   1 
HETATM 2921 O O   . HOH D 3 .   ? -10.30619 -34.82826 20.59990  1.000 54.39790  ? 770 HOH B O   1 
HETATM 2922 O O   . HOH D 3 .   ? -53.917   -52.747   -19.118   1.000 48.11880  ? 771 HOH B O   1 
HETATM 2923 O O   . HOH D 3 .   ? -37.961   -37.312   9.557     1.000 67.89287  ? 772 HOH B O   1 
HETATM 2924 O O   . HOH D 3 .   ? -49.69095 -52.63936 -13.15115 1.000 44.22666  ? 773 HOH B O   1 
HETATM 2925 O O   . HOH D 3 .   ? -22.99074 -58.45186 -6.10275  1.000 35.04961  ? 774 HOH B O   1 
HETATM 2926 O O   . HOH D 3 .   ? -34.54244 -35.17559 5.49174   1.000 38.39082  ? 775 HOH B O   1 
HETATM 2927 O O   . HOH D 3 .   ? -32.130   -40.403   13.563    1.000 63.40025  ? 776 HOH B O   1 
HETATM 2928 O O   . HOH D 3 .   ? -37.20252 -41.01904 3.31808   1.000 47.38303  ? 777 HOH B O   1 
HETATM 2929 O O   . HOH D 3 .   ? -17.93166 -47.72628 0.42376   1.000 46.48853  ? 778 HOH B O   1 
HETATM 2930 O O   . HOH D 3 .   ? -37.00495 -32.17009 -16.54452 1.000 67.21390  ? 779 HOH B O   1 
HETATM 2931 O O   . HOH D 3 .   ? -33.84284 -55.82023 -2.66399  1.000 41.77597  ? 780 HOH B O   1 
HETATM 2932 O O   . HOH D 3 .   ? -34.36289 -51.12827 -27.28533 1.000 53.87479  ? 781 HOH B O   1 
HETATM 2933 O O   . HOH D 3 .   ? -48.76721 -52.54399 -9.95899  1.000 54.85731  ? 782 HOH B O   1 
HETATM 2934 O O   . HOH D 3 .   ? -21.33409 -35.79862 -9.45985  1.000 49.12245  ? 783 HOH B O   1 
HETATM 2935 O O   . HOH D 3 .   ? -29.688   -41.041   11.987    1.000 56.99709  ? 784 HOH B O   1 
HETATM 2936 O O   . HOH D 3 .   ? -41.96561 -43.74193 -10.67147 1.000 58.64442  ? 785 HOH B O   1 
HETATM 2937 O O   . HOH D 3 .   ? -37.934   -36.703   -7.755    1.000 44.16117  ? 786 HOH B O   1 
HETATM 2938 O O   . HOH D 3 .   ? -34.01141 -57.18929 -19.20065 1.000 34.84768  ? 787 HOH B O   1 
HETATM 2939 O O   . HOH D 3 .   ? -40.78138 -58.89547 -8.34328  1.000 30.74493  ? 788 HOH B O   1 
HETATM 2940 O O   . HOH D 3 .   ? -20.70540 -43.85008 -8.56562  1.000 40.27288  ? 789 HOH B O   1 
HETATM 2941 O O   . HOH D 3 .   ? -40.860   -45.980   -6.039    1.000 44.93825  ? 790 HOH B O   1 
HETATM 2942 O O   . HOH D 3 .   ? -39.14550 -38.77518 0.00000   0.50  59.04812  ? 791 HOH B O   1 
HETATM 2943 O O   . HOH D 3 .   ? -45.54149 -55.91407 -4.84609  1.000 33.62172  ? 792 HOH B O   1 
HETATM 2944 O O   . HOH D 3 .   ? -13.35140 -35.74233 -0.79895  1.000 59.81401  ? 793 HOH B O   1 
HETATM 2945 O O   . HOH D 3 .   ? -25.23703 -26.40005 8.62115   1.000 54.88364  ? 794 HOH B O   1 
HETATM 2946 O O   . HOH D 3 .   ? -11.26802 -47.08657 4.12029   1.000 66.80562  ? 795 HOH B O   1 
HETATM 2947 O O   . HOH D 3 .   ? -20.89078 -31.96552 -5.45542  1.000 46.82151  ? 796 HOH B O   1 
HETATM 2948 O O   . HOH D 3 .   ? -12.02102 -49.43858 5.72894   1.000 60.57154  ? 797 HOH B O   1 
HETATM 2949 O O   . HOH D 3 .   ? -3.42923  -41.07156 3.69488   1.000 66.94577  ? 798 HOH B O   1 
HETATM 2950 O O   . HOH D 3 .   ? -32.74851 -43.35929 -33.30568 1.000 58.66671  ? 799 HOH B O   1 
HETATM 2951 O O   . HOH D 3 .   ? -33.96129 -45.93207 -31.76578 1.000 55.60269  ? 800 HOH B O   1 
HETATM 2952 O O   . HOH D 3 .   ? -35.89696 -34.14819 9.45700   1.000 59.56569  ? 801 HOH B O   1 
HETATM 2953 O O   . HOH D 3 .   ? -36.79754 -43.03388 6.47106   1.000 46.18235  ? 802 HOH B O   1 
HETATM 2954 O O   . HOH D 3 .   ? -17.07176 -58.11052 -7.61919  1.000 51.30490  ? 803 HOH B O   1 
HETATM 2955 O O   . HOH D 3 .   ? -31.40347 -42.75026 -30.43572 1.000 56.93785  ? 804 HOH B O   1 
HETATM 2956 O O   . HOH D 3 .   ? -11.24109 -45.31730 -1.45155  1.000 54.21198  ? 805 HOH B O   1 
HETATM 2957 O O   . HOH D 3 .   ? -30.54517 -27.45207 0.92275   1.000 49.74102  ? 806 HOH B O   1 
HETATM 2958 O O   . HOH D 3 .   ? -34.840   -46.615   9.890     1.000 42.01519  ? 807 HOH B O   1 
HETATM 2959 O O   . HOH D 3 .   ? -39.712   -42.636   -4.910    1.000 43.43552  ? 808 HOH B O   1 
HETATM 2960 O O   . HOH D 3 .   ? -19.89226 -53.95582 9.65138   1.000 56.33847  ? 809 HOH B O   1 
HETATM 2961 O O   . HOH D 3 .   ? -54.007   -54.636   -17.091   1.000 41.22959  ? 810 HOH B O   1 
HETATM 2962 O O   . HOH D 3 .   ? -45.34617 -39.53222 -15.99834 1.000 44.16151  ? 811 HOH B O   1 
HETATM 2963 O O   . HOH D 3 .   ? -38.18041 -40.15435 -9.16472  1.000 34.62084  ? 812 HOH B O   1 
HETATM 2964 O O   . HOH D 3 .   ? -30.00134 -57.01571 -2.45099  1.000 42.10591  ? 813 HOH B O   1 
HETATM 2965 O O   . HOH D 3 .   ? -44.050   -60.876   -7.082    1.000 51.32041  ? 814 HOH B O   1 
HETATM 2966 O O   . HOH D 3 .   ? -17.13292 -42.68246 -1.83830  1.000 58.60080  ? 815 HOH B O   1 
HETATM 2967 O O   . HOH D 3 .   ? -28.18231 -55.21068 2.20414   1.000 42.83138  ? 816 HOH B O   1 
HETATM 2968 O O   . HOH D 3 .   ? -52.129   -55.972   -13.962   1.000 59.81166  ? 817 HOH B O   1 
HETATM 2969 O O   . HOH D 3 .   ? -36.18307 -45.00845 8.23915   1.000 37.05777  ? 818 HOH B O   1 
HETATM 2970 O O   . HOH D 3 .   ? -36.80392 -58.51836 -10.06098 1.000 39.23946  ? 819 HOH B O   1 
HETATM 2971 O O   . HOH D 3 .   ? -40.43734 -58.50363 -5.25395  1.000 40.95048  ? 820 HOH B O   1 
HETATM 2972 O O   . HOH D 3 .   ? -45.68675 -45.53452 -11.26952 1.000 35.24847  ? 821 HOH B O   1 
HETATM 2973 O O   . HOH D 3 .   ? -31.29169 -31.56162 -24.18197 1.000 72.04217  ? 822 HOH B O   1 
HETATM 2974 O O   . HOH D 3 .   ? -36.057   -34.353   -8.123    1.000 50.99873  ? 823 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 3   ? 1.08369 1.65537 1.54532 0.05275  0.04859  0.79172  499 ARG A N   
2    C CA  . ARG A 3   ? 1.16867 1.63212 1.54634 0.06069  0.08899  0.75758  499 ARG A CA  
3    C C   . ARG A 3   ? 1.21423 1.63493 1.53356 0.01961  0.09230  0.70732  499 ARG A C   
4    O O   . ARG A 3   ? 1.24942 1.59835 1.49157 0.00459  0.09557  0.67647  499 ARG A O   
5    C CB  . ARG A 3   ? 1.19374 1.62528 1.59691 0.10884  0.15112  0.76840  499 ARG A CB  
6    C CG  . ARG A 3   ? 1.19699 1.51469 1.51316 0.10964  0.19131  0.72851  499 ARG A CG  
7    C CD  . ARG A 3   ? 1.29358 1.55849 1.61934 0.15882  0.24996  0.73897  499 ARG A CD  
8    N NE  . ARG A 3   ? 1.37676 1.53542 1.61636 0.14579  0.28461  0.69105  499 ARG A NE  
9    C CZ  . ARG A 3   ? 1.43677 1.57006 1.64747 0.13318  0.31463  0.65499  499 ARG A CZ  
10   N NH1 . ARG A 3   ? 1.38493 1.58679 1.64612 0.13513  0.32066  0.66380  499 ARG A NH1 
11   N NH2 . ARG A 3   ? 1.50561 1.54709 1.63645 0.11671  0.33802  0.61201  499 ARG A NH2 
12   N N   . LYS A 4   ? 1.22268 1.69199 1.58448 0.00137  0.09105  0.70336  500 LYS A N   
13   C CA  . LYS A 4   ? 1.20061 1.63662 1.51521 -0.03435 0.09199  0.66393  500 LYS A CA  
14   C C   . LYS A 4   ? 1.07772 1.50299 1.34872 -0.07282 0.04640  0.64417  500 LYS A C   
15   O O   . LYS A 4   ? 1.11993 1.50805 1.34706 -0.09757 0.04842  0.61241  500 LYS A O   
16   C CB  . LYS A 4   ? 1.23473 1.72481 1.60746 -0.04390 0.10292  0.67169  500 LYS A CB  
17   C CG  . LYS A 4   ? 1.30655 1.78125 1.68865 -0.01190 0.16115  0.67419  500 LYS A CG  
18   C CD  . LYS A 4   ? 1.35667 1.73882 1.64569 -0.01301 0.18797  0.63459  500 LYS A CD  
19   C CE  . LYS A 4   ? 1.46095 1.79890 1.73859 0.02897  0.23697  0.63714  500 LYS A CE  
20   N NZ  . LYS A 4   ? 1.47450 1.81049 1.77267 0.05436  0.22569  0.66193  500 LYS A NZ  
21   N N   . ALA A 5   ? 0.89323 1.35061 1.17340 -0.07695 0.00656  0.66310  501 ALA A N   
22   C CA  . ALA A 5   ? 0.85984 1.29758 1.08557 -0.11138 -0.03136 0.64077  501 ALA A CA  
23   C C   . ALA A 5   ? 0.92838 1.28657 1.07214 -0.10833 -0.01442 0.61637  501 ALA A C   
24   O O   . ALA A 5   ? 0.87576 1.19869 0.97158 -0.13449 -0.02081 0.58508  501 ALA A O   
25   C CB  . ALA A 5   ? 0.86875 1.36293 1.11557 -0.11787 -0.07973 0.66743  501 ALA A CB  
26   N N   . GLU A 6   ? 0.99654 1.32471 1.12828 -0.07644 0.00989  0.63183  502 GLU A N   
27   C CA  . GLU A 6   ? 1.11562 1.37091 1.17645 -0.07777 0.02607  0.61223  502 GLU A CA  
28   C C   . GLU A 6   ? 1.00868 1.21000 1.04990 -0.07488 0.06840  0.58587  502 GLU A C   
29   O O   . GLU A 6   ? 1.03982 1.18952 1.02918 -0.08863 0.07752  0.56159  502 GLU A O   
30   C CB  . GLU A 6   ? 1.30874 1.55010 1.35662 -0.05077 0.02589  0.64437  502 GLU A CB  
31   C CG  . GLU A 6   ? 1.36477 1.54326 1.33738 -0.06115 0.02936  0.62637  502 GLU A CG  
32   C CD  . GLU A 6   ? 1.36246 1.55806 1.29353 -0.08978 -0.00915 0.61720  502 GLU A CD  
33   O OE1 . GLU A 6   ? 1.37563 1.52292 1.24909 -0.10300 -0.00017 0.59078  502 GLU A OE1 
34   O OE2 . GLU A 6   ? 1.34859 1.60410 1.30473 -0.09986 -0.04683 0.63251  502 GLU A OE2 
35   N N   . ILE A 7   ? 0.94800 1.16233 1.02735 -0.05953 0.09415  0.58889  503 ILE A N   
36   C CA  . ILE A 7   ? 0.90117 1.07540 0.95217 -0.06903 0.12296  0.55728  503 ILE A CA  
37   C C   . ILE A 7   ? 0.88247 1.06795 0.91708 -0.10343 0.10060  0.53393  503 ILE A C   
38   O O   . ILE A 7   ? 0.84850 0.99479 0.84160 -0.11882 0.10719  0.50392  503 ILE A O   
39   C CB  . ILE A 7   ? 0.89800 1.08809 0.98531 -0.04689 0.15537  0.56531  503 ILE A CB  
40   C CG1 . ILE A 7   ? 0.99825 1.14664 1.08513 -0.01020 0.19186  0.57766  503 ILE A CG1 
41   C CG2 . ILE A 7   ? 0.88812 1.05890 0.94462 -0.06527 0.17157  0.53511  503 ILE A CG2 
42   C CD1 . ILE A 7   ? 0.99559 1.12631 1.08726 0.01049  0.23857  0.56987  503 ILE A CD1 
43   N N   . MET A 8   ? 0.82459 1.06270 0.89545 -0.11558 0.07206  0.54527  504 MET A N   
44   C CA  . MET A 8   ? 0.79906 1.04019 0.85679 -0.14568 0.05123  0.52572  504 MET A CA  
45   C C   . MET A 8   ? 0.80983 1.01558 0.81778 -0.15858 0.03725  0.50669  504 MET A C   
46   O O   . MET A 8   ? 0.79864 0.97983 0.78207 -0.17222 0.03935  0.47903  504 MET A O   
47   C CB  . MET A 8   ? 0.90928 1.20625 1.01733 -0.15870 0.02415  0.54144  504 MET A CB  
48   C CG  . MET A 8   ? 0.96433 1.25785 1.06167 -0.19036 -0.00067 0.52344  504 MET A CG  
49   S SD  . MET A 8   ? 1.01957 1.28618 1.10418 -0.20317 0.01487  0.50042  504 MET A SD  
50   C CE  . MET A 8   ? 0.86927 1.13996 0.96677 -0.17791 0.04990  0.50103  504 MET A CE  
51   N N   . GLU A 9   ? 0.96979 1.17497 0.96340 -0.15177 0.02433  0.52263  505 GLU A N   
52   C CA  . GLU A 9   ? 0.93783 1.10912 0.87827 -0.16336 0.01718  0.50784  505 GLU A CA  
53   C C   . GLU A 9   ? 0.88602 1.00607 0.79654 -0.15676 0.04664  0.48515  505 GLU A C   
54   O O   . GLU A 9   ? 0.86937 0.96442 0.74755 -0.16945 0.04918  0.46478  505 GLU A O   
55   C CB  . GLU A 9   ? 1.02828 1.21176 0.95277 -0.15642 -0.00482 0.53083  505 GLU A CB  
56   C CG  . GLU A 9   ? 1.19639 1.37023 1.07208 -0.17818 -0.02792 0.51559  505 GLU A CG  
57   C CD  . GLU A 9   ? 1.30023 1.50822 1.19604 -0.20070 -0.05977 0.50703  505 GLU A CD  
58   O OE1 . GLU A 9   ? 1.37504 1.56829 1.22525 -0.21993 -0.07779 0.48974  505 GLU A OE1 
59   O OE2 . GLU A 9   ? 1.27843 1.52388 1.23335 -0.20068 -0.06402 0.51661  505 GLU A OE2 
60   N N   . SER A 10  ? 0.87378 0.97840 0.79615 -0.13963 0.07088  0.49073  506 SER A N   
61   C CA  . SER A 10  ? 0.89266 0.94677 0.78595 -0.14151 0.09715  0.47242  506 SER A CA  
62   C C   . SER A 10  ? 0.86543 0.91807 0.75526 -0.16025 0.10132  0.44445  506 SER A C   
63   O O   . SER A 10  ? 0.87136 0.89992 0.73935 -0.17406 0.10818  0.42698  506 SER A O   
64   C CB  . SER A 10  ? 0.92677 0.95625 0.82746 -0.11963 0.12419  0.48995  506 SER A CB  
65   O OG  . SER A 10  ? 1.17781 1.16863 1.05871 -0.12984 0.14994  0.47079  506 SER A OG  
66   N N   . ILE A 11  ? 0.83937 0.92204 0.75383 -0.16085 0.09716  0.44374  507 ILE A N   
67   C CA  . ILE A 11  ? 0.82041 0.90550 0.72989 -0.17590 0.09757  0.42288  507 ILE A CA  
68   C C   . ILE A 11  ? 0.79798 0.89505 0.70981 -0.18849 0.07891  0.41240  507 ILE A C   
69   O O   . ILE A 11  ? 0.78883 0.88510 0.69664 -0.19910 0.07980  0.39873  507 ILE A O   
70   C CB  . ILE A 11  ? 0.80995 0.91926 0.73809 -0.17162 0.10223  0.42760  507 ILE A CB  
71   C CG1 . ILE A 11  ? 0.78272 0.93031 0.74620 -0.17255 0.08226  0.43772  507 ILE A CG1 
72   C CG2 . ILE A 11  ? 0.83981 0.93939 0.76832 -0.15469 0.12786  0.44268  507 ILE A CG2 
73   C CD1 . ILE A 11  ? 0.77684 0.94779 0.76035 -0.16930 0.08992  0.44401  507 ILE A CD1 
74   N N   . LYS A 12  ? 0.79682 0.90598 0.71387 -0.18891 0.06271  0.42211  508 LYS A N   
75   C CA  . LYS A 12  ? 0.79277 0.90115 0.70132 -0.20183 0.05230  0.41365  508 LYS A CA  
76   C C   . LYS A 12  ? 0.95907 1.04162 0.83924 -0.20499 0.06477  0.40353  508 LYS A C   
77   O O   . LYS A 12  ? 0.89480 0.97646 0.77481 -0.21328 0.06892  0.39360  508 LYS A O   
78   C CB  . LYS A 12  ? 0.80413 0.92698 0.71268 -0.20904 0.03147  0.42843  508 LYS A CB  
79   C CG  . LYS A 12  ? 0.78963 0.93187 0.72589 -0.22150 0.01829  0.43215  508 LYS A CG  
80   C CD  . LYS A 12  ? 0.80801 0.96890 0.75275 -0.23000 -0.00698 0.44169  508 LYS A CD  
81   C CE  . LYS A 12  ? 0.83442 0.97468 0.75984 -0.24817 -0.02064 0.42266  508 LYS A CE  
82   N NZ  . LYS A 12  ? 0.92994 1.09217 0.87610 -0.26536 -0.04889 0.42794  508 LYS A NZ  
83   N N   . ARG A 13  ? 0.83738 0.89986 0.69807 -0.19757 0.07379  0.41005  509 ARG A N   
84   C CA  . ARG A 13  ? 0.95926 0.99593 0.79646 -0.20217 0.09002  0.40312  509 ARG A CA  
85   C C   . ARG A 13  ? 0.92550 0.95188 0.77226 -0.21014 0.10623  0.39189  509 ARG A C   
86   O O   . ARG A 13  ? 0.93723 0.95189 0.77778 -0.22014 0.11969  0.38599  509 ARG A O   
87   C CB  . ARG A 13  ? 0.90190 0.91604 0.71121 -0.19195 0.09390  0.41904  509 ARG A CB  
88   C CG  . ARG A 13  ? 0.92367 0.94722 0.70604 -0.19268 0.07649  0.42975  509 ARG A CG  
89   C CD  . ARG A 13  ? 0.97047 0.97762 0.72442 -0.17965 0.07618  0.45103  509 ARG A CD  
90   N NE  . ARG A 13  ? 0.97093 1.00553 0.74317 -0.16786 0.05402  0.47442  509 ARG A NE  
91   C CZ  . ARG A 13  ? 0.98185 1.01039 0.77366 -0.14838 0.06212  0.49283  509 ARG A CZ  
92   N NH1 . ARG A 13  ? 1.00901 0.99499 0.79538 -0.14314 0.09101  0.48757  509 ARG A NH1 
93   N NH2 . ARG A 13  ? 0.98181 1.04705 0.80128 -0.13556 0.04257  0.51932  509 ARG A NH2 
94   N N   . LEU A 14  ? 0.84543 0.87824 0.70521 -0.20936 0.10586  0.39077  510 LEU A N   
95   C CA  . LEU A 14  ? 0.95101 0.97584 0.81001 -0.22485 0.11689  0.38140  510 LEU A CA  
96   C C   . LEU A 14  ? 0.90268 0.96236 0.78144 -0.23715 0.10561  0.37324  510 LEU A C   
97   O O   . LEU A 14  ? 0.83311 0.89907 0.71605 -0.25680 0.10902  0.36748  510 LEU A O   
98   C CB  . LEU A 14  ? 0.87201 0.88285 0.72228 -0.22063 0.12610  0.38656  510 LEU A CB  
99   C CG  . LEU A 14  ? 0.92173 0.89401 0.74974 -0.23820 0.14546  0.37927  510 LEU A CG  
100  C CD1 . LEU A 14  ? 0.94544 0.88616 0.76592 -0.24782 0.15780  0.38183  510 LEU A CD1 
101  C CD2 . LEU A 14  ? 0.97197 0.91237 0.78591 -0.22056 0.16291  0.38034  510 LEU A CD2 
102  N N   . TYR A 15  ? 0.85410 0.93824 0.74852 -0.22811 0.09155  0.37642  511 TYR A N   
103  C CA  . TYR A 15  ? 0.85435 0.96955 0.77097 -0.23428 0.08186  0.37644  511 TYR A CA  
104  C C   . TYR A 15  ? 0.83210 0.95158 0.75944 -0.22769 0.07756  0.38026  511 TYR A C   
105  O O   . TYR A 15  ? 0.77844 0.90641 0.71730 -0.22237 0.06760  0.38601  511 TYR A O   
106  C CB  . TYR A 15  ? 0.88250 1.01432 0.80230 -0.23233 0.07371  0.38072  511 TYR A CB  
107  C CG  . TYR A 15  ? 0.88999 1.00687 0.78364 -0.23988 0.08336  0.37764  511 TYR A CG  
108  C CD1 . TYR A 15  ? 0.80786 0.90819 0.69009 -0.22679 0.09294  0.38199  511 TYR A CD1 
109  C CD2 . TYR A 15  ? 0.82812 0.94783 0.70862 -0.26388 0.08480  0.37272  511 TYR A CD2 
110  C CE1 . TYR A 15  ? 0.84519 0.92354 0.69754 -0.23344 0.10948  0.38117  511 TYR A CE1 
111  C CE2 . TYR A 15  ? 0.85864 0.95041 0.70565 -0.27183 0.09504  0.35970  511 TYR A CE2 
112  C CZ  . TYR A 15  ? 0.87509 0.94121 0.70503 -0.25445 0.11022  0.36284  511 TYR A CZ  
113  O OH  . TYR A 15  ? 0.95831 0.98650 0.75082 -0.25867 0.12698  0.34655  511 TYR A OH  
114  N N   . PRO A 16  ? 0.89151 1.00087 0.81138 -0.23056 0.08830  0.37847  512 PRO A N   
115  C CA  . PRO A 16  ? 0.78797 0.89317 0.70465 -0.22839 0.08953  0.38267  512 PRO A CA  
116  C C   . PRO A 16  ? 0.77419 0.90010 0.72468 -0.22603 0.08775  0.38663  512 PRO A C   
117  O O   . PRO A 16  ? 0.86189 1.01507 0.83981 -0.22868 0.08920  0.39042  512 PRO A O   
118  C CB  . PRO A 16  ? 0.90368 0.99493 0.80042 -0.23181 0.10893  0.38055  512 PRO A CB  
119  C CG  . PRO A 16  ? 0.82276 0.90190 0.71033 -0.23431 0.11420  0.37633  512 PRO A CG  
120  C CD  . PRO A 16  ? 0.82305 0.92118 0.73419 -0.23882 0.10387  0.37416  512 PRO A CD  
121  N N   . GLY A 17  ? 0.78326 0.89486 0.73356 -0.22046 0.08221  0.38481  513 GLY A N   
122  C CA  . GLY A 17  ? 0.83592 0.95628 0.81946 -0.21309 0.08062  0.39055  513 GLY A CA  
123  C C   . GLY A 17  ? 0.90085 1.04351 0.90382 -0.21416 0.06629  0.40609  513 GLY A C   
124  O O   . GLY A 17  ? 0.88320 1.02777 0.91088 -0.20713 0.06383  0.41645  513 GLY A O   
125  N N   . SER A 18  ? 0.74364 0.89717 0.73303 -0.21948 0.05994  0.40628  514 SER A N   
126  C CA  . SER A 18  ? 0.76497 0.93666 0.76186 -0.21651 0.05059  0.41247  514 SER A CA  
127  C C   . SER A 18  ? 0.76866 0.93143 0.75956 -0.21357 0.04605  0.41192  514 SER A C   
128  O O   . SER A 18  ? 0.73456 0.90845 0.73562 -0.20999 0.04237  0.42154  514 SER A O   
129  C CB  . SER A 18  ? 0.73515 0.92300 0.71902 -0.22365 0.05065  0.40742  514 SER A CB  
130  O OG  . SER A 18  ? 0.83024 1.04902 0.83569 -0.22937 0.04746  0.41888  514 SER A OG  
131  N N   . VAL A 19  ? 0.67119 0.79426 0.58731 -0.16119 0.11188  0.27631  515 VAL A N   
132  C CA  . VAL A 19  ? 0.60029 0.70987 0.49882 -0.15086 0.11047  0.27202  515 VAL A CA  
133  C C   . VAL A 19  ? 0.65160 0.76091 0.55438 -0.13855 0.11350  0.27137  515 VAL A C   
134  O O   . VAL A 19  ? 0.60268 0.69523 0.49300 -0.13596 0.12225  0.26953  515 VAL A O   
135  C CB  . VAL A 19  ? 0.62487 0.70333 0.49166 -0.15130 0.11802  0.26750  515 VAL A CB  
136  C CG1 . VAL A 19  ? 0.62349 0.68890 0.47634 -0.13852 0.11792  0.26527  515 VAL A CG1 
137  C CG2 . VAL A 19  ? 0.63960 0.71477 0.49809 -0.16523 0.11633  0.26710  515 VAL A CG2 
138  N N   . TYR A 20  ? 0.60232 0.72897 0.52100 -0.13219 0.10668  0.27289  516 TYR A N   
139  C CA  . TYR A 20  ? 0.62531 0.75056 0.54612 -0.12301 0.11020  0.27198  516 TYR A CA  
140  C C   . TYR A 20  ? 0.73819 0.84637 0.63652 -0.11456 0.10922  0.26881  516 TYR A C   
141  O O   . TYR A 20  ? 0.80620 0.90301 0.69370 -0.11037 0.11381  0.26769  516 TYR A O   
142  C CB  . TYR A 20  ? 0.56827 0.71719 0.51518 -0.11978 0.10537  0.27515  516 TYR A CB  
143  C CG  . TYR A 20  ? 0.70500 0.87582 0.68072 -0.12649 0.10476  0.28138  516 TYR A CG  
144  C CD1 . TYR A 20  ? 0.78236 0.95685 0.77451 -0.12603 0.11445  0.28392  516 TYR A CD1 
145  C CD2 . TYR A 20  ? 0.83036 1.01820 0.81741 -0.13371 0.09462  0.28567  516 TYR A CD2 
146  C CE1 . TYR A 20  ? 0.86740 1.06453 0.89128 -0.13083 0.11386  0.29195  516 TYR A CE1 
147  C CE2 . TYR A 20  ? 0.91462 1.12625 0.93081 -0.14026 0.09161  0.29408  516 TYR A CE2 
148  C CZ  . TYR A 20  ? 0.91031 1.12780 0.94721 -0.13780 0.10114  0.29790  516 TYR A CZ  
149  O OH  . TYR A 20  ? 0.90223 1.14515 0.97246 -0.14296 0.09820  0.30837  516 TYR A OH  
150  N N   . GLY A 21  ? 0.67590 0.78182 0.56709 -0.11270 0.10361  0.26820  517 GLY A N   
151  C CA  . GLY A 21  ? 0.67917 0.77023 0.55273 -0.10467 0.10305  0.26750  517 GLY A CA  
152  C C   . GLY A 21  ? 0.68027 0.78293 0.56196 -0.09889 0.09508  0.26812  517 GLY A C   
153  O O   . GLY A 21  ? 0.72523 0.84554 0.62351 -0.10139 0.08992  0.26840  517 GLY A O   
154  N N   . ARG A 22  ? 0.62334 0.71619 0.49394 -0.09116 0.09408  0.26948  518 ARG A N   
155  C CA  . ARG A 22  ? 0.55418 0.65716 0.43276 -0.08467 0.08749  0.27087  518 ARG A CA  
156  C C   . ARG A 22  ? 0.65796 0.77958 0.55158 -0.08230 0.08187  0.27084  518 ARG A C   
157  O O   . ARG A 22  ? 0.63967 0.75905 0.52955 -0.08251 0.08378  0.27083  518 ARG A O   
158  C CB  . ARG A 22  ? 0.56650 0.65702 0.43371 -0.07678 0.08809  0.27499  518 ARG A CB  
159  C CG  . ARG A 22  ? 0.78911 0.88741 0.66504 -0.07061 0.08390  0.27736  518 ARG A CG  
160  C CD  . ARG A 22  ? 0.65607 0.74284 0.52508 -0.06254 0.08626  0.28417  518 ARG A CD  
161  N NE  . ARG A 22  ? 0.64690 0.71007 0.49839 -0.06504 0.09591  0.28471  518 ARG A NE  
162  C CZ  . ARG A 22  ? 0.62717 0.67328 0.46888 -0.06845 0.10494  0.28303  518 ARG A CZ  
163  N NH1 . ARG A 22  ? 0.60359 0.65336 0.45052 -0.06982 0.10517  0.28081  518 ARG A NH1 
164  N NH2 . ARG A 22  ? 0.64071 0.66359 0.46472 -0.07167 0.11469  0.28329  518 ARG A NH2 
165  N N   . LEU A 23  ? 0.55538 0.69253 0.46346 -0.08091 0.07635  0.27059  519 LEU A N   
166  C CA  . LEU A 23  ? 0.52430 0.67817 0.44737 -0.07970 0.07287  0.27032  519 LEU A CA  
167  C C   . LEU A 23  ? 0.50608 0.65803 0.42257 -0.07491 0.07092  0.27154  519 LEU A C   
168  O O   . LEU A 23  ? 0.55237 0.70751 0.47096 -0.07666 0.07285  0.27047  519 LEU A O   
169  C CB  . LEU A 23  ? 0.48530 0.65455 0.42344 -0.07899 0.06733  0.27032  519 LEU A CB  
170  C CG  . LEU A 23  ? 0.50504 0.68955 0.45743 -0.07605 0.06437  0.27047  519 LEU A CG  
171  C CD1 . LEU A 23  ? 0.52708 0.71816 0.49100 -0.08024 0.06902  0.27087  519 LEU A CD1 
172  C CD2 . LEU A 23  ? 0.61116 0.80823 0.57524 -0.07392 0.05868  0.27078  519 LEU A CD2 
173  N N   . ILE A 24  ? 0.51284 0.65826 0.42046 -0.06990 0.06803  0.27469  520 ILE A N   
174  C CA  . ILE A 24  ? 0.60751 0.75275 0.50818 -0.06732 0.06400  0.27794  520 ILE A CA  
175  C C   . ILE A 24  ? 0.63556 0.76704 0.51972 -0.07207 0.06872  0.27720  520 ILE A C   
176  O O   . ILE A 24  ? 0.60761 0.73864 0.48455 -0.07488 0.06753  0.27717  520 ILE A O   
177  C CB  . ILE A 24  ? 0.58102 0.72484 0.48033 -0.06049 0.05985  0.28454  520 ILE A CB  
178  C CG1 . ILE A 24  ? 0.62027 0.76966 0.51598 -0.05940 0.05258  0.28995  520 ILE A CG1 
179  C CG2 . ILE A 24  ? 0.54274 0.66874 0.43013 -0.05926 0.06574  0.28700  520 ILE A CG2 
180  C CD1 . ILE A 24  ? 0.68426 0.83703 0.58512 -0.05198 0.04805  0.29959  520 ILE A CD1 
181  N N   . ASP A 25  ? 0.70730 0.82543 0.58311 -0.07450 0.07527  0.27612  521 ASP A N   
182  C CA  . ASP A 25  ? 0.78114 0.88409 0.64034 -0.07926 0.08133  0.27521  521 ASP A CA  
183  C C   . ASP A 25  ? 0.82028 0.92547 0.68530 -0.08500 0.08842  0.27068  521 ASP A C   
184  O O   . ASP A 25  ? 0.92055 1.01278 0.77106 -0.08945 0.09467  0.26947  521 ASP A O   
185  C CB  . ASP A 25  ? 0.58275 0.66985 0.43123 -0.07999 0.08700  0.27585  521 ASP A CB  
186  C CG  . ASP A 25  ? 0.73780 0.81948 0.58094 -0.07349 0.08319  0.28172  521 ASP A CG  
187  O OD1 . ASP A 25  ? 0.75150 0.82513 0.59350 -0.07284 0.08774  0.28166  521 ASP A OD1 
188  O OD2 . ASP A 25  ? 0.74832 0.83366 0.58878 -0.06966 0.07625  0.28723  521 ASP A OD2 
189  N N   . LEU A 26  ? 0.70744 0.82789 0.59332 -0.08512 0.08838  0.26904  522 LEU A N   
190  C CA  . LEU A 26  ? 0.62437 0.74880 0.52149 -0.08939 0.09639  0.26698  522 LEU A CA  
191  C C   . LEU A 26  ? 0.61132 0.74235 0.51367 -0.08881 0.09669  0.26596  522 LEU A C   
192  O O   . LEU A 26  ? 0.55394 0.68440 0.46424 -0.09181 0.10632  0.26461  522 LEU A O   
193  C CB  . LEU A 26  ? 0.52641 0.66526 0.44530 -0.09084 0.09590  0.26792  522 LEU A CB  
194  C CG  . LEU A 26  ? 0.71334 0.84209 0.62314 -0.09407 0.09759  0.26820  522 LEU A CG  
195  C CD1 . LEU A 26  ? 0.70748 0.84951 0.63273 -0.09748 0.09358  0.26967  522 LEU A CD1 
196  C CD2 . LEU A 26  ? 0.75874 0.87373 0.66040 -0.09897 0.10849  0.26731  522 LEU A CD2 
197  N N   . CYS A 27  ? 0.55121 0.68794 0.45046 -0.08528 0.08777  0.26695  523 CYS A N   
198  C CA  . CYS A 27  ? 0.60298 0.74450 0.50531 -0.08614 0.08885  0.26558  523 CYS A CA  
199  C C   . CYS A 27  ? 0.62662 0.76523 0.51247 -0.08614 0.08053  0.26732  523 CYS A C   
200  O O   . CYS A 27  ? 0.62677 0.76346 0.50490 -0.08351 0.07323  0.27086  523 CYS A O   
201  C CB  . CYS A 27  ? 0.68330 0.84484 0.61167 -0.08238 0.08575  0.26599  523 CYS A CB  
202  S SG  . CYS A 27  ? 0.60266 0.77802 0.53844 -0.07620 0.07207  0.26837  523 CYS A SG  
203  N N   . GLN A 28  ? 0.62027 0.75796 0.50092 -0.08985 0.08250  0.26560  524 GLN A N   
204  C CA  . GLN A 28  ? 0.60724 0.74368 0.47171 -0.09289 0.07402  0.26795  524 GLN A CA  
205  C C   . GLN A 28  ? 0.56470 0.70829 0.43497 -0.09512 0.07516  0.26563  524 GLN A C   
206  O O   . GLN A 28  ? 0.56865 0.70535 0.44196 -0.09782 0.08814  0.26123  524 GLN A O   
207  C CB  . GLN A 28  ? 0.59286 0.70705 0.42635 -0.10134 0.07816  0.26783  524 GLN A CB  
208  C CG  . GLN A 28  ? 0.60156 0.71571 0.41669 -0.10732 0.06729  0.27169  524 GLN A CG  
209  C CD  . GLN A 28  ? 0.69233 0.81639 0.50976 -0.10235 0.05236  0.28027  524 GLN A CD  
210  O OE1 . GLN A 28  ? 0.79134 0.91412 0.61531 -0.09567 0.05293  0.28236  524 GLN A OE1 
211  N NE2 . GLN A 28  ? 0.74978 0.88393 0.56320 -0.10599 0.03972  0.28604  524 GLN A NE2 
212  N N   . PRO A 29  ? 0.57915 0.73629 0.45308 -0.09380 0.06329  0.26897  525 PRO A N   
213  C CA  . PRO A 29  ? 0.65225 0.81361 0.52760 -0.09762 0.06498  0.26648  525 PRO A CA  
214  C C   . PRO A 29  ? 0.75065 0.89050 0.59570 -0.11008 0.07268  0.26337  525 PRO A C   
215  O O   . PRO A 29  ? 0.78239 0.91100 0.60518 -0.11587 0.06883  0.26573  525 PRO A O   
216  C CB  . PRO A 29  ? 0.54744 0.72852 0.43314 -0.09401 0.04956  0.27210  525 PRO A CB  
217  C CG  . PRO A 29  ? 0.53823 0.72245 0.42523 -0.08880 0.04102  0.27830  525 PRO A CG  
218  C CD  . PRO A 29  ? 0.54404 0.71421 0.42610 -0.08749 0.04990  0.27553  525 PRO A CD  
219  N N   . THR A 30  ? 0.73855 0.87017 0.58185 -0.11443 0.08531  0.25799  526 THR A N   
220  C CA  . THR A 30  ? 0.78374 0.88797 0.59599 -0.12689 0.09882  0.25329  526 THR A CA  
221  C C   . THR A 30  ? 0.95564 1.05822 0.74185 -0.13824 0.08584  0.25584  526 THR A C   
222  O O   . THR A 30  ? 1.14159 1.22325 0.89697 -0.14909 0.08945  0.25455  526 THR A O   
223  C CB  . THR A 30  ? 0.70703 0.80074 0.52515 -0.12824 0.11815  0.24720  526 THR A CB  
224  O OG1 . THR A 30  ? 0.59827 0.70837 0.42845 -0.12696 0.11074  0.24760  526 THR A OG1 
225  C CG2 . THR A 30  ? 0.64308 0.74046 0.48867 -0.11897 0.12939  0.24638  526 THR A CG2 
226  N N   . GLN A 31  ? 0.89732 1.02286 0.69633 -0.13663 0.06992  0.26019  527 GLN A N   
227  C CA  . GLN A 31  ? 0.94433 1.07456 0.72459 -0.14833 0.05456  0.26462  527 GLN A CA  
228  C C   . GLN A 31  ? 0.98941 1.14844 0.79276 -0.13959 0.03408  0.27490  527 GLN A C   
229  O O   . GLN A 31  ? 0.97852 1.15233 0.81071 -0.12514 0.03339  0.27661  527 GLN A O   
230  C CB  . GLN A 31  ? 0.91027 1.03822 0.68211 -0.15834 0.05815  0.26017  527 GLN A CB  
231  C CG  . GLN A 31  ? 0.96642 1.07036 0.73194 -0.15978 0.08365  0.25025  527 GLN A CG  
232  C CD  . GLN A 31  ? 1.14407 1.23418 0.88613 -0.17509 0.08959  0.24474  527 GLN A CD  
233  O OE1 . GLN A 31  ? 1.27953 1.36329 0.99257 -0.19134 0.07931  0.24546  527 GLN A OE1 
234  N NE2 . GLN A 31  ? 1.16059 1.24564 0.91493 -0.17099 0.10592  0.23932  527 GLN A NE2 
235  N N   . LYS A 32  ? 0.99188 1.15834 0.78291 -0.14912 0.01800  0.28237  528 LYS A N   
236  C CA  . LYS A 32  ? 0.91141 1.10471 0.72758 -0.14016 0.00100  0.29413  528 LYS A CA  
237  C C   . LYS A 32  ? 0.83168 1.04796 0.67449 -0.13444 -0.00361 0.29614  528 LYS A C   
238  O O   . LYS A 32  ? 0.82046 1.05554 0.69230 -0.12080 -0.00889 0.30260  528 LYS A O   
239  C CB  . LYS A 32  ? 0.95747 1.15538 0.75796 -0.15193 -0.01543 0.30415  528 LYS A CB  
240  C CG  . LYS A 32  ? 0.93951 1.15871 0.76639 -0.13970 -0.02784 0.31778  528 LYS A CG  
241  C CD  . LYS A 32  ? 0.93827 1.17616 0.76585 -0.15009 -0.04728 0.33150  528 LYS A CD  
242  C CE  . LYS A 32  ? 0.93136 1.18140 0.77782 -0.13928 -0.05561 0.34578  528 LYS A CE  
243  N NZ  . LYS A 32  ? 0.88498 1.14389 0.76437 -0.11800 -0.04783 0.34701  528 LYS A NZ  
244  N N   . LYS A 33  ? 0.78234 0.99464 0.61447 -0.14474 0.00050  0.29017  529 LYS A N   
245  C CA  . LYS A 33  ? 0.73130 0.96347 0.58613 -0.14055 -0.00272 0.29142  529 LYS A CA  
246  C C   . LYS A 33  ? 0.73425 0.97317 0.61799 -0.12254 0.00588  0.28820  529 LYS A C   
247  O O   . LYS A 33  ? 0.76968 1.02825 0.67754 -0.11518 0.00094  0.29194  529 LYS A O   
248  C CB  . LYS A 33  ? 0.72583 0.94537 0.55949 -0.15527 0.00473  0.28325  529 LYS A CB  
249  C CG  . LYS A 33  ? 0.68440 0.87299 0.49751 -0.15816 0.02605  0.27122  529 LYS A CG  
250  C CD  . LYS A 33  ? 0.62453 0.79621 0.41581 -0.17250 0.03703  0.26277  529 LYS A CD  
251  C CE  . LYS A 33  ? 0.59852 0.78635 0.41401 -0.16563 0.03829  0.26198  529 LYS A CE  
252  N NZ  . LYS A 33  ? 0.68336 0.84863 0.47966 -0.17634 0.05580  0.25178  529 LYS A NZ  
253  N N   . TYR A 34  ? 0.66456 0.88772 0.54607 -0.11647 0.01833  0.28184  530 TYR A N   
254  C CA  . TYR A 34  ? 0.50875 0.73668 0.41439 -0.10263 0.02591  0.27845  530 TYR A CA  
255  C C   . TYR A 34  ? 0.48797 0.72308 0.40872 -0.09130 0.02097  0.28364  530 TYR A C   
256  O O   . TYR A 34  ? 0.55622 0.79370 0.49352 -0.08193 0.02622  0.28091  530 TYR A O   
257  C CB  . TYR A 34  ? 0.52323 0.73130 0.42039 -0.10415 0.04295  0.26965  530 TYR A CB  
258  C CG  . TYR A 34  ? 0.51994 0.71788 0.40709 -0.11233 0.05355  0.26349  530 TYR A CG  
259  C CD1 . TYR A 34  ? 0.58324 0.79462 0.48565 -0.10969 0.05165  0.26327  530 TYR A CD1 
260  C CD2 . TYR A 34  ? 0.58800 0.75982 0.44963 -0.12256 0.06804  0.25753  530 TYR A CD2 
261  C CE1 . TYR A 34  ? 0.67425 0.87377 0.56710 -0.11696 0.06346  0.25727  530 TYR A CE1 
262  C CE2 . TYR A 34  ? 0.63130 0.78927 0.48265 -0.13000 0.08151  0.25134  530 TYR A CE2 
263  C CZ  . TYR A 34  ? 0.72377 0.89579 0.59097 -0.12711 0.07902  0.25121  530 TYR A CZ  
264  O OH  . TYR A 34  ? 0.87127 1.02733 0.72812 -0.13422 0.09420  0.24480  530 TYR A OH  
265  N N   . GLN A 35  ? 0.49991 0.73773 0.41484 -0.09274 0.01137  0.29151  531 GLN A N   
266  C CA  . GLN A 35  ? 0.54793 0.78649 0.47313 -0.08263 0.01036  0.29591  531 GLN A CA  
267  C C   . GLN A 35  ? 0.56978 0.82393 0.52188 -0.07102 0.00866  0.29948  531 GLN A C   
268  O O   . GLN A 35  ? 0.51243 0.76195 0.47267 -0.06321 0.01477  0.29680  531 GLN A O   
269  C CB  . GLN A 35  ? 0.59596 0.83363 0.51006 -0.08642 0.00125  0.30508  531 GLN A CB  
270  C CG  . GLN A 35  ? 0.71766 0.93416 0.61082 -0.08935 0.00737  0.30179  531 GLN A CG  
271  C CD  . GLN A 35  ? 0.80973 1.02172 0.68380 -0.09766 -0.00167 0.30953  531 GLN A CD  
272  O OE1 . GLN A 35  ? 0.79456 1.02292 0.67772 -0.09824 -0.01414 0.32056  531 GLN A OE1 
273  N NE2 . GLN A 35  ? 0.81756 1.00773 0.66633 -0.10428 0.00483  0.30472  531 GLN A NE2 
274  N N   . ILE A 36  ? 0.59778 0.86912 0.56228 -0.07110 0.00115  0.30551  532 ILE A N   
275  C CA  . ILE A 36  ? 0.55350 0.83778 0.54247 -0.06034 0.00115  0.30985  532 ILE A CA  
276  C C   . ILE A 36  ? 0.42672 0.70819 0.42249 -0.05665 0.00933  0.30032  532 ILE A C   
277  O O   . ILE A 36  ? 0.41653 0.69656 0.42309 -0.04846 0.01382  0.29975  532 ILE A O   
278  C CB  . ILE A 36  ? 0.60227 0.90677 0.60401 -0.06240 -0.00854 0.31982  532 ILE A CB  
279  C CG1 . ILE A 36  ? 0.54926 0.86077 0.55330 -0.06291 -0.01737 0.33324  532 ILE A CG1 
280  C CG2 . ILE A 36  ? 0.42350 0.73967 0.44906 -0.05283 -0.00557 0.32197  532 ILE A CG2 
281  C CD1 . ILE A 36  ? 0.48313 0.81687 0.49869 -0.06898 -0.02933 0.34471  532 ILE A CD1 
282  N N   . ALA A 37  ? 0.42644 0.70525 0.41444 -0.06347 0.01210  0.29320  533 ALA A N   
283  C CA  . ALA A 37  ? 0.41131 0.68896 0.40770 -0.06017 0.01922  0.28585  533 ALA A CA  
284  C C   . ALA A 37  ? 0.42517 0.69133 0.41953 -0.05739 0.02583  0.28130  533 ALA A C   
285  O O   . ALA A 37  ? 0.47503 0.74292 0.48031 -0.05234 0.02833  0.27934  533 ALA A O   
286  C CB  . ALA A 37  ? 0.41524 0.69053 0.40407 -0.06773 0.02294  0.28064  533 ALA A CB  
287  N N   . VAL A 38  ? 0.51788 0.77188 0.49708 -0.06195 0.02849  0.28000  534 VAL A N   
288  C CA  . VAL A 38  ? 0.42526 0.66960 0.40331 -0.06033 0.03445  0.27683  534 VAL A CA  
289  C C   . VAL A 38  ? 0.42331 0.66688 0.40576 -0.05433 0.03238  0.28034  534 VAL A C   
290  O O   . VAL A 38  ? 0.45973 0.70061 0.44726 -0.05241 0.03578  0.27786  534 VAL A O   
291  C CB  . VAL A 38  ? 0.47786 0.70772 0.43769 -0.06686 0.03924  0.27494  534 VAL A CB  
292  C CG1 . VAL A 38  ? 0.44613 0.66717 0.40505 -0.06538 0.04419  0.27353  534 VAL A CG1 
293  C CG2 . VAL A 38  ? 0.44880 0.67374 0.40429 -0.07257 0.04701  0.27022  534 VAL A CG2 
294  N N   . THR A 39  ? 0.45097 0.69649 0.43152 -0.05201 0.02731  0.28712  535 THR A N   
295  C CA  . THR A 39  ? 0.48615 0.72830 0.47130 -0.04532 0.02842  0.29170  535 THR A CA  
296  C C   . THR A 39  ? 0.47331 0.71967 0.47081 -0.04094 0.03091  0.29013  535 THR A C   
297  O O   . THR A 39  ? 0.42258 0.65862 0.41738 -0.03958 0.03616  0.28816  535 THR A O   
298  C CB  . THR A 39  ? 0.49640 0.74428 0.48393 -0.04235 0.02277  0.30218  535 THR A CB  
299  O OG1 . THR A 39  ? 0.53649 0.78078 0.50942 -0.04908 0.01869  0.30341  535 THR A OG1 
300  C CG2 . THR A 39  ? 0.45013 0.68920 0.43997 -0.03500 0.02752  0.30805  535 THR A CG2 
301  N N   . LYS A 40  ? 0.40819 0.66758 0.41624 -0.04040 0.02767  0.29045  536 LYS A N   
302  C CA  . LYS A 40  ? 0.39772 0.66045 0.41601 -0.03680 0.02999  0.28916  536 LYS A CA  
303  C C   . LYS A 40  ? 0.39213 0.64980 0.40818 -0.04036 0.03324  0.28154  536 LYS A C   
304  O O   . LYS A 40  ? 0.39394 0.64435 0.40866 -0.03982 0.03668  0.28015  536 LYS A O   
305  C CB  . LYS A 40  ? 0.41672 0.69482 0.44606 -0.03632 0.02563  0.29147  536 LYS A CB  
306  C CG  . LYS A 40  ? 0.45295 0.73426 0.49225 -0.03280 0.02824  0.29024  536 LYS A CG  
307  C CD  . LYS A 40  ? 0.38597 0.65720 0.42583 -0.02725 0.03408  0.29414  536 LYS A CD  
308  C CE  . LYS A 40  ? 0.38022 0.65314 0.42797 -0.02441 0.03739  0.29393  536 LYS A CE  
309  N NZ  . LYS A 40  ? 0.37315 0.66312 0.43615 -0.02111 0.03351  0.30103  536 LYS A NZ  
310  N N   . VAL A 41  ? 0.38807 0.64900 0.40348 -0.04479 0.03274  0.27766  537 VAL A N   
311  C CA  . VAL A 41  ? 0.38200 0.64315 0.40117 -0.04772 0.03488  0.27363  537 VAL A CA  
312  C C   . VAL A 41  ? 0.39140 0.64195 0.40262 -0.05076 0.03739  0.27280  537 VAL A C   
313  O O   . VAL A 41  ? 0.40768 0.65685 0.41995 -0.05358 0.03767  0.27174  537 VAL A O   
314  C CB  . VAL A 41  ? 0.37825 0.64442 0.40114 -0.05043 0.03654  0.27177  537 VAL A CB  
315  C CG1 . VAL A 41  ? 0.37383 0.64228 0.40465 -0.05275 0.03896  0.27093  537 VAL A CG1 
316  C CG2 . VAL A 41  ? 0.37076 0.64571 0.40009 -0.04893 0.03500  0.27184  537 VAL A CG2 
317  N N   . LEU A 42  ? 0.40221 0.64439 0.40350 -0.05159 0.03899  0.27364  538 LEU A N   
318  C CA  . LEU A 42  ? 0.41254 0.64362 0.40519 -0.05522 0.04215  0.27279  538 LEU A CA  
319  C C   . LEU A 42  ? 0.42194 0.64182 0.40690 -0.05419 0.04435  0.27365  538 LEU A C   
320  O O   . LEU A 42  ? 0.42945 0.64123 0.40778 -0.05971 0.04668  0.27189  538 LEU A O   
321  C CB  . LEU A 42  ? 0.53976 0.76265 0.52212 -0.05631 0.04430  0.27345  538 LEU A CB  
322  C CG  . LEU A 42  ? 0.54096 0.76679 0.52464 -0.05948 0.04640  0.27192  538 LEU A CG  
323  C CD1 . LEU A 42  ? 0.43963 0.65254 0.40851 -0.06182 0.04968  0.27226  538 LEU A CD1 
324  C CD2 . LEU A 42  ? 0.41495 0.64801 0.41110 -0.06262 0.04872  0.27089  538 LEU A CD2 
325  N N   . GLY A 43  ? 0.50824 0.72658 0.49354 -0.04804 0.04466  0.27726  539 GLY A N   
326  C CA  . GLY A 43  ? 0.43647 0.64129 0.41496 -0.04633 0.05028  0.27876  539 GLY A CA  
327  C C   . GLY A 43  ? 0.48279 0.66854 0.44563 -0.04894 0.05653  0.27890  539 GLY A C   
328  O O   . GLY A 43  ? 0.54363 0.72736 0.50290 -0.04777 0.05612  0.28093  539 GLY A O   
329  N N   . LYS A 44  ? 0.48083 0.65017 0.43127 -0.05409 0.06300  0.27633  540 LYS A N   
330  C CA  . LYS A 44  ? 0.56930 0.71706 0.50161 -0.05859 0.07073  0.27561  540 LYS A CA  
331  C C   . LYS A 44  ? 0.58926 0.74050 0.51864 -0.06610 0.06723  0.27237  540 LYS A C   
332  O O   . LYS A 44  ? 0.51945 0.65529 0.43548 -0.06914 0.07278  0.27221  540 LYS A O   
333  C CB  . LYS A 44  ? 0.54128 0.66739 0.45653 -0.06541 0.07978  0.27276  540 LYS A CB  
334  C CG  . LYS A 44  ? 0.69402 0.82649 0.60748 -0.07629 0.07432  0.26783  540 LYS A CG  
335  C CD  . LYS A 44  ? 0.88738 1.00931 0.79328 -0.07860 0.07923  0.26643  540 LYS A CD  
336  C CE  . LYS A 44  ? 0.99564 1.11560 0.89070 -0.09320 0.07552  0.26239  540 LYS A CE  
337  N NZ  . LYS A 44  ? 0.97447 1.12485 0.89123 -0.09405 0.06146  0.26335  540 LYS A NZ  
338  N N   . ASN A 45  ? 0.57319 0.74400 0.51610 -0.06869 0.05945  0.27074  541 ASN A N   
339  C CA  . ASN A 45  ? 0.53625 0.71175 0.48062 -0.07463 0.05782  0.26967  541 ASN A CA  
340  C C   . ASN A 45  ? 0.58130 0.75427 0.52355 -0.07011 0.05929  0.27119  541 ASN A C   
341  O O   . ASN A 45  ? 0.62240 0.79182 0.56068 -0.07503 0.06142  0.27040  541 ASN A O   
342  C CB  . ASN A 45  ? 0.45174 0.64865 0.41417 -0.07719 0.05130  0.26976  541 ASN A CB  
343  C CG  . ASN A 45  ? 0.50610 0.70569 0.46850 -0.08550 0.04847  0.26948  541 ASN A CG  
344  O OD1 . ASN A 45  ? 0.55168 0.73876 0.50004 -0.09439 0.05098  0.26862  541 ASN A OD1 
345  N ND2 . ASN A 45  ? 0.49553 0.71009 0.47147 -0.08389 0.04331  0.27042  541 ASN A ND2 
346  N N   . MET A 46  ? 0.54005 0.71457 0.48414 -0.06193 0.05807  0.27417  542 MET A N   
347  C CA  . MET A 46  ? 0.54988 0.72070 0.48828 -0.06005 0.05845  0.27614  542 MET A CA  
348  C C   . MET A 46  ? 0.50018 0.65088 0.42258 -0.06077 0.06502  0.27756  542 MET A C   
349  O O   . MET A 46  ? 0.55258 0.69708 0.46710 -0.06224 0.06655  0.27793  542 MET A O   
350  C CB  . MET A 46  ? 0.56506 0.74511 0.50919 -0.05362 0.05337  0.28050  542 MET A CB  
351  C CG  . MET A 46  ? 0.75489 0.92996 0.69835 -0.04651 0.05422  0.28735  542 MET A CG  
352  S SD  . MET A 46  ? 0.86632 1.05365 0.81417 -0.04278 0.04600  0.29490  542 MET A SD  
353  C CE  . MET A 46  ? 0.48118 0.68457 0.43700 -0.04749 0.04082  0.28909  542 MET A CE  
354  N N   . ASP A 47  ? 0.53279 0.67033 0.44797 -0.06089 0.07061  0.27792  543 ASP A N   
355  C CA  . ASP A 47  ? 0.56589 0.68060 0.46372 -0.06306 0.07947  0.27856  543 ASP A CA  
356  C C   . ASP A 47  ? 0.61520 0.72081 0.50294 -0.07470 0.08351  0.27293  543 ASP A C   
357  O O   . ASP A 47  ? 0.59837 0.68207 0.46871 -0.07884 0.09242  0.27230  543 ASP A O   
358  C CB  . ASP A 47  ? 0.71259 0.81364 0.60622 -0.05686 0.08660  0.28330  543 ASP A CB  
359  C CG  . ASP A 47  ? 0.99260 1.10000 0.89539 -0.04558 0.08395  0.29268  543 ASP A CG  
360  O OD1 . ASP A 47  ? 1.08985 1.20801 0.99583 -0.04477 0.07664  0.29424  543 ASP A OD1 
361  O OD2 . ASP A 47  ? 1.10677 1.20836 1.01386 -0.03818 0.08956  0.29937  543 ASP A OD2 
362  N N   . ALA A 48  ? 0.48960 0.91969 0.92915 -0.02694 0.10527  0.46786  544 ALA A N   
363  C CA  . ALA A 48  ? 0.46741 0.87117 0.86110 -0.03737 0.10556  0.45760  544 ALA A CA  
364  C C   . ALA A 48  ? 0.46658 0.87156 0.84215 -0.04161 0.09048  0.46151  544 ALA A C   
365  O O   . ALA A 48  ? 0.45121 0.87708 0.83332 -0.03985 0.07841  0.46520  544 ALA A O   
366  C CB  . ALA A 48  ? 0.46169 0.86519 0.83739 -0.04425 0.10421  0.44429  544 ALA A CB  
367  N N   . ILE A 49  ? 0.48921 0.86910 0.84042 -0.04943 0.09414  0.46014  545 ILE A N   
368  C CA  . ILE A 49  ? 0.49410 0.87178 0.82897 -0.05612 0.08481  0.46126  545 ILE A CA  
369  C C   . ILE A 49  ? 0.48349 0.87003 0.80788 -0.06674 0.07824  0.44985  545 ILE A C   
370  O O   . ILE A 49  ? 0.49641 0.87008 0.80723 -0.07710 0.08075  0.44517  545 ILE A O   
371  C CB  . ILE A 49  ? 0.52749 0.87307 0.84729 -0.06135 0.09264  0.46694  545 ILE A CB  
372  C CG1 . ILE A 49  ? 0.54355 0.87664 0.88132 -0.04791 0.10060  0.48326  545 ILE A CG1 
373  C CG2 . ILE A 49  ? 0.53584 0.87911 0.84110 -0.06952 0.08628  0.46778  545 ILE A CG2 
374  C CD1 . ILE A 49  ? 0.52909 0.88749 0.88890 -0.03560 0.08876  0.49836  545 ILE A CD1 
375  N N   . ILE A 50  ? 0.46536 0.87324 0.79688 -0.06514 0.07041  0.44833  546 ILE A N   
376  C CA  . ILE A 50  ? 0.45509 0.87537 0.78927 -0.07222 0.06502  0.44222  546 ILE A CA  
377  C C   . ILE A 50  ? 0.49457 0.90971 0.82377 -0.08428 0.06524  0.44308  546 ILE A C   
378  O O   . ILE A 50  ? 0.48066 0.89007 0.80411 -0.08466 0.06967  0.44597  546 ILE A O   
379  C CB  . ILE A 50  ? 0.43516 0.87679 0.78299 -0.06534 0.06202  0.44025  546 ILE A CB  
380  C CG1 . ILE A 50  ? 0.57845 1.02478 0.93518 -0.05650 0.06248  0.44027  546 ILE A CG1 
381  C CG2 . ILE A 50  ? 0.42662 0.88127 0.78646 -0.06978 0.05805  0.43787  546 ILE A CG2 
382  C CD1 . ILE A 50  ? 0.58112 1.04371 0.94795 -0.05244 0.06084  0.43987  546 ILE A CD1 
383  N N   . VAL A 51  ? 0.47462 0.89172 0.80595 -0.09643 0.06032  0.44301  547 VAL A N   
384  C CA  . VAL A 51  ? 0.48914 0.90621 0.82523 -0.11193 0.05944  0.44524  547 VAL A CA  
385  C C   . VAL A 51  ? 0.47623 0.92187 0.83942 -0.11844 0.04889  0.44873  547 VAL A C   
386  O O   . VAL A 51  ? 0.47277 0.93076 0.84302 -0.11189 0.04213  0.45090  547 VAL A O   
387  C CB  . VAL A 51  ? 0.51979 0.90928 0.83546 -0.12669 0.06168  0.44720  547 VAL A CB  
388  C CG1 . VAL A 51  ? 0.55595 0.91625 0.85347 -0.11804 0.07377  0.44757  547 VAL A CG1 
389  C CG2 . VAL A 51  ? 0.52828 0.91321 0.83097 -0.13400 0.05519  0.44896  547 VAL A CG2 
390  N N   . ASP A 52  ? 0.48432 0.94084 0.86772 -0.13178 0.04807  0.45119  548 ASP A N   
391  C CA  . ASP A 52  ? 0.47367 0.96292 0.89672 -0.13774 0.03674  0.45776  548 ASP A CA  
392  C C   . ASP A 52  ? 0.49975 0.99390 0.92065 -0.15366 0.01746  0.46914  548 ASP A C   
393  O O   . ASP A 52  ? 0.54434 1.05575 0.97804 -0.14982 0.00555  0.47821  548 ASP A O   
394  C CB  . ASP A 52  ? 0.48200 0.98433 0.93652 -0.14797 0.04358  0.45604  548 ASP A CB  
395  C CG  . ASP A 52  ? 0.58078 1.06656 1.02582 -0.17008 0.04360  0.45682  548 ASP A CG  
396  O OD1 . ASP A 52  ? 0.53675 0.99057 0.94177 -0.17226 0.04668  0.45561  548 ASP A OD1 
397  O OD2 . ASP A 52  ? 0.62050 1.12314 1.10139 -0.18522 0.04295  0.45753  548 ASP A OD2 
398  N N   . SER A 53  ? 0.53376 1.00665 0.93104 -0.17318 0.01507  0.47025  549 SER A N   
399  C CA  . SER A 53  ? 0.56435 1.03678 0.95207 -0.19567 -0.00677 0.47944  549 SER A CA  
400  C C   . SER A 53  ? 0.62390 1.04538 0.94811 -0.20014 -0.00008 0.46987  549 SER A C   
401  O O   . SER A 53  ? 0.67489 1.07344 0.98361 -0.19305 0.02213  0.46586  549 SER A O   
402  C CB  . SER A 53  ? 0.55289 1.04463 0.97685 -0.21816 -0.02208 0.48014  549 SER A CB  
403  O OG  . SER A 53  ? 0.61938 1.07666 1.01470 -0.23469 -0.01333 0.47157  549 SER A OG  
404  N N   . GLU A 54  ? 0.62030 1.02145 0.90660 -0.21198 -0.01927 0.46670  550 GLU A N   
405  C CA  . GLU A 54  ? 0.70457 1.05232 0.92636 -0.21743 -0.00849 0.45501  550 GLU A CA  
406  C C   . GLU A 54  ? 0.75035 1.06723 0.95503 -0.23769 -0.00447 0.44425  550 GLU A C   
407  O O   . GLU A 54  ? 0.77309 1.04568 0.94046 -0.23565 0.01749  0.43410  550 GLU A O   
408  C CB  . GLU A 54  ? 0.82649 1.15635 1.00199 -0.22549 -0.02815 0.45519  550 GLU A CB  
409  C CG  . GLU A 54  ? 1.03652 1.30517 1.13587 -0.23767 -0.01725 0.44042  550 GLU A CG  
410  C CD  . GLU A 54  ? 1.22740 1.47280 1.28761 -0.26899 -0.04572 0.43327  550 GLU A CD  
411  O OE1 . GLU A 54  ? 1.29040 1.55448 1.34942 -0.27844 -0.08060 0.44317  550 GLU A OE1 
412  O OE2 . GLU A 54  ? 1.29554 1.50316 1.32789 -0.28461 -0.03530 0.41824  550 GLU A OE2 
413  N N   . LYS A 55  ? 0.70208 1.04166 0.94053 -0.25666 -0.02269 0.44631  551 LYS A N   
414  C CA  . LYS A 55  ? 0.84708 1.15716 1.07550 -0.27765 -0.01665 0.43638  551 LYS A CA  
415  C C   . LYS A 55  ? 0.84232 1.14074 1.08373 -0.26265 0.01611  0.43838  551 LYS A C   
416  O O   . LYS A 55  ? 0.94718 1.19705 1.15495 -0.26674 0.03338  0.42924  551 LYS A O   
417  C CB  . LYS A 55  ? 0.88136 1.22602 1.15709 -0.30182 -0.04203 0.43944  551 LYS A CB  
418  C CG  . LYS A 55  ? 0.91802 1.22672 1.17605 -0.33232 -0.04341 0.42645  551 LYS A CG  
419  C CD  . LYS A 55  ? 0.92637 1.25006 1.23568 -0.33646 -0.02336 0.43126  551 LYS A CD  
420  C CE  . LYS A 55  ? 0.97572 1.25355 1.26365 -0.36640 -0.01909 0.41792  551 LYS A CE  
421  N NZ  . LYS A 55  ? 1.04378 1.25007 1.25955 -0.36281 0.00070  0.40451  551 LYS A NZ  
422  N N   . THR A 56  ? 0.72302 1.06150 1.01003 -0.24518 0.02483  0.45065  552 THR A N   
423  C CA  . THR A 56  ? 0.65457 0.97916 0.94460 -0.23104 0.05127  0.45528  552 THR A CA  
424  C C   . THR A 56  ? 0.65701 0.95213 0.91401 -0.20917 0.06612  0.45287  552 THR A C   
425  O O   . THR A 56  ? 0.70601 0.97204 0.95331 -0.19989 0.08365  0.45338  552 THR A O   
426  C CB  . THR A 56  ? 0.61437 0.97613 0.94261 -0.21353 0.05450  0.45639  552 THR A CB  
427  O OG1 . THR A 56  ? 0.72892 1.10344 1.05368 -0.18681 0.05481  0.45472  552 THR A OG1 
428  C CG2 . THR A 56  ? 0.60281 1.00732 0.97763 -0.22995 0.03850  0.46037  552 THR A CG2 
429  N N   . GLY A 57  ? 0.64891 0.94938 0.89109 -0.20028 0.05933  0.44990  553 GLY A N   
430  C CA  . GLY A 57  ? 0.69115 0.96204 0.90686 -0.18342 0.07613  0.44511  553 GLY A CA  
431  C C   . GLY A 57  ? 0.84196 1.05624 1.01773 -0.19471 0.08819  0.43204  553 GLY A C   
432  O O   . GLY A 57  ? 0.94611 1.13179 1.11885 -0.18099 0.10890  0.43101  553 GLY A O   
433  N N   . ARG A 58  ? 0.82982 1.02559 0.97562 -0.22035 0.07411  0.42181  554 ARG A N   
434  C CA  . ARG A 58  ? 0.92597 1.06166 1.02806 -0.23600 0.08599  0.40584  554 ARG A CA  
435  C C   . ARG A 58  ? 0.91421 1.03271 1.03491 -0.24170 0.09603  0.40811  554 ARG A C   
436  O O   . ARG A 58  ? 0.91819 0.98422 1.01627 -0.24071 0.11739  0.39915  554 ARG A O   
437  C CB  . ARG A 58  ? 1.09923 1.22054 1.15955 -0.26577 0.06214  0.39442  554 ARG A CB  
438  C CG  . ARG A 58  ? 1.33252 1.39421 1.34707 -0.29308 0.06596  0.37544  554 ARG A CG  
439  C CD  . ARG A 58  ? 1.50110 1.49907 1.47101 -0.28332 0.10146  0.36010  554 ARG A CD  
440  N NE  . ARG A 58  ? 1.62780 1.56708 1.56780 -0.30548 0.11179  0.34309  554 ARG A NE  
441  C CZ  . ARG A 58  ? 1.62195 1.51259 1.55849 -0.29310 0.14621  0.33592  554 ARG A CZ  
442  N NH1 . ARG A 58  ? 1.50634 1.40493 1.47215 -0.25824 0.17080  0.34538  554 ARG A NH1 
443  N NH2 . ARG A 58  ? 1.69209 1.52561 1.59994 -0.31594 0.15475  0.31953  554 ARG A NH2 
444  N N   . ASP A 59  ? 0.93737 1.09647 1.10018 -0.24658 0.08459  0.42068  555 ASP A N   
445  C CA  . ASP A 59  ? 0.99222 1.13438 1.17124 -0.25207 0.09710  0.42631  555 ASP A CA  
446  C C   . ASP A 59  ? 0.98473 1.10939 1.16821 -0.22322 0.11943  0.43664  555 ASP A C   
447  O O   . ASP A 59  ? 0.98329 1.06281 1.15720 -0.22397 0.13554  0.43711  555 ASP A O   
448  C CB  . ASP A 59  ? 0.94376 1.13573 1.16817 -0.26252 0.08540  0.43797  555 ASP A CB  
449  C CG  . ASP A 59  ? 0.93641 1.12762 1.16820 -0.29793 0.06962  0.42932  555 ASP A CG  
450  O OD1 . ASP A 59  ? 0.87864 1.11227 1.15690 -0.30844 0.06266  0.43759  555 ASP A OD1 
451  O OD2 . ASP A 59  ? 0.98257 1.13047 1.17541 -0.31636 0.06504  0.41324  555 ASP A OD2 
452  N N   . CYS A 60  ? 0.91494 1.07407 1.11520 -0.19812 0.11848  0.44602  556 CYS A N   
453  C CA  . CYS A 60  ? 0.86833 1.01423 1.07560 -0.17087 0.13306  0.45608  556 CYS A CA  
454  C C   . CYS A 60  ? 0.95802 1.06313 1.14706 -0.15897 0.14894  0.44486  556 CYS A C   
455  O O   . CYS A 60  ? 0.91886 0.99829 1.11681 -0.14018 0.16264  0.45192  556 CYS A O   
456  C CB  . CYS A 60  ? 0.73689 0.93059 0.96718 -0.14928 0.12370  0.46328  556 CYS A CB  
457  S SG  . CYS A 60  ? 0.74781 0.98260 0.99506 -0.15448 0.10911  0.46097  556 CYS A SG  
458  N N   . ILE A 61  ? 0.98387 1.08053 1.14766 -0.16898 0.14844  0.42848  557 ILE A N   
459  C CA  . ILE A 61  ? 1.00783 1.05579 1.14791 -0.16234 0.17129  0.41400  557 ILE A CA  
460  C C   . ILE A 61  ? 1.12985 1.11795 1.25124 -0.17385 0.18614  0.40625  557 ILE A C   
461  O O   . ILE A 61  ? 1.15376 1.10449 1.28304 -0.15566 0.20899  0.40591  557 ILE A O   
462  C CB  . ILE A 61  ? 0.97194 1.01438 1.07326 -0.17635 0.16874  0.39780  557 ILE A CB  
463  C CG1 . ILE A 61  ? 0.90558 0.99466 1.02739 -0.15912 0.16340  0.40564  557 ILE A CG1 
464  C CG2 . ILE A 61  ? 0.99567 0.97367 1.05797 -0.17880 0.19736  0.37776  557 ILE A CG2 
465  C CD1 . ILE A 61  ? 0.92859 1.01646 1.08000 -0.13005 0.18617  0.40865  557 ILE A CD1 
466  N N   . GLN A 62  ? 1.14395 1.12369 1.24789 -0.20386 0.17288  0.40116  558 GLN A N   
467  C CA  . GLN A 62  ? 1.18517 1.10543 1.27060 -0.21976 0.18629  0.39257  558 GLN A CA  
468  C C   . GLN A 62  ? 1.19015 1.10048 1.30681 -0.20154 0.19674  0.41266  558 GLN A C   
469  O O   . GLN A 62  ? 1.26599 1.11729 1.37357 -0.19939 0.21720  0.40876  558 GLN A O   
470  C CB  . GLN A 62  ? 1.24444 1.16714 1.31407 -0.25854 0.16576  0.38396  558 GLN A CB  
471  C CG  . GLN A 62  ? 1.38760 1.24376 1.43319 -0.28190 0.17886  0.37056  558 GLN A CG  
472  C CD  . GLN A 62  ? 1.59677 1.39321 1.58422 -0.29780 0.18985  0.34166  558 GLN A CD  
473  O OE1 . GLN A 62  ? 1.66367 1.43410 1.63463 -0.27635 0.21271  0.33406  558 GLN A OE1 
474  N NE2 . GLN A 62  ? 1.68777 1.46055 1.64375 -0.33724 0.17473  0.32441  558 GLN A NE2 
475  N N   . TYR A 63  ? 1.13215 1.09423 1.28126 -0.18813 0.18364  0.43448  559 TYR A N   
476  C CA  . TYR A 63  ? 1.08631 1.03599 1.25422 -0.17149 0.19032  0.45649  559 TYR A CA  
477  C C   . TYR A 63  ? 1.11174 1.03886 1.29377 -0.13755 0.20442  0.46249  559 TYR A C   
478  O O   . TYR A 63  ? 1.24475 1.11999 1.42718 -0.12921 0.21961  0.46835  559 TYR A O   
479  C CB  . TYR A 63  ? 1.02969 1.03590 1.21819 -0.16786 0.17405  0.47583  559 TYR A CB  
480  C CG  . TYR A 63  ? 1.01683 1.00426 1.20968 -0.15673 0.17894  0.50000  559 TYR A CG  
481  C CD1 . TYR A 63  ? 1.00375 0.96187 1.18551 -0.17832 0.18574  0.50409  559 TYR A CD1 
482  C CD2 . TYR A 63  ? 0.98820 0.98549 1.19336 -0.12559 0.17443  0.51716  559 TYR A CD2 
483  C CE1 . TYR A 63  ? 0.98946 0.92359 1.16122 -0.16681 0.18812  0.51895  559 TYR A CE1 
484  C CE2 . TYR A 63  ? 0.94391 0.91973 1.14039 -0.11450 0.17200  0.53372  559 TYR A CE2 
485  C CZ  . TYR A 63  ? 0.96591 0.90779 1.14156 -0.13472 0.17985  0.53444  559 TYR A CZ  
486  O OH  . TYR A 63  ? 1.00511 0.92001 1.16326 -0.12477 0.17834  0.55209  559 TYR A OH  
487  N N   . ILE A 64  ? 1.06417 1.02935 1.26357 -0.11772 0.20011  0.46155  560 ILE A N   
488  C CA  . ILE A 64  ? 1.07288 1.02636 1.30019 -0.08524 0.21252  0.46711  560 ILE A CA  
489  C C   . ILE A 64  ? 1.19280 1.08353 1.40732 -0.08516 0.24161  0.44757  560 ILE A C   
490  O O   . ILE A 64  ? 1.14064 0.99844 1.38084 -0.06133 0.25726  0.45497  560 ILE A O   
491  C CB  . ILE A 64  ? 0.89950 0.90864 1.15110 -0.06952 0.20355  0.46711  560 ILE A CB  
492  C CG1 . ILE A 64  ? 0.83495 0.89996 1.08993 -0.07548 0.17785  0.47999  560 ILE A CG1 
493  C CG2 . ILE A 64  ? 0.89839 0.90935 1.19526 -0.03545 0.20995  0.47836  560 ILE A CG2 
494  C CD1 . ILE A 64  ? 0.75446 0.87028 1.03418 -0.06104 0.16852  0.48073  560 ILE A CD1 
495  N N   . LYS A 65  ? 1.29984 1.17012 1.47331 -0.11203 0.24882  0.42243  561 LYS A N   
496  C CA  . LYS A 65  ? 1.41336 1.21363 1.55951 -0.11874 0.27880  0.39934  561 LYS A CA  
497  C C   . LYS A 65  ? 1.42940 1.17085 1.57313 -0.12240 0.28990  0.40455  561 LYS A C   
498  O O   . LYS A 65  ? 1.49004 1.17073 1.63277 -0.11259 0.31958  0.39335  561 LYS A O   
499  C CB  . LYS A 65  ? 1.47333 1.26214 1.56279 -0.15342 0.27566  0.37325  561 LYS A CB  
500  C CG  . LYS A 65  ? 1.63762 1.34989 1.68053 -0.16658 0.30704  0.34339  561 LYS A CG  
501  C CD  . LYS A 65  ? 1.73492 1.41304 1.72586 -0.20913 0.29428  0.32725  561 LYS A CD  
502  C CE  . LYS A 65  ? 1.79050 1.39498 1.71498 -0.23128 0.31865  0.29260  561 LYS A CE  
503  N NZ  . LYS A 65  ? 1.80309 1.38558 1.67981 -0.27654 0.29583  0.27794  561 LYS A NZ  
504  N N   . GLU A 66  ? 1.31118 1.06674 1.45594 -0.13573 0.27003  0.42186  562 GLU A N   
505  C CA  . GLU A 66  ? 1.32100 1.01936 1.46065 -0.14274 0.28043  0.42939  562 GLU A CA  
506  C C   . GLU A 66  ? 1.34457 1.03282 1.52245 -0.10725 0.28352  0.45918  562 GLU A C   
507  O O   . GLU A 66  ? 1.40972 1.03645 1.58537 -0.10581 0.29844  0.46601  562 GLU A O   
508  C CB  . GLU A 66  ? 1.30530 1.02103 1.42997 -0.17601 0.26150  0.43517  562 GLU A CB  
509  C CG  . GLU A 66  ? 1.36091 1.06313 1.44869 -0.21717 0.25768  0.40680  562 GLU A CG  
510  C CD  . GLU A 66  ? 1.34269 1.08830 1.43638 -0.24599 0.23451  0.41457  562 GLU A CD  
511  O OE1 . GLU A 66  ? 1.33013 1.09922 1.44783 -0.23659 0.23001  0.44040  562 GLU A OE1 
512  O OE2 . GLU A 66  ? 1.34557 1.10164 1.42048 -0.27817 0.22083  0.39527  562 GLU A OE2 
513  N N   . GLN A 67  ? 1.29376 1.03800 1.50546 -0.07980 0.26749  0.47803  563 GLN A N   
514  C CA  . GLN A 67  ? 1.31333 1.05426 1.55794 -0.04843 0.26016  0.51010  563 GLN A CA  
515  C C   . GLN A 67  ? 1.40212 1.14449 1.69492 -0.01075 0.27036  0.51207  563 GLN A C   
516  O O   . GLN A 67  ? 1.37303 1.13675 1.70198 0.01748  0.25320  0.53967  563 GLN A O   
517  C CB  . GLN A 67  ? 1.20568 1.00684 1.45186 -0.04759 0.22958  0.53375  563 GLN A CB  
518  C CG  . GLN A 67  ? 1.16481 0.98829 1.37796 -0.08335 0.22063  0.52768  563 GLN A CG  
519  C CD  . GLN A 67  ? 1.22716 1.01560 1.42014 -0.09705 0.22167  0.54757  563 GLN A CD  
520  O OE1 . GLN A 67  ? 1.24309 1.00117 1.44101 -0.07658 0.22050  0.57348  563 GLN A OE1 
521  N NE2 . GLN A 67  ? 1.26545 1.05719 1.43750 -0.13243 0.22351  0.53691  563 GLN A NE2 
522  N N   . ARG A 68  ? 1.50918 1.23135 1.80358 -0.01088 0.29732  0.48333  564 ARG A N   
523  C CA  . ARG A 68  ? 1.51464 1.23716 1.86060 0.02185  0.31679  0.47903  564 ARG A CA  
524  C C   . ARG A 68  ? 1.33274 1.13430 1.71919 0.03945  0.29518  0.48924  564 ARG A C   
525  O O   . ARG A 68  ? 1.29928 1.11248 1.73771 0.06482  0.31056  0.48545  564 ARG A O   
526  C CB  . ARG A 68  ? 1.66525 1.33937 2.05496 0.05331  0.32788  0.49938  564 ARG A CB  
527  C CG  . ARG A 68  ? 1.75164 1.39756 2.19387 0.08210  0.36433  0.48603  564 ARG A CG  
528  C CD  . ARG A 68  ? 1.89340 1.44867 2.30613 0.07131  0.40597  0.46178  564 ARG A CD  
529  N NE  . ARG A 68  ? 1.95248 1.49251 2.32320 0.04811  0.43638  0.42076  564 ARG A NE  
530  C CZ  . ARG A 68  ? 2.05271 1.52381 2.36019 0.01802  0.46152  0.39153  564 ARG A CZ  
531  N NH1 . ARG A 68  ? 2.11313 1.52530 2.39901 0.00714  0.46234  0.39790  564 ARG A NH1 
532  N NH2 . ARG A 68  ? 2.08239 1.53999 2.34414 -0.00311 0.48537  0.35603  564 ARG A NH2 
533  N N   . GLY A 69  ? 1.21816 1.07315 1.58530 0.02546  0.26313  0.49990  565 GLY A N   
534  C CA  . GLY A 69  ? 1.11169 1.03581 1.51607 0.04119  0.24086  0.51072  565 GLY A CA  
535  C C   . GLY A 69  ? 1.00171 0.95336 1.41174 0.03655  0.25661  0.48595  565 GLY A C   
536  O O   . GLY A 69  ? 0.99383 0.91804 1.36132 0.01445  0.27743  0.46083  565 GLY A O   
537  N N   . GLU A 70  ? 1.08100 1.08531 1.54203 0.05629  0.24538  0.49391  566 GLU A N   
538  C CA  . GLU A 70  ? 1.21199 1.24011 1.68551 0.05443  0.26434  0.47322  566 GLU A CA  
539  C C   . GLU A 70  ? 1.14337 1.19961 1.56421 0.02565  0.25070  0.46294  566 GLU A C   
540  O O   . GLU A 70  ? 1.04768 1.13461 1.45415 0.01742  0.21996  0.47693  566 GLU A O   
541  C CB  . GLU A 70  ? 1.27964 1.35813 1.83147 0.08196  0.25556  0.48524  566 GLU A CB  
542  C CG  . GLU A 70  ? 1.30276 1.41968 1.87724 0.09332  0.21153  0.51439  566 GLU A CG  
543  C CD  . GLU A 70  ? 1.34051 1.48773 2.00271 0.12541  0.20150  0.53022  566 GLU A CD  
544  O OE1 . GLU A 70  ? 1.32623 1.52450 2.01098 0.12971  0.16635  0.54475  566 GLU A OE1 
545  O OE2 . GLU A 70  ? 1.38578 1.50564 2.09711 0.14588  0.22852  0.52741  566 GLU A OE2 
546  N N   . PRO A 71  ? 1.14745 1.19026 1.53688 0.01010  0.27382  0.43933  567 PRO A N   
547  C CA  . PRO A 71  ? 1.09717 1.16134 1.43647 -0.01664 0.25839  0.43183  567 PRO A CA  
548  C C   . PRO A 71  ? 0.90445 1.03378 1.27307 -0.01058 0.23414  0.44351  567 PRO A C   
549  O O   . PRO A 71  ? 0.78306 0.94128 1.20757 0.01063  0.23528  0.45042  567 PRO A O   
550  C CB  . PRO A 71  ? 1.19235 1.22121 1.49294 -0.03008 0.29008  0.40646  567 PRO A CB  
551  C CG  . PRO A 71  ? 1.26155 1.23414 1.57430 -0.01759 0.32484  0.39676  567 PRO A CG  
552  C CD  . PRO A 71  ? 1.21893 1.21713 1.60961 0.01472  0.31688  0.41840  567 PRO A CD  
553  N N   . GLU A 72  ? 0.82899 0.98105 1.16369 -0.03003 0.21168  0.44534  568 GLU A N   
554  C CA  . GLU A 72  ? 0.73853 0.94541 1.09080 -0.02863 0.18965  0.45374  568 GLU A CA  
555  C C   . GLU A 72  ? 0.66103 0.87362 0.97441 -0.04927 0.18902  0.44224  568 GLU A C   
556  O O   . GLU A 72  ? 0.69918 0.87631 0.96717 -0.06715 0.19749  0.43044  568 GLU A O   
557  C CB  . GLU A 72  ? 0.71823 0.94690 1.07202 -0.02921 0.16212  0.47089  568 GLU A CB  
558  C CG  . GLU A 72  ? 0.66173 0.87910 1.04319 -0.01004 0.15736  0.48671  568 GLU A CG  
559  C CD  . GLU A 72  ? 0.64510 0.90426 1.05287 0.00169  0.13159  0.50275  568 GLU A CD  
560  O OE1 . GLU A 72  ? 0.59445 0.89133 1.02123 0.00305  0.12558  0.49826  568 GLU A OE1 
561  O OE2 . GLU A 72  ? 0.78621 1.03615 1.19194 0.00859  0.11734  0.51998  568 GLU A OE2 
562  N N   . THR A 73  ? 0.61877 0.87334 0.94817 -0.04765 0.17686  0.44619  569 THR A N   
563  C CA  . THR A 73  ? 0.66631 0.92720 0.96265 -0.06459 0.17246  0.43993  569 THR A CA  
564  C C   . THR A 73  ? 0.58398 0.87566 0.87716 -0.07232 0.14434  0.44662  569 THR A C   
565  O O   . THR A 73  ? 0.55018 0.86824 0.87009 -0.06149 0.13027  0.45296  569 THR A O   
566  C CB  . THR A 73  ? 0.75220 1.02908 1.06641 -0.05811 0.18486  0.43645  569 THR A CB  
567  O OG1 . THR A 73  ? 0.75629 1.07697 1.11891 -0.04477 0.17089  0.44619  569 THR A OG1 
568  C CG2 . THR A 73  ? 0.78870 1.03413 1.11090 -0.04982 0.21865  0.42600  569 THR A CG2 
569  N N   . PHE A 74  ? 0.59167 0.87660 0.85032 -0.09006 0.13464  0.44081  570 PHE A N   
570  C CA  . PHE A 74  ? 0.56755 0.87676 0.82858 -0.09598 0.11029  0.44095  570 PHE A CA  
571  C C   . PHE A 74  ? 0.60135 0.92838 0.85667 -0.09999 0.09866  0.43826  570 PHE A C   
572  O O   . PHE A 74  ? 0.66812 0.97637 0.89357 -0.11054 0.10421  0.43768  570 PHE A O   
573  C CB  . PHE A 74  ? 0.67603 0.96659 0.91689 -0.11488 0.10614  0.44295  570 PHE A CB  
574  C CG  . PHE A 74  ? 0.76202 1.03384 1.01047 -0.11017 0.11540  0.44794  570 PHE A CG  
575  C CD1 . PHE A 74  ? 0.67938 0.96702 0.94333 -0.10593 0.10505  0.45165  570 PHE A CD1 
576  C CD2 . PHE A 74  ? 0.80793 1.04035 1.04538 -0.10789 0.13612  0.44653  570 PHE A CD2 
577  C CE1 . PHE A 74  ? 0.69753 0.96281 0.96281 -0.10164 0.11276  0.45980  570 PHE A CE1 
578  C CE2 . PHE A 74  ? 0.80630 1.01667 1.05254 -0.10063 0.14321  0.45214  570 PHE A CE2 
579  C CZ  . PHE A 74  ? 0.74788 0.97592 1.00783 -0.09921 0.13141  0.46483  570 PHE A CZ  
580  N N   . LEU A 75  ? 0.54827 0.90724 0.82901 -0.09171 0.08445  0.43856  571 LEU A N   
581  C CA  . LEU A 75  ? 0.50430 0.88158 0.78874 -0.09326 0.07277  0.43968  571 LEU A CA  
582  C C   . LEU A 75  ? 0.61306 1.00842 0.90742 -0.10336 0.05667  0.44516  571 LEU A C   
583  O O   . LEU A 75  ? 0.47395 0.88941 0.79269 -0.09620 0.05321  0.44425  571 LEU A O   
584  C CB  . LEU A 75  ? 0.47287 0.87111 0.78426 -0.07722 0.07280  0.43706  571 LEU A CB  
585  C CG  . LEU A 75  ? 0.54043 0.93330 0.84724 -0.07462 0.07967  0.43567  571 LEU A CG  
586  C CD1 . LEU A 75  ? 0.44915 0.86370 0.78484 -0.06319 0.07671  0.43399  571 LEU A CD1 
587  C CD2 . LEU A 75  ? 0.50188 0.88673 0.78415 -0.08743 0.07125  0.44220  571 LEU A CD2 
588  N N   . PRO A 76  ? 0.58714 0.97594 0.86382 -0.12205 0.04726  0.45255  572 PRO A N   
589  C CA  . PRO A 76  ? 0.53619 0.95192 0.83807 -0.13316 0.03035  0.46190  572 PRO A CA  
590  C C   . PRO A 76  ? 0.54580 0.99116 0.87785 -0.12341 0.02105  0.46876  572 PRO A C   
591  O O   . PRO A 76  ? 0.61176 1.05105 0.93030 -0.12057 0.01858  0.47350  572 PRO A O   
592  C CB  . PRO A 76  ? 0.59996 0.99957 0.87200 -0.15934 0.01843  0.47196  572 PRO A CB  
593  C CG  . PRO A 76  ? 0.67547 1.02969 0.89909 -0.16014 0.03634  0.46160  572 PRO A CG  
594  C CD  . PRO A 76  ? 0.59528 0.95055 0.82705 -0.13675 0.05191  0.45451  572 PRO A CD  
595  N N   . LEU A 77  ? 0.52653 0.99876 0.89742 -0.11802 0.01941  0.46892  573 LEU A N   
596  C CA  . LEU A 77  ? 0.44271 0.93805 0.84535 -0.10569 0.01687  0.47327  573 LEU A CA  
597  C C   . LEU A 77  ? 0.49318 1.01386 0.92561 -0.11690 -0.00218 0.49394  573 LEU A C   
598  O O   . LEU A 77  ? 0.59601 1.12010 1.03266 -0.11185 -0.00789 0.50514  573 LEU A O   
599  C CB  . LEU A 77  ? 0.50893 1.01397 0.93357 -0.09500 0.02824  0.46298  573 LEU A CB  
600  C CG  . LEU A 77  ? 0.54303 1.04989 0.97554 -0.07849 0.03778  0.45604  573 LEU A CG  
601  C CD1 . LEU A 77  ? 0.40931 0.89761 0.81434 -0.07173 0.04195  0.44982  573 LEU A CD1 
602  C CD2 . LEU A 77  ? 0.40992 0.91733 0.84685 -0.07507 0.05126  0.44620  573 LEU A CD2 
603  N N   . ASP A 78  ? 0.50636 1.04411 0.96096 -0.13441 -0.01402 0.50141  574 ASP A N   
604  C CA  . ASP A 78  ? 0.62852 1.19650 1.12930 -0.13967 -0.03824 0.51365  574 ASP A CA  
605  C C   . ASP A 78  ? 0.67941 1.23450 1.15616 -0.13869 -0.06363 0.52431  574 ASP A C   
606  O O   . ASP A 78  ? 0.77915 1.35814 1.30033 -0.12998 -0.07847 0.53649  574 ASP A O   
607  C CB  . ASP A 78  ? 0.62239 1.19957 1.13781 -0.16052 -0.05208 0.51204  574 ASP A CB  
608  C CG  . ASP A 78  ? 0.78816 1.38203 1.34263 -0.15799 -0.03055 0.50316  574 ASP A CG  
609  O OD1 . ASP A 78  ? 0.85157 1.43628 1.40276 -0.13610 -0.00901 0.49145  574 ASP A OD1 
610  O OD2 . ASP A 78  ? 0.98208 1.58407 1.55547 -0.17577 -0.03639 0.50101  574 ASP A OD2 
611  N N   . TYR A 79  ? 0.61991 1.13479 1.02722 -0.14662 -0.06683 0.52093  575 TYR A N   
612  C CA  . TYR A 79  ? 0.65453 1.14955 1.02640 -0.14795 -0.08911 0.53251  575 TYR A CA  
613  C C   . TYR A 79  ? 0.70681 1.16763 1.02981 -0.13908 -0.06593 0.52892  575 TYR A C   
614  O O   . TYR A 79  ? 0.70264 1.12508 0.96152 -0.14802 -0.07115 0.53039  575 TYR A O   
615  C CB  . TYR A 79  ? 0.65904 1.13417 0.98756 -0.17156 -0.11976 0.53348  575 TYR A CB  
616  C CG  . TYR A 79  ? 0.68712 1.20416 1.07945 -0.17825 -0.15261 0.54391  575 TYR A CG  
617  C CD1 . TYR A 79  ? 0.65441 1.19936 1.09695 -0.16496 -0.17369 0.56270  575 TYR A CD1 
618  C CD2 . TYR A 79  ? 0.61917 1.15030 1.03274 -0.19663 -0.15985 0.53533  575 TYR A CD2 
619  C CE1 . TYR A 79  ? 0.71086 1.30052 1.22798 -0.16885 -0.20315 0.57314  575 TYR A CE1 
620  C CE2 . TYR A 79  ? 0.61522 1.19111 1.10108 -0.20357 -0.18842 0.54466  575 TYR A CE2 
621  C CZ  . TYR A 79  ? 0.73998 1.34751 1.28097 -0.18881 -0.21031 0.56366  575 TYR A CZ  
622  O OH  . TYR A 79  ? 0.75588 1.41272 1.38196 -0.19383 -0.23842 0.57376  575 TYR A OH  
623  N N   . LEU A 80  ? 0.62603 1.09993 0.97928 -0.12288 -0.03933 0.52374  576 LEU A N   
624  C CA  . LEU A 80  ? 0.64922 1.09879 0.97288 -0.11468 -0.01704 0.52007  576 LEU A CA  
625  C C   . LEU A 80  ? 0.74127 1.17944 1.05566 -0.10963 -0.02783 0.53503  576 LEU A C   
626  O O   . LEU A 80  ? 0.66879 1.13076 1.03068 -0.09939 -0.03825 0.54544  576 LEU A O   
627  C CB  . LEU A 80  ? 0.49749 0.96222 0.85586 -0.09761 0.00489  0.50176  576 LEU A CB  
628  C CG  . LEU A 80  ? 0.48307 0.92155 0.81272 -0.09042 0.02568  0.48113  576 LEU A CG  
629  C CD1 . LEU A 80  ? 0.51965 0.92750 0.80065 -0.10328 0.02987  0.47681  576 LEU A CD1 
630  C CD2 . LEU A 80  ? 0.44936 0.90049 0.80393 -0.07870 0.03646  0.46535  576 LEU A CD2 
631  N N   . GLU A 81  ? 0.76477 1.16192 1.01678 -0.11621 -0.02346 0.53360  577 GLU A N   
632  C CA  . GLU A 81  ? 0.86570 1.24133 1.09921 -0.11067 -0.02566 0.54298  577 GLU A CA  
633  C C   . GLU A 81  ? 0.74682 1.13550 1.02405 -0.09334 -0.00248 0.53303  577 GLU A C   
634  O O   . GLU A 81  ? 0.68582 1.06031 0.95101 -0.09008 0.02285  0.51320  577 GLU A O   
635  C CB  . GLU A 81  ? 1.08407 1.40708 1.23715 -0.12180 -0.01442 0.53563  577 GLU A CB  
636  C CG  . GLU A 81  ? 1.26864 1.56652 1.35963 -0.14291 -0.03572 0.54276  577 GLU A CG  
637  C CD  . GLU A 81  ? 1.39840 1.65689 1.42673 -0.15120 -0.05575 0.55823  577 GLU A CD  
638  O OE1 . GLU A 81  ? 1.44211 1.69408 1.48189 -0.13899 -0.05057 0.56456  577 GLU A OE1 
639  O OE2 . GLU A 81  ? 1.54084 1.77016 1.50311 -0.17123 -0.07663 0.56344  577 GLU A OE2 
640  N N   . VAL A 82  ? 0.56085 0.97550 0.89130 -0.08279 -0.01084 0.54732  578 VAL A N   
641  C CA  . VAL A 82  ? 0.52836 0.95078 0.89488 -0.06949 0.01090  0.53714  578 VAL A CA  
642  C C   . VAL A 82  ? 0.68213 1.10777 1.08243 -0.06038 0.00173  0.55987  578 VAL A C   
643  O O   . VAL A 82  ? 0.80167 1.24534 1.23124 -0.05759 -0.02147 0.57742  578 VAL A O   
644  C CB  . VAL A 82  ? 0.57438 1.02643 0.97829 -0.06408 0.02244  0.51919  578 VAL A CB  
645  C CG1 . VAL A 82  ? 0.62790 1.11462 1.08041 -0.06295 0.01125  0.53257  578 VAL A CG1 
646  C CG2 . VAL A 82  ? 0.70178 1.15166 1.12399 -0.05411 0.04160  0.50378  578 VAL A CG2 
647  N N   . LYS A 83  ? 0.61594 1.02046 1.01382 -0.05456 0.01845  0.55575  579 LYS A N   
648  C CA  . LYS A 83  ? 0.71617 1.11082 1.14190 -0.04471 0.02012  0.57163  579 LYS A CA  
649  C C   . LYS A 83  ? 0.71274 1.13265 1.19840 -0.03570 0.03834  0.56295  579 LYS A C   
650  O O   . LYS A 83  ? 0.72401 1.15698 1.21138 -0.03772 0.05253  0.53739  579 LYS A O   
651  C CB  . LYS A 83  ? 0.85994 1.21254 1.24299 -0.04844 0.03504  0.56621  579 LYS A CB  
652  C CG  . LYS A 83  ? 1.08416 1.39939 1.40005 -0.05771 0.01960  0.57788  579 LYS A CG  
653  C CD  . LYS A 83  ? 1.19725 1.49731 1.45816 -0.07098 0.03123  0.55846  579 LYS A CD  
654  C CE  . LYS A 83  ? 1.24748 1.50725 1.43216 -0.08338 0.01511  0.56987  579 LYS A CE  
655  N NZ  . LYS A 83  ? 1.21094 1.44859 1.34111 -0.09642 0.03362  0.55133  579 LYS A NZ  
656  N N   . PRO A 84  ? 0.73855 1.16062 1.26892 -0.02256 0.03574  0.57120  580 PRO A N   
657  C CA  . PRO A 84  ? 0.67487 1.11401 1.25257 -0.01468 0.05562  0.55231  580 PRO A CA  
658  C C   . PRO A 84  ? 0.63959 1.05603 1.20939 -0.01833 0.07920  0.53976  580 PRO A C   
659  O O   . PRO A 84  ? 0.69074 1.07641 1.23574 -0.02226 0.08210  0.55098  580 PRO A O   
660  C CB  . PRO A 84  ? 0.71892 1.16393 1.35023 0.00159  0.04642  0.56657  580 PRO A CB  
661  C CG  . PRO A 84  ? 0.80523 1.23286 1.41531 0.00255  0.01715  0.59687  580 PRO A CG  
662  C CD  . PRO A 84  ? 0.80884 1.21152 1.34600 -0.01392 0.01657  0.59823  580 PRO A CD  
663  N N   . THR A 85  ? 0.52009 0.95049 1.10884 -0.01917 0.09595  0.51610  581 THR A N   
664  C CA  . THR A 85  ? 0.51252 0.92713 1.09626 -0.02641 0.11427  0.50014  581 THR A CA  
665  C C   . THR A 85  ? 0.61027 0.99568 1.21700 -0.01995 0.12426  0.50617  581 THR A C   
666  O O   . THR A 85  ? 0.57360 0.95911 1.21548 -0.00726 0.12619  0.50788  581 THR A O   
667  C CB  . THR A 85  ? 0.47990 0.91009 1.06682 -0.02889 0.12190  0.47098  581 THR A CB  
668  O OG1 . THR A 85  ? 0.49811 0.94448 1.05735 -0.03037 0.10882  0.46305  581 THR A OG1 
669  C CG2 . THR A 85  ? 0.50857 0.92530 1.08795 -0.03926 0.13263  0.45304  581 THR A CG2 
670  N N   . ASP A 86  ? 0.65348 1.01191 1.24383 -0.02850 0.13328  0.50956  582 ASP A N   
671  C CA  . ASP A 86  ? 0.64939 0.97215 1.25683 -0.02396 0.14367  0.51800  582 ASP A CA  
672  C C   . ASP A 86  ? 0.74790 1.06734 1.38598 -0.02480 0.16154  0.49181  582 ASP A C   
673  O O   . ASP A 86  ? 0.80354 1.12384 1.43657 -0.03929 0.17188  0.47110  582 ASP A O   
674  C CB  . ASP A 86  ? 0.58985 0.88196 1.16846 -0.03595 0.15215  0.52912  582 ASP A CB  
675  C CG  . ASP A 86  ? 0.69153 0.93999 1.27845 -0.02969 0.15819  0.54833  582 ASP A CG  
676  O OD1 . ASP A 86  ? 0.75242 0.99732 1.37126 -0.01335 0.15266  0.55469  582 ASP A OD1 
677  O OD2 . ASP A 86  ? 0.83013 1.04590 1.39138 -0.03909 0.16834  0.55353  582 ASP A OD2 
678  N N   . GLU A 87  ? 0.64152 1.37948 1.22517 0.10328  -0.00000 0.10997  583 GLU A N   
679  C CA  . GLU A 87  ? 0.64903 1.34433 1.25533 0.12211  0.05789  0.08245  583 GLU A CA  
680  C C   . GLU A 87  ? 0.57666 1.17908 1.14670 0.14756  0.07495  0.08373  583 GLU A C   
681  O O   . GLU A 87  ? 0.51483 1.04592 1.03433 0.13598  0.11498  0.05113  583 GLU A O   
682  C CB  . GLU A 87  ? 0.74108 1.51693 1.47600 0.15421  0.08188  0.09309  583 GLU A CB  
683  C CG  . GLU A 87  ? 0.76358 1.66405 1.56519 0.13644  0.04704  0.11139  583 GLU A CG  
684  C CD  . GLU A 87  ? 0.81978 1.78588 1.65816 0.15098  -0.01550 0.16390  583 GLU A CD  
685  O OE1 . GLU A 87  ? 0.86605 1.80095 1.72578 0.19529  -0.02222 0.19423  583 GLU A OE1 
686  O OE2 . GLU A 87  ? 0.82021 1.86287 1.65589 0.11307  -0.05681 0.17456  583 GLU A OE2 
687  N N   . LYS A 88  ? 0.60169 1.20206 1.18916 0.17666  0.04470  0.12133  584 LYS A N   
688  C CA  . LYS A 88  ? 0.71378 1.22482 1.27392 0.20293  0.06542  0.12520  584 LYS A CA  
689  C C   . LYS A 88  ? 0.74461 1.17299 1.19115 0.16692  0.06728  0.09836  584 LYS A C   
690  O O   . LYS A 88  ? 0.83467 1.18363 1.24751 0.17315  0.09995  0.08452  584 LYS A O   
691  C CB  . LYS A 88  ? 0.78518 1.31241 1.37914 0.23814  0.02705  0.17603  584 LYS A CB  
692  C CG  . LYS A 88  ? 0.88773 1.43256 1.41875 0.20672  -0.03337 0.19475  584 LYS A CG  
693  C CD  . LYS A 88  ? 0.95997 1.47989 1.48352 0.23297  -0.06506 0.23886  584 LYS A CD  
694  C CE  . LYS A 88  ? 0.89717 1.38476 1.32000 0.19196  -0.10402 0.24078  584 LYS A CE  
695  N NZ  . LYS A 88  ? 0.83991 1.22009 1.18327 0.18703  -0.08287 0.22413  584 LYS A NZ  
696  N N   . LEU A 89  ? 0.60639 1.05253 0.99558 0.12803  0.03725  0.09085  585 LEU A N   
697  C CA  . LEU A 89  ? 0.59957 0.98369 0.89673 0.09833  0.03645  0.07295  585 LEU A CA  
698  C C   . LEU A 89  ? 0.68727 1.03327 0.95096 0.07824  0.07761  0.03590  585 LEU A C   
699  O O   . LEU A 89  ? 0.65430 0.95273 0.85150 0.05649  0.07928  0.02414  585 LEU A O   
700  C CB  . LEU A 89  ? 0.54756 0.95848 0.80043 0.06763  0.00167  0.07842  585 LEU A CB  
701  C CG  . LEU A 89  ? 0.60258 1.04144 0.86236 0.07213  -0.04034 0.11206  585 LEU A CG  
702  C CD1 . LEU A 89  ? 0.57145 1.02228 0.77761 0.03514  -0.06083 0.11062  585 LEU A CD1 
703  C CD2 . LEU A 89  ? 0.65967 1.04193 0.89314 0.08867  -0.04950 0.13006  585 LEU A CD2 
704  N N   . ARG A 90  ? 0.72339 1.09140 1.03009 0.08141  0.11110  0.01813  586 ARG A N   
705  C CA  . ARG A 90  ? 0.77015 1.09295 1.03236 0.05602  0.15256  -0.01768 586 ARG A CA  
706  C C   . ARG A 90  ? 0.83075 1.07621 1.06962 0.06261  0.18712  -0.02913 586 ARG A C   
707  O O   . ARG A 90  ? 0.83546 1.03346 1.00880 0.02835  0.21152  -0.05718 586 ARG A O   
708  C CB  . ARG A 90  ? 0.78119 1.13855 1.09200 0.05519  0.18720  -0.03601 586 ARG A CB  
709  C CG  . ARG A 90  ? 0.69859 1.12589 1.02310 0.03926  0.16093  -0.03085 586 ARG A CG  
710  C CD  . ARG A 90  ? 0.67900 1.12317 1.02191 0.02265  0.20251  -0.05909 586 ARG A CD  
711  N NE  . ARG A 90  ? 0.55277 1.04425 0.88057 -0.00402 0.18154  -0.05944 586 ARG A NE  
712  C CZ  . ARG A 90  ? 0.57516 1.13975 0.97281 -0.00147 0.18155  -0.05535 586 ARG A CZ  
713  N NH1 . ARG A 90  ? 0.64835 1.25986 1.15029 0.03248  0.19902  -0.04611 586 ARG A NH1 
714  N NH2 . ARG A 90  ? 0.55329 1.14503 0.91822 -0.03352 0.16639  -0.05888 586 ARG A NH2 
715  N N   . GLU A 91  ? 0.88251 1.11159 1.16672 0.10207  0.18972  -0.00659 587 GLU A N   
716  C CA  . GLU A 91  ? 0.96743 1.11004 1.22311 0.10864  0.22658  -0.01567 587 GLU A CA  
717  C C   . GLU A 91  ? 0.96208 1.06569 1.14662 0.08826  0.19812  -0.00996 587 GLU A C   
718  O O   . GLU A 91  ? 1.04152 1.07046 1.19495 0.08900  0.22586  -0.01642 587 GLU A O   
719  C CB  . GLU A 91  ? 1.00922 1.14460 1.34757 0.16584  0.24747  0.01110  587 GLU A CB  
720  C CG  . GLU A 91  ? 1.10946 1.25241 1.51666 0.18677  0.30383  -0.00286 587 GLU A CG  
721  C CD  . GLU A 91  ? 1.14588 1.38215 1.67181 0.23511  0.28355  0.03557  587 GLU A CD  
722  O OE1 . GLU A 91  ? 1.18848 1.44450 1.74724 0.26907  0.24591  0.07836  587 GLU A OE1 
723  O OE2 . GLU A 91  ? 1.13109 1.42382 1.71598 0.23580  0.30442  0.02420  587 GLU A OE2 
724  N N   . LEU A 92  ? 0.82251 0.97007 0.98059 0.06903  0.14978  0.00098  588 LEU A N   
725  C CA  . LEU A 92  ? 0.73283 0.85180 0.83383 0.05046  0.12611  0.00729  588 LEU A CA  
726  C C   . LEU A 92  ? 0.79165 0.88394 0.82584 0.00391  0.14230  -0.02237 588 LEU A C   
727  O O   . LEU A 92  ? 0.66337 0.79184 0.68039 -0.02076 0.13527  -0.03319 588 LEU A O   
728  C CB  . LEU A 92  ? 0.63311 0.80408 0.73439 0.04899  0.07718  0.03091  588 LEU A CB  
729  C CG  . LEU A 92  ? 0.64303 0.79248 0.72687 0.05759  0.05084  0.05563  588 LEU A CG  
730  C CD1 . LEU A 92  ? 0.63103 0.73435 0.73814 0.09060  0.06621  0.07000  588 LEU A CD1 
731  C CD2 . LEU A 92  ? 0.53432 0.73529 0.63154 0.06072  0.01261  0.07866  588 LEU A CD2 
732  N N   . LYS A 93  ? 1.00478 1.03410 0.99782 -0.01116 0.16369  -0.03379 589 LYS A N   
733  C CA  . LYS A 93  ? 1.05839 1.06984 0.98514 -0.06364 0.17516  -0.06004 589 LYS A CA  
734  C C   . LYS A 93  ? 0.92966 0.99492 0.83639 -0.08503 0.13013  -0.04549 589 LYS A C   
735  O O   . LYS A 93  ? 0.91569 0.99133 0.83577 -0.06814 0.10394  -0.02254 589 LYS A O   
736  C CB  . LYS A 93  ? 1.26489 1.19398 1.14906 -0.08070 0.21136  -0.07683 589 LYS A CB  
737  C CG  . LYS A 93  ? 1.38690 1.29101 1.27276 -0.06220 0.19472  -0.05462 589 LYS A CG  
738  C CD  . LYS A 93  ? 1.47793 1.29650 1.30648 -0.09148 0.23293  -0.07537 589 LYS A CD  
739  C CE  . LYS A 93  ? 1.42437 1.23517 1.23609 -0.09562 0.20833  -0.05827 589 LYS A CE  
740  N NZ  . LYS A 93  ? 1.46038 1.17256 1.24929 -0.08185 0.24476  -0.05796 589 LYS A NZ  
741  N N   . GLY A 94  ? 0.85173 0.94918 0.72605 -0.12148 0.12381  -0.05653 590 GLY A N   
742  C CA  . GLY A 94  ? 0.78337 0.93570 0.64684 -0.13740 0.08631  -0.03826 590 GLY A CA  
743  C C   . GLY A 94  ? 0.71699 0.91901 0.60820 -0.11620 0.06318  -0.01900 590 GLY A C   
744  O O   . GLY A 94  ? 0.66132 0.90420 0.54216 -0.12769 0.03994  -0.00286 590 GLY A O   
745  N N   . ALA A 95  ? 0.70134 0.90240 0.62898 -0.08668 0.07114  -0.01864 591 ALA A N   
746  C CA  . ALA A 95  ? 0.64132 0.88245 0.59051 -0.07097 0.05173  -0.00177 591 ALA A CA  
747  C C   . ALA A 95  ? 0.64325 0.89460 0.61150 -0.06683 0.07057  -0.01610 591 ALA A C   
748  O O   . ALA A 95  ? 0.73665 0.96657 0.72951 -0.05611 0.09727  -0.03096 591 ALA A O   
749  C CB  . ALA A 95  ? 0.58632 0.82887 0.56501 -0.04287 0.03378  0.01978  591 ALA A CB  
750  N N   . LYS A 96  ? 0.59821 0.87924 0.55676 -0.07432 0.06144  -0.01065 592 LYS A N   
751  C CA  . LYS A 96  ? 0.67983 0.97890 0.66414 -0.06902 0.07580  -0.02028 592 LYS A CA  
752  C C   . LYS A 96  ? 0.64792 0.97525 0.64362 -0.06003 0.05483  -0.00100 592 LYS A C   
753  O O   . LYS A 96  ? 0.65918 0.98402 0.63166 -0.06077 0.03576  0.01774  592 LYS A O   
754  C CB  . LYS A 96  ? 0.77650 1.06953 0.72181 -0.09802 0.09710  -0.04044 592 LYS A CB  
755  C CG  . LYS A 96  ? 0.80682 1.10011 0.69209 -0.12406 0.08095  -0.03052 592 LYS A CG  
756  C CD  . LYS A 96  ? 0.84925 1.12644 0.68447 -0.15918 0.10301  -0.05213 592 LYS A CD  
757  C CE  . LYS A 96  ? 0.90828 1.14841 0.72583 -0.17871 0.12854  -0.07800 592 LYS A CE  
758  N NZ  . LYS A 96  ? 0.96735 1.18364 0.71592 -0.22492 0.14993  -0.09999 592 LYS A NZ  
759  N N   . LEU A 97  ? 0.53239 0.88583 0.56562 -0.05383 0.06289  -0.00657 593 LEU A N   
760  C CA  . LEU A 97  ? 0.46341 0.84165 0.50124 -0.05524 0.04735  0.00676  593 LEU A CA  
761  C C   . LEU A 97  ? 0.47904 0.84582 0.46275 -0.07611 0.05184  0.00765  593 LEU A C   
762  O O   . LEU A 97  ? 0.61986 0.97736 0.57738 -0.09063 0.06887  -0.00557 593 LEU A O   
763  C CB  . LEU A 97  ? 0.46925 0.89103 0.56516 -0.05038 0.05517  -0.00031 593 LEU A CB  
764  C CG  . LEU A 97  ? 0.47853 0.92470 0.63342 -0.02453 0.03817  0.01604  593 LEU A CG  
765  C CD1 . LEU A 97  ? 0.42158 0.91819 0.65411 -0.01212 0.05434  0.00939  593 LEU A CD1 
766  C CD2 . LEU A 97  ? 0.40333 0.86046 0.54205 -0.03058 0.00559  0.03872  593 LEU A CD2 
767  N N   . VAL A 98  ? 0.44227 0.80213 0.40315 -0.07863 0.03988  0.02464  594 VAL A N   
768  C CA  . VAL A 98  ? 0.45455 0.79320 0.36426 -0.09213 0.04963  0.03109  594 VAL A CA  
769  C C   . VAL A 98  ? 0.50509 0.85431 0.40912 -0.11088 0.06936  0.01396  594 VAL A C   
770  O O   . VAL A 98  ? 0.61120 0.94205 0.47519 -0.12280 0.08425  0.01090  594 VAL A O   
771  C CB  . VAL A 98  ? 0.55552 0.87019 0.44013 -0.08995 0.04379  0.05161  594 VAL A CB  
772  C CG1 . VAL A 98  ? 0.47291 0.75786 0.30788 -0.10209 0.06382  0.05829  594 VAL A CG1 
773  C CG2 . VAL A 98  ? 0.52413 0.82543 0.40820 -0.07403 0.03196  0.06875  594 VAL A CG2 
774  N N   . ILE A 99  ? 0.53087 0.89749 0.48569 -0.06104 0.12076  0.26408  595 ILE A N   
775  C CA  . ILE A 99  ? 0.57761 0.92215 0.53230 -0.06047 0.13694  0.26734  595 ILE A CA  
776  C C   . ILE A 99  ? 0.69928 1.02133 0.62367 -0.07118 0.15826  0.25911  595 ILE A C   
777  O O   . ILE A 99  ? 0.58454 0.88663 0.48247 -0.07467 0.16726  0.26050  595 ILE A O   
778  C CB  . ILE A 99  ? 0.48919 0.83880 0.49189 -0.05532 0.14452  0.27034  595 ILE A CB  
779  C CG1 . ILE A 99  ? 0.50842 0.84169 0.51103 -0.05799 0.16040  0.27143  595 ILE A CG1 
780  C CG2 . ILE A 99  ? 0.48510 0.83563 0.50976 -0.05621 0.15779  0.26542  595 ILE A CG2 
781  C CD1 . ILE A 99  ? 0.48459 0.83188 0.53494 -0.05377 0.16553  0.27281  595 ILE A CD1 
782  N N   . ASP A 100 ? 0.71175 1.03380 0.63221 -0.07845 0.16681  0.25014  596 ASP A N   
783  C CA  . ASP A 100 ? 0.72861 1.03051 0.62092 -0.09012 0.18919  0.24029  596 ASP A CA  
784  C C   . ASP A 100 ? 0.77041 1.06848 0.60979 -0.09761 0.18188  0.23647  596 ASP A C   
785  O O   . ASP A 100 ? 0.88576 1.17218 0.69708 -0.10983 0.19669  0.22557  596 ASP A O   
786  C CB  . ASP A 100 ? 0.72265 1.02270 0.62419 -0.09613 0.20151  0.23220  596 ASP A CB  
787  C CG  . ASP A 100 ? 0.80954 1.10687 0.75561 -0.08744 0.21803  0.23586  596 ASP A CG  
788  O OD1 . ASP A 100 ? 0.85095 1.15167 0.82209 -0.07979 0.22217  0.24067  596 ASP A OD1 
789  O OD2 . ASP A 100 ? 0.81158 1.09793 0.76629 -0.08738 0.22522  0.22985  596 ASP A OD2 
790  N N   . VAL A 101 ? 0.67841 0.98599 0.50264 -0.08948 0.16001  0.24522  597 VAL A N   
791  C CA  . VAL A 101 ? 0.67900 0.99563 0.45795 -0.09072 0.14398  0.24327  597 VAL A CA  
792  C C   . VAL A 101 ? 0.70299 1.00727 0.46369 -0.07857 0.13209  0.25706  597 VAL A C   
793  O O   . VAL A 101 ? 0.76254 1.06787 0.48248 -0.07323 0.11635  0.25968  597 VAL A O   
794  C CB  . VAL A 101 ? 0.72277 1.07663 0.51058 -0.09166 0.12497  0.23641  597 VAL A CB  
795  C CG1 . VAL A 101 ? 0.63503 1.01770 0.39561 -0.08380 0.09759  0.23699  597 VAL A CG1 
796  C CG2 . VAL A 101 ? 0.81291 1.16398 0.59182 -0.10956 0.14103  0.22008  597 VAL A CG2 
797  N N   . ILE A 102 ? 0.65624 0.94467 0.44396 -0.07468 0.14143  0.26494  598 ILE A N   
798  C CA  . ILE A 102 ? 0.79365 1.05604 0.55974 -0.06856 0.13918  0.27661  598 ILE A CA  
799  C C   . ILE A 102 ? 0.88467 1.11345 0.64223 -0.08166 0.16880  0.27383  598 ILE A C   
800  O O   . ILE A 102 ? 0.88238 1.11684 0.67772 -0.08842 0.18788  0.26605  598 ILE A O   
801  C CB  . ILE A 102 ? 0.64539 0.92024 0.44796 -0.05644 0.12555  0.28583  598 ILE A CB  
802  C CG1 . ILE A 102 ? 0.60789 0.92342 0.42854 -0.04708 0.10115  0.28404  598 ILE A CG1 
803  C CG2 . ILE A 102 ? 0.68107 0.92499 0.45125 -0.04917 0.11973  0.29786  598 ILE A CG2 
804  C CD1 . ILE A 102 ? 0.57000 0.90223 0.42735 -0.03608 0.08754  0.29125  598 ILE A CD1 
805  N N   . ARG A 103 ? 0.76825 0.96209 0.47386 -0.08497 0.17292  0.27928  599 ARG A N   
806  C CA  . ARG A 103 ? 0.80404 0.96326 0.49727 -0.09907 0.20110  0.27761  599 ARG A CA  
807  C C   . ARG A 103 ? 0.82476 0.96045 0.51293 -0.09532 0.19759  0.28975  599 ARG A C   
808  O O   . ARG A 103 ? 0.82900 0.95624 0.49100 -0.08150 0.17427  0.30127  599 ARG A O   
809  C CB  . ARG A 103 ? 0.94615 1.07397 0.57647 -0.10935 0.21267  0.27476  599 ARG A CB  
810  C CG  . ARG A 103 ? 1.03924 1.18508 0.66602 -0.11616 0.21922  0.26105  599 ARG A CG  
811  C CD  . ARG A 103 ? 1.17943 1.29339 0.74720 -0.12731 0.23548  0.25734  599 ARG A CD  
812  N NE  . ARG A 103 ? 1.24241 1.36221 0.76245 -0.12156 0.21237  0.25855  599 ARG A NE  
813  C CZ  . ARG A 103 ? 1.19292 1.33338 0.70557 -0.12872 0.21333  0.24485  599 ARG A CZ  
814  N NH1 . ARG A 103 ? 1.14594 1.29713 0.61619 -0.12400 0.19041  0.24445  599 ARG A NH1 
815  N NH2 . ARG A 103 ? 1.14687 1.29782 0.69479 -0.14005 0.23677  0.23035  599 ARG A NH2 
816  N N   . TYR A 104 ? 0.83795 0.96326 0.54987 -0.10802 0.22154  0.28559  600 TYR A N   
817  C CA  . TYR A 104 ? 0.88519 0.99299 0.60172 -0.10856 0.22155  0.29403  600 TYR A CA  
818  C C   . TYR A 104 ? 0.97182 1.04130 0.66248 -0.13092 0.25280  0.28954  600 TYR A C   
819  O O   . TYR A 104 ? 0.87956 0.95693 0.58477 -0.14487 0.27778  0.27548  600 TYR A O   
820  C CB  . TYR A 104 ? 0.81492 0.96554 0.60437 -0.10177 0.21555  0.29107  600 TYR A CB  
821  C CG  . TYR A 104 ? 0.86658 1.05300 0.71012 -0.10600 0.22997  0.27648  600 TYR A CG  
822  C CD1 . TYR A 104 ? 0.81351 1.02897 0.67806 -0.09584 0.21779  0.27306  600 TYR A CD1 
823  C CD2 . TYR A 104 ? 0.91013 1.10090 0.78249 -0.12001 0.25616  0.26541  600 TYR A CD2 
824  C CE1 . TYR A 104 ? 0.79517 1.03527 0.70372 -0.09698 0.23080  0.26184  600 TYR A CE1 
825  C CE2 . TYR A 104 ? 0.84515 1.06906 0.76689 -0.11922 0.26785  0.25268  600 TYR A CE2 
826  C CZ  . TYR A 104 ? 0.79287 1.03782 0.73089 -0.10633 0.25493  0.25239  600 TYR A CZ  
827  O OH  . TYR A 104 ? 0.75047 1.02164 0.73307 -0.10287 0.26696  0.24207  600 TYR A OH  
828  N N   . GLU A 105 ? 1.20336 1.23068 0.85708 -0.13510 0.25303  0.30049  601 GLU A N   
829  C CA  . GLU A 105 ? 1.44047 1.41586 1.04449 -0.15642 0.28130  0.29867  601 GLU A CA  
830  C C   . GLU A 105 ? 1.37872 1.37622 1.03892 -0.17243 0.31182  0.28118  601 GLU A C   
831  O O   . GLU A 105 ? 1.43349 1.49077 1.13069 -0.17019 0.32240  0.29103  601 GLU A O   
832  C CB  . GLU A 105 ? 1.67498 1.59671 1.21971 -0.15499 0.26617  0.31434  601 GLU A CB  
833  C CG  . GLU A 105 ? 1.80892 1.69971 1.28841 -0.13601 0.23636  0.33117  601 GLU A CG  
834  C CD  . GLU A 105 ? 1.86111 1.75442 1.31241 -0.12449 0.23643  0.32824  601 GLU A CD  
835  O OE1 . GLU A 105 ? 1.92127 1.85786 1.39999 -0.12286 0.25809  0.33804  601 GLU A OE1 
836  O OE2 . GLU A 105 ? 1.78348 1.69943 1.22715 -0.10654 0.20735  0.33325  601 GLU A OE2 
837  N N   . PRO A 106 ? 1.15014 1.16931 0.85064 -0.18405 0.31192  0.27697  602 PRO A N   
838  C CA  . PRO A 106 ? 1.06698 1.15496 0.83361 -0.20609 0.32284  0.26182  602 PRO A CA  
839  C C   . PRO A 106 ? 0.96066 1.07956 0.78900 -0.18706 0.32979  0.24908  602 PRO A C   
840  O O   . PRO A 106 ? 0.91772 1.05102 0.75724 -0.16322 0.30193  0.26003  602 PRO A O   
841  C CB  . PRO A 106 ? 0.90246 1.00272 0.70452 -0.19872 0.32828  0.28182  602 PRO A CB  
842  C CG  . PRO A 106 ? 0.94004 0.98922 0.68095 -0.19470 0.30756  0.29968  602 PRO A CG  
843  C CD  . PRO A 106 ? 1.06072 1.06785 0.75916 -0.17958 0.29802  0.29025  602 PRO A CD  
844  N N   . PRO A 107 ? 0.97219 1.13424 0.85335 -0.19683 0.34794  0.22939  603 PRO A N   
845  C CA  . PRO A 107 ? 0.89234 1.10721 0.84074 -0.17578 0.33738  0.22401  603 PRO A CA  
846  C C   . PRO A 107 ? 0.81865 1.06638 0.82006 -0.16363 0.32039  0.22716  603 PRO A C   
847  O O   . PRO A 107 ? 0.74796 1.03127 0.79267 -0.14305 0.30276  0.22888  603 PRO A O   
848  C CB  . PRO A 107 ? 0.81953 1.06870 0.79992 -0.18934 0.36361  0.20223  603 PRO A CB  
849  C CG  . PRO A 107 ? 0.82394 1.07266 0.76895 -0.20034 0.36991  0.21861  603 PRO A CG  
850  C CD  . PRO A 107 ? 0.90617 1.11558 0.81602 -0.20203 0.36230  0.23810  603 PRO A CD  
851  N N   . HIS A 108 ? 0.80302 1.03645 0.79700 -0.17735 0.32534  0.22831  604 HIS A N   
852  C CA  . HIS A 108 ? 0.81402 1.07599 0.85167 -0.16816 0.30838  0.23134  604 HIS A CA  
853  C C   . HIS A 108 ? 0.80081 1.05903 0.82902 -0.14473 0.27536  0.25029  604 HIS A C   
854  O O   . HIS A 108 ? 0.73416 1.02995 0.80869 -0.13071 0.25700  0.25142  604 HIS A O   
855  C CB  . HIS A 108 ? 0.89001 1.12638 0.90876 -0.19058 0.32240  0.22963  604 HIS A CB  
856  C CG  . HIS A 108 ? 1.10165 1.32154 1.10201 -0.21943 0.35623  0.21313  604 HIS A CG  
857  N ND1 . HIS A 108 ? 1.19209 1.40809 1.15222 -0.21670 0.34881  0.24342  604 HIS A ND1 
858  C CD2 . HIS A 108 ? 1.14691 1.41093 1.21875 -0.20982 0.37345  0.21608  604 HIS A CD2 
859  C CE1 . HIS A 108 ? 1.23819 1.45799 1.21057 -0.23055 0.37929  0.23737  604 HIS A CE1 
860  N NE2 . HIS A 108 ? 1.20047 1.47047 1.23791 -0.23354 0.38556  0.22259  604 HIS A NE2 
861  N N   . ILE A 109 ? 0.83640 1.05208 0.80409 -0.14064 0.26723  0.26388  605 ILE A N   
862  C CA  . ILE A 109 ? 0.73388 0.94568 0.68650 -0.12049 0.23724  0.28002  605 ILE A CA  
863  C C   . ILE A 109 ? 0.68644 0.93977 0.67729 -0.10233 0.21947  0.27852  605 ILE A C   
864  O O   . ILE A 109 ? 0.65542 0.92342 0.65532 -0.08755 0.19515  0.28733  605 ILE A O   
865  C CB  . ILE A 109 ? 0.72595 0.88335 0.60157 -0.12085 0.23484  0.29190  605 ILE A CB  
866  C CG1 . ILE A 109 ? 0.78033 0.89022 0.61616 -0.13502 0.24594  0.29841  605 ILE A CG1 
867  C CG2 . ILE A 109 ? 0.71114 0.87147 0.56767 -0.09793 0.20394  0.30456  605 ILE A CG2 
868  C CD1 . ILE A 109 ? 0.75291 0.87828 0.62349 -0.13340 0.23847  0.30119  605 ILE A CD1 
869  N N   . LYS A 110 ? 0.70948 0.98199 0.72420 -0.10423 0.23290  0.26671  606 LYS A N   
870  C CA  . LYS A 110 ? 0.61262 0.91558 0.65754 -0.08892 0.21957  0.26575  606 LYS A CA  
871  C C   . LYS A 110 ? 0.51208 0.85043 0.60525 -0.07726 0.20077  0.26872  606 LYS A C   
872  O O   . LYS A 110 ? 0.48454 0.83658 0.58397 -0.06478 0.18119  0.27434  606 LYS A O   
873  C CB  . LYS A 110 ? 0.58736 0.90305 0.65411 -0.09244 0.24113  0.25250  606 LYS A CB  
874  C CG  . LYS A 110 ? 0.69831 1.03352 0.78527 -0.07784 0.23077  0.25328  606 LYS A CG  
875  C CD  . LYS A 110 ? 0.78159 1.13811 0.90780 -0.07483 0.25043  0.24201  606 LYS A CD  
876  C CE  . LYS A 110 ? 0.85292 1.24298 1.03355 -0.07305 0.25694  0.23458  606 LYS A CE  
877  N NZ  . LYS A 110 ? 0.90483 1.31228 1.10718 -0.06732 0.23438  0.24210  606 LYS A NZ  
878  N N   . LYS A 111 ? 0.50434 0.85714 0.62777 -0.08348 0.20631  0.26410  607 LYS A N   
879  C CA  . LYS A 111 ? 0.46172 0.84737 0.62626 -0.07360 0.18718  0.26644  607 LYS A CA  
880  C C   . LYS A 111 ? 0.45468 0.82966 0.59600 -0.06824 0.16582  0.27919  607 LYS A C   
881  O O   . LYS A 111 ? 0.41931 0.81848 0.58254 -0.05735 0.14584  0.28297  607 LYS A O   
882  C CB  . LYS A 111 ? 0.45801 0.86603 0.66084 -0.08323 0.19856  0.25488  607 LYS A CB  
883  C CG  . LYS A 111 ? 0.42074 0.86106 0.66138 -0.07572 0.17881  0.25540  607 LYS A CG  
884  C CD  . LYS A 111 ? 0.51615 0.99383 0.80640 -0.07889 0.18790  0.23929  607 LYS A CD  
885  C CE  . LYS A 111 ? 0.55030 1.02562 0.84174 -0.09864 0.19873  0.23046  607 LYS A CE  
886  N NZ  . LYS A 111 ? 0.65755 1.17519 0.99582 -0.09659 0.18868  0.21926  607 LYS A NZ  
887  N N   . ALA A 112 ? 0.49198 0.83016 0.58658 -0.07473 0.16965  0.28627  608 ALA A N   
888  C CA  . ALA A 112 ? 0.48797 0.81892 0.56117 -0.06543 0.14894  0.29870  608 ALA A CA  
889  C C   . ALA A 112 ? 0.47272 0.81311 0.53288 -0.05217 0.13143  0.30248  608 ALA A C   
890  O O   . ALA A 112 ? 0.44504 0.80613 0.51523 -0.04251 0.11137  0.30718  608 ALA A O   
891  C CB  . ALA A 112 ? 0.54142 0.82474 0.56250 -0.07209 0.15648  0.30714  608 ALA A CB  
892  N N   . LEU A 113 ? 0.49114 0.81970 0.53036 -0.05400 0.14023  0.29831  609 LEU A N   
893  C CA  . LEU A 113 ? 0.48045 0.81937 0.50661 -0.04569 0.12609  0.29866  609 LEU A CA  
894  C C   . LEU A 113 ? 0.43886 0.81120 0.50784 -0.04118 0.11883  0.29403  609 LEU A C   
895  O O   . LEU A 113 ? 0.41791 0.80737 0.48633 -0.03519 0.10127  0.29565  609 LEU A O   
896  C CB  . LEU A 113 ? 0.51680 0.83247 0.50623 -0.05172 0.13939  0.29423  609 LEU A CB  
897  C CG  . LEU A 113 ? 0.59588 0.87549 0.53050 -0.05271 0.13896  0.30173  609 LEU A CG  
898  C CD1 . LEU A 113 ? 0.60853 0.86039 0.50913 -0.06407 0.15917  0.29641  609 LEU A CD1 
899  C CD2 . LEU A 113 ? 0.56823 0.85463 0.47557 -0.03922 0.11357  0.30800  609 LEU A CD2 
900  N N   . GLN A 114 ? 0.42779 0.80970 0.53194 -0.04386 0.13235  0.28800  610 GLN A N   
901  C CA  . GLN A 114 ? 0.39485 0.80373 0.53739 -0.03705 0.12480  0.28659  610 GLN A CA  
902  C C   . GLN A 114 ? 0.37854 0.80885 0.53871 -0.03205 0.10367  0.29162  610 GLN A C   
903  O O   . GLN A 114 ? 0.37081 0.81624 0.53906 -0.02747 0.09022  0.29306  610 GLN A O   
904  C CB  . GLN A 114 ? 0.39292 0.81337 0.57270 -0.03723 0.14120  0.28052  610 GLN A CB  
905  C CG  . GLN A 114 ? 0.50083 0.91411 0.67997 -0.03714 0.15995  0.27516  610 GLN A CG  
906  C CD  . GLN A 114 ? 0.53596 0.96779 0.75598 -0.03575 0.17744  0.26743  610 GLN A CD  
907  O OE1 . GLN A 114 ? 0.49866 0.93155 0.72439 -0.04462 0.18676  0.26119  610 GLN A OE1 
908  N NE2 . GLN A 114 ? 0.52704 0.97478 0.77584 -0.02461 0.18316  0.26735  610 GLN A NE2 
909  N N   . TYR A 115 ? 0.36596 0.79529 0.52876 -0.03504 0.10235  0.29380  611 TYR A N   
910  C CA  . TYR A 115 ? 0.34172 0.78985 0.51718 -0.03170 0.08411  0.29777  611 TYR A CA  
911  C C   . TYR A 115 ? 0.35823 0.80851 0.50658 -0.02700 0.06878  0.30288  611 TYR A C   
912  O O   . TYR A 115 ? 0.44906 0.92293 0.61040 -0.02386 0.05331  0.30274  611 TYR A O   
913  C CB  . TYR A 115 ? 0.35316 0.79339 0.53089 -0.03833 0.09047  0.29873  611 TYR A CB  
914  C CG  . TYR A 115 ? 0.33568 0.79072 0.52074 -0.03629 0.07502  0.30299  611 TYR A CG  
915  C CD1 . TYR A 115 ? 0.30813 0.78963 0.52867 -0.03617 0.06517  0.29698  611 TYR A CD1 
916  C CD2 . TYR A 115 ? 0.35323 0.79246 0.50547 -0.03304 0.06971  0.31201  611 TYR A CD2 
917  C CE1 . TYR A 115 ? 0.29440 0.78924 0.52085 -0.03595 0.05230  0.29833  611 TYR A CE1 
918  C CE2 . TYR A 115 ? 0.35033 0.79823 0.50882 -0.02877 0.05476  0.31040  611 TYR A CE2 
919  C CZ  . TYR A 115 ? 0.38522 0.86686 0.58415 -0.03317 0.04925  0.30608  611 TYR A CZ  
920  O OH  . TYR A 115 ? 0.40076 0.89057 0.60451 -0.03063 0.03621  0.30267  611 TYR A OH  
921  N N   . ALA A 116 ? 0.36937 0.79650 0.47768 -0.02657 0.07227  0.30615  612 ALA A N   
922  C CA  . ALA A 116 ? 0.37124 0.80559 0.45319 -0.01953 0.05566  0.30940  612 ALA A CA  
923  C C   . ALA A 116 ? 0.40544 0.85427 0.48153 -0.02052 0.05003  0.30259  612 ALA A C   
924  O O   . ALA A 116 ? 0.34948 0.82101 0.42156 -0.01710 0.03381  0.29991  612 ALA A O   
925  C CB  . ALA A 116 ? 0.41475 0.81659 0.45079 -0.01507 0.05731  0.31493  612 ALA A CB  
926  N N   . CYS A 117 ? 0.37395 0.80906 0.44761 -0.02622 0.06397  0.29733  613 CYS A N   
927  C CA  . CYS A 117 ? 0.37379 0.81591 0.43708 -0.03041 0.06212  0.29029  613 CYS A CA  
928  C C   . CYS A 117 ? 0.43980 0.89130 0.53254 -0.03282 0.06297  0.28763  613 CYS A C   
929  O O   . CYS A 117 ? 0.36538 0.82946 0.45325 -0.03720 0.05467  0.28325  613 CYS A O   
930  C CB  . CYS A 117 ? 0.40735 0.82472 0.44187 -0.03589 0.07782  0.28587  613 CYS A CB  
931  S SG  . CYS A 117 ? 0.44652 0.84199 0.43617 -0.03333 0.07875  0.29019  613 CYS A SG  
932  N N   . GLY A 118 ? 0.32597 0.65774 0.50575 -0.01139 0.04199  0.22563  614 GLY A N   
933  C CA  . GLY A 118 ? 0.25256 0.59830 0.44699 -0.00157 0.04220  0.23672  614 GLY A CA  
934  C C   . GLY A 118 ? 0.34397 0.67630 0.54101 0.00857  0.05615  0.23689  614 GLY A C   
935  O O   . GLY A 118 ? 0.42881 0.75217 0.62361 0.00861  0.07017  0.23195  614 GLY A O   
936  N N   . ASN A 119 ? 0.38286 0.71126 0.58179 0.01495  0.05436  0.24110  615 ASN A N   
937  C CA  . ASN A 119 ? 0.35526 0.66718 0.55562 0.02278  0.07035  0.24039  615 ASN A CA  
938  C C   . ASN A 119 ? 0.35913 0.65024 0.53843 0.01528  0.06787  0.22840  615 ASN A C   
939  O O   . ASN A 119 ? 0.39264 0.67002 0.57017 0.01890  0.07733  0.22803  615 ASN A O   
940  C CB  . ASN A 119 ? 0.22852 0.55141 0.45036 0.03693  0.07389  0.25753  615 ASN A CB  
941  C CG  . ASN A 119 ? 0.42139 0.76690 0.66584 0.04519  0.07829  0.27263  615 ASN A CG  
942  O OD1 . ASN A 119 ? 0.38882 0.73580 0.63472 0.04233  0.08601  0.26731  615 ASN A OD1 
943  N ND2 . ASN A 119 ? 0.42494 0.78998 0.68605 0.05418  0.07315  0.29292  615 ASN A ND2 
944  N N   . ALA A 120 ? 0.24479 0.53355 0.40928 0.00487  0.05604  0.22006  616 ALA A N   
945  C CA  . ALA A 120 ? 0.23562 0.50909 0.38193 -0.00239 0.05300  0.21111  616 ALA A CA  
946  C C   . ALA A 120 ? 0.31636 0.57290 0.44750 -0.00768 0.06958  0.20431  616 ALA A C   
947  O O   . ALA A 120 ? 0.34363 0.59869 0.47342 -0.00898 0.08176  0.20294  616 ALA A O   
948  C CB  . ALA A 120 ? 0.21563 0.49092 0.35370 -0.00992 0.04088  0.20718  616 ALA A CB  
949  N N   . LEU A 121 ? 0.28416 0.52768 0.40190 -0.01293 0.07160  0.19938  617 LEU A N   
950  C CA  . LEU A 121 ? 0.34312 0.56824 0.43982 -0.02324 0.08898  0.19135  617 LEU A CA  
951  C C   . LEU A 121 ? 0.43181 0.65596 0.50598 -0.03768 0.07864  0.18558  617 LEU A C   
952  O O   . LEU A 121 ? 0.35543 0.58766 0.43405 -0.03653 0.06216  0.18788  617 LEU A O   
953  C CB  . LEU A 121 ? 0.32839 0.53795 0.42717 -0.01973 0.10370  0.19166  617 LEU A CB  
954  C CG  . LEU A 121 ? 0.36087 0.57157 0.48578 -0.00248 0.11761  0.20160  617 LEU A CG  
955  C CD1 . LEU A 121 ? 0.30178 0.49486 0.42971 0.00233  0.13013  0.20430  617 LEU A CD1 
956  C CD2 . LEU A 121 ? 0.37951 0.58334 0.50368 -0.00254 0.13961  0.19829  617 LEU A CD2 
957  N N   . VAL A 122 ? 0.47451 0.69105 0.52518 -0.05152 0.08896  0.17919  618 VAL A N   
958  C CA  . VAL A 122 ? 0.32582 0.54682 0.35494 -0.06640 0.07896  0.17672  618 VAL A CA  
959  C C   . VAL A 122 ? 0.50098 0.70521 0.50505 -0.08243 0.09530  0.16756  618 VAL A C   
960  O O   . VAL A 122 ? 0.53716 0.72272 0.52955 -0.08777 0.12048  0.16047  618 VAL A O   
961  C CB  . VAL A 122 ? 0.40625 0.63685 0.42488 -0.07287 0.07410  0.17863  618 VAL A CB  
962  C CG1 . VAL A 122 ? 0.50264 0.72030 0.50877 -0.07787 0.09673  0.17247  618 VAL A CG1 
963  C CG2 . VAL A 122 ? 0.42455 0.66769 0.42405 -0.08795 0.06137  0.18009  618 VAL A CG2 
964  N N   . CYS A 123 ? 0.44761 0.65816 0.44511 -0.09052 0.08337  0.16739  619 CYS A N   
965  C CA  . CYS A 123 ? 0.46444 0.66324 0.43551 -0.11066 0.09497  0.15799  619 CYS A CA  
966  C C   . CYS A 123 ? 0.56978 0.79220 0.52216 -0.12878 0.07667  0.15869  619 CYS A C   
967  O O   . CYS A 123 ? 0.57448 0.82197 0.54113 -0.12178 0.05500  0.16966  619 CYS A O   
968  C CB  . CYS A 123 ? 0.45876 0.64912 0.43976 -0.10706 0.09575  0.15797  619 CYS A CB  
969  S SG  . CYS A 123 ? 0.55307 0.73428 0.56676 -0.08077 0.10159  0.16527  619 CYS A SG  
970  N N   . ASP A 124 ? 0.64030 0.85615 0.56180 -0.15341 0.08595  0.14730  620 ASP A N   
971  C CA  . ASP A 124 ? 0.75542 0.99962 0.65591 -0.17554 0.06799  0.14792  620 ASP A CA  
972  C C   . ASP A 124 ? 0.70612 0.97869 0.61963 -0.17849 0.04492  0.15662  620 ASP A C   
973  O O   . ASP A 124 ? 0.83450 1.14332 0.74673 -0.18874 0.02403  0.16628  620 ASP A O   
974  C CB  . ASP A 124 ? 0.94478 1.17296 0.80266 -0.20596 0.08590  0.12886  620 ASP A CB  
975  C CG  . ASP A 124 ? 1.10568 1.31801 0.94759 -0.20720 0.10383  0.12230  620 ASP A CG  
976  O OD1 . ASP A 124 ? 1.14191 1.37231 0.99587 -0.19574 0.09140  0.13467  620 ASP A OD1 
977  O OD2 . ASP A 124 ? 1.19213 1.37195 1.01063 -0.21928 0.13220  0.10426  620 ASP A OD2 
978  N N   . ASN A 125 ? 0.57351 0.83342 0.50212 -0.16940 0.04874  0.15548  621 ASN A N   
979  C CA  . ASN A 125 ? 0.53448 0.82129 0.47756 -0.17107 0.02902  0.16380  621 ASN A CA  
980  C C   . ASN A 125 ? 0.49141 0.76514 0.46430 -0.14651 0.03022  0.16840  621 ASN A C   
981  O O   . ASN A 125 ? 0.47292 0.71774 0.45179 -0.13273 0.04653  0.16434  621 ASN A O   
982  C CB  . ASN A 125 ? 0.50710 0.79687 0.42211 -0.20211 0.03161  0.15203  621 ASN A CB  
983  C CG  . ASN A 125 ? 0.58886 0.83217 0.48244 -0.21112 0.06163  0.13290  621 ASN A CG  
984  O OD1 . ASN A 125 ? 0.62709 0.84932 0.53345 -0.20153 0.07156  0.13133  621 ASN A OD1 
985  N ND2 . ASN A 125 ? 0.67112 0.89697 0.53280 -0.22931 0.07811  0.11873  621 ASN A ND2 
986  N N   . VAL A 126 ? 0.49283 0.79158 0.48486 -0.14229 0.01282  0.17800  622 VAL A N   
987  C CA  . VAL A 126 ? 0.31568 0.60686 0.33465 -0.12051 0.01108  0.18250  622 VAL A CA  
988  C C   . VAL A 126 ? 0.39457 0.65408 0.40598 -0.12264 0.02862  0.17208  622 VAL A C   
989  O O   . VAL A 126 ? 0.52543 0.76555 0.55016 -0.10493 0.03638  0.17254  622 VAL A O   
990  C CB  . VAL A 126 ? 0.34377 0.66852 0.38295 -0.11775 -0.00764 0.19483  622 VAL A CB  
991  C CG1 . VAL A 126 ? 0.25193 0.56509 0.30994 -0.10202 -0.00606 0.19516  622 VAL A CG1 
992  C CG2 . VAL A 126 ? 0.39983 0.75016 0.45771 -0.10697 -0.02037 0.20908  622 VAL A CG2 
993  N N   . GLU A 127 ? 0.46602 0.72111 0.45584 -0.14590 0.03543  0.16321  623 GLU A N   
994  C CA  . GLU A 127 ? 0.46352 0.68629 0.44746 -0.14912 0.05452  0.15469  623 GLU A CA  
995  C C   . GLU A 127 ? 0.54524 0.73210 0.52399 -0.14116 0.07925  0.15025  623 GLU A C   
996  O O   . GLU A 127 ? 0.51673 0.68015 0.50599 -0.12932 0.09249  0.15222  623 GLU A O   
997  C CB  . GLU A 127 ? 0.42075 0.64422 0.37933 -0.17999 0.05851  0.14348  623 GLU A CB  
998  C CG  . GLU A 127 ? 0.61302 0.86927 0.58384 -0.18496 0.03842  0.15000  623 GLU A CG  
999  C CD  . GLU A 127 ? 0.68682 0.93692 0.68559 -0.16107 0.03630  0.15787  623 GLU A CD  
1000 O OE1 . GLU A 127 ? 0.60898 0.82697 0.60527 -0.15956 0.05344  0.15232  623 GLU A OE1 
1001 O OE2 . GLU A 127 ? 0.69558 0.97160 0.71774 -0.14433 0.01902  0.16991  623 GLU A OE2 
1002 N N   . ASP A 128 ? 0.55703 0.74198 0.52174 -0.14648 0.08576  0.14655  624 ASP A N   
1003 C CA  . ASP A 128 ? 0.59391 0.75147 0.56038 -0.13512 0.10903  0.14572  624 ASP A CA  
1004 C C   . ASP A 128 ? 0.53464 0.70026 0.53261 -0.10611 0.09877  0.15797  624 ASP A C   
1005 O O   . ASP A 128 ? 0.47460 0.62248 0.48624 -0.09179 0.11213  0.16200  624 ASP A O   
1006 C CB  . ASP A 128 ? 0.76569 0.92336 0.70973 -0.14798 0.11659  0.13840  624 ASP A CB  
1007 C CG  . ASP A 128 ? 0.83695 0.97012 0.74532 -0.17634 0.13854  0.12002  624 ASP A CG  
1008 O OD1 . ASP A 128 ? 0.81889 0.93034 0.72184 -0.18480 0.15074  0.11311  624 ASP A OD1 
1009 O OD2 . ASP A 128 ? 0.84846 0.98147 0.73215 -0.19133 0.14371  0.11032  624 ASP A OD2 
1010 N N   . ALA A 129 ? 0.43876 0.63280 0.44910 -0.09798 0.07467  0.16451  625 ALA A N   
1011 C CA  . ALA A 129 ? 0.39155 0.59413 0.42837 -0.07493 0.06448  0.17309  625 ALA A CA  
1012 C C   . ALA A 129 ? 0.40856 0.60816 0.46183 -0.06364 0.06074  0.17718  625 ALA A C   
1013 O O   . ALA A 129 ? 0.34660 0.54377 0.41668 -0.04779 0.06240  0.18277  625 ALA A O   
1014 C CB  . ALA A 129 ? 0.32375 0.55282 0.36895 -0.07174 0.04361  0.17859  625 ALA A CB  
1015 N N   . ARG A 130 ? 0.35487 0.55748 0.40320 -0.07294 0.05553  0.17524  626 ARG A N   
1016 C CA  . ARG A 130 ? 0.35307 0.55188 0.41332 -0.06477 0.05316  0.17838  626 ARG A CA  
1017 C C   . ARG A 130 ? 0.32795 0.49932 0.38571 -0.06210 0.07359  0.17879  626 ARG A C   
1018 O O   . ARG A 130 ? 0.35625 0.52642 0.42973 -0.04721 0.07227  0.18618  626 ARG A O   
1019 C CB  . ARG A 130 ? 0.34411 0.55362 0.39924 -0.07738 0.04481  0.17610  626 ARG A CB  
1020 C CG  . ARG A 130 ? 0.25153 0.46341 0.31977 -0.06896 0.03882  0.17953  626 ARG A CG  
1021 C CD  . ARG A 130 ? 0.38467 0.61351 0.45137 -0.08077 0.02970  0.17868  626 ARG A CD  
1022 N NE  . ARG A 130 ? 0.45939 0.67616 0.50702 -0.10125 0.04101  0.17153  626 ARG A NE  
1023 C CZ  . ARG A 130 ? 0.49812 0.69363 0.54078 -0.10587 0.05324  0.16849  626 ARG A CZ  
1024 N NH1 . ARG A 130 ? 0.52953 0.71749 0.58474 -0.09045 0.05317  0.17355  626 ARG A NH1 
1025 N NH2 . ARG A 130 ? 0.41722 0.59944 0.44093 -0.12785 0.06570  0.16028  626 ARG A NH2 
1026 N N   . ARG A 131 ? 0.37189 0.52152 0.41010 -0.07717 0.09406  0.17194  627 ARG A N   
1027 C CA  . ARG A 131 ? 0.46421 0.58266 0.50174 -0.07414 0.11858  0.17374  627 ARG A CA  
1028 C C   . ARG A 131 ? 0.45473 0.57081 0.51157 -0.05252 0.12617  0.18286  627 ARG A C   
1029 O O   . ARG A 131 ? 0.36606 0.47039 0.43935 -0.03652 0.13520  0.19285  627 ARG A O   
1030 C CB  . ARG A 131 ? 0.55743 0.65017 0.56693 -0.09952 0.14313  0.16196  627 ARG A CB  
1031 C CG  . ARG A 131 ? 0.75356 0.80899 0.76112 -0.09995 0.16841  0.16221  627 ARG A CG  
1032 C CD  . ARG A 131 ? 0.87377 0.89563 0.85471 -0.12117 0.19801  0.14645  627 ARG A CD  
1033 N NE  . ARG A 131 ? 0.90096 0.90430 0.88906 -0.10513 0.21695  0.14547  627 ARG A NE  
1034 C CZ  . ARG A 131 ? 0.93914 0.94686 0.91041 -0.11659 0.22235  0.13526  627 ARG A CZ  
1035 N NH1 . ARG A 131 ? 0.92288 0.95457 0.86912 -0.14309 0.20718  0.12628  627 ARG A NH1 
1036 N NH2 . ARG A 131 ? 0.90599 0.89682 0.88736 -0.10012 0.24147  0.13507  627 ARG A NH2 
1037 N N   . ILE A 132 ? 0.33760 0.46667 0.39479 -0.05105 0.12277  0.18127  628 ILE A N   
1038 C CA  . ILE A 132 ? 0.39214 0.52432 0.47098 -0.03097 0.12933  0.19066  628 ILE A CA  
1039 C C   . ILE A 132 ? 0.34109 0.50016 0.44550 -0.01309 0.10735  0.20299  628 ILE A C   
1040 O O   . ILE A 132 ? 0.34365 0.50627 0.47075 0.00463  0.11241  0.21637  628 ILE A O   
1041 C CB  . ILE A 132 ? 0.50881 0.64728 0.57881 -0.03703 0.13279  0.18451  628 ILE A CB  
1042 C CG1 . ILE A 132 ? 0.62192 0.73401 0.66273 -0.05813 0.15837  0.17124  628 ILE A CG1 
1043 C CG2 . ILE A 132 ? 0.39437 0.54190 0.49038 -0.01634 0.13751  0.19506  628 ILE A CG2 
1044 C CD1 . ILE A 132 ? 0.71461 0.79130 0.76028 -0.05057 0.19020  0.17113  628 ILE A CD1 
1045 N N   . ALA A 133 ? 0.34298 0.52244 0.44479 -0.01814 0.08429  0.19949  629 ALA A N   
1046 C CA  . ALA A 133 ? 0.24043 0.44392 0.36117 -0.00675 0.06583  0.20741  629 ALA A CA  
1047 C C   . ALA A 133 ? 0.25670 0.45868 0.38736 0.00066  0.06624  0.21585  629 ALA A C   
1048 O O   . ALA A 133 ? 0.36081 0.57914 0.51107 0.01314  0.06269  0.22821  629 ALA A O   
1049 C CB  . ALA A 133 ? 0.23420 0.45195 0.34935 -0.01434 0.04748  0.20073  629 ALA A CB  
1050 N N   . PHE A 134 ? 0.29432 0.48052 0.41164 -0.00851 0.06957  0.21037  630 PHE A N   
1051 C CA  . PHE A 134 ? 0.26078 0.44691 0.38402 -0.00425 0.06681  0.21674  630 PHE A CA  
1052 C C   . PHE A 134 ? 0.39885 0.55527 0.51713 -0.00409 0.08734  0.22033  630 PHE A C   
1053 O O   . PHE A 134 ? 0.36969 0.52414 0.49379 0.00112  0.08705  0.22818  630 PHE A O   
1054 C CB  . PHE A 134 ? 0.30647 0.49945 0.42031 -0.01488 0.05345  0.20822  630 PHE A CB  
1055 C CG  . PHE A 134 ? 0.21288 0.42938 0.33237 -0.01464 0.03669  0.20505  630 PHE A CG  
1056 C CD1 . PHE A 134 ? 0.21788 0.45225 0.35108 -0.00609 0.03027  0.21110  630 PHE A CD1 
1057 C CD2 . PHE A 134 ? 0.22835 0.44974 0.34084 -0.02359 0.02880  0.19747  630 PHE A CD2 
1058 C CE1 . PHE A 134 ? 0.32052 0.57027 0.45614 -0.00815 0.01856  0.20733  630 PHE A CE1 
1059 C CE2 . PHE A 134 ? 0.18592 0.42394 0.30492 -0.02197 0.01738  0.19631  630 PHE A CE2 
1060 C CZ  . PHE A 134 ? 0.22976 0.47848 0.35831 -0.01502 0.01345  0.20011  630 PHE A CZ  
1061 N N   . GLY A 135 ? 0.38535 0.51649 0.49084 -0.01190 0.10688  0.21375  631 GLY A N   
1062 C CA  . GLY A 135 ? 0.45896 0.55509 0.55603 -0.01596 0.12942  0.21377  631 GLY A CA  
1063 C C   . GLY A 135 ? 0.51151 0.59331 0.63011 0.00553  0.14790  0.22968  631 GLY A C   
1064 O O   . GLY A 135 ? 0.57682 0.62947 0.69463 0.00789  0.16526  0.23373  631 GLY A O   
1065 N N   . GLY A 136 ? 0.56785 0.67020 0.70799 0.02190  0.14556  0.24010  632 GLY A N   
1066 C CA  . GLY A 136 ? 0.63613 0.73288 0.80433 0.04550  0.16322  0.25955  632 GLY A CA  
1067 C C   . GLY A 136 ? 0.62871 0.76237 0.82289 0.06106  0.14486  0.28008  632 GLY A C   
1068 O O   . GLY A 136 ? 0.60878 0.76734 0.79645 0.05243  0.12045  0.27634  632 GLY A O   
1069 N N   . HIS A 137 ? 0.66231 0.80172 0.88807 0.08378  0.15898  0.30235  633 HIS A N   
1070 C CA  . HIS A 137 ? 0.65905 0.84353 0.91183 0.09545  0.14232  0.32337  633 HIS A CA  
1071 C C   . HIS A 137 ? 0.52274 0.75841 0.78894 0.09390  0.11983  0.32666  633 HIS A C   
1072 O O   . HIS A 137 ? 0.52476 0.79939 0.79660 0.08778  0.09874  0.33078  633 HIS A O   
1073 C CB  . HIS A 137 ? 0.76872 0.95253 1.05670 0.11992  0.16516  0.34931  633 HIS A CB  
1074 C CG  . HIS A 137 ? 0.76418 1.00026 1.07788 0.12564  0.14954  0.37045  633 HIS A CG  
1075 N ND1 . HIS A 137 ? 0.75557 0.99241 1.05469 0.11618  0.13713  0.36893  633 HIS A ND1 
1076 C CD2 . HIS A 137 ? 0.72937 1.02153 1.07865 0.13389  0.14490  0.39230  633 HIS A CD2 
1077 C CE1 . HIS A 137 ? 0.76644 1.05433 1.08890 0.11867  0.12566  0.38852  633 HIS A CE1 
1078 N NE2 . HIS A 137 ? 0.74023 1.06351 1.09247 0.12724  0.13031  0.40298  633 HIS A NE2 
1079 N N   . GLN A 138 ? 0.40184 0.63601 0.67124 0.09673  0.12615  0.32359  634 GLN A N   
1080 C CA  . GLN A 138 ? 0.37833 0.65207 0.65294 0.09139  0.10541  0.32244  634 GLN A CA  
1081 C C   . GLN A 138 ? 0.34844 0.60503 0.58701 0.07039  0.09333  0.29520  634 GLN A C   
1082 O O   . GLN A 138 ? 0.46409 0.68319 0.68039 0.06241  0.10714  0.27961  634 GLN A O   
1083 C CB  . GLN A 138 ? 0.48497 0.76720 0.78356 0.10695  0.11878  0.33662  634 GLN A CB  
1084 C CG  . GLN A 138 ? 0.68371 0.98714 0.97412 0.09769  0.10131  0.32962  634 GLN A CG  
1085 C CD  . GLN A 138 ? 0.83621 1.17813 1.12563 0.08684  0.07761  0.33338  634 GLN A CD  
1086 O OE1 . GLN A 138 ? 0.93444 1.29729 1.23971 0.08965  0.07887  0.34724  634 GLN A OE1 
1087 N NE2 . GLN A 138 ? 0.74740 1.09593 1.01529 0.07082  0.05967  0.31835  634 GLN A NE2 
1088 N N   . ARG A 139 ? 0.31840 0.60448 0.55275 0.05998  0.06957  0.28969  635 ARG A N   
1089 C CA  . ARG A 139 ? 0.34894 0.62369 0.55647 0.04356  0.05905  0.26767  635 ARG A CA  
1090 C C   . ARG A 139 ? 0.39241 0.66956 0.59835 0.04256  0.06019  0.26329  635 ARG A C   
1091 O O   . ARG A 139 ? 0.31275 0.61121 0.53769 0.05178  0.06017  0.27728  635 ARG A O   
1092 C CB  . ARG A 139 ? 0.25655 0.55476 0.46044 0.03369  0.03836  0.26315  635 ARG A CB  
1093 C CG  . ARG A 139 ? 0.20555 0.49957 0.40565 0.03095  0.03698  0.26370  635 ARG A CG  
1094 C CD  . ARG A 139 ? 0.19466 0.47997 0.37400 0.01735  0.02691  0.24662  635 ARG A CD  
1095 N NE  . ARG A 139 ? 0.31790 0.59218 0.48865 0.01350  0.02757  0.24472  635 ARG A NE  
1096 C CZ  . ARG A 139 ? 0.25267 0.53291 0.41417 0.00412  0.01771  0.23702  635 ARG A CZ  
1097 N NH1 . ARG A 139 ? 0.17877 0.47316 0.33839 -0.00185 0.00806  0.23117  635 ARG A NH1 
1098 N NH2 . ARG A 139 ? 0.20166 0.47116 0.35478 0.00069  0.01946  0.23588  635 ARG A NH2 
1099 N N   . HIS A 140 ? 0.31420 0.57228 0.49741 0.03037  0.06047  0.24517  636 HIS A N   
1100 C CA  . HIS A 140 ? 0.27151 0.53196 0.45042 0.02689  0.06092  0.23927  636 HIS A CA  
1101 C C   . HIS A 140 ? 0.33889 0.60144 0.50151 0.01423  0.04588  0.22597  636 HIS A C   
1102 O O   . HIS A 140 ? 0.29725 0.55077 0.44759 0.00682  0.04119  0.21794  636 HIS A O   
1103 C CB  . HIS A 140 ? 0.31603 0.55068 0.48548 0.02534  0.08325  0.23295  636 HIS A CB  
1104 C CG  . HIS A 140 ? 0.38053 0.60517 0.56800 0.04004  0.10471  0.24594  636 HIS A CG  
1105 N ND1 . HIS A 140 ? 0.35651 0.59807 0.56983 0.05500  0.11089  0.26142  636 HIS A ND1 
1106 C CD2 . HIS A 140 ? 0.40600 0.60410 0.59144 0.04323  0.12299  0.24753  636 HIS A CD2 
1107 C CE1 . HIS A 140 ? 0.38379 0.61037 0.61373 0.06956  0.13294  0.27356  636 HIS A CE1 
1108 N NE2 . HIS A 140 ? 0.41275 0.61007 0.62517 0.06255  0.14164  0.26455  636 HIS A NE2 
1109 N N   . LYS A 141 ? 0.25831 0.53247 0.42251 0.01250  0.03975  0.22523  637 LYS A N   
1110 C CA  . LYS A 141 ? 0.27124 0.54378 0.42283 0.00295  0.03005  0.21514  637 LYS A CA  
1111 C C   . LYS A 141 ? 0.32762 0.58480 0.46396 -0.00379 0.03878  0.20699  637 LYS A C   
1112 O O   . LYS A 141 ? 0.37903 0.63319 0.51470 -0.00313 0.04941  0.20727  637 LYS A O   
1113 C CB  . LYS A 141 ? 0.24955 0.53648 0.40653 0.00209  0.02282  0.21799  637 LYS A CB  
1114 C CG  . LYS A 141 ? 0.23891 0.52198 0.38676 -0.00546 0.01668  0.21061  637 LYS A CG  
1115 C CD  . LYS A 141 ? 0.17104 0.46460 0.32279 -0.00830 0.01290  0.21331  637 LYS A CD  
1116 C CE  . LYS A 141 ? 0.25036 0.53638 0.39549 -0.01480 0.01054  0.20768  637 LYS A CE  
1117 N NZ  . LYS A 141 ? 0.33466 0.62638 0.48082 -0.02149 0.00881  0.20779  637 LYS A NZ  
1118 N N   . THR A 142 ? 0.26768 0.51737 0.39120 -0.01162 0.03513  0.20061  638 THR A N   
1119 C CA  . THR A 142 ? 0.27991 0.51974 0.38514 -0.02207 0.04192  0.19446  638 THR A CA  
1120 C C   . THR A 142 ? 0.23110 0.48016 0.33130 -0.02840 0.02933  0.19336  638 THR A C   
1121 O O   . THR A 142 ? 0.27334 0.53008 0.38237 -0.02558 0.01891  0.19533  638 THR A O   
1122 C CB  . THR A 142 ? 0.23498 0.45818 0.32656 -0.02946 0.05361  0.19015  638 THR A CB  
1123 O OG1 . THR A 142 ? 0.39604 0.62221 0.48861 -0.03129 0.04376  0.18991  638 THR A OG1 
1124 C CG2 . THR A 142 ? 0.24869 0.45961 0.34844 -0.02114 0.07068  0.19399  638 THR A CG2 
1125 N N   . VAL A 143 ? 0.22111 0.47012 0.30749 -0.03717 0.03215  0.19154  639 VAL A N   
1126 C CA  . VAL A 143 ? 0.21860 0.48079 0.30236 -0.04279 0.02096  0.19486  639 VAL A CA  
1127 C C   . VAL A 143 ? 0.35480 0.61676 0.41545 -0.05870 0.02484  0.19174  639 VAL A C   
1128 O O   . VAL A 143 ? 0.37457 0.62338 0.41848 -0.06594 0.03911  0.18571  639 VAL A O   
1129 C CB  . VAL A 143 ? 0.21256 0.48151 0.30439 -0.03829 0.01748  0.19943  639 VAL A CB  
1130 C CG1 . VAL A 143 ? 0.27191 0.53348 0.35242 -0.04188 0.02870  0.19646  639 VAL A CG1 
1131 C CG2 . VAL A 143 ? 0.21162 0.49567 0.30668 -0.04140 0.00758  0.20694  639 VAL A CG2 
1132 N N   . ALA A 144 ? 0.35923 0.63718 0.41907 -0.06562 0.01372  0.19595  640 ALA A N   
1133 C CA  . ALA A 144 ? 0.39069 0.67717 0.42770 -0.08475 0.01329  0.19446  640 ALA A CA  
1134 C C   . ALA A 144 ? 0.36941 0.67680 0.40627 -0.08835 0.00386  0.20365  640 ALA A C   
1135 O O   . ALA A 144 ? 0.31738 0.62987 0.37394 -0.07522 -0.00078 0.21119  640 ALA A O   
1136 C CB  . ALA A 144 ? 0.35533 0.65454 0.39299 -0.09281 0.00534  0.19593  640 ALA A CB  
1137 N N   . LEU A 145 ? 0.40220 0.72215 0.41561 -0.10831 0.00188  0.20306  641 LEU A N   
1138 C CA  . LEU A 145 ? 0.45133 0.79173 0.46274 -0.11298 -0.00609 0.21295  641 LEU A CA  
1139 C C   . LEU A 145 ? 0.47962 0.85164 0.52222 -0.10411 -0.02216 0.23115  641 LEU A C   
1140 O O   . LEU A 145 ? 0.49618 0.87974 0.54941 -0.09923 -0.02566 0.24215  641 LEU A O   
1141 C CB  . LEU A 145 ? 0.43114 0.78123 0.40763 -0.13984 -0.00522 0.20765  641 LEU A CB  
1142 C CG  . LEU A 145 ? 0.49132 0.80888 0.43564 -0.15052 0.01681  0.18966  641 LEU A CG  
1143 C CD1 . LEU A 145 ? 0.53300 0.86409 0.44081 -0.18054 0.01603  0.18391  641 LEU A CD1 
1144 C CD2 . LEU A 145 ? 0.39384 0.69221 0.34599 -0.13453 0.02809  0.18941  641 LEU A CD2 
1145 N N   . ASP A 146 ? 0.41261 0.79743 0.47233 -0.10109 -0.02890 0.23527  642 ASP A N   
1146 C CA  . ASP A 146 ? 0.25429 0.66841 0.34975 -0.09066 -0.03833 0.25353  642 ASP A CA  
1147 C C   . ASP A 146 ? 0.39009 0.78549 0.51125 -0.06789 -0.03182 0.25447  642 ASP A C   
1148 O O   . ASP A 146 ? 0.36115 0.77380 0.51289 -0.05797 -0.03357 0.26781  642 ASP A O   
1149 C CB  . ASP A 146 ? 0.34949 0.79108 0.45502 -0.09855 -0.04711 0.25977  642 ASP A CB  
1150 C CG  . ASP A 146 ? 0.52299 0.93825 0.61583 -0.09803 -0.04175 0.24472  642 ASP A CG  
1151 O OD1 . ASP A 146 ? 0.56523 0.95049 0.66399 -0.08219 -0.03305 0.23679  642 ASP A OD1 
1152 O OD2 . ASP A 146 ? 0.56431 0.99093 0.64187 -0.11515 -0.04592 0.24150  642 ASP A OD2 
1153 N N   . GLY A 147 ? 0.36447 0.72715 0.47471 -0.06114 -0.02255 0.24136  643 GLY A N   
1154 C CA  . GLY A 147 ? 0.26046 0.60684 0.38938 -0.04480 -0.01709 0.24045  643 GLY A CA  
1155 C C   . GLY A 147 ? 0.23550 0.57094 0.37206 -0.03784 -0.01553 0.23402  643 GLY A C   
1156 O O   . GLY A 147 ? 0.31075 0.63291 0.45835 -0.02756 -0.01109 0.23231  643 GLY A O   
1157 N N   . THR A 148 ? 0.22947 0.56936 0.35768 -0.04509 -0.01861 0.23051  644 THR A N   
1158 C CA  . THR A 148 ? 0.26848 0.59572 0.40030 -0.03949 -0.01639 0.22416  644 THR A CA  
1159 C C   . THR A 148 ? 0.26172 0.56403 0.38300 -0.03643 -0.00824 0.21243  644 THR A C   
1160 O O   . THR A 148 ? 0.35807 0.65110 0.46189 -0.04361 -0.00271 0.20614  644 THR A O   
1161 C CB  . THR A 148 ? 0.19187 0.52901 0.31504 -0.05012 -0.02050 0.22369  644 THR A CB  
1162 O OG1 . THR A 148 ? 0.28738 0.65650 0.42634 -0.05224 -0.02953 0.23861  644 THR A OG1 
1163 C CG2 . THR A 148 ? 0.18371 0.50668 0.30909 -0.04518 -0.01736 0.21757  644 THR A CG2 
1164 N N   . LEU A 149 ? 0.17190 0.46520 0.30409 -0.02678 -0.00616 0.21095  645 LEU A N   
1165 C CA  . LEU A 149 ? 0.24638 0.52585 0.37505 -0.02329 -0.00074 0.20449  645 LEU A CA  
1166 C C   . LEU A 149 ? 0.25406 0.52746 0.38424 -0.02073 0.00003  0.20092  645 LEU A C   
1167 O O   . LEU A 149 ? 0.22101 0.49652 0.35769 -0.01868 -0.00257 0.20257  645 LEU A O   
1168 C CB  . LEU A 149 ? 0.23205 0.50960 0.36869 -0.01858 0.00027  0.20669  645 LEU A CB  
1169 C CG  . LEU A 149 ? 0.30914 0.58072 0.44479 -0.01669 0.00368  0.20309  645 LEU A CG  
1170 C CD1 . LEU A 149 ? 0.28943 0.56042 0.41875 -0.01850 0.00809  0.20252  645 LEU A CD1 
1171 C CD2 . LEU A 149 ? 0.21852 0.48704 0.35931 -0.01625 0.00460  0.20405  645 LEU A CD2 
1172 N N   . PHE A 150 ? 0.17397 0.43976 0.29907 -0.02029 0.00530  0.19769  646 PHE A N   
1173 C CA  . PHE A 150 ? 0.16576 0.42786 0.29354 -0.01742 0.00651  0.19703  646 PHE A CA  
1174 C C   . PHE A 150 ? 0.23084 0.49660 0.36573 -0.01201 0.00732  0.19998  646 PHE A C   
1175 O O   . PHE A 150 ? 0.16818 0.43320 0.30382 -0.00963 0.01282  0.20207  646 PHE A O   
1176 C CB  . PHE A 150 ? 0.17901 0.43069 0.29779 -0.02109 0.01406  0.19507  646 PHE A CB  
1177 C CG  . PHE A 150 ? 0.24199 0.49359 0.35055 -0.03099 0.01290  0.19252  646 PHE A CG  
1178 C CD1 . PHE A 150 ? 0.19722 0.45282 0.29598 -0.03908 0.01300  0.19190  646 PHE A CD1 
1179 C CD2 . PHE A 150 ? 0.27480 0.52558 0.38283 -0.03408 0.01143  0.19177  646 PHE A CD2 
1180 C CE1 . PHE A 150 ? 0.29319 0.55652 0.38265 -0.05105 0.00978  0.19171  646 PHE A CE1 
1181 C CE2 . PHE A 150 ? 0.19754 0.45391 0.29752 -0.04524 0.00934  0.19089  646 PHE A CE2 
1182 C CZ  . PHE A 150 ? 0.20621 0.47125 0.29735 -0.05426 0.00756  0.19144  646 PHE A CZ  
1183 N N   . GLN A 151 ? 0.15619 0.42743 0.29525 -0.01154 0.00281  0.20106  647 GLN A N   
1184 C CA  . GLN A 151 ? 0.15591 0.43712 0.30012 -0.00994 0.00145  0.20587  647 GLN A CA  
1185 C C   . GLN A 151 ? 0.24201 0.52983 0.39223 -0.00607 0.00251  0.21216  647 GLN A C   
1186 O O   . GLN A 151 ? 0.15957 0.44085 0.30745 -0.00637 0.00409  0.21047  647 GLN A O   
1187 C CB  . GLN A 151 ? 0.15603 0.43993 0.29683 -0.01598 -0.00206 0.20385  647 GLN A CB  
1188 C CG  . GLN A 151 ? 0.17686 0.45168 0.31523 -0.01844 0.00013  0.19989  647 GLN A CG  
1189 C CD  . GLN A 151 ? 0.38135 0.65904 0.52012 -0.02143 0.00147  0.20072  647 GLN A CD  
1190 O OE1 . GLN A 151 ? 0.39473 0.68287 0.53646 -0.02023 0.00020  0.20497  647 GLN A OE1 
1191 N NE2 . GLN A 151 ? 0.55070 0.81954 0.68849 -0.02509 0.00564  0.19818  647 GLN A NE2 
1192 N N   . LYS A 152 ? 0.17802 0.48114 0.33739 -0.00244 0.00171  0.22164  648 LYS A N   
1193 C CA  . LYS A 152 ? 0.16315 0.47945 0.33425 0.00309  0.00261  0.23290  648 LYS A CA  
1194 C C   . LYS A 152 ? 0.25418 0.57600 0.41992 -0.00400 -0.00309 0.23082  648 LYS A C   
1195 O O   . LYS A 152 ? 0.16568 0.49038 0.33796 -0.00066 -0.00053 0.23646  648 LYS A O   
1196 C CB  . LYS A 152 ? 0.17094 0.50217 0.34990 0.00600  0.00334  0.24303  648 LYS A CB  
1197 C CG  . LYS A 152 ? 0.17573 0.50492 0.36721 0.01785  0.01324  0.25190  648 LYS A CG  
1198 C CD  . LYS A 152 ? 0.26321 0.60775 0.46033 0.01905  0.01302  0.26165  648 LYS A CD  
1199 C CE  . LYS A 152 ? 0.45699 0.81088 0.67324 0.03166  0.02241  0.27954  648 LYS A CE  
1200 N NZ  . LYS A 152 ? 0.51561 0.88496 0.74005 0.03488  0.02480  0.29288  648 LYS A NZ  
1201 N N   . SER A 153 ? 0.22627 0.55078 0.38123 -0.01369 -0.00950 0.22485  649 SER A N   
1202 C CA  . SER A 153 ? 0.16510 0.49344 0.31148 -0.02231 -0.01274 0.22230  649 SER A CA  
1203 C C   . SER A 153 ? 0.16420 0.47287 0.30519 -0.02098 -0.00817 0.21483  649 SER A C   
1204 O O   . SER A 153 ? 0.21311 0.52357 0.34796 -0.02624 -0.00884 0.21425  649 SER A O   
1205 C CB  . SER A 153 ? 0.17198 0.49806 0.30391 -0.03496 -0.01375 0.21437  649 SER A CB  
1206 O OG  . SER A 153 ? 0.16899 0.47216 0.29723 -0.03332 -0.00772 0.20453  649 SER A OG  
1207 N N   . GLY A 154 ? 0.16016 0.45260 0.30163 -0.01603 -0.00387 0.20991  650 GLY A N   
1208 C CA  . GLY A 154 ? 0.16118 0.43935 0.29752 -0.01663 -0.00071 0.20445  650 GLY A CA  
1209 C C   . GLY A 154 ? 0.15866 0.42906 0.29057 -0.01947 -0.00052 0.19793  650 GLY A C   
1210 O O   . GLY A 154 ? 0.15904 0.42316 0.28973 -0.01988 0.00097  0.19571  650 GLY A O   
1211 N N   . VAL A 155 ? 0.15910 0.43095 0.28975 -0.02201 -0.00083 0.19648  651 VAL A N   
1212 C CA  . VAL A 155 ? 0.22252 0.48666 0.35388 -0.02245 0.00248  0.19362  651 VAL A CA  
1213 C C   . VAL A 155 ? 0.15510 0.41925 0.29131 -0.01788 0.00077  0.19590  651 VAL A C   
1214 O O   . VAL A 155 ? 0.15336 0.42012 0.29001 -0.01620 -0.00048 0.19705  651 VAL A O   
1215 C CB  . VAL A 155 ? 0.26268 0.52546 0.39148 -0.02783 0.00591  0.19146  651 VAL A CB  
1216 C CG1 . VAL A 155 ? 0.17008 0.42377 0.30446 -0.02607 0.01205  0.19143  651 VAL A CG1 
1217 C CG2 . VAL A 155 ? 0.17738 0.44136 0.29760 -0.03762 0.00951  0.18737  651 VAL A CG2 
1218 N N   . ILE A 156 ? 0.15552 0.41946 0.29562 -0.01688 0.00144  0.19779  652 ILE A N   
1219 C CA  . ILE A 156 ? 0.15434 0.42481 0.29786 -0.01594 -0.00158 0.20192  652 ILE A CA  
1220 C C   . ILE A 156 ? 0.15682 0.43000 0.31033 -0.01248 0.00038  0.20863  652 ILE A C   
1221 O O   . ILE A 156 ? 0.22131 0.49019 0.38056 -0.01058 0.00596  0.21032  652 ILE A O   
1222 C CB  . ILE A 156 ? 0.21125 0.48659 0.35228 -0.01962 -0.00381 0.20248  652 ILE A CB  
1223 C CG1 . ILE A 156 ? 0.23870 0.50626 0.37132 -0.02241 -0.00152 0.19715  652 ILE A CG1 
1224 C CG2 . ILE A 156 ? 0.16610 0.45382 0.30736 -0.02365 -0.00792 0.20751  652 ILE A CG2 
1225 C CD1 . ILE A 156 ? 0.16646 0.43401 0.29353 -0.02909 -0.00083 0.19625  652 ILE A CD1 
1226 N N   A SER A 157 ? 0.20009 0.47975 0.35696 -0.01169 -0.00173 0.21322  653 SER A N   
1227 N N   B SER A 157 ? 0.15719 0.43716 0.31409 -0.01174 -0.00186 0.21331  653 SER A N   
1228 C CA  A SER A 157 ? 0.22460 0.50887 0.39495 -0.00691 0.00104  0.22338  653 SER A CA  
1229 C CA  B SER A 157 ? 0.25970 0.54407 0.43003 -0.00694 0.00098  0.22338  653 SER A CA  
1230 C C   A SER A 157 ? 0.20667 0.51140 0.38218 -0.00863 -0.00566 0.23216  653 SER A C   
1231 C C   B SER A 157 ? 0.22009 0.52464 0.39560 -0.00860 -0.00558 0.23214  653 SER A C   
1232 O O   A SER A 157 ? 0.17967 0.48813 0.34309 -0.01565 -0.00974 0.22677  653 SER A O   
1233 O O   B SER A 157 ? 0.16235 0.47028 0.32582 -0.01546 -0.00946 0.22675  653 SER A O   
1234 C CB  A SER A 157 ? 0.21094 0.48137 0.38089 -0.00628 0.00831  0.22095  653 SER A CB  
1235 C CB  B SER A 157 ? 0.20055 0.47063 0.36995 -0.00647 0.00828  0.22043  653 SER A CB  
1236 O OG  A SER A 157 ? 0.23282 0.50506 0.41778 -0.00078 0.01373  0.23248  653 SER A OG  
1237 O OG  B SER A 157 ? 0.16597 0.43897 0.32903 -0.00910 0.00476  0.21844  653 SER A OG  
1238 N N   . GLY A 158 ? 0.16873 0.48310 0.35963 -0.00403 -0.00363 0.24463  654 GLY A N   
1239 C CA  . GLY A 158 ? 0.17574 0.50876 0.36775 -0.00937 -0.00827 0.25170  654 GLY A CA  
1240 C C   . GLY A 158 ? 0.19441 0.53894 0.40791 -0.00245 -0.00373 0.26840  654 GLY A C   
1241 O O   . GLY A 158 ? 0.20149 0.53600 0.43138 0.00870  0.00545  0.27534  654 GLY A O   
1242 N N   . GLY A 159 ? 0.20925 0.57797 0.42441 -0.00978 -0.00921 0.27731  655 GLY A N   
1243 C CA  . GLY A 159 ? 0.23481 0.62298 0.47298 -0.00493 -0.00507 0.29737  655 GLY A CA  
1244 C C   . GLY A 159 ? 0.29289 0.70138 0.53048 -0.01207 -0.00964 0.30630  655 GLY A C   
1245 O O   . GLY A 159 ? 0.21419 0.61461 0.45749 -0.00618 -0.00524 0.30885  655 GLY A O   
1246 N N   . ALA A 160 ? 0.48157 0.87103 0.68136 0.01504  -0.07175 0.43566  656 ALA A N   
1247 C CA  . ALA A 160 ? 0.48787 0.88914 0.68744 0.01816  -0.06411 0.44434  656 ALA A CA  
1248 C C   . ALA A 160 ? 0.51698 0.89261 0.68890 0.01703  -0.06400 0.44837  656 ALA A C   
1249 O O   . ALA A 160 ? 0.54012 0.92338 0.71013 0.01239  -0.05846 0.45970  656 ALA A O   
1250 C CB  . ALA A 160 ? 0.47098 0.88705 0.68033 0.03459  -0.05768 0.43627  656 ALA A CB  
1251 N N   . SER A 161 ? 0.53039 0.87561 0.68129 0.02144  -0.06891 0.44002  657 SER A N   
1252 C CA  . SER A 161 ? 0.58222 0.90436 0.70870 0.02253  -0.06660 0.44527  657 SER A CA  
1253 C C   . SER A 161 ? 0.58052 0.89031 0.70127 0.00437  -0.06651 0.45840  657 SER A C   
1254 O O   . SER A 161 ? 0.62482 0.92501 0.73274 0.00163  -0.06084 0.46765  657 SER A O   
1255 C CB  . SER A 161 ? 0.56859 0.86310 0.67503 0.03481  -0.07042 0.43352  657 SER A CB  
1256 O OG  . SER A 161 ? 0.60203 0.86787 0.69647 0.02615  -0.07493 0.43534  657 SER A OG  
1257 N N   . ASP A 162 ? 0.57426 0.88609 0.70470 -0.00902 -0.07185 0.45978  658 ASP A N   
1258 C CA  . ASP A 162 ? 0.59432 0.89889 0.72095 -0.02912 -0.07068 0.47248  658 ASP A CA  
1259 C C   . ASP A 162 ? 0.59063 0.92383 0.73200 -0.03839 -0.06483 0.48388  658 ASP A C   
1260 O O   . ASP A 162 ? 0.61326 0.93813 0.74676 -0.05123 -0.05958 0.49414  658 ASP A O   
1261 C CB  . ASP A 162 ? 0.58884 0.89234 0.72136 -0.04265 -0.07832 0.47113  658 ASP A CB  
1262 C CG  . ASP A 162 ? 0.66419 0.92895 0.77608 -0.04246 -0.08150 0.46628  658 ASP A CG  
1263 O OD1 . ASP A 162 ? 0.69665 0.93919 0.79337 -0.02599 -0.08005 0.45948  658 ASP A OD1 
1264 O OD2 . ASP A 162 ? 0.61930 0.87744 0.73061 -0.05966 -0.08507 0.46975  658 ASP A OD2 
1265 N N   . LEU A 163 ? 0.56348 0.92943 0.72687 -0.03184 -0.06425 0.48212  659 LEU A N   
1266 C CA  . LEU A 163 ? 0.55825 0.95331 0.73789 -0.03861 -0.05802 0.49298  659 LEU A CA  
1267 C C   . LEU A 163 ? 0.56933 0.96212 0.73931 -0.02914 -0.04971 0.49583  659 LEU A C   
1268 O O   . LEU A 163 ? 0.75456 1.15972 0.92900 -0.03792 -0.04344 0.50614  659 LEU A O   
1269 C CB  . LEU A 163 ? 0.52613 0.95693 0.73517 -0.03441 -0.05890 0.49168  659 LEU A CB  
1270 C CG  . LEU A 163 ? 0.51482 0.95801 0.73717 -0.04616 -0.06636 0.49241  659 LEU A CG  
1271 C CD1 . LEU A 163 ? 0.49493 0.96860 0.74529 -0.03658 -0.06576 0.48912  659 LEU A CD1 
1272 C CD2 . LEU A 163 ? 0.52666 0.98327 0.75321 -0.06797 -0.06572 0.50561  659 LEU A CD2 
1273 N N   . LYS A 164 ? 0.57001 0.94972 0.72702 -0.01185 -0.04943 0.48668  660 LYS A N   
1274 C CA  . LYS A 164 ? 0.58334 0.96204 0.72802 -0.00330 -0.04211 0.48988  660 LYS A CA  
1275 C C   . LYS A 164 ? 0.64554 0.99643 0.76770 -0.01118 -0.03904 0.49757  660 LYS A C   
1276 O O   . LYS A 164 ? 0.63128 0.98746 0.74957 -0.01418 -0.03155 0.50636  660 LYS A O   
1277 C CB  . LYS A 164 ? 0.57634 0.95130 0.71217 0.01619  -0.04310 0.47796  660 LYS A CB  
1278 C CG  . LYS A 164 ? 0.64407 1.02083 0.76472 0.02535  -0.03632 0.48133  660 LYS A CG  
1279 C CD  . LYS A 164 ? 0.63376 1.02879 0.75758 0.04214  -0.03499 0.47180  660 LYS A CD  
1280 C CE  . LYS A 164 ? 0.66055 1.03384 0.76112 0.05466  -0.03883 0.46219  660 LYS A CE  
1281 N NZ  . LYS A 164 ? 0.76663 1.12457 0.84375 0.05541  -0.03504 0.47054  660 LYS A NZ  
1282 N N   . ALA A 165 ? 0.63258 0.95336 0.74082 -0.01513 -0.04364 0.49491  661 ALA A N   
1283 C CA  . ALA A 165 ? 0.66734 0.95797 0.75541 -0.02251 -0.03890 0.50279  661 ALA A CA  
1284 C C   . ALA A 165 ? 0.70327 1.00049 0.79860 -0.04308 -0.03344 0.51438  661 ALA A C   
1285 O O   . ALA A 165 ? 0.88435 1.16124 0.96522 -0.04867 -0.02598 0.52210  661 ALA A O   
1286 C CB  . ALA A 165 ? 0.67966 0.93761 0.75483 -0.02352 -0.04386 0.49796  661 ALA A CB  
1287 N N   . LYS A 166 ? 0.69266 1.01834 0.81041 -0.05452 -0.03616 0.51589  662 LYS A N   
1288 C CA  . LYS A 166 ? 0.85419 1.19187 0.98035 -0.07372 -0.03047 0.52584  662 LYS A CA  
1289 C C   . LYS A 166 ? 0.74970 1.12419 0.89533 -0.07174 -0.02661 0.52981  662 LYS A C   
1290 O O   . LYS A 166 ? 0.82534 1.21267 0.97929 -0.08665 -0.02155 0.53730  662 LYS A O   
1291 C CB  . LYS A 166 ? 0.93119 1.27311 1.06693 -0.09380 -0.03522 0.52660  662 LYS A CB  
1292 C CG  . LYS A 166 ? 1.06048 1.36664 1.17889 -0.09691 -0.03841 0.52246  662 LYS A CG  
1293 C CD  . LYS A 166 ? 1.04324 1.35881 1.17203 -0.11544 -0.04467 0.52114  662 LYS A CD  
1294 C CE  . LYS A 166 ? 0.99240 1.35264 1.14734 -0.11610 -0.05080 0.52083  662 LYS A CE  
1295 N NZ  . LYS A 166 ? 0.95088 1.31740 1.11332 -0.12503 -0.05957 0.51221  662 LYS A NZ  
1296 N N   . ALA A 167 ? 0.64879 1.04058 0.80259 -0.05442 -0.02774 0.52467  663 ALA A N   
1297 C CA  . ALA A 167 ? 0.64654 1.06758 0.81471 -0.05083 -0.02084 0.52948  663 ALA A CA  
1298 C C   . ALA A 167 ? 0.72929 1.13804 0.87843 -0.04539 -0.01272 0.53351  663 ALA A C   
1299 O O   . ALA A 167 ? 0.63895 1.06703 0.79656 -0.04881 -0.00535 0.53998  663 ALA A O   
1300 C CB  . ALA A 167 ? 0.58426 1.02895 0.76944 -0.03558 -0.02254 0.52320  663 ALA A CB  
1301 N N   . ARG A 168 ? 0.73475 1.11249 0.85872 -0.03710 -0.01352 0.53042  664 ARG A N   
1302 C CA  . ARG A 168 ? 0.77296 1.13884 0.87784 -0.03242 -0.00570 0.53592  664 ARG A CA  
1303 C C   . ARG A 168 ? 0.80845 1.16422 0.91011 -0.04984 0.00116  0.54577  664 ARG A C   
1304 O O   . ARG A 168 ? 0.73902 1.09109 0.82956 -0.04823 0.00916  0.55200  664 ARG A O   
1305 C CB  . ARG A 168 ? 0.80956 1.14495 0.88957 -0.01935 -0.00796 0.53151  664 ARG A CB  
1306 C CG  . ARG A 168 ? 0.86384 1.16366 0.93188 -0.02907 -0.00941 0.53321  664 ARG A CG  
1307 C CD  . ARG A 168 ? 0.92775 1.19940 0.97528 -0.01457 -0.01229 0.52801  664 ARG A CD  
1308 N NE  . ARG A 168 ? 1.02300 1.26874 1.06791 -0.02264 -0.01675 0.52531  664 ARG A NE  
1309 C CZ  . ARG A 168 ? 1.13723 1.35005 1.16911 -0.03180 -0.01122 0.53195  664 ARG A CZ  
1310 N NH1 . ARG A 168 ? 1.05001 1.24228 1.08140 -0.03999 -0.01500 0.52880  664 ARG A NH1 
1311 N NH2 . ARG A 168 ? 1.21166 1.41179 1.23153 -0.03322 -0.00090 0.54187  664 ARG A NH2 
1312 N N   . ARG A 169 ? 0.89676 1.24976 1.00806 -0.06708 -0.00139 0.54698  665 ARG A N   
1313 C CA  . ARG A 169 ? 0.73059 1.07874 0.84215 -0.08590 0.00581  0.55482  665 ARG A CA  
1314 C C   . ARG A 169 ? 0.72084 1.10101 0.84865 -0.08977 0.01152  0.55961  665 ARG A C   
1315 O O   . ARG A 169 ? 0.74302 1.11722 0.86587 -0.10012 0.01981  0.56596  665 ARG A O   
1316 C CB  . ARG A 169 ? 0.72900 1.07452 0.84946 -0.10470 0.00148  0.55357  665 ARG A CB  
1317 C CG  . ARG A 169 ? 0.81553 1.13635 0.92477 -0.12247 0.00983  0.55890  665 ARG A CG  
1318 C CD  . ARG A 169 ? 0.77303 1.07175 0.87741 -0.13538 0.00683  0.55565  665 ARG A CD  
1319 N NE  . ARG A 169 ? 0.86301 1.19201 0.98890 -0.14823 -0.00114 0.55204  665 ARG A NE  
1320 C CZ  . ARG A 169 ? 0.82172 1.17030 0.96129 -0.17021 0.00137  0.55368  665 ARG A CZ  
1321 N NH1 . ARG A 169 ? 0.75748 1.13705 0.91646 -0.17925 -0.00703 0.55048  665 ARG A NH1 
1322 N NH2 . ARG A 169 ? 0.77534 1.11447 0.90968 -0.18281 0.01229  0.55807  665 ARG A NH2 
1323 N N   . TRP A 170 ? 0.68948 1.10216 0.83683 -0.08119 0.00845  0.55666  666 TRP A N   
1324 C CA  . TRP A 170 ? 0.67914 1.12291 0.84378 -0.08316 0.01489  0.56107  666 TRP A CA  
1325 C C   . TRP A 170 ? 0.76431 1.20201 0.91279 -0.07522 0.02360  0.56495  666 TRP A C   
1326 O O   . TRP A 170 ? 0.83319 1.28473 0.98855 -0.08252 0.03107  0.57028  666 TRP A O   
1327 C CB  . TRP A 170 ? 0.64358 1.11980 0.83212 -0.07328 0.01191  0.55742  666 TRP A CB  
1328 C CG  . TRP A 170 ? 0.71449 1.20877 0.92594 -0.08304 0.00562  0.55676  666 TRP A CG  
1329 C CD1 . TRP A 170 ? 0.61653 1.11220 0.83475 -0.07797 -0.00292 0.55128  666 TRP A CD1 
1330 C CD2 . TRP A 170 ? 0.66980 1.18587 0.90062 -0.09945 0.00700  0.56166  666 TRP A CD2 
1331 N NE1 . TRP A 170 ? 0.59065 1.10888 0.83105 -0.09011 -0.00686 0.55358  666 TRP A NE1 
1332 C CE2 . TRP A 170 ? 0.61267 1.14492 0.86142 -0.10322 -0.00119 0.55969  666 TRP A CE2 
1333 C CE3 . TRP A 170 ? 0.63495 1.15940 0.86948 -0.11106 0.01417  0.56709  666 TRP A CE3 
1334 C CZ2 . TRP A 170 ? 0.59266 1.15168 0.86271 -0.11763 -0.00287 0.56328  666 TRP A CZ2 
1335 C CZ3 . TRP A 170 ? 0.62741 1.17661 0.88315 -0.12540 0.01252  0.56953  666 TRP A CZ3 
1336 C CH2 . TRP A 170 ? 0.72033 1.28772 0.99352 -0.12842 0.00377  0.56775  666 TRP A CH2 
1337 N N   . ASP A 171 ? 0.97368 1.28484 0.93846 -0.04005 0.00128  0.54456  667 ASP A N   
1338 C CA  . ASP A 171 ? 0.98718 1.30580 0.93888 -0.03137 0.00986  0.55731  667 ASP A CA  
1339 C C   . ASP A 171 ? 1.03094 1.30994 0.96011 -0.04396 0.01180  0.57290  667 ASP A C   
1340 O O   . ASP A 171 ? 1.05813 1.33874 0.97138 -0.04555 0.02298  0.58821  667 ASP A O   
1341 C CB  . ASP A 171 ? 0.97851 1.29306 0.91962 -0.00382 0.00452  0.54685  667 ASP A CB  
1342 C CG  . ASP A 171 ? 0.96864 1.32152 0.92372 0.00913  0.00413  0.53483  667 ASP A CG  
1343 O OD1 . ASP A 171 ? 0.92740 1.31542 0.89303 0.00329  0.01205  0.53911  667 ASP A OD1 
1344 O OD2 . ASP A 171 ? 0.97592 1.32351 0.93500 0.02556  -0.00402 0.52133  667 ASP A OD2 
1345 N N   . GLU A 172 ? 1.04914 1.28564 0.96942 -0.05256 0.00333  0.56993  668 GLU A N   
1346 C CA  . GLU A 172 ? 1.09870 1.28974 0.99108 -0.06268 0.00287  0.58389  668 GLU A CA  
1347 C C   . GLU A 172 ? 1.12373 1.31796 1.02359 -0.09436 0.00778  0.60061  668 GLU A C   
1348 O O   . GLU A 172 ? 1.42348 1.59035 1.29967 -0.10467 0.01386  0.61706  668 GLU A O   
1349 C CB  . GLU A 172 ? 1.15614 1.29493 1.03313 -0.05711 -0.00644 0.57446  668 GLU A CB  
1350 C CG  . GLU A 172 ? 1.35234 1.47485 1.23301 -0.07303 -0.01166 0.56691  668 GLU A CG  
1351 C CD  . GLU A 172 ? 1.51008 1.56722 1.36233 -0.06846 -0.01516 0.56085  668 GLU A CD  
1352 O OE1 . GLU A 172 ? 1.61428 1.62892 1.44283 -0.08922 -0.02280 0.56798  668 GLU A OE1 
1353 O OE2 . GLU A 172 ? 1.50283 1.54976 1.35905 -0.04401 -0.00992 0.54906  668 GLU A OE2 
1354 N N   . LYS A 173 ? 1.10197 1.32559 1.03588 -0.11076 0.00329  0.59708  669 LYS A N   
1355 C CA  . LYS A 173 ? 1.16419 1.39684 1.12207 -0.14274 0.00432  0.61317  669 LYS A CA  
1356 C C   . LYS A 173 ? 1.23149 1.51564 1.21596 -0.14558 0.02832  0.62798  669 LYS A C   
1357 O O   . LYS A 173 ? 1.25598 1.54667 1.26267 -0.17200 0.03834  0.64616  669 LYS A O   
1358 C CB  . LYS A 173 ? 1.18880 1.43004 1.17727 -0.15858 -0.01595 0.60386  669 LYS A CB  
1359 C CG  . LYS A 173 ? 1.17995 1.46962 1.19457 -0.14139 -0.01683 0.58896  669 LYS A CG  
1360 C CD  . LYS A 173 ? 1.13253 1.48386 1.20737 -0.15576 -0.01361 0.59717  669 LYS A CD  
1361 C CE  . LYS A 173 ? 1.01782 1.41841 1.10653 -0.13038 -0.00385 0.58654  669 LYS A CE  
1362 N NZ  . LYS A 173 ? 0.98683 1.44777 1.14045 -0.14040 -0.00351 0.59097  669 LYS A NZ  
1363 N N   . ALA A 174 ? 1.20240 1.52012 1.18552 -0.11933 0.03918  0.62070  670 ALA A N   
1364 C CA  . ALA A 174 ? 1.20779 1.55410 1.19127 -0.11374 0.06732  0.63487  670 ALA A CA  
1365 C C   . ALA A 174 ? 1.22738 1.52306 1.16288 -0.12000 0.08053  0.65301  670 ALA A C   
1366 O O   . ALA A 174 ? 1.18590 1.42865 1.07573 -0.10940 0.06554  0.64839  670 ALA A O   
1367 C CB  . ALA A 174 ? 1.15568 1.51998 1.12044 -0.07999 0.06994  0.62227  670 ALA A CB  
1368 N N   . VAL A 175 ? 1.33927 1.65025 1.28767 -0.13655 0.11026  0.67372  671 VAL A N   
1369 C CA  . VAL A 175 ? 1.53726 1.80238 1.45292 -0.15615 0.12815  0.69594  671 VAL A CA  
1370 C C   . VAL A 175 ? 1.58485 1.77304 1.41775 -0.13913 0.11547  0.69519  671 VAL A C   
1371 O O   . VAL A 175 ? 1.69759 1.87106 1.48986 -0.10671 0.10778  0.68456  671 VAL A O   
1372 C CB  . VAL A 175 ? 1.61239 1.90521 1.53876 -0.16031 0.17395  0.71559  671 VAL A CB  
1373 C CG1 . VAL A 175 ? 1.54602 1.92236 1.56442 -0.16919 0.18275  0.71270  671 VAL A CG1 
1374 C CG2 . VAL A 175 ? 1.65123 1.91772 1.50517 -0.12430 0.19050  0.71476  671 VAL A CG2 
1375 N N   . ASP A 176 ? 1.46215 1.59816 1.27214 -0.15982 0.10722  0.70480  672 ASP A N   
1376 C CA  . ASP A 176 ? 1.51295 1.57358 1.24247 -0.14219 0.09885  0.70741  672 ASP A CA  
1377 C C   . ASP A 176 ? 1.59914 1.63352 1.27997 -0.14291 0.13396  0.72867  672 ASP A C   
1378 O O   . ASP A 176 ? 1.64065 1.66465 1.32653 -0.17351 0.15980  0.74971  672 ASP A O   
1379 C CB  . ASP A 176 ? 1.55373 1.55542 1.26063 -0.15807 0.07787  0.70969  672 ASP A CB  
1380 C CG  . ASP A 176 ? 1.65893 1.58301 1.28654 -0.13277 0.06247  0.70869  672 ASP A CG  
1381 O OD1 . ASP A 176 ? 1.73927 1.60841 1.34059 -0.13919 0.04478  0.70937  672 ASP A OD1 
1382 O OD2 . ASP A 176 ? 1.67070 1.58318 1.25969 -0.10456 0.06420  0.70646  672 ASP A OD2 
1383 N N   . LYS A 177 ? 1.60960 1.62684 1.23989 -0.10902 0.13467  0.72315  673 LYS A N   
1384 C CA  . LYS A 177 ? 1.70069 1.67209 1.25831 -0.10027 0.16580  0.74065  673 LYS A CA  
1385 C C   . LYS A 177 ? 1.70695 1.59217 1.19394 -0.11561 0.17315  0.75991  673 LYS A C   
1386 O O   . LYS A 177 ? 1.76378 1.60458 1.19248 -0.11798 0.20869  0.77444  673 LYS A O   
1387 C CB  . LYS A 177 ? 1.78232 1.72906 1.28554 -0.05742 0.14485  0.72597  673 LYS A CB  
1388 C CG  . LYS A 177 ? 1.72418 1.65423 1.23133 -0.03756 0.09338  0.70439  673 LYS A CG  
1389 C CD  . LYS A 177 ? 1.61778 1.54608 1.10395 0.00061  0.06829  0.68724  673 LYS A CD  
1390 C CE  . LYS A 177 ? 1.64085 1.49766 1.02570 0.02156  0.07754  0.69857  673 LYS A CE  
1391 N NZ  . LYS A 177 ? 1.65141 1.47624 1.00204 0.05876  0.03439  0.68163  673 LYS A NZ  
1392 N N   . LEU A 178 ? 1.68151 1.53414 1.16763 -0.12491 0.14193  0.75512  674 LEU A N   
1393 C CA  . LEU A 178 ? 1.77506 1.53883 1.18920 -0.13714 0.14189  0.77103  674 LEU A CA  
1394 C C   . LEU A 178 ? 1.77284 1.54912 1.23672 -0.18194 0.15085  0.78330  674 LEU A C   
1395 O O   . LEU A 178 ? 1.77856 1.59080 1.28600 -0.21133 0.18781  0.79627  674 LEU A O   
1396 C CB  . LEU A 178 ? 1.79131 1.49491 1.15669 -0.10726 0.09441  0.75528  674 LEU A CB  
1397 C CG  . LEU A 178 ? 1.85772 1.49267 1.13309 -0.06824 0.07747  0.75197  674 LEU A CG  
1398 C CD1 . LEU A 178 ? 1.83664 1.50900 1.11162 -0.04671 0.09133  0.74698  674 LEU A CD1 
1399 C CD2 . LEU A 178 ? 1.83869 1.44939 1.11564 -0.03976 0.02561  0.73127  674 LEU A CD2 
1400 N N   A ALA B 16  ? 0.80765 0.87055 1.01968 -0.02440 -0.10451 0.29217  500 ALA B N   
1401 N N   B ALA B 16  ? 0.73148 0.67161 0.93951 -0.02010 -0.17233 0.22726  500 ALA B N   
1402 C CA  A ALA B 16  ? 0.73972 0.81258 0.94731 -0.01796 -0.09653 0.28808  500 ALA B CA  
1403 C CA  B ALA B 16  ? 0.77174 0.72146 0.98598 -0.02310 -0.17228 0.22938  500 ALA B CA  
1404 C C   A ALA B 16  ? 0.65816 0.72017 0.86261 -0.01443 -0.10002 0.27480  500 ALA B C   
1405 C C   B ALA B 16  ? 0.78582 0.75303 0.99474 -0.01880 -0.15900 0.22939  500 ALA B C   
1406 O O   A ALA B 16  ? 0.65102 0.69940 0.84215 -0.00945 -0.10121 0.26358  500 ALA B O   
1407 O O   B ALA B 16  ? 0.83012 0.81212 1.04878 -0.02318 -0.15598 0.23685  500 ALA B O   
1408 C CB  A ALA B 16  ? 0.77161 0.86591 0.99477 -0.02137 -0.09187 0.30110  500 ALA B CB  
1409 C CB  B ALA B 16  ? 0.78979 0.72582 0.99860 -0.01974 -0.18028 0.22007  500 ALA B CB  
1410 N N   A THR B 17  ? 0.66335 0.73224 0.88086 -0.01738 -0.10191 0.27722  501 THR B N   
1411 N N   B THR B 17  ? 0.69138 0.65700 0.88579 -0.01018 -0.15154 0.22127  501 THR B N   
1412 C CA  A THR B 17  ? 0.58006 0.64348 0.79587 -0.01417 -0.10387 0.26701  501 THR B CA  
1413 C CA  B THR B 17  ? 0.63741 0.61727 0.82588 -0.00587 -0.14006 0.22034  501 THR B CA  
1414 C C   A THR B 17  ? 0.52086 0.56491 0.72323 -0.01001 -0.10829 0.25324  501 THR B C   
1415 C C   B THR B 17  ? 0.52894 0.51817 0.71821 -0.00721 -0.13349 0.22745  501 THR B C   
1416 O O   A THR B 17  ? 0.46174 0.50309 0.65200 -0.00299 -0.10394 0.24369  501 THR B O   
1417 O O   B THR B 17  ? 0.47112 0.45283 0.65618 -0.00628 -0.13467 0.22706  501 THR B O   
1418 C CB  A THR B 17  ? 0.53012 0.59765 0.76416 -0.02140 -0.11071 0.27317  501 THR B CB  
1419 C CB  B THR B 17  ? 0.56961 0.54431 0.74292 0.00345  -0.13560 0.20888  501 THR B CB  
1420 O OG1 A THR B 17  ? 0.53894 0.62765 0.78669 -0.02372 -0.10515 0.28560  501 THR B OG1 
1421 O OG1 B THR B 17  ? 0.53515 0.49729 0.70555 0.00565  -0.14314 0.20216  501 THR B OG1 
1422 C CG2 A THR B 17  ? 0.35052 0.40986 0.58122 -0.01853 -0.11439 0.26244  501 THR B CG2 
1423 C CG2 B THR B 17  ? 0.50007 0.48810 0.66998 0.00640  -0.12679 0.20776  501 THR B CG2 
1424 N N   A GLY B 18  ? 0.58611 0.61713 0.79087 -0.01400 -0.11683 0.25274  502 GLY B N   
1425 N N   B GLY B 18  ? 0.55205 0.55763 0.74613 -0.00868 -0.12663 0.23384  502 GLY B N   
1426 C CA  A GLY B 18  ? 0.58803 0.60181 0.78194 -0.00949 -0.12120 0.24061  502 GLY B CA  
1427 C CA  B GLY B 18  ? 0.58592 0.60160 0.78055 -0.00980 -0.12047 0.24178  502 GLY B CA  
1428 C C   A GLY B 18  ? 0.65789 0.66671 0.83687 -0.00295 -0.11631 0.23439  502 GLY B C   
1429 C C   B GLY B 18  ? 0.65724 0.66891 0.83642 -0.00280 -0.11486 0.23515  502 GLY B C   
1430 O O   A GLY B 18  ? 0.69452 0.69685 0.86300 0.00344  -0.11482 0.22400  502 GLY B O   
1431 O O   B GLY B 18  ? 0.69403 0.70237 0.86290 0.00370  -0.11178 0.22545  502 GLY B O   
1432 N N   . LYS B 19  ? 0.69519 0.70753 0.87335 -0.00463 -0.11404 0.24125  503 LYS B N   
1433 C CA  . LYS B 19  ? 0.77430 0.78165 0.93882 0.00104  -0.11056 0.23604  503 LYS B CA  
1434 C C   . LYS B 19  ? 0.68008 0.69735 0.83602 0.00635  -0.10172 0.23384  503 LYS B C   
1435 O O   . LYS B 19  ? 0.83655 0.84860 0.98097 0.01236  -0.09947 0.22537  503 LYS B O   
1436 C CB  . LYS B 19  ? 0.84407 0.84978 1.00980 -0.00280 -0.11267 0.24421  503 LYS B CB  
1437 C CG  . LYS B 19  ? 0.98614 0.97582 1.14727 -0.00105 -0.11883 0.23864  503 LYS B CG  
1438 C CD  . LYS B 19  ? 1.07833 1.06513 1.22544 0.00608  -0.11455 0.23178  503 LYS B CD  
1439 C CE  . LYS B 19  ? 1.08116 1.05350 1.22534 0.00852  -0.12042 0.22668  503 LYS B CE  
1440 N NZ  . LYS B 19  ? 1.07177 1.04286 1.20429 0.01457  -0.11683 0.22178  503 LYS B NZ  
1441 N N   . ALA B 20  ? 0.48603 0.51780 0.64824 0.00435  -0.09700 0.24178  504 ALA B N   
1442 C CA  . ALA B 20  ? 0.51391 0.55453 0.66841 0.00989  -0.08918 0.23989  504 ALA B CA  
1443 C C   . ALA B 20  ? 0.51222 0.54894 0.66195 0.01481  -0.08841 0.22878  504 ALA B C   
1444 O O   . ALA B 20  ? 0.41102 0.44788 0.55041 0.02048  -0.08412 0.22304  504 ALA B O   
1445 C CB  . ALA B 20  ? 0.34924 0.40728 0.51342 0.00740  -0.08427 0.25143  504 ALA B CB  
1446 N N   . ILE B 21  ? 0.43135 0.46397 0.58803 0.01258  -0.09313 0.22589  505 ILE B N   
1447 C CA  . ILE B 21  ? 0.38200 0.40997 0.53306 0.01706  -0.09295 0.21568  505 ILE B CA  
1448 C C   . ILE B 21  ? 0.38163 0.39725 0.52164 0.02129  -0.09460 0.20672  505 ILE B C   
1449 O O   . ILE B 21  ? 0.42034 0.43496 0.55147 0.02649  -0.09123 0.19965  505 ILE B O   
1450 C CB  . ILE B 21  ? 0.43805 0.46487 0.59875 0.01347  -0.09825 0.21593  505 ILE B CB  
1451 C CG1 . ILE B 21  ? 0.32552 0.36666 0.49670 0.01120  -0.09530 0.22297  505 ILE B CG1 
1452 C CG2 . ILE B 21  ? 0.40718 0.42531 0.56023 0.01782  -0.10002 0.20533  505 ILE B CG2 
1453 C CD1 . ILE B 21  ? 0.32884 0.37010 0.51309 0.00531  -0.10219 0.22690  505 ILE B CD1 
1454 N N   . LEU B 22  ? 0.47061 0.47714 0.61200 0.01914  -0.09998 0.20755  506 LEU B N   
1455 C CA  . LEU B 22  ? 0.34105 0.33696 0.47391 0.02363  -0.10163 0.19996  506 LEU B CA  
1456 C C   . LEU B 22  ? 0.37284 0.37071 0.49675 0.02708  -0.09710 0.19896  506 LEU B C   
1457 O O   . LEU B 22  ? 0.42237 0.41659 0.53873 0.03205  -0.09574 0.19167  506 LEU B O   
1458 C CB  . LEU B 22  ? 0.53839 0.52401 0.67577 0.02090  -0.10882 0.20177  506 LEU B CB  
1459 C CG  . LEU B 22  ? 0.67504 0.65129 0.81491 0.02165  -0.11492 0.19678  506 LEU B CG  
1460 C CD1 . LEU B 22  ? 0.63123 0.61279 0.77566 0.01979  -0.11507 0.19697  506 LEU B CD1 
1461 C CD2 . LEU B 22  ? 0.70893 0.67545 0.85575 0.01749  -0.12305 0.20076  506 LEU B CD2 
1462 N N   . ASN B 23  ? 0.34332 0.34750 0.46807 0.02449  -0.09495 0.20675  507 ASN B N   
1463 C CA  . ASN B 23  ? 0.46839 0.47449 0.58349 0.02791  -0.09115 0.20618  507 ASN B CA  
1464 C C   . ASN B 23  ? 0.48796 0.49916 0.59759 0.03220  -0.08628 0.20111  507 ASN B C   
1465 O O   . ASN B 23  ? 0.33278 0.34113 0.43370 0.03629  -0.08506 0.19601  507 ASN B O   
1466 C CB  . ASN B 23  ? 0.59493 0.60767 0.71125 0.02452  -0.08963 0.21663  507 ASN B CB  
1467 C CG  . ASN B 23  ? 0.55742 0.56377 0.67772 0.02036  -0.09492 0.22168  507 ASN B CG  
1468 O OD1 . ASN B 23  ? 0.55852 0.55472 0.67556 0.02225  -0.09871 0.21662  507 ASN B OD1 
1469 N ND2 . ASN B 23  ? 0.51291 0.52562 0.64144 0.01466  -0.09539 0.23216  507 ASN B ND2 
1470 N N   . GLY B 24  ? 0.48322 0.50177 0.59871 0.03115  -0.08412 0.20273  508 GLY B N   
1471 C CA  . GLY B 24  ? 0.33362 0.35643 0.44475 0.03520  -0.08005 0.19824  508 GLY B CA  
1472 C C   . GLY B 24  ? 0.37904 0.39473 0.48547 0.03850  -0.08129 0.18851  508 GLY B C   
1473 O O   . GLY B 24  ? 0.31243 0.32778 0.41190 0.04227  -0.07909 0.18387  508 GLY B O   
1474 N N   . ILE B 25  ? 0.31629 0.32631 0.42662 0.03717  -0.08513 0.18597  509 ILE B N   
1475 C CA  . ILE B 25  ? 0.31289 0.31699 0.41905 0.04062  -0.08619 0.17802  509 ILE B CA  
1476 C C   . ILE B 25  ? 0.31462 0.31428 0.41412 0.04367  -0.08614 0.17482  509 ILE B C   
1477 O O   . ILE B 25  ? 0.35057 0.35019 0.44530 0.04696  -0.08437 0.16981  509 ILE B O   
1478 C CB  . ILE B 25  ? 0.31659 0.31472 0.42753 0.03925  -0.09103 0.17710  509 ILE B CB  
1479 C CG1 . ILE B 25  ? 0.31463 0.31733 0.43210 0.03631  -0.09176 0.17969  509 ILE B CG1 
1480 C CG2 . ILE B 25  ? 0.31567 0.30792 0.42202 0.04367  -0.09209 0.17016  509 ILE B CG2 
1481 C CD1 . ILE B 25  ? 0.31997 0.31584 0.44139 0.03504  -0.09775 0.17865  509 ILE B CD1 
1482 N N   A ASP B 26  ? 0.38503 0.38132 0.48486 0.04226  -0.08842 0.17839  510 ASP B N   
1483 N N   B ASP B 26  ? 0.36424 0.36050 0.46415 0.04223  -0.08846 0.17841  510 ASP B N   
1484 C CA  A ASP B 26  ? 0.32466 0.31670 0.41928 0.04500  -0.08928 0.17592  510 ASP B CA  
1485 C CA  B ASP B 26  ? 0.32493 0.31692 0.41970 0.04487  -0.08937 0.17614  510 ASP B CA  
1486 C C   A ASP B 26  ? 0.33626 0.33218 0.42414 0.04659  -0.08629 0.17616  510 ASP B C   
1487 C C   B ASP B 26  ? 0.33031 0.32617 0.41828 0.04653  -0.08635 0.17624  510 ASP B C   
1488 O O   A ASP B 26  ? 0.32165 0.31580 0.40522 0.04960  -0.08628 0.17188  510 ASP B O   
1489 O O   B ASP B 26  ? 0.32180 0.31580 0.40552 0.04955  -0.08639 0.17193  510 ASP B O   
1490 C CB  A ASP B 26  ? 0.43502 0.42199 0.53206 0.04292  -0.09316 0.18026  510 ASP B CB  
1491 C CB  B ASP B 26  ? 0.42075 0.40794 0.51805 0.04256  -0.09317 0.18084  510 ASP B CB  
1492 C CG  A ASP B 26  ? 0.49643 0.47658 0.59888 0.04297  -0.09743 0.17843  510 ASP B CG  
1493 C CG  B ASP B 26  ? 0.36934 0.35340 0.46148 0.04474  -0.09425 0.18030  510 ASP B CG  
1494 O OD1 A ASP B 26  ? 0.45615 0.43589 0.55940 0.04503  -0.09715 0.17378  510 ASP B OD1 
1495 O OD1 B ASP B 26  ? 0.33870 0.31859 0.43078 0.04805  -0.09592 0.17550  510 ASP B OD1 
1496 O OD2 A ASP B 26  ? 0.57318 0.54791 0.67871 0.04119  -0.10146 0.18187  510 ASP B OD2 
1497 O OD2 B ASP B 26  ? 0.35709 0.34338 0.44539 0.04337  -0.09356 0.18519  510 ASP B OD2 
1498 N N   . SER B 27  ? 0.34245 0.34390 0.42974 0.04483  -0.08406 0.18159  511 SER B N   
1499 C CA  . SER B 27  ? 0.37874 0.38302 0.45851 0.04727  -0.08171 0.18183  511 SER B CA  
1500 C C   . SER B 27  ? 0.41399 0.41953 0.49182 0.05018  -0.07976 0.17582  511 SER B C   
1501 O O   . SER B 27  ? 0.40991 0.41384 0.48139 0.05293  -0.07988 0.17308  511 SER B O   
1502 C CB  . SER B 27  ? 0.33039 0.34156 0.41048 0.04562  -0.07923 0.18974  511 SER B CB  
1503 O OG  . SER B 27  ? 0.43509 0.44587 0.51853 0.04194  -0.08108 0.19644  511 SER B OG  
1504 N N   . ILE B 28  ? 0.40796 0.41588 0.49130 0.04940  -0.07865 0.17403  512 ILE B N   
1505 C CA  . ILE B 28  ? 0.30511 0.31393 0.38700 0.05173  -0.07714 0.16890  512 ILE B CA  
1506 C C   . ILE B 28  ? 0.50485 0.50898 0.58536 0.05333  -0.07884 0.16340  512 ILE B C   
1507 O O   . ILE B 28  ? 0.30059 0.30441 0.37784 0.05540  -0.07837 0.16008  512 ILE B O   
1508 C CB  . ILE B 28  ? 0.34849 0.36134 0.43646 0.05033  -0.07592 0.16933  512 ILE B CB  
1509 C CG1 . ILE B 28  ? 0.30085 0.32069 0.39028 0.05052  -0.07314 0.17397  512 ILE B CG1 
1510 C CG2 . ILE B 28  ? 0.29445 0.30602 0.38175 0.05199  -0.07571 0.16359  512 ILE B CG2 
1511 C CD1 . ILE B 28  ? 0.29606 0.32028 0.39190 0.04959  -0.07228 0.17417  512 ILE B CD1 
1512 N N   . ASN B 29  ? 0.30453 0.30520 0.38829 0.05259  -0.08109 0.16299  513 ASN B N   
1513 C CA  . ASN B 29  ? 0.30388 0.30138 0.38749 0.05479  -0.08257 0.15908  513 ASN B CA  
1514 C C   . ASN B 29  ? 0.36784 0.36425 0.44731 0.05612  -0.08344 0.15894  513 ASN B C   
1515 O O   . ASN B 29  ? 0.30425 0.30104 0.38338 0.05786  -0.08354 0.15593  513 ASN B O   
1516 C CB  . ASN B 29  ? 0.30783 0.30118 0.39545 0.05474  -0.08534 0.15942  513 ASN B CB  
1517 C CG  . ASN B 29  ? 0.42890 0.42208 0.51967 0.05473  -0.08557 0.15801  513 ASN B CG  
1518 O OD1 . ASN B 29  ? 0.39028 0.38695 0.48036 0.05476  -0.08346 0.15655  513 ASN B OD1 
1519 N ND2 . ASN B 29  ? 0.38977 0.37816 0.48373 0.05498  -0.08879 0.15851  513 ASN B ND2 
1520 N N   . LYS B 30  ? 0.34934 0.34494 0.42566 0.05512  -0.08427 0.16289  514 LYS B N   
1521 C CA  . LYS B 30  ? 0.36836 0.36240 0.43929 0.05650  -0.08587 0.16327  514 LYS B CA  
1522 C C   . LYS B 30  ? 0.33495 0.33071 0.40132 0.05813  -0.08468 0.16131  514 LYS B C   
1523 O O   . LYS B 30  ? 0.32747 0.32207 0.39267 0.05957  -0.08638 0.15888  514 LYS B O   
1524 C CB  . LYS B 30  ? 0.42427 0.41724 0.49155 0.05514  -0.08700 0.16888  514 LYS B CB  
1525 C CG  . LYS B 30  ? 0.51294 0.50175 0.58161 0.05484  -0.09046 0.17027  514 LYS B CG  
1526 C CD  . LYS B 30  ? 0.63452 0.62238 0.70578 0.05185  -0.09119 0.17580  514 LYS B CD  
1527 C CE  . LYS B 30  ? 0.67993 0.66246 0.75385 0.05180  -0.09530 0.17690  514 LYS B CE  
1528 N NZ  . LYS B 30  ? 0.66625 0.64718 0.74243 0.04831  -0.09681 0.18337  514 LYS B NZ  
1529 N N   . VAL B 31  ? 0.40332 0.40194 0.46805 0.05801  -0.08219 0.16276  515 VAL B N   
1530 C CA  . VAL B 31  ? 0.31453 0.31373 0.37486 0.06023  -0.08158 0.16111  515 VAL B CA  
1531 C C   . VAL B 31  ? 0.41087 0.40994 0.47467 0.06066  -0.08166 0.15637  515 VAL B C   
1532 O O   . VAL B 31  ? 0.30952 0.30692 0.37047 0.06217  -0.08334 0.15463  515 VAL B O   
1533 C CB  . VAL B 31  ? 0.43378 0.43710 0.49413 0.06051  -0.07864 0.16386  515 VAL B CB  
1534 C CG1 . VAL B 31  ? 0.31433 0.31742 0.37117 0.06354  -0.07838 0.16162  515 VAL B CG1 
1535 C CG2 . VAL B 31  ? 0.32227 0.32732 0.37908 0.06030  -0.07823 0.17000  515 VAL B CG2 
1536 N N   . LEU B 32  ? 0.30138 0.30221 0.37130 0.05930  -0.08026 0.15488  516 LEU B N   
1537 C CA  . LEU B 32  ? 0.29597 0.29779 0.36900 0.05959  -0.07989 0.15170  516 LEU B CA  
1538 C C   . LEU B 32  ? 0.41071 0.41173 0.48607 0.06002  -0.08202 0.15059  516 LEU B C   
1539 O O   . LEU B 32  ? 0.29489 0.29684 0.37175 0.06027  -0.08263 0.14936  516 LEU B O   
1540 C CB  . LEU B 32  ? 0.29101 0.29486 0.36855 0.05856  -0.07818 0.15108  516 LEU B CB  
1541 C CG  . LEU B 32  ? 0.28906 0.29512 0.36625 0.05822  -0.07627 0.15174  516 LEU B CG  
1542 C CD1 . LEU B 32  ? 0.53308 0.54030 0.61400 0.05672  -0.07585 0.15286  516 LEU B CD1 
1543 C CD2 . LEU B 32  ? 0.39426 0.40120 0.47193 0.05877  -0.07573 0.14964  516 LEU B CD2 
1544 N N   . ASP B 33  ? 0.30535 0.30499 0.38219 0.06003  -0.08346 0.15161  517 ASP B N   
1545 C CA  . ASP B 33  ? 0.37625 0.37594 0.45670 0.06085  -0.08575 0.15116  517 ASP B CA  
1546 C C   . ASP B 33  ? 0.37594 0.37441 0.45276 0.06116  -0.08836 0.15164  517 ASP B C   
1547 O O   . ASP B 33  ? 0.30855 0.30886 0.38948 0.06120  -0.08987 0.15106  517 ASP B O   
1548 C CB  . ASP B 33  ? 0.35081 0.34837 0.43339 0.06131  -0.08727 0.15238  517 ASP B CB  
1549 C CG  . ASP B 33  ? 0.56135 0.55994 0.64976 0.06287  -0.08955 0.15206  517 ASP B CG  
1550 O OD1 . ASP B 33  ? 0.53885 0.54097 0.63309 0.06393  -0.08851 0.15089  517 ASP B OD1 
1551 O OD2 . ASP B 33  ? 0.60878 0.60524 0.69634 0.06317  -0.09248 0.15357  517 ASP B OD2 
1552 N N   . HIS B 34  ? 0.31115 0.30678 0.38043 0.06144  -0.08924 0.15334  518 HIS B N   
1553 C CA  . HIS B 34  ? 0.34548 0.33875 0.40886 0.06250  -0.09236 0.15388  518 HIS B CA  
1554 C C   . HIS B 34  ? 0.40829 0.40212 0.47209 0.06283  -0.09240 0.15199  518 HIS B C   
1555 O O   . HIS B 34  ? 0.45721 0.45038 0.52223 0.06283  -0.09582 0.15176  518 HIS B O   
1556 C CB  . HIS B 34  ? 0.32581 0.31642 0.37985 0.06349  -0.09260 0.15666  518 HIS B CB  
1557 C CG  . HIS B 34  ? 0.43059 0.41791 0.47606 0.06571  -0.09595 0.15721  518 HIS B CG  
1558 N ND1 . HIS B 34  ? 0.54534 0.52995 0.58725 0.06628  -0.10066 0.15842  518 HIS B ND1 
1559 C CD2 . HIS B 34  ? 0.51991 0.50566 0.55929 0.06799  -0.09594 0.15687  518 HIS B CD2 
1560 C CE1 . HIS B 34  ? 0.58878 0.56998 0.62196 0.06874  -0.10369 0.15871  518 HIS B CE1 
1561 N NE2 . HIS B 34  ? 0.57021 0.55175 0.60164 0.07014  -0.10088 0.15771  518 HIS B NE2 
1562 N N   . PHE B 35  ? 0.31077 0.30579 0.37445 0.06285  -0.08917 0.15106  519 PHE B N   
1563 C CA  . PHE B 35  ? 0.43809 0.43323 0.50308 0.06301  -0.08938 0.14957  519 PHE B CA  
1564 C C   . PHE B 35  ? 0.44784 0.44635 0.52187 0.06105  -0.08985 0.14909  519 PHE B C   
1565 O O   . PHE B 35  ? 0.30507 0.30326 0.38144 0.06042  -0.09237 0.14920  519 PHE B O   
1566 C CB  . PHE B 35  ? 0.30712 0.30358 0.37185 0.06326  -0.08583 0.14898  519 PHE B CB  
1567 C CG  . PHE B 35  ? 0.37981 0.37443 0.43736 0.06566  -0.08533 0.15033  519 PHE B CG  
1568 C CD1 . PHE B 35  ? 0.40333 0.39432 0.45306 0.06803  -0.08825 0.15182  519 PHE B CD1 
1569 C CD2 . PHE B 35  ? 0.30679 0.30403 0.36578 0.06577  -0.08210 0.15078  519 PHE B CD2 
1570 C CE1 . PHE B 35  ? 0.40755 0.39795 0.45070 0.07090  -0.08750 0.15411  519 PHE B CE1 
1571 C CE2 . PHE B 35  ? 0.37802 0.37550 0.43240 0.06824  -0.08127 0.15312  519 PHE B CE2 
1572 C CZ  . PHE B 35  ? 0.32221 0.31649 0.36854 0.07103  -0.08373 0.15497  519 PHE B CZ  
1573 N N   . ARG B 36  ? 0.29854 0.30041 0.37820 0.06024  -0.08779 0.14919  520 ARG B N   
1574 C CA  . ARG B 36  ? 0.29433 0.30075 0.38303 0.05917  -0.08767 0.14971  520 ARG B CA  
1575 C C   . ARG B 36  ? 0.29796 0.30521 0.39102 0.05881  -0.09157 0.15108  520 ARG B C   
1576 O O   . ARG B 36  ? 0.30405 0.31448 0.40390 0.05733  -0.09305 0.15244  520 ARG B O   
1577 C CB  . ARG B 36  ? 0.29049 0.29952 0.38299 0.05979  -0.08502 0.14959  520 ARG B CB  
1578 C CG  . ARG B 36  ? 0.28728 0.30208 0.38895 0.05987  -0.08430 0.15091  520 ARG B CG  
1579 C CD  . ARG B 36  ? 0.34032 0.35606 0.44468 0.06213  -0.08323 0.15075  520 ARG B CD  
1580 N NE  . ARG B 36  ? 0.36310 0.38507 0.47544 0.06347  -0.08184 0.15248  520 ARG B NE  
1581 C CZ  . ARG B 36  ? 0.37691 0.40030 0.49279 0.06682  -0.08132 0.15262  520 ARG B CZ  
1582 N NH1 . ARG B 36  ? 0.29025 0.30830 0.40275 0.06847  -0.08259 0.15096  520 ARG B NH1 
1583 N NH2 . ARG B 36  ? 0.37785 0.40813 0.50096 0.06891  -0.07970 0.15496  520 ARG B NH2 
1584 N N   . ARG B 37  ? 0.30284 0.30750 0.39276 0.05979  -0.09370 0.15139  521 ARG B N   
1585 C CA  . ARG B 37  ? 0.40294 0.40865 0.49769 0.05944  -0.09801 0.15293  521 ARG B CA  
1586 C C   . ARG B 37  ? 0.43791 0.44075 0.52944 0.05852  -0.10235 0.15339  521 ARG B C   
1587 O O   . ARG B 37  ? 0.51522 0.52038 0.61404 0.05703  -0.10630 0.15507  521 ARG B O   
1588 C CB  . ARG B 37  ? 0.31203 0.31509 0.40367 0.06077  -0.09961 0.15353  521 ARG B CB  
1589 C CG  . ARG B 37  ? 0.47779 0.48294 0.57481 0.06199  -0.09714 0.15339  521 ARG B CG  
1590 C CD  . ARG B 37  ? 0.48471 0.48648 0.57969 0.06309  -0.09970 0.15460  521 ARG B CD  
1591 N NE  . ARG B 37  ? 0.67620 0.67315 0.76161 0.06289  -0.09862 0.15500  521 ARG B NE  
1592 C CZ  . ARG B 37  ? 0.71612 0.70947 0.79249 0.06262  -0.10069 0.15646  521 ARG B CZ  
1593 N NH1 . ARG B 37  ? 0.38868 0.37920 0.45791 0.06240  -0.09917 0.15793  521 ARG B NH1 
1594 N NH2 . ARG B 37  ? 0.79785 0.79064 0.87249 0.06264  -0.10465 0.15703  521 ARG B NH2 
1595 N N   . LYS B 38  ? 0.34251 0.34036 0.42393 0.05961  -0.10221 0.15226  522 LYS B N   
1596 C CA  . LYS B 38  ? 0.32452 0.31796 0.40123 0.05981  -0.10730 0.15254  522 LYS B CA  
1597 C C   . LYS B 38  ? 0.32227 0.31593 0.40291 0.05839  -0.10752 0.15221  522 LYS B C   
1598 O O   . LYS B 38  ? 0.65502 0.64412 0.73276 0.05842  -0.11254 0.15240  522 LYS B O   
1599 C CB  . LYS B 38  ? 0.33320 0.32060 0.39595 0.06301  -0.10809 0.15227  522 LYS B CB  
1600 C CG  . LYS B 38  ? 0.45774 0.44431 0.51591 0.06393  -0.10867 0.15375  522 LYS B CG  
1601 C CD  . LYS B 38  ? 0.69325 0.67973 0.75489 0.06279  -0.11469 0.15527  522 LYS B CD  
1602 C CE  . LYS B 38  ? 0.71565 0.69841 0.76752 0.06449  -0.11760 0.15736  522 LYS B CE  
1603 N NZ  . LYS B 38  ? 0.74307 0.72865 0.80168 0.06342  -0.11726 0.15865  522 LYS B NZ  
1604 N N   . GLY B 39  ? 0.28856 0.34255 0.44764 0.02516  -0.12220 0.06699  523 GLY B N   
1605 C CA  . GLY B 39  ? 0.17443 0.25178 0.33718 0.01164  -0.11289 0.06934  523 GLY B CA  
1606 C C   . GLY B 39  ? 0.27091 0.31104 0.38331 0.00568  -0.10708 0.08467  523 GLY B C   
1607 O O   . GLY B 39  ? 0.30203 0.33569 0.39396 -0.00731 -0.10973 0.08684  523 GLY B O   
1608 N N   . ILE B 40  ? 0.27043 0.28513 0.35780 0.01306  -0.09526 0.08815  524 ILE B N   
1609 C CA  . ILE B 40  ? 0.22344 0.21296 0.27032 0.01166  -0.08613 0.09232  524 ILE B CA  
1610 C C   . ILE B 40  ? 0.18290 0.17721 0.23606 0.01643  -0.06921 0.09086  524 ILE B C   
1611 O O   . ILE B 40  ? 0.27432 0.28262 0.35219 0.01961  -0.06395 0.08847  524 ILE B O   
1612 C CB  . ILE B 40  ? 0.25236 0.21641 0.26237 0.01212  -0.09039 0.09730  524 ILE B CB  
1613 C CG1 . ILE B 40  ? 0.25022 0.21085 0.26435 0.01394  -0.08947 0.10166  524 ILE B CG1 
1614 C CG2 . ILE B 40  ? 0.26153 0.21630 0.26119 0.00659  -0.10898 0.09755  524 ILE B CG2 
1615 C CD1 . ILE B 40  ? 0.28880 0.22283 0.25793 0.00572  -0.09460 0.11186  524 ILE B CD1 
1616 N N   . ASN B 41  ? 0.24501 0.22589 0.27729 0.01847  -0.06428 0.08998  525 ASN B N   
1617 C CA  . ASN B 41  ? 0.22569 0.21092 0.26526 0.02488  -0.05148 0.08686  525 ASN B CA  
1618 C C   . ASN B 41  ? 0.17490 0.17507 0.23962 0.02135  -0.04710 0.08416  525 ASN B C   
1619 O O   . ASN B 41  ? 0.16407 0.17442 0.24400 0.02422  -0.03756 0.08250  525 ASN B O   
1620 C CB  . ASN B 41  ? 0.25371 0.24320 0.28895 0.02661  -0.04119 0.09050  525 ASN B CB  
1621 C CG  . ASN B 41  ? 0.29474 0.27420 0.29510 0.02445  -0.03931 0.08752  525 ASN B CG  
1622 O OD1 . ASN B 41  ? 0.35135 0.32370 0.33790 0.03014  -0.04062 0.07508  525 ASN B OD1 
1623 N ND2 . ASN B 41  ? 0.33307 0.30674 0.31359 0.01457  -0.03982 0.09804  525 ASN B ND2 
1624 N N   . GLN B 42  ? 0.20439 0.20527 0.26913 0.01074  -0.05563 0.08506  526 GLN B N   
1625 C CA  . GLN B 42  ? 0.22418 0.24110 0.30331 0.00053  -0.05101 0.08270  526 GLN B CA  
1626 C C   . GLN B 42  ? 0.25673 0.26133 0.33207 0.00570  -0.04758 0.08170  526 GLN B C   
1627 O O   . GLN B 42  ? 0.25683 0.27602 0.34765 0.00352  -0.04004 0.07967  526 GLN B O   
1628 C CB  . GLN B 42  ? 0.27570 0.29156 0.33947 -0.02195 -0.05975 0.08355  526 GLN B CB  
1629 C CG  . GLN B 42  ? 0.42883 0.47254 0.50254 -0.04151 -0.05134 0.07910  526 GLN B CG  
1630 C CD  . GLN B 42  ? 0.46885 0.55993 0.58612 -0.03475 -0.03979 0.06684  526 GLN B CD  
1631 O OE1 . GLN B 42  ? 0.58173 0.68973 0.71991 -0.02845 -0.04509 0.06290  526 GLN B OE1 
1632 N NE2 . GLN B 42  ? 0.21617 0.32548 0.34808 -0.03415 -0.02832 0.05850  526 GLN B NE2 
1633 N N   . HIS B 43  ? 0.26225 0.24254 0.32019 0.01468  -0.05394 0.07819  527 HIS B N   
1634 C CA  . HIS B 43  ? 0.23075 0.20403 0.29178 0.02185  -0.05379 0.07142  527 HIS B CA  
1635 C C   . HIS B 43  ? 0.17028 0.16687 0.25460 0.03033  -0.03785 0.06895  527 HIS B C   
1636 O O   . HIS B 43  ? 0.12981 0.12918 0.22345 0.03046  -0.03650 0.06573  527 HIS B O   
1637 C CB  . HIS B 43  ? 0.22976 0.17842 0.27698 0.03422  -0.06704 0.06122  527 HIS B CB  
1638 C CG  . HIS B 43  ? 0.26915 0.23057 0.32706 0.05183  -0.05985 0.05410  527 HIS B CG  
1639 N ND1 . HIS B 43  ? 0.33145 0.29475 0.37369 0.04878  -0.05511 0.05645  527 HIS B ND1 
1640 C CD2 . HIS B 43  ? 0.27035 0.24972 0.34651 0.06734  -0.05210 0.03852  527 HIS B CD2 
1641 C CE1 . HIS B 43  ? 0.27020 0.24937 0.31302 0.05860  -0.04303 0.04449  527 HIS B CE1 
1642 N NE2 . HIS B 43  ? 0.34751 0.34187 0.41377 0.06965  -0.03891 0.03168  527 HIS B NE2 
1643 N N   . VAL B 44  ? 0.12995 0.13847 0.21922 0.03376  -0.02928 0.07259  528 VAL B N   
1644 C CA  . VAL B 44  ? 0.13361 0.15737 0.23902 0.03426  -0.01835 0.07553  528 VAL B CA  
1645 C C   . VAL B 44  ? 0.21827 0.24638 0.33303 0.02680  -0.01721 0.07442  528 VAL B C   
1646 O O   . VAL B 44  ? 0.25655 0.28869 0.38196 0.02568  -0.01340 0.07235  528 VAL B O   
1647 C CB  . VAL B 44  ? 0.16149 0.18700 0.25730 0.03319  -0.01473 0.08415  528 VAL B CB  
1648 C CG1 . VAL B 44  ? 0.14424 0.17411 0.24891 0.02653  -0.01049 0.09281  528 VAL B CG1 
1649 C CG2 . VAL B 44  ? 0.14917 0.18061 0.23112 0.03719  -0.00767 0.07318  528 VAL B CG2 
1650 N N   . GLN B 45  ? 0.23359 0.26443 0.35040 0.02383  -0.02211 0.07520  529 GLN B N   
1651 C CA  . GLN B 45  ? 0.10865 0.15279 0.24624 0.02269  -0.02239 0.07081  529 GLN B CA  
1652 C C   . GLN B 45  ? 0.08759 0.13996 0.23373 0.01834  -0.02040 0.07012  529 GLN B C   
1653 O O   . GLN B 45  ? 0.09827 0.15556 0.25574 0.01937  -0.01684 0.06415  529 GLN B O   
1654 C CB  . GLN B 45  ? 0.09564 0.15629 0.24751 0.02198  -0.02950 0.06864  529 GLN B CB  
1655 C CG  . GLN B 45  ? 0.21711 0.26693 0.36455 0.02730  -0.03811 0.06865  529 GLN B CG  
1656 C CD  . GLN B 45  ? 0.17659 0.24911 0.34641 0.02785  -0.04744 0.06104  529 GLN B CD  
1657 O OE1 . GLN B 45  ? 0.21569 0.31266 0.41319 0.03235  -0.04773 0.04426  529 GLN B OE1 
1658 N NE2 . GLN B 45  ? 0.18202 0.25066 0.34049 0.02307  -0.05531 0.06916  529 GLN B NE2 
1659 N N   . ASN B 46  ? 0.09876 0.14232 0.22438 0.00825  -0.02478 0.07259  530 ASN B N   
1660 C CA  . ASN B 46  ? 0.14405 0.18094 0.25584 -0.00436 -0.02678 0.07112  530 ASN B CA  
1661 C C   . ASN B 46  ? 0.13081 0.15579 0.24931 0.00581  -0.02894 0.07237  530 ASN B C   
1662 O O   . ASN B 46  ? 0.19267 0.21769 0.30980 -0.00103 -0.02900 0.06953  530 ASN B O   
1663 C CB  . ASN B 46  ? 0.13885 0.15073 0.21670 -0.01939 -0.04026 0.07698  530 ASN B CB  
1664 C CG  . ASN B 46  ? 0.29225 0.31981 0.36206 -0.03726 -0.03839 0.07622  530 ASN B CG  
1665 O OD1 . ASN B 46  ? 0.13025 0.19569 0.22526 -0.03837 -0.02601 0.06674  530 ASN B OD1 
1666 N ND2 . ASN B 46  ? 0.17878 0.17738 0.21625 -0.05132 -0.05401 0.08391  530 ASN B ND2 
1667 N N   . GLY B 47  ? 0.10491 0.12329 0.22439 0.01771  -0.02837 0.07019  531 GLY B N   
1668 C CA  . GLY B 47  ? 0.10617 0.12280 0.23093 0.02349  -0.02812 0.06366  531 GLY B CA  
1669 C C   . GLY B 47  ? 0.16463 0.19447 0.30516 0.02342  -0.01766 0.06334  531 GLY B C   
1670 O O   . GLY B 47  ? 0.20605 0.24016 0.35752 0.02581  -0.01794 0.06038  531 GLY B O   
1671 N N   . TYR B 48  ? 0.08875 0.12295 0.23294 0.02092  -0.01275 0.06599  532 TYR B N   
1672 C CA  . TYR B 48  ? 0.10499 0.14042 0.26055 0.01969  -0.01036 0.06828  532 TYR B CA  
1673 C C   . TYR B 48  ? 0.08818 0.12195 0.25218 0.01876  -0.01355 0.06283  532 TYR B C   
1674 O O   . TYR B 48  ? 0.08999 0.12958 0.25923 0.02126  -0.01471 0.05700  532 TYR B O   
1675 C CB  . TYR B 48  ? 0.16508 0.19743 0.31961 0.02028  -0.01205 0.07403  532 TYR B CB  
1676 C CG  . TYR B 48  ? 0.10688 0.13168 0.27218 0.01714  -0.01736 0.08055  532 TYR B CG  
1677 C CD1 . TYR B 48  ? 0.18852 0.21743 0.36322 0.01116  -0.01515 0.09627  532 TYR B CD1 
1678 C CD2 . TYR B 48  ? 0.15838 0.17253 0.32870 0.02045  -0.02673 0.07221  532 TYR B CD2 
1679 C CE1 . TYR B 48  ? 0.26194 0.27602 0.43959 0.00141  -0.02358 0.10634  532 TYR B CE1 
1680 C CE2 . TYR B 48  ? 0.21867 0.21642 0.39456 0.01695  -0.03759 0.07759  532 TYR B CE2 
1681 C CZ  . TYR B 48  ? 0.26890 0.26380 0.44465 0.00503  -0.03717 0.09560  532 TYR B CZ  
1682 O OH  . TYR B 48  ? 0.17510 0.14757 0.34802 -0.00481 -0.05089 0.10302  532 TYR B OH  
1683 N N   . HIS B 49  ? 0.11613 0.14752 0.28917 0.01652  -0.01552 0.06346  533 HIS B N   
1684 C CA  . HIS B 49  ? 0.13693 0.16661 0.31964 0.01683  -0.02028 0.05750  533 HIS B CA  
1685 C C   . HIS B 49  ? 0.14011 0.16040 0.33508 0.01779  -0.02595 0.05592  533 HIS B C   
1686 O O   . HIS B 49  ? 0.13582 0.15332 0.34187 0.02064  -0.03159 0.04714  533 HIS B O   
1687 C CB  . HIS B 49  ? 0.09336 0.12089 0.27612 0.01328  -0.02634 0.05934  533 HIS B CB  
1688 C CG  . HIS B 49  ? 0.14096 0.16594 0.31001 0.01228  -0.03071 0.06257  533 HIS B CG  
1689 N ND1 . HIS B 49  ? 0.11195 0.13759 0.26192 0.00438  -0.02912 0.06042  533 HIS B ND1 
1690 C CD2 . HIS B 49  ? 0.10275 0.12149 0.26366 0.01416  -0.03624 0.06149  533 HIS B CD2 
1691 C CE1 . HIS B 49  ? 0.11625 0.12729 0.24709 0.00070  -0.03880 0.06583  533 HIS B CE1 
1692 N NE2 . HIS B 49  ? 0.11496 0.12071 0.25725 0.01104  -0.04562 0.06563  533 HIS B NE2 
1693 N N   . GLY B 50  ? 0.11011 0.12366 0.30618 0.01501  -0.02833 0.06514  534 GLY B N   
1694 C CA  . GLY B 50  ? 0.25645 0.25138 0.46038 0.01349  -0.04132 0.06679  534 GLY B CA  
1695 C C   . GLY B 50  ? 0.25243 0.24509 0.46862 0.00289  -0.04510 0.07812  534 GLY B C   
1696 O O   . GLY B 50  ? 0.20527 0.21635 0.43230 -0.00020 -0.03759 0.08358  534 GLY B O   
1697 N N   . ILE B 51  ? 0.30819 0.27674 0.52397 -0.00271 -0.06042 0.08053  535 ILE B N   
1698 C CA  . ILE B 51  ? 0.29539 0.26109 0.51918 -0.01924 -0.06500 0.09311  535 ILE B CA  
1699 C C   . ILE B 51  ? 0.20843 0.17416 0.44486 -0.01565 -0.06875 0.08213  535 ILE B C   
1700 O O   . ILE B 51  ? 0.18129 0.14192 0.41409 -0.00222 -0.07013 0.06490  535 ILE B O   
1701 C CB  . ILE B 51  ? 0.22232 0.15729 0.42758 -0.03294 -0.08277 0.10200  535 ILE B CB  
1702 C CG1 . ILE B 51  ? 0.31971 0.22430 0.52029 -0.01771 -0.10205 0.08456  535 ILE B CG1 
1703 C CG2 . ILE B 51  ? 0.24324 0.17761 0.42741 -0.04450 -0.07896 0.11691  535 ILE B CG2 
1704 C CD1 . ILE B 51  ? 0.30193 0.16824 0.48464 -0.03056 -0.12713 0.09227  535 ILE B CD1 
1705 N N   . VAL B 52  ? 0.17095 0.14666 0.42121 -0.03117 -0.06963 0.09042  536 VAL B N   
1706 C CA  . VAL B 52  ? 0.27408 0.25106 0.53252 -0.03029 -0.07636 0.08038  536 VAL B CA  
1707 C C   . VAL B 52  ? 0.20509 0.14641 0.45142 -0.02441 -0.09200 0.06802  536 VAL B C   
1708 O O   . VAL B 52  ? 0.19470 0.13321 0.43351 -0.01637 -0.09306 0.05255  536 VAL B O   
1709 C CB  . VAL B 52  ? 0.22198 0.22162 0.49887 -0.04803 -0.07756 0.08751  536 VAL B CB  
1710 C CG1 . VAL B 52  ? 0.18377 0.17342 0.46521 -0.04914 -0.09253 0.07905  536 VAL B CG1 
1711 C CG2 . VAL B 52  ? 0.17217 0.21505 0.46421 -0.04398 -0.06185 0.08523  536 VAL B CG2 
1712 N N   . MET B 53  ? 0.23786 0.15592 0.47343 -0.02802 -0.10410 0.07043  537 MET B N   
1713 C CA  . MET B 53  ? 0.26069 0.14567 0.48751 -0.01950 -0.12246 0.05364  537 MET B CA  
1714 C C   . MET B 53  ? 0.30348 0.18818 0.53221 0.00339  -0.11823 0.02881  537 MET B C   
1715 O O   . MET B 53  ? 0.37036 0.23852 0.59928 0.01307  -0.12784 0.00586  537 MET B O   
1716 C CB  . MET B 53  ? 0.38713 0.24452 0.59995 -0.02670 -0.14023 0.06257  537 MET B CB  
1717 C CG  . MET B 53  ? 0.69757 0.51964 0.90279 -0.02691 -0.16504 0.05295  537 MET B CG  
1718 S SD  . MET B 53  ? 0.71057 0.49240 0.90136 -0.01844 -0.19314 0.04793  537 MET B SD  
1719 C CE  . MET B 53  ? 0.54285 0.33507 0.71909 -0.03685 -0.18325 0.07664  537 MET B CE  
1720 N N   . ASN B 54  ? 0.24965 0.15578 0.48063 0.01184  -0.10358 0.02953  538 ASN B N   
1721 C CA  . ASN B 54  ? 0.26797 0.18567 0.50674 0.03187  -0.09791 0.00385  538 ASN B CA  
1722 C C   . ASN B 54  ? 0.35463 0.30538 0.58158 0.02652  -0.07707 -0.00258 538 ASN B C   
1723 O O   . ASN B 54  ? 0.31624 0.29231 0.54129 0.03315  -0.06463 -0.02233 538 ASN B O   
1724 C CB  . ASN B 54  ? 0.21725 0.14525 0.45430 0.03838  -0.09432 0.00569  538 ASN B CB  
1725 C CG  . ASN B 54  ? 0.26631 0.16270 0.49712 0.03900  -0.11750 0.00686  538 ASN B CG  
1726 O OD1 . ASN B 54  ? 0.30792 0.17983 0.54062 0.04286  -0.13664 -0.00564 538 ASN B OD1 
1727 N ND2 . ASN B 54  ? 0.26232 0.15530 0.48306 0.03458  -0.11937 0.02169  538 ASN B ND2 
1728 N N   . ASN B 55  ? 0.32936 0.28100 0.54648 0.01179  -0.07562 0.01263  539 ASN B N   
1729 C CA  . ASN B 55  ? 0.18413 0.15369 0.38083 0.00358  -0.06500 0.01064  539 ASN B CA  
1730 C C   . ASN B 55  ? 0.22417 0.17986 0.40311 -0.00763 -0.07485 0.00464  539 ASN B C   
1731 O O   . ASN B 55  ? 0.24657 0.20413 0.40379 -0.01864 -0.07574 0.00986  539 ASN B O   
1732 C CB  . ASN B 55  ? 0.22563 0.20744 0.42633 0.00030  -0.06015 0.03182  539 ASN B CB  
1733 C CG  . ASN B 55  ? 0.15947 0.15649 0.36292 0.00828  -0.04820 0.03346  539 ASN B CG  
1734 O OD1 . ASN B 55  ? 0.26174 0.27141 0.45049 0.00709  -0.03950 0.02288  539 ASN B OD1 
1735 N ND2 . ASN B 55  ? 0.12818 0.12444 0.34686 0.01206  -0.04836 0.04658  539 ASN B ND2 
1736 N N   . PHE B 56  ? 0.28615 0.22100 0.46975 -0.00590 -0.08725 -0.00621 540 PHE B N   
1737 C CA  . PHE B 56  ? 0.28644 0.20659 0.44702 -0.01738 -0.09726 -0.01536 540 PHE B CA  
1738 C C   . PHE B 56  ? 0.29327 0.19565 0.45327 -0.00925 -0.10501 -0.04209 540 PHE B C   
1739 O O   . PHE B 56  ? 0.29797 0.19009 0.48129 0.00534  -0.11116 -0.04738 540 PHE B O   
1740 C CB  . PHE B 56  ? 0.25861 0.16740 0.43006 -0.02841 -0.11417 0.00571  540 PHE B CB  
1741 C CG  . PHE B 56  ? 0.26795 0.15918 0.46447 -0.02961 -0.12801 0.01266  540 PHE B CG  
1742 C CD1 . PHE B 56  ? 0.30522 0.16749 0.49342 -0.03527 -0.14625 0.00202  540 PHE B CD1 
1743 C CD2 . PHE B 56  ? 0.27350 0.17380 0.49524 -0.02984 -0.12442 0.03065  540 PHE B CD2 
1744 C CE1 . PHE B 56  ? 0.33972 0.18369 0.54259 -0.03997 -0.16080 0.01134  540 PHE B CE1 
1745 C CE2 . PHE B 56  ? 0.31649 0.20184 0.54746 -0.03828 -0.13687 0.04024  540 PHE B CE2 
1746 C CZ  . PHE B 56  ? 0.36685 0.22618 0.58690 -0.04257 -0.15470 0.03173  540 PHE B CZ  
1747 N N   . GLU B 57  ? 0.32738 0.22095 0.45745 -0.01907 -0.10893 -0.05982 541 GLU B N   
1748 C CA  . GLU B 57  ? 0.36857 0.23902 0.49601 -0.01212 -0.12165 -0.08748 541 GLU B CA  
1749 C C   . GLU B 57  ? 0.43766 0.27961 0.54382 -0.02985 -0.14128 -0.07893 541 GLU B C   
1750 O O   . GLU B 57  ? 0.41017 0.25616 0.49650 -0.04667 -0.14260 -0.06089 541 GLU B O   
1751 C CB  . GLU B 57  ? 0.39343 0.29035 0.50251 -0.00635 -0.10349 -0.13073 541 GLU B CB  
1752 C CG  . GLU B 57  ? 0.64908 0.58707 0.78019 0.00749  -0.08226 -0.14271 541 GLU B CG  
1753 C CD  . GLU B 57  ? 0.87352 0.80111 1.04946 0.03832  -0.09606 -0.16152 541 GLU B CD  
1754 O OE1 . GLU B 57  ? 0.84500 0.77696 1.04763 0.04861  -0.09673 -0.14312 541 GLU B OE1 
1755 O OE2 . GLU B 57  ? 1.02988 0.93964 1.21157 0.05243  -0.11039 -0.19566 541 GLU B OE2 
1756 N N   . CYS B 58  ? 0.46849 0.27670 0.57934 -0.02550 -0.16199 -0.09234 542 CYS B N   
1757 C CA  . CYS B 58  ? 0.53250 0.31334 0.61725 -0.04213 -0.18138 -0.09388 542 CYS B CA  
1758 C C   . CYS B 58  ? 0.52411 0.27381 0.60154 -0.03107 -0.19605 -0.12958 542 CYS B C   
1759 O O   . CYS B 58  ? 0.58670 0.33517 0.68607 -0.00818 -0.19494 -0.14941 542 CYS B O   
1760 C CB  . CYS B 58  ? 0.56165 0.33284 0.66891 -0.05425 -0.19920 -0.05704 542 CYS B CB  
1761 S SG  . CYS B 58  ? 0.53607 0.29702 0.67885 -0.04454 -0.20808 -0.03935 542 CYS B SG  
1762 N N   . GLU B 59  ? 0.73560 0.46522 0.78110 -0.04403 -0.20845 -0.13525 543 GLU B N   
1763 C CA  . GLU B 59  ? 0.64557 0.35201 0.68103 -0.03133 -0.21823 -0.16662 543 GLU B CA  
1764 C C   . GLU B 59  ? 0.72493 0.40553 0.79337 -0.02071 -0.23933 -0.14434 543 GLU B C   
1765 O O   . GLU B 59  ? 0.82894 0.51036 0.91446 -0.03391 -0.24675 -0.10402 543 GLU B O   
1766 C CB  . GLU B 59  ? 0.67090 0.36137 0.65912 -0.05055 -0.22591 -0.17671 543 GLU B CB  
1767 C CG  . GLU B 59  ? 0.79318 0.50627 0.73145 -0.07009 -0.20786 -0.19404 543 GLU B CG  
1768 C CD  . GLU B 59  ? 1.05277 0.79569 0.97281 -0.05920 -0.18294 -0.24946 543 GLU B CD  
1769 O OE1 . GLU B 59  ? 1.18675 0.95807 1.05771 -0.08146 -0.16154 -0.26112 543 GLU B OE1 
1770 O OE2 . GLU B 59  ? 1.11977 0.86643 1.07354 -0.02993 -0.18065 -0.27641 543 GLU B OE2 
1771 N N   . PRO B 60  ? 0.65676 0.40939 0.92912 -0.16902 -0.03951 0.01634  544 PRO B N   
1772 C CA  . PRO B 60  ? 0.61292 0.35635 0.89164 -0.16190 -0.04511 0.02326  544 PRO B CA  
1773 C C   . PRO B 60  ? 0.55433 0.29256 0.80740 -0.17379 -0.04683 0.02735  544 PRO B C   
1774 O O   . PRO B 60  ? 0.55982 0.29569 0.81289 -0.16922 -0.05415 0.03635  544 PRO B O   
1775 C CB  . PRO B 60  ? 0.56276 0.28815 0.86125 -0.15712 -0.03518 0.01116  544 PRO B CB  
1776 C CG  . PRO B 60  ? 0.55491 0.28920 0.87065 -0.15412 -0.02828 0.00109  544 PRO B CG  
1777 C CD  . PRO B 60  ? 0.60193 0.34698 0.89184 -0.16777 -0.02695 0.00118  544 PRO B CD  
1778 N N   . ALA B 61  ? 0.56474 0.30187 0.79530 -0.18982 -0.04067 0.02102  545 ALA B N   
1779 C CA  . ALA B 61  ? 0.58016 0.31662 0.78851 -0.20172 -0.04287 0.02433  545 ALA B CA  
1780 C C   . ALA B 61  ? 0.66210 0.41875 0.86877 -0.19670 -0.05678 0.03784  545 ALA B C   
1781 O O   . ALA B 61  ? 0.68984 0.44694 0.88723 -0.20141 -0.06046 0.04228  545 ALA B O   
1782 C CB  . ALA B 61  ? 0.58659 0.32170 0.77293 -0.21940 -0.03551 0.01560  545 ALA B CB  
1783 N N   . PHE B 62  ? 0.58436 0.35766 0.80017 -0.18779 -0.06401 0.04360  546 PHE B N   
1784 C CA  . PHE B 62  ? 0.50895 0.30216 0.72336 -0.18380 -0.07671 0.05492  546 PHE B CA  
1785 C C   . PHE B 62  ? 0.49717 0.29377 0.72726 -0.17097 -0.08354 0.06369  546 PHE B C   
1786 O O   . PHE B 62  ? 0.48257 0.29497 0.71166 -0.16883 -0.09299 0.07220  546 PHE B O   
1787 C CB  . PHE B 62  ? 0.49419 0.30207 0.70669 -0.18261 -0.08126 0.05657  546 PHE B CB  
1788 C CG  . PHE B 62  ? 0.50882 0.31222 0.70252 -0.19627 -0.07631 0.04921  546 PHE B CG  
1789 C CD1 . PHE B 62  ? 0.56599 0.36099 0.75816 -0.19947 -0.06741 0.04068  546 PHE B CD1 
1790 C CD2 . PHE B 62  ? 0.52746 0.33467 0.70446 -0.20733 -0.08022 0.05000  546 PHE B CD2 
1791 C CE1 . PHE B 62  ? 0.62324 0.41245 0.79475 -0.21398 -0.06264 0.03385  546 PHE B CE1 
1792 C CE2 . PHE B 62  ? 0.59134 0.39413 0.74966 -0.22038 -0.07701 0.04385  546 PHE B CE2 
1793 C CZ  . PHE B 62  ? 0.60923 0.40214 0.76350 -0.22396 -0.06811 0.03603  546 PHE B CZ  
1794 N N   . TYR B 63  ? 0.50576 0.28729 0.75009 -0.16329 -0.07927 0.06129  547 TYR B N   
1795 C CA  . TYR B 63  ? 0.56966 0.35203 0.82889 -0.15088 -0.08674 0.06989  547 TYR B CA  
1796 C C   . TYR B 63  ? 0.58196 0.36756 0.82970 -0.15476 -0.09361 0.07829  547 TYR B C   
1797 O O   . TYR B 63  ? 0.55407 0.35354 0.80629 -0.14912 -0.10236 0.08703  547 TYR B O   
1798 C CB  . TYR B 63  ? 0.74213 0.50332 1.01619 -0.14390 -0.08183 0.06518  547 TYR B CB  
1799 C CG  . TYR B 63  ? 0.81847 0.58118 1.11533 -0.13454 -0.07819 0.05884  547 TYR B CG  
1800 C CD1 . TYR B 63  ? 0.82235 0.60406 1.12437 -0.13180 -0.08048 0.05993  547 TYR B CD1 
1801 C CD2 . TYR B 63  ? 0.82831 0.57327 1.14286 -0.12848 -0.07217 0.05078  547 TYR B CD2 
1802 C CE1 . TYR B 63  ? 0.79313 0.57704 1.11611 -0.12490 -0.07608 0.05289  547 TYR B CE1 
1803 C CE2 . TYR B 63  ? 0.75817 0.50706 1.09739 -0.12034 -0.06815 0.04300  547 TYR B CE2 
1804 C CZ  . TYR B 63  ? 0.73826 0.50699 1.08110 -0.11935 -0.06974 0.04395  547 TYR B CZ  
1805 O OH  . TYR B 63  ? 0.77046 0.54406 1.13771 -0.11295 -0.06466 0.03498  547 TYR B OH  
1806 N N   . THR B 64  ? 0.69433 0.46797 0.92633 -0.16607 -0.08889 0.07479  548 THR B N   
1807 C CA  . THR B 64  ? 0.66392 0.43817 0.88531 -0.17103 -0.09381 0.08133  548 THR B CA  
1808 C C   . THR B 64  ? 0.58446 0.38491 0.80096 -0.17512 -0.10100 0.08588  548 THR B C   
1809 O O   . THR B 64  ? 0.49591 0.30568 0.71375 -0.17282 -0.10792 0.09335  548 THR B O   
1810 C CB  . THR B 64  ? 0.74733 0.50233 0.95296 -0.18327 -0.08594 0.07536  548 THR B CB  
1811 O OG1 . THR B 64  ? 0.84998 0.58085 1.06210 -0.17936 -0.07819 0.06887  548 THR B OG1 
1812 C CG2 . THR B 64  ? 0.62192 0.37161 0.81749 -0.18759 -0.08979 0.08177  548 THR B CG2 
1813 N N   . CYS B 65  ? 0.54383 0.35600 0.75470 -0.18152 -0.09994 0.08123  549 CYS B N   
1814 C CA  . CYS B 65  ? 0.55303 0.38962 0.76165 -0.18467 -0.10809 0.08513  549 CYS B CA  
1815 C C   . CYS B 65  ? 0.60460 0.45731 0.82706 -0.17288 -0.11531 0.09126  549 CYS B C   
1816 O O   . CYS B 65  ? 0.48590 0.35660 0.71095 -0.17254 -0.12239 0.09610  549 CYS B O   
1817 C CB  . CYS B 65  ? 0.61189 0.45454 0.80929 -0.19544 -0.10705 0.07916  549 CYS B CB  
1818 S SG  . CYS B 65  ? 0.61164 0.45047 0.80926 -0.19305 -0.10365 0.07417  549 CYS B SG  
1819 N N   . VAL B 66  ? 0.65327 0.49979 0.88571 -0.16363 -0.11281 0.09032  550 VAL B N   
1820 C CA  . VAL B 66  ? 0.43162 0.29168 0.67732 -0.15260 -0.11867 0.09583  550 VAL B CA  
1821 C C   . VAL B 66  ? 0.42811 0.28876 0.68095 -0.14670 -0.12313 0.10310  550 VAL B C   
1822 O O   . VAL B 66  ? 0.48342 0.36063 0.74069 -0.14367 -0.12956 0.10860  550 VAL B O   
1823 C CB  . VAL B 66  ? 0.42952 0.28300 0.68411 -0.14590 -0.11379 0.09155  550 VAL B CB  
1824 C CG1 . VAL B 66  ? 0.42324 0.28887 0.69244 -0.13457 -0.11906 0.09710  550 VAL B CG1 
1825 C CG2 . VAL B 66  ? 0.43288 0.28750 0.67687 -0.15315 -0.11075 0.08551  550 VAL B CG2 
1826 N N   . GLU B 67  ? 0.47823 0.31961 0.73161 -0.14544 -0.12010 0.10316  551 GLU B N   
1827 C CA  . GLU B 67  ? 0.48798 0.32681 0.74464 -0.14113 -0.12568 0.11096  551 GLU B CA  
1828 C C   . GLU B 67  ? 0.46317 0.30998 0.70691 -0.15097 -0.12869 0.11426  551 GLU B C   
1829 O O   . GLU B 67  ? 0.50534 0.36300 0.75128 -0.14923 -0.13440 0.12043  551 GLU B O   
1830 C CB  . GLU B 67  ? 0.67662 0.49029 0.93633 -0.13708 -0.12332 0.11060  551 GLU B CB  
1831 C CG  . GLU B 67  ? 0.98941 0.79698 1.26620 -0.12764 -0.11931 0.10504  551 GLU B CG  
1832 C CD  . GLU B 67  ? 1.20248 0.98972 1.49131 -0.11888 -0.12028 0.10574  551 GLU B CD  
1833 O OE1 . GLU B 67  ? 1.27296 1.04571 1.55286 -0.12065 -0.12385 0.11092  551 GLU B OE1 
1834 O OE2 . GLU B 67  ? 1.22158 1.00656 1.52897 -0.11064 -0.11733 0.10031  551 GLU B OE2 
1835 N N   . VAL B 68  ? 0.58660 0.43026 0.81724 -0.16249 -0.12439 0.10921  552 VAL B N   
1836 C CA  . VAL B 68  ? 0.48359 0.33767 0.70370 -0.17327 -0.12623 0.11027  552 VAL B CA  
1837 C C   . VAL B 68  ? 0.47030 0.35300 0.69780 -0.17223 -0.13157 0.11114  552 VAL B C   
1838 O O   . VAL B 68  ? 0.50054 0.39532 0.72760 -0.17513 -0.13472 0.11420  552 VAL B O   
1839 C CB  . VAL B 68  ? 0.62430 0.46992 0.83018 -0.18632 -0.12020 0.10358  552 VAL B CB  
1840 C CG1 . VAL B 68  ? 0.54884 0.41140 0.74697 -0.19820 -0.12178 0.10247  552 VAL B CG1 
1841 C CG2 . VAL B 68  ? 0.50975 0.32531 0.70677 -0.18833 -0.11488 0.10320  552 VAL B CG2 
1842 N N   . THR B 69  ? 0.42662 0.31937 0.66060 -0.16824 -0.13251 0.10820  553 THR B N   
1843 C CA  . THR B 69  ? 0.40629 0.32381 0.64828 -0.16570 -0.13844 0.10925  553 THR B CA  
1844 C C   . THR B 69  ? 0.42099 0.34526 0.67377 -0.15578 -0.14194 0.11519  553 THR B C   
1845 O O   . THR B 69  ? 0.50552 0.44754 0.76227 -0.15643 -0.14531 0.11658  553 THR B O   
1846 C CB  . THR B 69  ? 0.53966 0.46243 0.78351 -0.16382 -0.13998 0.10591  553 THR B CB  
1847 O OG1 . THR B 69  ? 0.59210 0.50798 0.82442 -0.17410 -0.13692 0.10033  553 THR B OG1 
1848 C CG2 . THR B 69  ? 0.38279 0.32945 0.63466 -0.16145 -0.14725 0.10689  553 THR B CG2 
1849 N N   . ALA B 70  ? 0.44587 0.35756 0.70451 -0.14684 -0.14079 0.11767  554 ALA B N   
1850 C CA  . ALA B 70  ? 0.47725 0.39717 0.74666 -0.13780 -0.14456 0.12290  554 ALA B CA  
1851 C C   . ALA B 70  ? 0.46831 0.38691 0.73407 -0.14077 -0.14681 0.12821  554 ALA B C   
1852 O O   . ALA B 70  ? 0.37079 0.30429 0.64057 -0.13953 -0.14987 0.13103  554 ALA B O   
1853 C CB  . ALA B 70  ? 0.37466 0.28384 0.65328 -0.12807 -0.14289 0.12298  554 ALA B CB  
1854 N N   . GLY B 71  ? 0.47116 0.37062 0.72739 -0.14567 -0.14502 0.12926  555 GLY B N   
1855 C CA  . GLY B 71  ? 0.41493 0.30793 0.66425 -0.14912 -0.14798 0.13529  555 GLY B CA  
1856 C C   . GLY B 71  ? 0.45789 0.35066 0.71814 -0.13870 -0.15305 0.14146  555 GLY B C   
1857 O O   . GLY B 71  ? 0.43079 0.31615 0.70221 -0.12905 -0.15319 0.14107  555 GLY B O   
1858 N N   . ASN B 72  ? 0.40321 0.30595 0.66101 -0.14144 -0.15672 0.14615  556 ASN B N   
1859 C CA  . ASN B 72  ? 0.45549 0.35924 0.72221 -0.13345 -0.16233 0.15242  556 ASN B CA  
1860 C C   . ASN B 72  ? 0.40680 0.32795 0.68973 -0.12419 -0.16204 0.15029  556 ASN B C   
1861 O O   . ASN B 72  ? 0.39225 0.31476 0.68502 -0.11698 -0.16609 0.15443  556 ASN B O   
1862 C CB  . ASN B 72  ? 0.57364 0.48139 0.82910 -0.14176 -0.16558 0.15766  556 ASN B CB  
1863 C CG  . ASN B 72  ? 0.66266 0.54710 0.90057 -0.14945 -0.16813 0.16239  556 ASN B CG  
1864 O OD1 . ASN B 72  ? 0.57412 0.43797 0.81179 -0.14517 -0.16908 0.16311  556 ASN B OD1 
1865 N ND2 . ASN B 72  ? 0.70385 0.59046 0.92583 -0.16143 -0.16844 0.16471  556 ASN B ND2 
1866 N N   . ARG B 73  ? 0.39865 0.33238 0.68383 -0.12465 -0.15797 0.14409  557 ARG B N   
1867 C CA  . ARG B 73  ? 0.36156 0.30862 0.65872 -0.11653 -0.15767 0.14213  557 ARG B CA  
1868 C C   . ARG B 73  ? 0.37519 0.31207 0.68208 -0.10831 -0.15634 0.14038  557 ARG B C   
1869 O O   . ARG B 73  ? 0.32467 0.26950 0.64105 -0.10179 -0.15600 0.13931  557 ARG B O   
1870 C CB  . ARG B 73  ? 0.32990 0.29100 0.62513 -0.11965 -0.15544 0.13651  557 ARG B CB  
1871 C CG  . ARG B 73  ? 0.49189 0.46227 0.77873 -0.12934 -0.15500 0.13537  557 ARG B CG  
1872 C CD  . ARG B 73  ? 0.57112 0.56166 0.86199 -0.12972 -0.15451 0.12996  557 ARG B CD  
1873 N NE  . ARG B 73  ? 0.68371 0.67424 0.97411 -0.13098 -0.15462 0.12532  557 ARG B NE  
1874 C CZ  . ARG B 73  ? 0.72457 0.71301 1.00741 -0.13999 -0.15335 0.12185  557 ARG B CZ  
1875 N NH1 . ARG B 73  ? 0.74092 0.72588 1.01529 -0.14885 -0.15111 0.12223  557 ARG B NH1 
1876 N NH2 . ARG B 73  ? 0.62792 0.61697 0.91003 -0.14136 -0.15449 0.11794  557 ARG B NH2 
1877 N N   . LEU B 74  ? 0.35479 0.27366 0.65926 -0.10907 -0.15473 0.13922  558 LEU B N   
1878 C CA  . LEU B 74  ? 0.35782 0.26587 0.67396 -0.10141 -0.15287 0.13667  558 LEU B CA  
1879 C C   . LEU B 74  ? 0.35149 0.26311 0.68147 -0.09370 -0.15806 0.14162  558 LEU B C   
1880 O O   . LEU B 74  ? 0.34483 0.25740 0.68908 -0.08681 -0.15624 0.13833  558 LEU B O   
1881 C CB  . LEU B 74  ? 0.38083 0.26762 0.69178 -0.10379 -0.15085 0.13510  558 LEU B CB  
1882 C CG  . LEU B 74  ? 0.48998 0.36482 0.80554 -0.10198 -0.14372 0.12684  558 LEU B CG  
1883 C CD1 . LEU B 74  ? 0.37763 0.26353 0.68985 -0.10479 -0.13884 0.12090  558 LEU B CD1 
1884 C CD2 . LEU B 74  ? 0.41090 0.26652 0.71483 -0.10820 -0.14065 0.12482  558 LEU B CD2 
1885 N N   . PHE B 75  ? 0.35417 0.26869 0.67955 -0.09618 -0.16431 0.14903  559 PHE B N   
1886 C CA  . PHE B 75  ? 0.35107 0.26878 0.68734 -0.09074 -0.17087 0.15482  559 PHE B CA  
1887 C C   . PHE B 75  ? 0.33350 0.27065 0.66972 -0.09211 -0.17202 0.15722  559 PHE B C   
1888 O O   . PHE B 75  ? 0.33352 0.27404 0.67326 -0.09132 -0.17811 0.16333  559 PHE B O   
1889 C CB  . PHE B 75  ? 0.37305 0.27580 0.70139 -0.09341 -0.17805 0.16195  559 PHE B CB  
1890 C CG  . PHE B 75  ? 0.46652 0.34813 0.78912 -0.09407 -0.17588 0.15932  559 PHE B CG  
1891 C CD1 . PHE B 75  ? 0.49691 0.37153 0.80023 -0.10410 -0.17258 0.15856  559 PHE B CD1 
1892 C CD2 . PHE B 75  ? 0.41745 0.28641 0.75499 -0.08498 -0.17641 0.15655  559 PHE B CD2 
1893 C CE1 . PHE B 75  ? 0.52611 0.38017 0.82316 -0.10543 -0.16970 0.15573  559 PHE B CE1 
1894 C CE2 . PHE B 75  ? 0.42454 0.27284 0.75698 -0.08549 -0.17353 0.15337  559 PHE B CE2 
1895 C CZ  . PHE B 75  ? 0.43653 0.27679 0.74782 -0.09587 -0.17006 0.15323  559 PHE B CZ  
1896 N N   . TYR B 76  ? 0.20008 0.26245 0.31618 -0.00172 -0.01330 0.17088  560 TYR B N   
1897 C CA  . TYR B 76  ? 0.18225 0.27072 0.31683 -0.00174 -0.00831 0.16994  560 TYR B CA  
1898 C C   . TYR B 76  ? 0.19351 0.28681 0.32864 0.00424  -0.00314 0.16601  560 TYR B C   
1899 O O   . TYR B 76  ? 0.17440 0.25453 0.29903 0.00819  -0.00273 0.16376  560 TYR B O   
1900 C CB  . TYR B 76  ? 0.20520 0.30264 0.34942 -0.00578 -0.00991 0.17032  560 TYR B CB  
1901 C CG  . TYR B 76  ? 0.26809 0.37214 0.42060 -0.01187 -0.01388 0.17649  560 TYR B CG  
1902 C CD1 . TYR B 76  ? 0.29812 0.39633 0.44651 -0.01460 -0.01623 0.18109  560 TYR B CD1 
1903 C CD2 . TYR B 76  ? 0.21555 0.33244 0.38053 -0.01454 -0.01521 0.17877  560 TYR B CD2 
1904 C CE1 . TYR B 76  ? 0.28467 0.39118 0.44232 -0.02052 -0.01954 0.18840  560 TYR B CE1 
1905 C CE2 . TYR B 76  ? 0.26384 0.39182 0.44104 -0.01956 -0.01885 0.18735  560 TYR B CE2 
1906 C CZ  . TYR B 76  ? 0.32501 0.44848 0.49901 -0.02278 -0.02085 0.19236  560 TYR B CZ  
1907 O OH  . TYR B 76  ? 0.38950 0.52613 0.57718 -0.02786 -0.02423 0.20253  560 TYR B OH  
1908 N N   . HIS B 77  ? 0.18947 0.30030 0.33529 0.00513  0.00049  0.16587  561 HIS B N   
1909 C CA  . HIS B 77  ? 0.19838 0.31592 0.34692 0.00903  0.00444  0.16394  561 HIS B CA  
1910 C C   . HIS B 77  ? 0.12888 0.25545 0.28403 0.00857  0.00634  0.16098  561 HIS B C   
1911 O O   . HIS B 77  ? 0.12055 0.25625 0.28183 0.00669  0.00602  0.16082  561 HIS B O   
1912 C CB  . HIS B 77  ? 0.13852 0.26529 0.29103 0.00923  0.00519  0.16602  561 HIS B CB  
1913 C CG  . HIS B 77  ? 0.27998 0.39704 0.42496 0.01032  0.00312  0.16910  561 HIS B CG  
1914 N ND1 . HIS B 77  ? 0.17486 0.28864 0.31666 0.01474  0.00390  0.17078  561 HIS B ND1 
1915 C CD2 . HIS B 77  ? 0.16364 0.27278 0.30308 0.00798  0.00005  0.17151  561 HIS B CD2 
1916 C CE1 . HIS B 77  ? 0.19780 0.30034 0.33091 0.01571  0.00090  0.17331  561 HIS B CE1 
1917 N NE2 . HIS B 77  ? 0.23175 0.33060 0.36270 0.01108  -0.00148 0.17372  561 HIS B NE2 
1918 N N   . ILE B 78  ? 0.12974 0.25221 0.28169 0.01140  0.00852  0.15910  562 ILE B N   
1919 C CA  . ILE B 78  ? 0.12012 0.24829 0.27591 0.01116  0.00996  0.15638  562 ILE B CA  
1920 C C   . ILE B 78  ? 0.12626 0.26764 0.28966 0.01172  0.01200  0.15681  562 ILE B C   
1921 O O   . ILE B 78  ? 0.11179 0.25724 0.27796 0.01385  0.01417  0.15994  562 ILE B O   
1922 C CB  . ILE B 78  ? 0.17988 0.29463 0.32553 0.01409  0.01104  0.15470  562 ILE B CB  
1923 C CG1 . ILE B 78  ? 0.14835 0.24474 0.28215 0.01230  0.00622  0.15445  562 ILE B CG1 
1924 C CG2 . ILE B 78  ? 0.12126 0.24113 0.26981 0.01392  0.01251  0.15221  562 ILE B CG2 
1925 C CD1 . ILE B 78  ? 0.16344 0.23831 0.27917 0.01647  0.00585  0.15271  562 ILE B CD1 
1926 N N   . VAL B 79  ? 0.10417 0.24922 0.26801 0.00993  0.01060  0.15435  563 VAL B N   
1927 C CA  . VAL B 79  ? 0.10344 0.25049 0.26452 0.00920  0.00973  0.15315  563 VAL B CA  
1928 C C   . VAL B 79  ? 0.10119 0.24572 0.25856 0.00889  0.00933  0.14972  563 VAL B C   
1929 O O   . VAL B 79  ? 0.10007 0.24180 0.25648 0.00919  0.00969  0.14796  563 VAL B O   
1930 C CB  . VAL B 79  ? 0.14819 0.29926 0.30974 0.00760  0.00792  0.15576  563 VAL B CB  
1931 C CG1 . VAL B 79  ? 0.10774 0.26284 0.27398 0.00753  0.00783  0.16060  563 VAL B CG1 
1932 C CG2 . VAL B 79  ? 0.10467 0.25560 0.26570 0.00798  0.00826  0.15584  563 VAL B CG2 
1933 N N   . ASP B 80  ? 0.14210 0.28906 0.29911 0.00769  0.00799  0.15052  564 ASP B N   
1934 C CA  . ASP B 80  ? 0.10021 0.24558 0.25470 0.00709  0.00729  0.14889  564 ASP B CA  
1935 C C   . ASP B 80  ? 0.09980 0.24498 0.25218 0.00715  0.00732  0.14884  564 ASP B C   
1936 O O   . ASP B 80  ? 0.09930 0.24141 0.24929 0.00808  0.00832  0.14706  564 ASP B O   
1937 C CB  . ASP B 80  ? 0.19604 0.34672 0.35348 0.00428  0.00433  0.15305  564 ASP B CB  
1938 C CG  . ASP B 80  ? 0.29367 0.44635 0.45437 0.00558  0.00559  0.15467  564 ASP B CG  
1939 O OD1 . ASP B 80  ? 0.13835 0.28752 0.29805 0.00923  0.00942  0.15250  564 ASP B OD1 
1940 O OD2 . ASP B 80  ? 0.38760 0.54699 0.55320 0.00267  0.00250  0.16010  564 ASP B OD2 
1941 N N   . SER B 81  ? 0.12417 0.26953 0.27385 0.00672  0.00685  0.15079  565 SER B N   
1942 C CA  . SER B 81  ? 0.17679 0.31337 0.31395 0.00770  0.00787  0.14999  565 SER B CA  
1943 C C   . SER B 81  ? 0.23360 0.36942 0.36700 0.00891  0.00897  0.15235  565 SER B C   
1944 O O   . SER B 81  ? 0.24412 0.38461 0.38300 0.00771  0.00766  0.15429  565 SER B O   
1945 C CB  . SER B 81  ? 0.14657 0.27244 0.27017 0.00483  0.00488  0.14999  565 SER B CB  
1946 O OG  . SER B 81  ? 0.29119 0.41651 0.41216 0.00140  0.00100  0.15334  565 SER B OG  
1947 N N   . ASP B 82  ? 0.15304 0.28203 0.27559 0.01200  0.01202  0.15309  566 ASP B N   
1948 C CA  . ASP B 82  ? 0.17126 0.29732 0.28637 0.01419  0.01417  0.15634  566 ASP B CA  
1949 C C   . ASP B 82  ? 0.18554 0.29887 0.28401 0.01135  0.01019  0.15717  566 ASP B C   
1950 O O   . ASP B 82  ? 0.23790 0.34970 0.33246 0.01137  0.00993  0.15972  566 ASP B O   
1951 C CB  . ASP B 82  ? 0.14986 0.27343 0.25820 0.02018  0.02019  0.15871  566 ASP B CB  
1952 C CG  . ASP B 82  ? 0.27923 0.38752 0.36921 0.02187  0.02051  0.15693  566 ASP B CG  
1953 O OD1 . ASP B 82  ? 0.34018 0.44505 0.43030 0.01823  0.01660  0.15344  566 ASP B OD1 
1954 O OD2 . ASP B 82  ? 0.36775 0.46617 0.44149 0.02769  0.02508  0.15968  566 ASP B OD2 
1955 N N   A GLU B 83  ? 0.26137 0.36418 0.34885 0.00835  0.00605  0.15585  567 GLU B N   
1956 N N   B GLU B 83  ? 0.25201 0.35486 0.33953 0.00843  0.00614  0.15581  567 GLU B N   
1957 C CA  A GLU B 83  ? 0.18211 0.27290 0.25497 0.00411  -0.00043 0.15800  567 GLU B CA  
1958 C CA  B GLU B 83  ? 0.18154 0.27257 0.25484 0.00402  -0.00047 0.15787  567 GLU B CA  
1959 C C   A GLU B 83  ? 0.26601 0.37158 0.35676 0.00030  -0.00396 0.16059  567 GLU B C   
1960 C C   B GLU B 83  ? 0.26375 0.36921 0.35440 0.00032  -0.00392 0.16052  567 GLU B C   
1961 O O   A GLU B 83  ? 0.29450 0.39423 0.37685 -0.00135 -0.00773 0.16366  567 GLU B O   
1962 O O   B GLU B 83  ? 0.29197 0.39112 0.37364 -0.00129 -0.00769 0.16356  567 GLU B O   
1963 C CB  A GLU B 83  ? 0.20152 0.28034 0.26290 0.00017  -0.00568 0.15742  567 GLU B CB  
1964 C CB  B GLU B 83  ? 0.19934 0.28095 0.26434 -0.00000 -0.00538 0.15713  567 GLU B CB  
1965 C CG  A GLU B 83  ? 0.26068 0.33192 0.31367 -0.00670 -0.01526 0.16152  567 GLU B CG  
1966 C CG  B GLU B 83  ? 0.27189 0.32755 0.30660 -0.00205 -0.01164 0.15890  567 GLU B CG  
1967 C CD  A GLU B 83  ? 0.29783 0.36145 0.34507 -0.01298 -0.02205 0.16278  567 GLU B CD  
1968 C CD  B GLU B 83  ? 0.35468 0.38699 0.36163 0.00440  -0.00781 0.15683  567 GLU B CD  
1969 O OE1 A GLU B 83  ? 0.35754 0.40619 0.38804 -0.01822 -0.03097 0.16643  567 GLU B OE1 
1970 O OE1 B GLU B 83  ? 0.43430 0.45364 0.42249 0.00955  -0.00510 0.15803  567 GLU B OE1 
1971 O OE2 A GLU B 83  ? 0.20410 0.27589 0.26285 -0.01340 -0.01958 0.16082  567 GLU B OE2 
1972 O OE2 B GLU B 83  ? 0.31787 0.34428 0.32078 0.00484  -0.00736 0.15473  567 GLU B OE2 
1973 N N   . VAL B 84  ? 0.20489 0.32775 0.31814 -0.00021 -0.00266 0.15992  568 VAL B N   
1974 C CA  . VAL B 84  ? 0.14534 0.28141 0.27454 -0.00204 -0.00450 0.16337  568 VAL B CA  
1975 C C   . VAL B 84  ? 0.28542 0.42149 0.41425 0.00073  -0.00196 0.16391  568 VAL B C   
1976 O O   . VAL B 84  ? 0.14655 0.28361 0.27595 -0.00087 -0.00491 0.16762  568 VAL B O   
1977 C CB  . VAL B 84  ? 0.15217 0.30195 0.29987 -0.00129 -0.00230 0.16289  568 VAL B CB  
1978 C CG1 . VAL B 84  ? 0.11659 0.27768 0.27846 -0.00060 -0.00121 0.16681  568 VAL B CG1 
1979 C CG2 . VAL B 84  ? 0.12388 0.27515 0.27305 -0.00494 -0.00573 0.16440  568 VAL B CG2 
1980 N N   . SER B 85  ? 0.13739 0.27261 0.26563 0.00450  0.00289  0.16138  569 SER B N   
1981 C CA  . SER B 85  ? 0.24358 0.37883 0.37159 0.00633  0.00493  0.16314  569 SER B CA  
1982 C C   . SER B 85  ? 0.19542 0.31872 0.30548 0.00626  0.00355  0.16577  569 SER B C   
1983 O O   . SER B 85  ? 0.18827 0.31048 0.29720 0.00551  0.00178  0.16848  569 SER B O   
1984 C CB  . SER B 85  ? 0.14520 0.28379 0.27732 0.00953  0.00946  0.16251  569 SER B CB  
1985 O OG  . SER B 85  ? 0.18215 0.32769 0.32601 0.00959  0.00973  0.16020  569 SER B OG  
1986 N N   . THR B 86  ? 0.17481 0.28566 0.26708 0.00755  0.00431  0.16521  570 THR B N   
1987 C CA  . THR B 86  ? 0.26286 0.35736 0.33215 0.00870  0.00363  0.16784  570 THR B CA  
1988 C C   . THR B 86  ? 0.32401 0.41006 0.38416 0.00428  -0.00502 0.16977  570 THR B C   
1989 O O   . THR B 86  ? 0.29335 0.36758 0.33768 0.00466  -0.00737 0.17250  570 THR B O   
1990 C CB  . THR B 86  ? 0.25283 0.33257 0.30111 0.01303  0.00787  0.16743  570 THR B CB  
1991 O OG1 . THR B 86  ? 0.22973 0.30231 0.27196 0.01096  0.00401  0.16478  570 THR B OG1 
1992 C CG2 . THR B 86  ? 0.20492 0.29798 0.26684 0.01797  0.01645  0.16825  570 THR B CG2 
1993 N N   . LYS B 87  ? 0.20201 0.29520 0.27310 -0.00009 -0.01019 0.16960  571 LYS B N   
1994 C CA  . LYS B 87  ? 0.21074 0.30324 0.28154 -0.00523 -0.01931 0.17392  571 LYS B CA  
1995 C C   . LYS B 87  ? 0.24506 0.35134 0.33303 -0.00537 -0.01960 0.17701  571 LYS B C   
1996 O O   . LYS B 87  ? 0.24714 0.34770 0.32777 -0.00707 -0.02578 0.18108  571 LYS B O   
1997 C CB  . LYS B 87  ? 0.29583 0.39723 0.37887 -0.01070 -0.02422 0.17532  571 LYS B CB  
1998 C CG  . LYS B 87  ? 0.36347 0.45009 0.42919 -0.01661 -0.03510 0.17914  571 LYS B CG  
1999 C CD  . LYS B 87  ? 0.49868 0.58652 0.56521 -0.02006 -0.04337 0.18517  571 LYS B CD  
2000 C CE  . LYS B 87  ? 0.65303 0.72015 0.69563 -0.02587 -0.05595 0.18856  571 LYS B CE  
2001 N NZ  . LYS B 87  ? 0.64485 0.70732 0.68118 -0.02793 -0.06475 0.19366  571 LYS B NZ  
2002 N N   . ILE B 88  ? 0.17879 0.30071 0.28732 -0.00334 -0.01380 0.17542  572 ILE B N   
2003 C CA  . ILE B 88  ? 0.21355 0.34230 0.33208 -0.00214 -0.01326 0.17806  572 ILE B CA  
2004 C C   . ILE B 88  ? 0.30425 0.41979 0.40602 0.00015  -0.01261 0.17842  572 ILE B C   
2005 O O   . ILE B 88  ? 0.21273 0.32426 0.31009 -0.00027 -0.01688 0.18213  572 ILE B O   
2006 C CB  . ILE B 88  ? 0.20010 0.34034 0.33578 0.00029  -0.00739 0.17588  572 ILE B CB  
2007 C CG1 . ILE B 88  ? 0.14451 0.29757 0.29585 -0.00131 -0.00732 0.17744  572 ILE B CG1 
2008 C CG2 . ILE B 88  ? 0.17387 0.31336 0.31197 0.00230  -0.00693 0.17829  572 ILE B CG2 
2009 C CD1 . ILE B 88  ? 0.13151 0.29020 0.29286 0.00172  -0.00165 0.17461  572 ILE B CD1 
2010 N N   . LEU B 89  ? 0.21807 0.32653 0.30954 0.00274  -0.00729 0.17571  573 LEU B N   
2011 C CA  . LEU B 89  ? 0.23114 0.32919 0.30835 0.00492  -0.00491 0.17766  573 LEU B CA  
2012 C C   . LEU B 89  ? 0.35580 0.43464 0.40697 0.00471  -0.00973 0.18008  573 LEU B C   
2013 O O   . LEU B 89  ? 0.38992 0.45968 0.42958 0.00561  -0.01049 0.18303  573 LEU B O   
2014 C CB  . LEU B 89  ? 0.20701 0.30653 0.28362 0.00797  0.00289  0.17653  573 LEU B CB  
2015 C CG  . LEU B 89  ? 0.37656 0.48920 0.47256 0.00809  0.00596  0.17677  573 LEU B CG  
2016 C CD1 . LEU B 89  ? 0.29024 0.40917 0.39129 0.01073  0.01206  0.17702  573 LEU B CD1 
2017 C CD2 . LEU B 89  ? 0.36954 0.47770 0.46204 0.00732  0.00505  0.18067  573 LEU B CD2 
2018 N N   . MET B 90  ? 0.24738 0.31682 0.28610 0.00341  -0.01388 0.17919  574 MET B N   
2019 C CA  . MET B 90  ? 0.35097 0.39705 0.35988 0.00330  -0.02041 0.18159  574 MET B CA  
2020 C C   . MET B 90  ? 0.35538 0.40443 0.36966 0.00027  -0.02958 0.18575  574 MET B C   
2021 O O   . MET B 90  ? 0.50734 0.53954 0.50019 0.00180  -0.03302 0.18838  574 MET B O   
2022 C CB  . MET B 90  ? 0.48192 0.51486 0.47505 0.00196  -0.02477 0.18012  574 MET B CB  
2023 C CG  . MET B 90  ? 0.59152 0.60036 0.55545 0.00058  -0.03555 0.18317  574 MET B CG  
2024 S SD  . MET B 90  ? 0.71472 0.70554 0.65841 -0.00130 -0.04142 0.18176  574 MET B SD  
2025 C CE  . MET B 90  ? 0.79225 0.75162 0.69517 0.00853  -0.03084 0.17872  574 MET B CE  
2026 N N   . GLU B 91  ? 0.27846 0.34903 0.32117 -0.00332 -0.03287 0.18716  575 GLU B N   
2027 C CA  . GLU B 91  ? 0.28757 0.36413 0.33894 -0.00545 -0.04086 0.19247  575 GLU B CA  
2028 C C   . GLU B 91  ? 0.34259 0.42265 0.40015 -0.00174 -0.03622 0.19302  575 GLU B C   
2029 O O   . GLU B 91  ? 0.31420 0.38768 0.36458 -0.00110 -0.04201 0.19687  575 GLU B O   
2030 C CB  . GLU B 91  ? 0.40320 0.50156 0.48214 -0.01025 -0.04503 0.19593  575 GLU B CB  
2031 C CG  . GLU B 91  ? 0.64650 0.75353 0.73697 -0.01221 -0.05336 0.20328  575 GLU B CG  
2032 C CD  . GLU B 91  ? 0.76153 0.85996 0.84073 -0.01842 -0.06736 0.20843  575 GLU B CD  
2033 O OE1 . GLU B 91  ? 0.81025 0.91280 0.89516 -0.01984 -0.07579 0.21481  575 GLU B OE1 
2034 O OE2 . GLU B 91  ? 0.73037 0.81673 0.79418 -0.02189 -0.07070 0.20634  575 GLU B OE2 
2035 N N   . PHE B 92  ? 0.27492 0.36381 0.34459 0.00047  -0.02701 0.18952  576 PHE B N   
2036 C CA  . PHE B 92  ? 0.35808 0.44616 0.42976 0.00314  -0.02303 0.18999  576 PHE B CA  
2037 C C   . PHE B 92  ? 0.39655 0.46526 0.44291 0.00452  -0.02369 0.19193  576 PHE B C   
2038 O O   . PHE B 92  ? 0.34681 0.40936 0.38822 0.00557  -0.02693 0.19512  576 PHE B O   
2039 C CB  . PHE B 92  ? 0.22295 0.31950 0.30623 0.00407  -0.01466 0.18610  576 PHE B CB  
2040 C CG  . PHE B 92  ? 0.22082 0.31770 0.30964 0.00535  -0.01203 0.18687  576 PHE B CG  
2041 C CD1 . PHE B 92  ? 0.20705 0.31262 0.31166 0.00615  -0.01104 0.18584  576 PHE B CD1 
2042 C CD2 . PHE B 92  ? 0.31362 0.39996 0.38960 0.00559  -0.01007 0.18897  576 PHE B CD2 
2043 C CE1 . PHE B 92  ? 0.23363 0.33406 0.33849 0.00704  -0.00987 0.18639  576 PHE B CE1 
2044 C CE2 . PHE B 92  ? 0.33072 0.41546 0.41074 0.00541  -0.00885 0.19038  576 PHE B CE2 
2045 C CZ  . PHE B 92  ? 0.27589 0.36634 0.36939 0.00605  -0.00954 0.18899  576 PHE B CZ  
2046 N N   . ASN B 93  ? 0.31865 0.37551 0.34625 0.00522  -0.02030 0.19051  577 ASN B N   
2047 C CA  . ASN B 93  ? 0.45630 0.49334 0.45701 0.00725  -0.01827 0.19294  577 ASN B CA  
2048 C C   . ASN B 93  ? 0.62537 0.64271 0.60120 0.00749  -0.02767 0.19556  577 ASN B C   
2049 O O   . ASN B 93  ? 0.74334 0.74333 0.69722 0.00931  -0.02823 0.19859  577 ASN B O   
2050 C CB  . ASN B 93  ? 0.31199 0.34370 0.30121 0.00929  -0.00947 0.19153  577 ASN B CB  
2051 C CG  . ASN B 93  ? 0.45260 0.50269 0.46439 0.00951  -0.00088 0.19099  577 ASN B CG  
2052 O OD1 . ASN B 93  ? 0.29518 0.35567 0.32432 0.00796  -0.00149 0.19181  577 ASN B OD1 
2053 N ND2 . ASN B 93  ? 0.45598 0.50854 0.46606 0.01189  0.00661  0.19030  577 ASN B ND2 
2054 N N   . LYS B 94  ? 0.53849 0.55735 0.51625 0.00534  -0.03555 0.19508  578 LYS B N   
2055 C CA  . LYS B 94  ? 0.51475 0.51818 0.47332 0.00474  -0.04725 0.19863  578 LYS B CA  
2056 C C   . LYS B 94  ? 0.51407 0.52345 0.48266 0.00484  -0.05291 0.20272  578 LYS B C   
2057 O O   . LYS B 94  ? 0.57976 0.56998 0.52420 0.00717  -0.05759 0.20570  578 LYS B O   
2058 C CB  . LYS B 94  ? 0.50845 0.51945 0.47645 -0.00000 -0.05599 0.19897  578 LYS B CB  
2059 C CG  . LYS B 94  ? 0.63053 0.62685 0.57987 -0.00238 -0.07018 0.20332  578 LYS B CG  
2060 C CD  . LYS B 94  ? 0.76114 0.76811 0.72444 -0.00989 -0.07893 0.20453  578 LYS B CD  
2061 C CE  . LYS B 94  ? 0.92228 0.92287 0.87835 -0.01631 -0.09666 0.21056  578 LYS B CE  
2062 N NZ  . LYS B 94  ? 0.99336 1.00814 0.96911 -0.02670 -0.10585 0.21324  578 LYS B NZ  
2063 N N   . MET B 95  ? 0.41202 0.44508 0.41285 0.00370  -0.05142 0.20297  579 MET B N   
2064 C CA  . MET B 95  ? 0.40181 0.44000 0.41246 0.00522  -0.05624 0.20698  579 MET B CA  
2065 C C   . MET B 95  ? 0.40626 0.43476 0.40781 0.00861  -0.04979 0.20678  579 MET B C   
2066 O O   . MET B 95  ? 0.39246 0.42208 0.39955 0.01087  -0.05339 0.20977  579 MET B O   
2067 C CB  . MET B 95  ? 0.41701 0.48091 0.46163 0.00420  -0.05627 0.20810  579 MET B CB  
2068 C CG  . MET B 95  ? 0.51704 0.59347 0.57502 -0.00051 -0.06572 0.21226  579 MET B CG  
2069 S SD  . MET B 95  ? 0.74912 0.85470 0.84345 -0.00183 -0.05925 0.21272  579 MET B SD  
2070 C CE  . MET B 95  ? 0.79143 0.91331 0.90402 -0.00777 -0.07190 0.22237  579 MET B CE  
2071 N N   . ASN B 96  ? 0.40891 0.42828 0.39729 0.00888  -0.04066 0.20428  580 ASN B N   
2072 C CA  . ASN B 96  ? 0.50219 0.51340 0.48288 0.01002  -0.03457 0.20567  580 ASN B CA  
2073 C C   . ASN B 96  ? 0.50816 0.53302 0.51222 0.01020  -0.03309 0.20541  580 ASN B C   
2074 O O   . ASN B 96  ? 0.58449 0.60060 0.58287 0.01167  -0.03491 0.20827  580 ASN B O   
2075 C CB  . ASN B 96  ? 0.45058 0.43908 0.40348 0.01211  -0.03961 0.20998  580 ASN B CB  
2076 C CG  . ASN B 96  ? 0.61004 0.57750 0.53114 0.01320  -0.03963 0.21040  580 ASN B CG  
2077 O OD1 . ASN B 96  ? 0.67864 0.63585 0.58371 0.01331  -0.03064 0.21068  580 ASN B OD1 
2078 N ND2 . ASN B 96  ? 0.63355 0.59391 0.54439 0.01411  -0.04995 0.21130  580 ASN B ND2 
2079 N N   . LEU B 97  ? 0.37291 0.41580 0.39967 0.00922  -0.02999 0.20202  581 LEU B N   
2080 C CA  . LEU B 97  ? 0.35696 0.40895 0.40161 0.01067  -0.02958 0.20165  581 LEU B CA  
2081 C C   . LEU B 97  ? 0.31311 0.36144 0.35749 0.00939  -0.02347 0.20104  581 LEU B C   
2082 O O   . LEU B 97  ? 0.29006 0.34007 0.33241 0.00696  -0.01766 0.20009  581 LEU B O   
2083 C CB  . LEU B 97  ? 0.35399 0.42435 0.42013 0.01040  -0.02846 0.19900  581 LEU B CB  
2084 C CG  . LEU B 97  ? 0.38344 0.46169 0.45656 0.01064  -0.03551 0.20184  581 LEU B CG  
2085 C CD1 . LEU B 97  ? 0.37720 0.47380 0.47122 0.00939  -0.03243 0.20019  581 LEU B CD1 
2086 C CD2 . LEU B 97  ? 0.30141 0.37665 0.37516 0.01496  -0.04156 0.20652  581 LEU B CD2 
2087 N N   . PRO B 98  ? 0.39793 0.44004 0.44316 0.01121  -0.02529 0.20241  582 PRO B N   
2088 C CA  . PRO B 98  ? 0.35988 0.39679 0.40420 0.00848  -0.02158 0.20339  582 PRO B CA  
2089 C C   . PRO B 98  ? 0.36131 0.41129 0.42278 0.00690  -0.01756 0.19983  582 PRO B C   
2090 O O   . PRO B 98  ? 0.34267 0.40171 0.41533 0.00940  -0.01787 0.19658  582 PRO B O   
2091 C CB  . PRO B 98  ? 0.32028 0.34168 0.35606 0.01188  -0.02668 0.20585  582 PRO B CB  
2092 C CG  . PRO B 98  ? 0.31433 0.34196 0.35774 0.01783  -0.03067 0.20437  582 PRO B CG  
2093 C CD  . PRO B 98  ? 0.31407 0.35179 0.35934 0.01628  -0.03159 0.20449  582 PRO B CD  
2094 N N   . GLY B 99  ? 0.34097 0.39181 0.40436 0.00265  -0.01399 0.20131  583 GLY B N   
2095 C CA  . GLY B 99  ? 0.27225 0.32924 0.34804 0.00091  -0.01271 0.19916  583 GLY B CA  
2096 C C   . GLY B 99  ? 0.37160 0.44325 0.45805 -0.00222 -0.00768 0.19900  583 GLY B C   
2097 O O   . GLY B 99  ? 0.35056 0.42715 0.43373 -0.00194 -0.00402 0.20016  583 GLY B O   
2098 N N   . GLU B 100 ? 0.35085 0.42679 0.44755 -0.00447 -0.00786 0.19793  584 GLU B N   
2099 C CA  . GLU B 100 ? 0.54104 0.63273 0.65104 -0.00589 -0.00422 0.19728  584 GLU B CA  
2100 C C   . GLU B 100 ? 0.41383 0.51106 0.53275 -0.00372 -0.00473 0.19139  584 GLU B C   
2101 O O   . GLU B 100 ? 0.45406 0.54090 0.56979 -0.00335 -0.00800 0.18976  584 GLU B O   
2102 C CB  . GLU B 100 ? 0.74037 0.83295 0.85529 -0.01164 -0.00507 0.20296  584 GLU B CB  
2103 C CG  . GLU B 100 ? 0.95078 1.06127 1.07780 -0.01152 -0.00018 0.20546  584 GLU B CG  
2104 C CD  . GLU B 100 ? 1.08072 1.19725 1.21908 -0.01738 -0.00262 0.21130  584 GLU B CD  
2105 O OE1 . GLU B 100 ? 1.06141 1.18916 1.20599 -0.01827 0.00137  0.21828  584 GLU B OE1 
2106 O OE2 . GLU B 100 ? 1.14156 1.25078 1.28153 -0.02095 -0.00852 0.20955  584 GLU B OE2 
2107 N N   . VAL B 101 ? 0.36725 0.47753 0.49385 -0.00158 -0.00125 0.18837  585 VAL B N   
2108 C CA  . VAL B 101 ? 0.30087 0.41640 0.43528 0.00008  -0.00113 0.18325  585 VAL B CA  
2109 C C   . VAL B 101 ? 0.26445 0.39155 0.40904 -0.00047 0.00108  0.18285  585 VAL B C   
2110 O O   . VAL B 101 ? 0.26194 0.39558 0.40719 0.00040  0.00419  0.18552  585 VAL B O   
2111 C CB  . VAL B 101 ? 0.31434 0.43275 0.44739 0.00327  -0.00032 0.17998  585 VAL B CB  
2112 C CG1 . VAL B 101 ? 0.18556 0.29416 0.31173 0.00493  -0.00322 0.18114  585 VAL B CG1 
2113 C CG2 . VAL B 101 ? 0.17680 0.29816 0.30423 0.00399  0.00164  0.18064  585 VAL B CG2 
2114 N N   . THR B 102 ? 0.17128 0.29880 0.32168 -0.00121 -0.00037 0.18014  586 THR B N   
2115 C CA  . THR B 102 ? 0.21465 0.35244 0.37475 -0.00125 0.00071  0.17970  586 THR B CA  
2116 C C   . THR B 102 ? 0.14001 0.27888 0.30190 0.00092  0.00164  0.17384  586 THR B C   
2117 O O   . THR B 102 ? 0.16387 0.29355 0.32109 0.00100  0.00032  0.17150  586 THR B O   
2118 C CB  . THR B 102 ? 0.23801 0.37362 0.40246 -0.00621 -0.00342 0.18397  586 THR B CB  
2119 O OG1 . THR B 102 ? 0.20077 0.33540 0.36350 -0.00899 -0.00415 0.19050  586 THR B OG1 
2120 C CG2 . THR B 102 ? 0.21867 0.36686 0.39469 -0.00586 -0.00288 0.18524  586 THR B CG2 
2121 N N   . PHE B 103 ? 0.14010 0.28803 0.30631 0.00338  0.00439  0.17200  587 PHE B N   
2122 C CA  . PHE B 103 ? 0.21691 0.36577 0.38380 0.00500  0.00549  0.16701  587 PHE B CA  
2123 C C   . PHE B 103 ? 0.21027 0.36228 0.38293 0.00455  0.00502  0.16609  587 PHE B C   
2124 O O   . PHE B 103 ? 0.12401 0.28260 0.30206 0.00483  0.00523  0.16944  587 PHE B O   
2125 C CB  . PHE B 103 ? 0.11862 0.27034 0.28139 0.00736  0.00780  0.16535  587 PHE B CB  
2126 C CG  . PHE B 103 ? 0.17542 0.32316 0.33179 0.00695  0.00697  0.16634  587 PHE B CG  
2127 C CD1 . PHE B 103 ? 0.15811 0.30531 0.31537 0.00670  0.00606  0.16509  587 PHE B CD1 
2128 C CD2 . PHE B 103 ? 0.13581 0.28037 0.28503 0.00705  0.00726  0.16954  587 PHE B CD2 
2129 C CE1 . PHE B 103 ? 0.21987 0.36478 0.37289 0.00624  0.00447  0.16726  587 PHE B CE1 
2130 C CE2 . PHE B 103 ? 0.27723 0.41650 0.41907 0.00640  0.00545  0.17077  587 PHE B CE2 
2131 C CZ  . PHE B 103 ? 0.14081 0.28086 0.28549 0.00587  0.00349  0.16977  587 PHE B CZ  
2132 N N   . LEU B 104 ? 0.11232 0.25948 0.28332 0.00436  0.00471  0.16238  588 LEU B N   
2133 C CA  . LEU B 104 ? 0.15168 0.29969 0.32545 0.00389  0.00422  0.16082  588 LEU B CA  
2134 C C   . LEU B 104 ? 0.10442 0.24999 0.27124 0.00648  0.00694  0.15525  588 LEU B C   
2135 O O   . LEU B 104 ? 0.10311 0.24584 0.26811 0.00711  0.00767  0.15326  588 LEU B O   
2136 C CB  . LEU B 104 ? 0.11646 0.25140 0.28407 0.00139  0.00122  0.15980  588 LEU B CB  
2137 C CG  . LEU B 104 ? 0.12852 0.25564 0.29436 -0.00303 -0.00396 0.16384  588 LEU B CG  
2138 C CD1 . LEU B 104 ? 0.14492 0.25071 0.29584 -0.00372 -0.00712 0.16159  588 LEU B CD1 
2139 C CD2 . LEU B 104 ? 0.12534 0.26323 0.30269 -0.00620 -0.00674 0.16857  588 LEU B CD2 
2140 N N   . PRO B 105 ? 0.10408 0.25140 0.26771 0.00829  0.00868  0.15422  589 PRO B N   
2141 C CA  . PRO B 105 ? 0.10211 0.24774 0.26042 0.00968  0.01006  0.15101  589 PRO B CA  
2142 C C   . PRO B 105 ? 0.10040 0.24265 0.25705 0.00975  0.01020  0.14825  589 PRO B C   
2143 O O   . PRO B 105 ? 0.10130 0.24485 0.25874 0.01069  0.01115  0.14925  589 PRO B O   
2144 C CB  . PRO B 105 ? 0.10430 0.25482 0.26160 0.01201  0.01224  0.15420  589 PRO B CB  
2145 C CG  . PRO B 105 ? 0.10738 0.26227 0.26908 0.01276  0.01298  0.15857  589 PRO B CG  
2146 C CD  . PRO B 105 ? 0.10689 0.25947 0.27287 0.00974  0.01003  0.15816  589 PRO B CD  
2147 N N   . LEU B 106 ? 0.09879 0.23784 0.25388 0.00924  0.00976  0.14598  590 LEU B N   
2148 C CA  . LEU B 106 ? 0.11780 0.25394 0.27258 0.00904  0.00965  0.14464  590 LEU B CA  
2149 C C   . LEU B 106 ? 0.14034 0.27694 0.29292 0.01014  0.01073  0.14423  590 LEU B C   
2150 O O   . LEU B 106 ? 0.25995 0.39584 0.41401 0.00988  0.01054  0.14470  590 LEU B O   
2151 C CB  . LEU B 106 ? 0.09733 0.23183 0.25124 0.00965  0.01033  0.14400  590 LEU B CB  
2152 C CG  . LEU B 106 ? 0.10248 0.23689 0.25939 0.01028  0.01109  0.14635  590 LEU B CG  
2153 C CD1 . LEU B 106 ? 0.10132 0.23498 0.25626 0.01273  0.01360  0.14675  590 LEU B CD1 
2154 C CD2 . LEU B 106 ? 0.10770 0.23102 0.25878 0.00892  0.00906  0.14615  590 LEU B CD2 
2155 N N   . ASN B 107 ? 0.11724 0.25609 0.26759 0.01133  0.01178  0.14513  591 ASN B N   
2156 C CA  . ASN B 107 ? 0.14738 0.28133 0.29032 0.01298  0.01334  0.14475  591 ASN B CA  
2157 C C   . ASN B 107 ? 0.12800 0.26750 0.27454 0.01639  0.01669  0.14870  591 ASN B C   
2158 O O   . ASN B 107 ? 0.27156 0.40665 0.41130 0.01944  0.01925  0.14968  591 ASN B O   
2159 C CB  . ASN B 107 ? 0.11261 0.23711 0.24225 0.01201  0.01220  0.14357  591 ASN B CB  
2160 C CG  . ASN B 107 ? 0.33568 0.45898 0.45979 0.01296  0.01297  0.14580  591 ASN B CG  
2161 O OD1 . ASN B 107 ? 0.40670 0.53851 0.53930 0.01404  0.01421  0.14802  591 ASN B OD1 
2162 N ND2 . ASN B 107 ? 0.35630 0.46614 0.46333 0.01205  0.01148  0.14573  591 ASN B ND2 
2163 N N   . LYS B 108 ? 0.10712 0.25344 0.26112 0.01642  0.01684  0.15137  592 LYS B N   
2164 C CA  . LYS B 108 ? 0.10846 0.26129 0.26656 0.02007  0.02041  0.15687  592 LYS B CA  
2165 C C   . LYS B 108 ? 0.14085 0.29541 0.30564 0.01718  0.01773  0.15850  592 LYS B C   
2166 O O   . LYS B 108 ? 0.11434 0.27611 0.28478 0.01998  0.02049  0.16457  592 LYS B O   
2167 C CB  . LYS B 108 ? 0.21034 0.36817 0.36903 0.02259  0.02262  0.16080  592 LYS B CB  
2168 C CG  . LYS B 108 ? 0.12212 0.26957 0.26437 0.02482  0.02471  0.15936  592 LYS B CG  
2169 C CD  . LYS B 108 ? 0.24793 0.39001 0.38029 0.03089  0.02990  0.16144  592 LYS B CD  
2170 C CE  . LYS B 108 ? 0.28953 0.40964 0.39651 0.03025  0.02788  0.15693  592 LYS B CE  
2171 N NZ  . LYS B 108 ? 0.42716 0.53702 0.52024 0.03688  0.03181  0.15826  592 LYS B NZ  
2172 N N   . LEU B 109 ? 0.15827 0.30811 0.32402 0.01206  0.01269  0.15539  593 LEU B N   
2173 C CA  . LEU B 109 ? 0.15685 0.30946 0.33095 0.00812  0.00871  0.15952  593 LEU B CA  
2174 C C   . LEU B 109 ? 0.24547 0.40050 0.42371 0.00783  0.00871  0.16243  593 LEU B C   
2175 O O   . LEU B 109 ? 0.38647 0.53648 0.56073 0.00760  0.00857  0.15906  593 LEU B O   
2176 C CB  . LEU B 109 ? 0.10643 0.25346 0.28079 0.00358  0.00397  0.15753  593 LEU B CB  
2177 C CG  . LEU B 109 ? 0.35975 0.50584 0.53236 0.00366  0.00397  0.15667  593 LEU B CG  
2178 C CD1 . LEU B 109 ? 0.13870 0.28048 0.31255 0.00098  0.00110  0.15662  593 LEU B CD1 
2179 C CD2 . LEU B 109 ? 0.10994 0.26289 0.28932 0.00286  0.00293  0.16285  593 LEU B CD2 
2180 N N   . ASP B 110 ? 0.23887 0.40299 0.42620 0.00821  0.00917  0.17007  594 ASP B N   
2181 C CA  . ASP B 110 ? 0.35675 0.52559 0.54964 0.00868  0.01033  0.17497  594 ASP B CA  
2182 C C   . ASP B 110 ? 0.27923 0.44891 0.48181 0.00086  0.00228  0.17968  594 ASP B C   
2183 O O   . ASP B 110 ? 0.50410 0.68021 0.71511 -0.00022 0.00189  0.18689  594 ASP B O   
2184 C CB  . ASP B 110 ? 0.56526 0.74601 0.76393 0.01501  0.01708  0.18323  594 ASP B CB  
2185 C CG  . ASP B 110 ? 0.80198 0.99358 1.01346 0.01283  0.01404  0.19228  594 ASP B CG  
2186 O OD1 . ASP B 110 ? 0.89244 1.09636 1.11148 0.01856  0.01953  0.20150  594 ASP B OD1 
2187 O OD2 . ASP B 110 ? 0.81668 1.00564 1.03119 0.00651  0.00661  0.19189  594 ASP B OD2 
2188 N N   . VAL B 111 ? 0.35924 0.63892 0.58162 0.03180  0.05098  0.12089  595 VAL B N   
2189 C CA  . VAL B 111 ? 0.42819 0.68932 0.63679 0.03064  0.02842  0.12897  595 VAL B CA  
2190 C C   . VAL B 111 ? 0.51710 0.72175 0.69578 0.05692  0.00309  0.13152  595 VAL B C   
2191 O O   . VAL B 111 ? 0.67166 0.82022 0.81029 0.06362  0.00826  0.13853  595 VAL B O   
2192 C CB  . VAL B 111 ? 0.43286 0.66299 0.60668 0.00797  0.03584  0.14567  595 VAL B CB  
2193 C CG1 . VAL B 111 ? 0.31688 0.49697 0.45053 0.01064  0.05043  0.14931  595 VAL B CG1 
2194 C CG2 . VAL B 111 ? 0.36127 0.57733 0.52469 0.00327  0.01464  0.14998  595 VAL B CG2 
2195 N N   A ARG B 112 ? 0.51927 0.73555 0.71205 0.06863  -0.02645 0.12523  596 ARG B N   
2196 N N   B ARG B 112 ? 0.52358 0.73958 0.71603 0.06851  -0.02643 0.12536  596 ARG B N   
2197 C CA  A ARG B 112 ? 0.61421 0.76945 0.76799 0.09246  -0.06143 0.13105  596 ARG B CA  
2198 C CA  B ARG B 112 ? 0.61233 0.76706 0.76562 0.09235  -0.06126 0.13122  596 ARG B CA  
2199 C C   A ARG B 112 ? 0.63360 0.76031 0.74317 0.07814  -0.07288 0.14505  596 ARG B C   
2200 C C   B ARG B 112 ? 0.63459 0.76275 0.74573 0.07880  -0.07386 0.14451  596 ARG B C   
2201 O O   A ARG B 112 ? 0.57211 0.73395 0.69872 0.05621  -0.05949 0.14429  596 ARG B O   
2202 O O   B ARG B 112 ? 0.58026 0.74615 0.71097 0.05764  -0.06176 0.14294  596 ARG B O   
2203 C CB  A ARG B 112 ? 0.64978 0.84314 0.85999 0.12634  -0.09716 0.10408  596 ARG B CB  
2204 C CB  B ARG B 112 ? 0.65261 0.84353 0.86173 0.12687  -0.09656 0.10437  596 ARG B CB  
2205 C CG  A ARG B 112 ? 0.68293 0.88275 0.92777 0.14945  -0.09736 0.08516  596 ARG B CG  
2206 C CG  B ARG B 112 ? 0.68527 0.87395 0.92165 0.14915  -0.09603 0.08844  596 ARG B CG  
2207 C CD  A ARG B 112 ? 0.74929 0.83764 0.92573 0.16930  -0.12351 0.10437  596 ARG B CD  
2208 C CD  B ARG B 112 ? 0.68870 0.96191 1.01836 0.17695  -0.11821 0.04197  596 ARG B CD  
2209 N NE  A ARG B 112 ? 0.68028 0.76973 0.90120 0.20116  -0.13953 0.07900  596 ARG B NE  
2210 N NE  B ARG B 112 ? 0.63083 1.00519 1.01583 0.15331  -0.10269 0.02084  596 ARG B NE  
2211 C CZ  A ARG B 112 ? 0.72083 0.82493 0.99412 0.24386  -0.18962 0.04754  596 ARG B CZ  
2212 C CZ  B ARG B 112 ? 0.57792 1.04406 1.01709 0.12731  -0.06693 -0.00286 596 ARG B CZ  
2213 N NH1 A ARG B 112 ? 0.76589 0.88612 1.04983 0.25902  -0.22783 0.03959  596 ARG B NH1 
2214 N NH1 B ARG B 112 ? 0.56743 1.04405 1.01914 0.12681  -0.04347 -0.01038 596 ARG B NH1 
2215 N NH2 A ARG B 112 ? 0.75260 0.85840 1.07369 0.27410  -0.20474 0.01805  596 ARG B NH2 
2216 N NH2 B ARG B 112 ? 0.52873 1.07455 1.00329 0.09635  -0.05392 -0.01931 596 ARG B NH2 
2217 N N   . ASP B 113 ? 0.73313 0.78980 0.77996 0.08815  -0.10049 0.15756  597 ASP B N   
2218 C CA  . ASP B 113 ? 0.83261 0.86487 0.83116 0.07255  -0.11221 0.16688  597 ASP B CA  
2219 C C   . ASP B 113 ? 0.80287 0.88676 0.84803 0.08681  -0.14280 0.15198  597 ASP B C   
2220 O O   . ASP B 113 ? 0.80399 0.91477 0.89420 0.11715  -0.17176 0.13536  597 ASP B O   
2221 C CB  . ASP B 113 ? 1.04903 0.98663 0.94946 0.06925  -0.13194 0.18654  597 ASP B CB  
2222 C CG  . ASP B 113 ? 1.15842 1.05430 1.00386 0.03826  -0.09278 0.19461  597 ASP B CG  
2223 O OD1 . ASP B 113 ? 1.13716 1.05272 0.97230 0.00991  -0.06639 0.18741  597 ASP B OD1 
2224 O OD2 . ASP B 113 ? 1.21375 1.06089 1.03213 0.04255  -0.08961 0.20201  597 ASP B OD2 
2225 N N   . THR B 114 ? 0.76219 0.86474 0.80277 0.06543  -0.13755 0.15087  598 THR B N   
2226 C CA  . THR B 114 ? 0.65871 0.81776 0.74685 0.07015  -0.15890 0.13325  598 THR B CA  
2227 C C   . THR B 114 ? 0.68970 0.81054 0.71990 0.07382  -0.19278 0.13856  598 THR B C   
2228 O O   . THR B 114 ? 0.73728 0.81618 0.70375 0.05010  -0.18094 0.15052  598 THR B O   
2229 C CB  . THR B 114 ? 0.54489 0.75063 0.67332 0.03948  -0.12993 0.12663  598 THR B CB  
2230 O OG1 . THR B 114 ? 0.43941 0.67894 0.61094 0.03180  -0.10320 0.12399  598 THR B OG1 
2231 C CG2 . THR B 114 ? 0.50966 0.76940 0.68099 0.03595  -0.14908 0.10690  598 THR B CG2 
2232 N N   . ALA B 115 ? 0.68719 0.82985 0.74139 0.10204  -0.23571 0.12381  599 ALA B N   
2233 C CA  . ALA B 115 ? 0.69572 0.81400 0.70016 0.10540  -0.27293 0.12570  599 ALA B CA  
2234 C C   . ALA B 115 ? 0.69715 0.87719 0.74135 0.08061  -0.25721 0.10838  599 ALA B C   
2235 O O   . ALA B 115 ? 0.70284 0.95855 0.82866 0.08443  -0.25798 0.08221  599 ALA B O   
2236 C CB  . ALA B 115 ? 0.75215 0.87212 0.77434 0.15083  -0.33282 0.11073  599 ALA B CB  
2237 N N   . TYR B 116 ? 0.66326 0.81355 0.65089 0.05133  -0.24238 0.11768  600 TYR B N   
2238 C CA  . TYR B 116 ? 0.62807 0.82780 0.65330 0.02979  -0.23283 0.09812  600 TYR B CA  
2239 C C   . TYR B 116 ? 0.73659 0.95039 0.74473 0.04025  -0.27421 0.08537  600 TYR B C   
2240 O O   . TYR B 116 ? 0.82268 0.98324 0.75184 0.05113  -0.30606 0.09994  600 TYR B O   
2241 C CB  . TYR B 116 ? 0.61734 0.79275 0.60845 -0.00298 -0.20019 0.10028  600 TYR B CB  
2242 C CG  . TYR B 116 ? 0.57805 0.74138 0.58756 -0.00987 -0.16513 0.10921  600 TYR B CG  
2243 C CD1 . TYR B 116 ? 0.57767 0.77901 0.65872 -0.01461 -0.14948 0.10339  600 TYR B CD1 
2244 C CD2 . TYR B 116 ? 0.59695 0.70948 0.54660 -0.01557 -0.14871 0.12320  600 TYR B CD2 
2245 C CE1 . TYR B 116 ? 0.58087 0.76915 0.67227 -0.02033 -0.12254 0.11276  600 TYR B CE1 
2246 C CE2 . TYR B 116 ? 0.55462 0.66221 0.52545 -0.01925 -0.11861 0.12734  600 TYR B CE2 
2247 C CZ  . TYR B 116 ? 0.49645 0.64184 0.53793 -0.01906 -0.10806 0.12289  600 TYR B CZ  
2248 O OH  . TYR B 116 ? 0.52011 0.65887 0.57602 -0.02257 -0.08356 0.12806  600 TYR B OH  
2249 N N   . PRO B 117 ? 0.74447 1.02442 0.81897 0.03409  -0.27679 0.05876  601 PRO B N   
2250 C CA  . PRO B 117 ? 0.75245 1.05542 0.81727 0.04486  -0.31682 0.04120  601 PRO B CA  
2251 C C   . PRO B 117 ? 0.88337 1.15622 0.87577 0.01912  -0.31493 0.04440  601 PRO B C   
2252 O O   . PRO B 117 ? 0.86551 1.13024 0.85345 -0.01054 -0.27865 0.04320  601 PRO B O   
2253 C CB  . PRO B 117 ? 0.64741 1.03512 0.81148 0.03605  -0.30892 0.00762  601 PRO B CB  
2254 C CG  . PRO B 117 ? 0.63066 1.01413 0.82295 0.00373  -0.26144 0.01526  601 PRO B CG  
2255 C CD  . PRO B 117 ? 0.65853 0.99023 0.81370 0.01315  -0.24573 0.04386  601 PRO B CD  
2256 N N   . GLU B 118 ? 1.03238 1.29137 0.96801 0.03129  -0.35823 0.04372  602 GLU B N   
2257 C CA  . GLU B 118 ? 1.04751 1.30106 0.92133 0.00309  -0.36038 0.03602  602 GLU B CA  
2258 C C   . GLU B 118 ? 0.87895 1.21072 0.83725 -0.00947 -0.35074 -0.00226 602 GLU B C   
2259 O O   . GLU B 118 ? 0.80202 1.18717 0.82561 0.01117  -0.37452 -0.02297 602 GLU B O   
2260 C CB  . GLU B 118 ? 1.23352 1.44541 1.01495 0.01956  -0.41724 0.04908  602 GLU B CB  
2261 C CG  . GLU B 118 ? 1.44739 1.61242 1.10541 -0.01975 -0.41613 0.06033  602 GLU B CG  
2262 C CD  . GLU B 118 ? 1.60278 1.69559 1.18060 -0.04772 -0.38323 0.08918  602 GLU B CD  
2263 O OE1 . GLU B 118 ? 1.63118 1.68144 1.21657 -0.02495 -0.38382 0.11292  602 GLU B OE1 
2264 O OE2 . GLU B 118 ? 1.66445 1.74927 1.17310 -0.09489 -0.35619 0.08228  602 GLU B OE2 
2265 N N   . THR B 119 ? 0.84037 1.18104 0.80206 -0.04359 -0.31777 -0.01773 603 THR B N   
2266 C CA  . THR B 119 ? 0.75220 1.15319 0.79287 -0.05798 -0.31018 -0.05458 603 THR B CA  
2267 C C   . THR B 119 ? 0.84118 1.24259 0.86542 -0.09080 -0.28651 -0.07774 603 THR B C   
2268 O O   . THR B 119 ? 0.83527 1.20115 0.82338 -0.10442 -0.26101 -0.06945 603 THR B O   
2269 C CB  . THR B 119 ? 0.65202 1.07479 0.78723 -0.05717 -0.28974 -0.05732 603 THR B CB  
2270 O OG1 . THR B 119 ? 0.62552 1.08547 0.82432 -0.07924 -0.28212 -0.08962 603 THR B OG1 
2271 C CG2 . THR B 119 ? 0.62264 0.99862 0.74914 -0.06325 -0.25788 -0.03373 603 THR B CG2 
2272 N N   . ASN B 120 ? 0.82912 1.27948 0.88894 -0.10307 -0.29562 -0.11502 604 ASN B N   
2273 C CA  . ASN B 120 ? 0.89061 1.35770 0.97075 -0.13068 -0.27556 -0.15286 604 ASN B CA  
2274 C C   . ASN B 120 ? 0.80945 1.27403 0.98342 -0.13438 -0.25894 -0.16611 604 ASN B C   
2275 O O   . ASN B 120 ? 0.85326 1.31559 1.05198 -0.14922 -0.24534 -0.19648 604 ASN B O   
2276 C CB  . ASN B 120 ? 0.94841 1.46922 1.02971 -0.14270 -0.29489 -0.19184 604 ASN B CB  
2277 C CG  . ASN B 120 ? 1.10018 1.61804 1.08488 -0.13744 -0.32449 -0.17499 604 ASN B CG  
2278 O OD1 . ASN B 120 ? 1.20916 1.69820 1.09648 -0.15652 -0.31918 -0.16478 604 ASN B OD1 
2279 N ND2 . ASN B 120 ? 1.09932 1.64516 1.10635 -0.11420 -0.35878 -0.17440 604 ASN B ND2 
2280 N N   . ASP B 121 ? 0.62479 1.08900 0.84842 -0.12341 -0.26299 -0.14760 605 ASP B N   
2281 C CA  . ASP B 121 ? 0.62673 1.08032 0.92537 -0.13562 -0.25424 -0.15509 605 ASP B CA  
2282 C C   . ASP B 121 ? 0.61424 1.01335 0.91175 -0.13395 -0.23534 -0.12707 605 ASP B C   
2283 O O   . ASP B 121 ? 0.56111 0.93206 0.90435 -0.14702 -0.23306 -0.13053 605 ASP B O   
2284 C CB  . ASP B 121 ? 0.69150 1.18060 1.03635 -0.13680 -0.26386 -0.15360 605 ASP B CB  
2285 C CG  . ASP B 121 ? 0.81635 1.36530 1.18077 -0.13997 -0.28474 -0.19024 605 ASP B CG  
2286 O OD1 . ASP B 121 ? 0.97474 1.53393 1.32495 -0.14679 -0.29009 -0.21831 605 ASP B OD1 
2287 O OD2 . ASP B 121 ? 0.67869 1.27330 1.07495 -0.13593 -0.29574 -0.19681 605 ASP B OD2 
2288 N N   . ALA B 122 ? 0.52316 0.80395 0.82913 -0.18321 -0.20522 -0.08946 606 ALA B N   
2289 C CA  . ALA B 122 ? 0.50582 0.80792 0.78125 -0.18407 -0.16122 -0.09215 606 ALA B CA  
2290 C C   . ALA B 122 ? 0.46600 0.75229 0.73694 -0.16158 -0.17019 -0.08631 606 ALA B C   
2291 O O   . ALA B 122 ? 0.51343 0.81402 0.77643 -0.15312 -0.19309 -0.08177 606 ALA B O   
2292 C CB  . ALA B 122 ? 0.51510 0.82752 0.81999 -0.17375 -0.16322 -0.07899 606 ALA B CB  
2293 N N   . ILE B 123 ? 0.42012 0.66990 0.68289 -0.15947 -0.15706 -0.07070 607 ILE B N   
2294 C CA  . ILE B 123 ? 0.43814 0.66496 0.68143 -0.14315 -0.16001 -0.05324 607 ILE B CA  
2295 C C   . ILE B 123 ? 0.42058 0.61628 0.67255 -0.12623 -0.15240 -0.02824 607 ILE B C   
2296 O O   . ILE B 123 ? 0.39941 0.57660 0.66827 -0.12928 -0.14022 -0.02931 607 ILE B O   
2297 C CB  . ILE B 123 ? 0.46987 0.67731 0.69735 -0.15442 -0.15111 -0.06999 607 ILE B CB  
2298 C CG1 . ILE B 123 ? 0.58992 0.79543 0.79216 -0.14389 -0.16101 -0.05972 607 ILE B CG1 
2299 C CG2 . ILE B 123 ? 0.46548 0.62328 0.69984 -0.15267 -0.13373 -0.06405 607 ILE B CG2 
2300 C CD1 . ILE B 123 ? 0.65829 0.89768 0.84540 -0.14191 -0.18184 -0.05385 607 ILE B CD1 
2301 N N   . PRO B 124 ? 0.43791 0.62844 0.67970 -0.10909 -0.15866 -0.00614 608 PRO B N   
2302 C CA  . PRO B 124 ? 0.34056 0.50106 0.58932 -0.09528 -0.14869 0.01135  608 PRO B CA  
2303 C C   . PRO B 124 ? 0.35118 0.47639 0.59178 -0.09673 -0.13723 0.00862  608 PRO B C   
2304 O O   . PRO B 124 ? 0.44652 0.56603 0.66928 -0.09938 -0.13942 0.00366  608 PRO B O   
2305 C CB  . PRO B 124 ? 0.36376 0.52798 0.60225 -0.07996 -0.15701 0.03136  608 PRO B CB  
2306 C CG  . PRO B 124 ? 0.25740 0.45867 0.49139 -0.08360 -0.17325 0.02911  608 PRO B CG  
2307 C CD  . PRO B 124 ? 0.27322 0.48680 0.49859 -0.10232 -0.17455 0.00481  608 PRO B CD  
2308 N N   . MET B 125 ? 0.22415 0.32770 0.47842 -0.09559 -0.12494 0.01168  609 MET B N   
2309 C CA  . MET B 125 ? 0.29802 0.36904 0.54840 -0.09546 -0.11467 0.01086  609 MET B CA  
2310 C C   . MET B 125 ? 0.33961 0.39596 0.57382 -0.08334 -0.11570 0.02317  609 MET B C   
2311 O O   . MET B 125 ? 0.31529 0.35426 0.54211 -0.08412 -0.11206 0.01754  609 MET B O   
2312 C CB  . MET B 125 ? 0.28437 0.33910 0.54893 -0.09549 -0.10328 0.01748  609 MET B CB  
2313 C CG  . MET B 125 ? 0.22397 0.24669 0.48684 -0.09320 -0.09403 0.02026  609 MET B CG  
2314 S SD  . MET B 125 ? 0.45859 0.46862 0.73534 -0.09660 -0.08288 0.03083  609 MET B SD  
2315 C CE  . MET B 125 ? 0.58093 0.61339 0.85578 -0.09117 -0.08521 0.04164  609 MET B CE  
2316 N N   . ILE B 126 ? 0.31145 0.37544 0.54237 -0.07270 -0.11954 0.03780  610 ILE B N   
2317 C CA  . ILE B 126 ? 0.32049 0.37140 0.53728 -0.06260 -0.11914 0.04886  610 ILE B CA  
2318 C C   . ILE B 126 ? 0.37903 0.43660 0.57743 -0.06611 -0.12759 0.04373  610 ILE B C   
2319 O O   . ILE B 126 ? 0.38349 0.42768 0.56959 -0.06181 -0.12581 0.04788  610 ILE B O   
2320 C CB  . ILE B 126 ? 0.26437 0.32122 0.48615 -0.05217 -0.11820 0.06215  610 ILE B CB  
2321 C CG1 . ILE B 126 ? 0.18880 0.22723 0.40121 -0.04384 -0.11153 0.07109  610 ILE B CG1 
2322 C CG2 . ILE B 126 ? 0.18574 0.26434 0.40534 -0.04996 -0.12922 0.06540  610 ILE B CG2 
2323 C CD1 . ILE B 126 ? 0.29636 0.33728 0.51915 -0.03664 -0.10479 0.07804  610 ILE B CD1 
2324 N N   . SER B 127 ? 0.39948 0.48095 0.59460 -0.07592 -0.13659 0.03329  611 SER B N   
2325 C CA  . SER B 127 ? 0.39134 0.48362 0.56393 -0.08279 -0.14427 0.02725  611 SER B CA  
2326 C C   . SER B 127 ? 0.32542 0.40205 0.49561 -0.09297 -0.13617 0.00709  611 SER B C   
2327 O O   . SER B 127 ? 0.26664 0.34730 0.41696 -0.09917 -0.13887 0.00040  611 SER B O   
2328 C CB  . SER B 127 ? 0.29119 0.41926 0.45792 -0.09116 -0.15687 0.02200  611 SER B CB  
2329 O OG  . SER B 127 ? 0.57540 0.71468 0.74536 -0.10843 -0.15503 -0.00465 611 SER B OG  
2330 N N   . LYS B 128 ? 0.29864 0.35621 0.48887 -0.09453 -0.12478 -0.00187 612 LYS B N   
2331 C CA  . LYS B 128 ? 0.34665 0.38406 0.54219 -0.10056 -0.11354 -0.02019 612 LYS B CA  
2332 C C   . LYS B 128 ? 0.31398 0.32135 0.51426 -0.08679 -0.10465 -0.00821 612 LYS B C   
2333 O O   . LYS B 128 ? 0.32380 0.31316 0.53206 -0.08731 -0.09473 -0.02028 612 LYS B O   
2334 C CB  . LYS B 128 ? 0.38438 0.41788 0.59975 -0.11042 -0.10562 -0.03537 612 LYS B CB  
2335 C CG  . LYS B 128 ? 0.45972 0.52639 0.67337 -0.12710 -0.11291 -0.05110 612 LYS B CG  
2336 C CD  . LYS B 128 ? 0.45905 0.55451 0.64842 -0.13860 -0.12218 -0.06479 612 LYS B CD  
2337 C CE  . LYS B 128 ? 0.49680 0.57839 0.67965 -0.15121 -0.11251 -0.08854 612 LYS B CE  
2338 N NZ  . LYS B 128 ? 0.68752 0.79612 0.84779 -0.16698 -0.12668 -0.10214 612 LYS B NZ  
2339 N N   . LEU B 129 ? 0.25032 0.25426 0.44766 -0.07441 -0.10708 0.01410  613 LEU B N   
2340 C CA  . LEU B 129 ? 0.24501 0.22816 0.44417 -0.06279 -0.09985 0.02505  613 LEU B CA  
2341 C C   . LEU B 129 ? 0.21546 0.19903 0.39841 -0.05962 -0.10255 0.02753  613 LEU B C   
2342 O O   . LEU B 129 ? 0.20652 0.20507 0.37758 -0.05959 -0.11109 0.03616  613 LEU B O   
2343 C CB  . LEU B 129 ? 0.17813 0.16109 0.38279 -0.05466 -0.09845 0.04355  613 LEU B CB  
2344 C CG  . LEU B 129 ? 0.20365 0.18967 0.42292 -0.06026 -0.09602 0.04248  613 LEU B CG  
2345 C CD1 . LEU B 129 ? 0.17469 0.16334 0.39636 -0.05446 -0.09281 0.05847  613 LEU B CD1 
2346 C CD2 . LEU B 129 ? 0.23786 0.20802 0.47001 -0.06419 -0.08889 0.03260  613 LEU B CD2 
2347 N N   . ARG B 130 ? 0.24032 0.20895 0.42455 -0.05672 -0.09494 0.02011  614 ARG B N   
2348 C CA  . ARG B 130 ? 0.26796 0.23483 0.43881 -0.05459 -0.09472 0.02107  614 ARG B CA  
2349 C C   . ARG B 130 ? 0.17392 0.13247 0.34637 -0.04110 -0.09003 0.03755  614 ARG B C   
2350 O O   . ARG B 130 ? 0.21056 0.16217 0.39373 -0.03410 -0.08360 0.03746  614 ARG B O   
2351 C CB  . ARG B 130 ? 0.25992 0.21964 0.43359 -0.05971 -0.08683 -0.00126 614 ARG B CB  
2352 C CG  . ARG B 130 ? 0.26061 0.23491 0.42740 -0.07568 -0.08847 -0.02397 614 ARG B CG  
2353 C CD  . ARG B 130 ? 0.25130 0.22256 0.41811 -0.08106 -0.07673 -0.04951 614 ARG B CD  
2354 N NE  . ARG B 130 ? 0.33781 0.29033 0.53392 -0.07331 -0.06476 -0.05851 614 ARG B NE  
2355 C CZ  . ARG B 130 ? 0.48713 0.43775 0.69905 -0.07912 -0.05892 -0.07485 614 ARG B CZ  
2356 N NH1 . ARG B 130 ? 0.54683 0.48134 0.78881 -0.06916 -0.04975 -0.07779 614 ARG B NH1 
2357 N NH2 . ARG B 130 ? 0.39282 0.36067 0.59295 -0.09490 -0.06382 -0.08677 614 ARG B NH2 
2358 N N   . TYR B 131 ? 0.15877 0.12359 0.32207 -0.03812 -0.09361 0.05091  615 TYR B N   
2359 C CA  . TYR B 131 ? 0.18139 0.14966 0.34277 -0.02771 -0.08684 0.05960  615 TYR B CA  
2360 C C   . TYR B 131 ? 0.17699 0.14718 0.32353 -0.02590 -0.08485 0.06379  615 TYR B C   
2361 O O   . TYR B 131 ? 0.14663 0.11896 0.28434 -0.02861 -0.09211 0.06875  615 TYR B O   
2362 C CB  . TYR B 131 ? 0.14111 0.12314 0.31260 -0.02746 -0.08636 0.06616  615 TYR B CB  
2363 C CG  . TYR B 131 ? 0.13149 0.11719 0.30454 -0.03129 -0.09128 0.07190  615 TYR B CG  
2364 C CD1 . TYR B 131 ? 0.14339 0.12842 0.32283 -0.03522 -0.09947 0.07176  615 TYR B CD1 
2365 C CD2 . TYR B 131 ? 0.18813 0.17952 0.35648 -0.02983 -0.08543 0.07495  615 TYR B CD2 
2366 C CE1 . TYR B 131 ? 0.14762 0.14526 0.32767 -0.03653 -0.10324 0.07456  615 TYR B CE1 
2367 C CE2 . TYR B 131 ? 0.13365 0.13070 0.30543 -0.02891 -0.08904 0.08003  615 TYR B CE2 
2368 C CZ  . TYR B 131 ? 0.17108 0.17275 0.34820 -0.03190 -0.09879 0.08060  615 TYR B CZ  
2369 O OH  . TYR B 131 ? 0.32629 0.34140 0.50937 -0.03057 -0.10319 0.08387  615 TYR B OH  
2370 N N   . ASN B 132 ? 0.20064 0.17528 0.34168 -0.02118 -0.07401 0.06123  616 ASN B N   
2371 C CA  . ASN B 132 ? 0.12570 0.10065 0.25528 -0.01876 -0.06881 0.06364  616 ASN B CA  
2372 C C   . ASN B 132 ? 0.12281 0.10672 0.25746 -0.01807 -0.06748 0.06876  616 ASN B C   
2373 O O   . ASN B 132 ? 0.11403 0.10530 0.26027 -0.01887 -0.06529 0.06839  616 ASN B O   
2374 C CB  . ASN B 132 ? 0.11717 0.09260 0.24483 -0.01523 -0.05924 0.05876  616 ASN B CB  
2375 C CG  . ASN B 132 ? 0.12086 0.09278 0.24045 -0.01338 -0.05327 0.06068  616 ASN B CG  
2376 O OD1 . ASN B 132 ? 0.11796 0.09495 0.24196 -0.01161 -0.04944 0.06334  616 ASN B OD1 
2377 N ND2 . ASN B 132 ? 0.12987 0.09098 0.24187 -0.01480 -0.05150 0.05924  616 ASN B ND2 
2378 N N   . PRO B 133 ? 0.13332 0.11636 0.26261 -0.01686 -0.06920 0.07526  617 PRO B N   
2379 C CA  . PRO B 133 ? 0.27062 0.26097 0.41262 -0.01480 -0.06893 0.08040  617 PRO B CA  
2380 C C   . PRO B 133 ? 0.26699 0.26126 0.42381 -0.01168 -0.05873 0.07643  617 PRO B C   
2381 O O   . PRO B 133 ? 0.12212 0.12211 0.29789 -0.01053 -0.05853 0.07932  617 PRO B O   
2382 C CB  . PRO B 133 ? 0.15303 0.14086 0.28636 -0.01330 -0.07277 0.09044  617 PRO B CB  
2383 C CG  . PRO B 133 ? 0.16447 0.14726 0.27816 -0.01859 -0.08076 0.09300  617 PRO B CG  
2384 C CD  . PRO B 133 ? 0.15081 0.12670 0.26420 -0.01922 -0.07543 0.08168  617 PRO B CD  
2385 N N   A ARG B 134 ? 0.15522 0.14719 0.30755 -0.01071 -0.05133 0.07056  618 ARG B N   
2386 N N   B ARG B 134 ? 0.15616 0.14837 0.30887 -0.01077 -0.05133 0.07051  618 ARG B N   
2387 C CA  A ARG B 134 ? 0.16062 0.15840 0.33017 -0.00970 -0.04382 0.06771  618 ARG B CA  
2388 C CA  B ARG B 134 ? 0.15619 0.15413 0.32700 -0.00954 -0.04374 0.06797  618 ARG B CA  
2389 C C   A ARG B 134 ? 0.15648 0.16344 0.34109 -0.01318 -0.04642 0.06954  618 ARG B C   
2390 C C   B ARG B 134 ? 0.15976 0.16688 0.34383 -0.01324 -0.04592 0.06915  618 ARG B C   
2391 O O   A ARG B 134 ? 0.18959 0.20238 0.39954 -0.01257 -0.04207 0.07054  618 ARG B O   
2392 O O   B ARG B 134 ? 0.18867 0.20230 0.39638 -0.01277 -0.04078 0.06961  618 ARG B O   
2393 C CB  A ARG B 134 ? 0.09855 0.09399 0.26012 -0.00969 -0.03884 0.06280  618 ARG B CB  
2394 C CB  B ARG B 134 ? 0.10030 0.09458 0.26478 -0.00867 -0.03705 0.06298  618 ARG B CB  
2395 C CG  A ARG B 134 ? 0.22305 0.22215 0.40436 -0.00920 -0.03021 0.06014  618 ARG B CG  
2396 C CG  B ARG B 134 ? 0.09439 0.09119 0.25026 -0.01136 -0.04000 0.06119  618 ARG B CG  
2397 C CD  A ARG B 134 ? 0.21323 0.21651 0.38981 -0.01364 -0.03004 0.05915  618 ARG B CD  
2398 C CD  B ARG B 134 ? 0.19420 0.18500 0.34225 -0.01046 -0.03593 0.05703  618 ARG B CD  
2399 N NE  A ARG B 134 ? 0.22869 0.22637 0.39813 -0.01400 -0.02551 0.05377  618 ARG B NE  
2400 N NE  B ARG B 134 ? 0.28571 0.27228 0.42275 -0.01095 -0.04121 0.05561  618 ARG B NE  
2401 C CZ  A ARG B 134 ? 0.26652 0.26981 0.44523 -0.01894 -0.01416 0.04369  618 ARG B CZ  
2402 C CZ  B ARG B 134 ? 0.28880 0.27799 0.42940 -0.01159 -0.04370 0.05478  618 ARG B CZ  
2403 N NH1 A ARG B 134 ? 0.09131 0.09126 0.26539 -0.02021 -0.01005 0.03785  618 ARG B NH1 
2404 N NH1 B ARG B 134 ? 0.10036 0.08365 0.23939 -0.01098 -0.04762 0.05205  618 ARG B NH1 
2405 N NH2 A ARG B 134 ? 0.20473 0.22132 0.39652 -0.02316 -0.00534 0.03509  618 ARG B NH2 
2406 N NH2 B ARG B 134 ? 0.13888 0.13634 0.28937 -0.01318 -0.04318 0.05818  618 ARG B NH2 
2407 N N   . PHE B 135 ? 0.18919 0.19631 0.36394 -0.01713 -0.05267 0.07030  619 PHE B N   
2408 C CA  . PHE B 135 ? 0.16060 0.17366 0.34439 -0.02067 -0.05469 0.07411  619 PHE B CA  
2409 C C   . PHE B 135 ? 0.23056 0.24272 0.42495 -0.02218 -0.05899 0.07761  619 PHE B C   
2410 O O   . PHE B 135 ? 0.20544 0.21741 0.40179 -0.02367 -0.06109 0.08141  619 PHE B O   
2411 C CB  . PHE B 135 ? 0.09725 0.10878 0.26926 -0.02311 -0.05861 0.07414  619 PHE B CB  
2412 C CG  . PHE B 135 ? 0.09353 0.10488 0.25871 -0.02231 -0.05627 0.07236  619 PHE B CG  
2413 C CD1 . PHE B 135 ? 0.14959 0.16627 0.31786 -0.02123 -0.05158 0.07512  619 PHE B CD1 
2414 C CD2 . PHE B 135 ? 0.09842 0.10126 0.25367 -0.02105 -0.05806 0.06789  619 PHE B CD2 
2415 C CE1 . PHE B 135 ? 0.19442 0.21138 0.35848 -0.02135 -0.05086 0.07495  619 PHE B CE1 
2416 C CE2 . PHE B 135 ? 0.13230 0.13373 0.28352 -0.01945 -0.05573 0.06634  619 PHE B CE2 
2417 C CZ  . PHE B 135 ? 0.10048 0.10943 0.25536 -0.02032 -0.05272 0.07027  619 PHE B CZ  
2418 N N   . ASP B 136 ? 0.20571 0.21673 0.40612 -0.01981 -0.06096 0.07857  620 ASP B N   
2419 C CA  . ASP B 136 ? 0.22162 0.23436 0.43029 -0.01952 -0.06799 0.08260  620 ASP B CA  
2420 C C   . ASP B 136 ? 0.17859 0.19883 0.40979 -0.01840 -0.06517 0.08316  620 ASP B C   
2421 O O   . ASP B 136 ? 0.12239 0.14799 0.35718 -0.02052 -0.07062 0.08389  620 ASP B O   
2422 C CB  . ASP B 136 ? 0.33045 0.34403 0.53988 -0.01419 -0.07056 0.08601  620 ASP B CB  
2423 C CG  . ASP B 136 ? 0.59432 0.61249 0.80113 -0.01462 -0.08255 0.09169  620 ASP B CG  
2424 O OD1 . ASP B 136 ? 0.58143 0.60768 0.80762 -0.01069 -0.08540 0.09582  620 ASP B OD1 
2425 O OD2 . ASP B 136 ? 0.70539 0.72118 0.89436 -0.01878 -0.08982 0.09156  620 ASP B OD2 
2426 N N   . LYS B 137 ? 0.20265 0.22849 0.45119 -0.01451 -0.05557 0.07923  621 LYS B N   
2427 C CA  . LYS B 137 ? 0.21042 0.25387 0.47933 -0.01506 -0.04927 0.07223  621 LYS B CA  
2428 C C   . LYS B 137 ? 0.18528 0.23694 0.43911 -0.02409 -0.04754 0.07138  621 LYS B C   
2429 O O   . LYS B 137 ? 0.11507 0.18010 0.37866 -0.02921 -0.04567 0.06780  621 LYS B O   
2430 C CB  . LYS B 137 ? 0.12036 0.17271 0.40929 -0.01293 -0.03509 0.06092  621 LYS B CB  
2431 C CG  . LYS B 137 ? 0.20699 0.25394 0.52484 -0.00461 -0.03505 0.06105  621 LYS B CG  
2432 C CD  . LYS B 137 ? 0.36798 0.41738 0.70741 -0.00264 -0.01922 0.04735  621 LYS B CD  
2433 C CE  . LYS B 137 ? 0.56113 0.60227 0.93512 0.00486  -0.01932 0.04914  621 LYS B CE  
2434 N NZ  . LYS B 137 ? 0.63012 0.67813 1.01287 0.00693  -0.03130 0.05720  621 LYS B NZ  
2435 N N   . ALA B 138 ? 0.10808 0.15179 0.33948 -0.02697 -0.04826 0.07561  622 ALA B N   
2436 C CA  . ALA B 138 ? 0.11322 0.16102 0.33120 -0.03590 -0.04803 0.07935  622 ALA B CA  
2437 C C   . ALA B 138 ? 0.11920 0.15852 0.33750 -0.03656 -0.05794 0.08444  622 ALA B C   
2438 O O   . ALA B 138 ? 0.12693 0.17396 0.34828 -0.04449 -0.05593 0.08481  622 ALA B O   
2439 C CB  . ALA B 138 ? 0.11222 0.15396 0.31103 -0.03711 -0.04858 0.08457  622 ALA B CB  
2440 N N   . PHE B 139 ? 0.11886 0.14384 0.33410 -0.03107 -0.06728 0.08665  623 PHE B N   
2441 C CA  . PHE B 139 ? 0.23271 0.25327 0.44889 -0.03446 -0.07525 0.08683  623 PHE B CA  
2442 C C   . PHE B 139 ? 0.31597 0.34943 0.54792 -0.03622 -0.07733 0.08250  623 PHE B C   
2443 O O   . PHE B 139 ? 0.30414 0.34182 0.54147 -0.04226 -0.08037 0.07985  623 PHE B O   
2444 C CB  . PHE B 139 ? 0.12911 0.13488 0.33478 -0.03213 -0.08304 0.08660  623 PHE B CB  
2445 C CG  . PHE B 139 ? 0.22897 0.23172 0.42538 -0.03039 -0.08160 0.08531  623 PHE B CG  
2446 C CD1 . PHE B 139 ? 0.11659 0.12325 0.30232 -0.02821 -0.07491 0.08141  623 PHE B CD1 
2447 C CD2 . PHE B 139 ? 0.18147 0.17996 0.38305 -0.03366 -0.08435 0.08485  623 PHE B CD2 
2448 C CE1 . PHE B 139 ? 0.15656 0.16245 0.33866 -0.02855 -0.07402 0.08050  623 PHE B CE1 
2449 C CE2 . PHE B 139 ? 0.23582 0.23177 0.43473 -0.03268 -0.08224 0.08415  623 PHE B CE2 
2450 C CZ  . PHE B 139 ? 0.20287 0.20448 0.39386 -0.03006 -0.07877 0.08307  623 PHE B CZ  
2451 N N   . LYS B 140 ? 0.22021 0.26149 0.46335 -0.03081 -0.07572 0.08098  624 LYS B N   
2452 C CA  . LYS B 140 ? 0.20957 0.26760 0.47299 -0.03070 -0.07837 0.07714  624 LYS B CA  
2453 C C   . LYS B 140 ? 0.25433 0.32838 0.53151 -0.03728 -0.06847 0.07108  624 LYS B C   
2454 O O   . LYS B 140 ? 0.21981 0.30710 0.50985 -0.04234 -0.07031 0.06678  624 LYS B O   
2455 C CB  . LYS B 140 ? 0.21395 0.27533 0.49102 -0.02187 -0.07934 0.07848  624 LYS B CB  
2456 C CG  . LYS B 140 ? 0.28131 0.33716 0.54556 -0.01912 -0.09091 0.08479  624 LYS B CG  
2457 C CD  . LYS B 140 ? 0.41103 0.46386 0.68292 -0.01148 -0.08950 0.08970  624 LYS B CD  
2458 C CE  . LYS B 140 ? 0.67129 0.73685 0.97936 -0.00548 -0.08566 0.08717  624 LYS B CE  
2459 N NZ  . LYS B 140 ? 0.69049 0.74968 1.01414 0.00189  -0.08171 0.09121  624 LYS B NZ  
2460 N N   . HIS B 141 ? 0.24933 0.32553 0.52188 -0.03992 -0.05707 0.06941  625 HIS B N   
2461 C CA  . HIS B 141 ? 0.17120 0.26539 0.44966 -0.05124 -0.04548 0.06318  625 HIS B CA  
2462 C C   . HIS B 141 ? 0.25594 0.34530 0.52419 -0.06170 -0.04782 0.06817  625 HIS B C   
2463 O O   . HIS B 141 ? 0.15295 0.25703 0.43320 -0.07100 -0.04302 0.06297  625 HIS B O   
2464 C CB  . HIS B 141 ? 0.16424 0.26409 0.43207 -0.05596 -0.03334 0.06043  625 HIS B CB  
2465 C CG  . HIS B 141 ? 0.26233 0.38398 0.53064 -0.07216 -0.02003 0.05400  625 HIS B CG  
2466 N ND1 . HIS B 141 ? 0.31501 0.46237 0.60380 -0.07690 -0.00743 0.03874  625 HIS B ND1 
2467 C CD2 . HIS B 141 ? 0.27074 0.39279 0.52228 -0.08592 -0.01685 0.06144  625 HIS B CD2 
2468 C CE1 . HIS B 141 ? 0.27551 0.44165 0.55695 -0.09560 0.00408  0.03504  625 HIS B CE1 
2469 N NE2 . HIS B 141 ? 0.29733 0.44629 0.55640 -0.10089 -0.00159 0.05020  625 HIS B NE2 
2470 N N   . VAL B 142 ? 0.17518 0.24411 0.42455 -0.06065 -0.05407 0.07739  626 VAL B N   
2471 C CA  . VAL B 142 ? 0.23387 0.29475 0.47844 -0.06964 -0.05519 0.08251  626 VAL B CA  
2472 C C   . VAL B 142 ? 0.26594 0.32506 0.52254 -0.07027 -0.06310 0.07672  626 VAL B C   
2473 O O   . VAL B 142 ? 0.27236 0.33805 0.53872 -0.08053 -0.05984 0.07350  626 VAL B O   
2474 C CB  . VAL B 142 ? 0.28739 0.32934 0.51474 -0.06690 -0.05893 0.09294  626 VAL B CB  
2475 C CG1 . VAL B 142 ? 0.29922 0.33034 0.52881 -0.07438 -0.06011 0.09804  626 VAL B CG1 
2476 C CG2 . VAL B 142 ? 0.16118 0.21024 0.37524 -0.06954 -0.05211 0.09917  626 VAL B CG2 
2477 N N   . PHE B 143 ? 0.26751 0.31996 0.52257 -0.06177 -0.07301 0.07448  627 PHE B N   
2478 C CA  . PHE B 143 ? 0.16858 0.22086 0.42943 -0.06532 -0.08123 0.06758  627 PHE B CA  
2479 C C   . PHE B 143 ? 0.23131 0.30232 0.50300 -0.06175 -0.08906 0.06205  627 PHE B C   
2480 O O   . PHE B 143 ? 0.17597 0.25455 0.45123 -0.06673 -0.09683 0.05472  627 PHE B O   
2481 C CB  . PHE B 143 ? 0.16971 0.20290 0.41766 -0.06274 -0.08691 0.06737  627 PHE B CB  
2482 C CG  . PHE B 143 ? 0.33236 0.34801 0.57294 -0.06260 -0.08158 0.07417  627 PHE B CG  
2483 C CD1 . PHE B 143 ? 0.36746 0.37425 0.61527 -0.07053 -0.07798 0.07325  627 PHE B CD1 
2484 C CD2 . PHE B 143 ? 0.32930 0.33863 0.55780 -0.05441 -0.08068 0.08150  627 PHE B CD2 
2485 C CE1 . PHE B 143 ? 0.39670 0.38898 0.64111 -0.06881 -0.07495 0.08179  627 PHE B CE1 
2486 C CE2 . PHE B 143 ? 0.31033 0.30959 0.53424 -0.05340 -0.07822 0.08795  627 PHE B CE2 
2487 C CZ  . PHE B 143 ? 0.35760 0.34842 0.59015 -0.05995 -0.07597 0.08934  627 PHE B CZ  
2488 N N   . GLY B 144 ? 0.39298 0.46313 0.65828 -0.14225 -0.15317 0.24400  628 GLY B N   
2489 C CA  . GLY B 144 ? 0.41019 0.49477 0.69076 -0.13067 -0.18786 0.24591  628 GLY B CA  
2490 C C   . GLY B 144 ? 0.41450 0.53967 0.74522 -0.13335 -0.20154 0.22637  628 GLY B C   
2491 O O   . GLY B 144 ? 0.43359 0.57190 0.76883 -0.12684 -0.23301 0.22875  628 GLY B O   
2492 N N   . LYS B 145 ? 0.40042 0.54913 0.76708 -0.14533 -0.18002 0.20853  629 LYS B N   
2493 C CA  . LYS B 145 ? 0.57141 0.76684 0.98968 -0.14906 -0.19241 0.18784  629 LYS B CA  
2494 C C   . LYS B 145 ? 0.41201 0.61402 0.82691 -0.17370 -0.18557 0.17637  629 LYS B C   
2495 O O   . LYS B 145 ? 0.41077 0.65088 0.86870 -0.18658 -0.18149 0.15782  629 LYS B O   
2496 C CB  . LYS B 145 ? 0.38706 0.62111 0.86078 -0.14523 -0.17855 0.17148  629 LYS B CB  
2497 C CG  . LYS B 145 ? 0.50379 0.75046 1.00811 -0.11563 -0.20231 0.16899  629 LYS B CG  
2498 C CD  . LYS B 145 ? 0.58964 0.87740 1.14656 -0.10931 -0.18529 0.14806  629 LYS B CD  
2499 C CE  . LYS B 145 ? 0.65081 0.94543 1.24317 -0.07545 -0.21356 0.14103  629 LYS B CE  
2500 N NZ  . LYS B 145 ? 0.68913 0.97197 1.27856 -0.06019 -0.25667 0.15069  629 LYS B NZ  
2501 N N   . THR B 146 ? 0.42321 0.59197 0.78963 -0.18094 -0.18619 0.18433  630 THR B N   
2502 C CA  . THR B 146 ? 0.43499 0.59904 0.79743 -0.20315 -0.17885 0.17114  630 THR B CA  
2503 C C   . THR B 146 ? 0.45430 0.62213 0.79127 -0.20314 -0.20309 0.16605  630 THR B C   
2504 O O   . THR B 146 ? 0.45861 0.61103 0.75339 -0.19247 -0.21342 0.17976  630 THR B O   
2505 C CB  . THR B 146 ? 0.43279 0.55352 0.76548 -0.21298 -0.15219 0.17907  630 THR B CB  
2506 O OG1 . THR B 146 ? 0.41593 0.54211 0.77116 -0.21618 -0.12956 0.18474  630 THR B OG1 
2507 C CG2 . THR B 146 ? 0.45989 0.56713 0.79388 -0.23484 -0.14853 0.16483  630 THR B CG2 
2508 N N   . LEU B 147 ? 0.46733 0.66196 0.83004 -0.21775 -0.21204 0.14542  631 LEU B N   
2509 C CA  . LEU B 147 ? 0.48692 0.69504 0.83082 -0.22212 -0.23301 0.13386  631 LEU B CA  
2510 C C   . LEU B 147 ? 0.57471 0.75599 0.90669 -0.24011 -0.22045 0.11665  631 LEU B C   
2511 O O   . LEU B 147 ? 0.60079 0.76844 0.95855 -0.25633 -0.20360 0.10934  631 LEU B O   
2512 C CB  . LEU B 147 ? 0.49442 0.75625 0.87889 -0.22489 -0.25517 0.11908  631 LEU B CB  
2513 C CG  . LEU B 147 ? 0.53022 0.82281 0.93626 -0.20435 -0.27678 0.13134  631 LEU B CG  
2514 C CD1 . LEU B 147 ? 0.50256 0.85010 0.93999 -0.20668 -0.30331 0.11552  631 LEU B CD1 
2515 C CD2 . LEU B 147 ? 0.49349 0.76332 0.85401 -0.18768 -0.29084 0.15788  631 LEU B CD2 
2516 N N   . ILE B 148 ? 0.51545 0.69072 0.80936 -0.23825 -0.23034 0.10958  632 ILE B N   
2517 C CA  . ILE B 148 ? 0.53657 0.69040 0.82448 -0.25138 -0.22577 0.08542  632 ILE B CA  
2518 C C   . ILE B 148 ? 0.60686 0.80427 0.91293 -0.26227 -0.24688 0.05835  632 ILE B C   
2519 O O   . ILE B 148 ? 0.60265 0.83699 0.88691 -0.25579 -0.26650 0.05658  632 ILE B O   
2520 C CB  . ILE B 148 ? 0.60882 0.73659 0.84722 -0.24113 -0.22226 0.08617  632 ILE B CB  
2521 C CG1 . ILE B 148 ? 0.54104 0.62590 0.76177 -0.23182 -0.19997 0.11068  632 ILE B CG1 
2522 C CG2 . ILE B 148 ? 0.60243 0.71277 0.84229 -0.25069 -0.22375 0.05366  632 ILE B CG2 
2523 C CD1 . ILE B 148 ? 0.55688 0.62539 0.72826 -0.22022 -0.19714 0.11133  632 ILE B CD1 
2524 N N   . CYS B 149 ? 0.57026 0.76584 0.91429 -0.28175 -0.24345 0.03793  633 CYS B N   
2525 C CA  . CYS B 149 ? 0.58662 0.82856 0.95692 -0.29493 -0.26163 0.01096  633 CYS B CA  
2526 C C   . CYS B 149 ? 0.61819 0.84180 0.98679 -0.30814 -0.26501 -0.02342 633 CYS B C   
2527 O O   . CYS B 149 ? 0.71073 0.87795 1.06990 -0.31015 -0.25267 -0.02665 633 CYS B O   
2528 C CB  . CYS B 149 ? 0.58260 0.84792 1.00331 -0.30986 -0.25770 0.00984  633 CYS B CB  
2529 S SG  . CYS B 149 ? 0.57347 0.85883 1.00891 -0.29204 -0.25232 0.04171  633 CYS B SG  
2530 N N   . ARG B 150 ? 0.63720 0.91102 1.01701 -0.31595 -0.28428 -0.05077 634 ARG B N   
2531 C CA  . ARG B 150 ? 0.79325 1.06070 1.17506 -0.32663 -0.29166 -0.09117 634 ARG B CA  
2532 C C   . ARG B 150 ? 0.85173 1.07195 1.27058 -0.34979 -0.28260 -0.10659 634 ARG B C   
2533 O O   . ARG B 150 ? 0.90466 1.07637 1.32093 -0.35319 -0.28194 -0.12817 634 ARG B O   
2534 C CB  . ARG B 150 ? 0.84320 1.18659 1.23086 -0.33175 -0.31437 -0.11642 634 ARG B CB  
2535 C CG  . ARG B 150 ? 0.89333 1.25077 1.26495 -0.33241 -0.32508 -0.15726 634 ARG B CG  
2536 C CD  . ARG B 150 ? 0.90268 1.33910 1.26335 -0.32554 -0.34226 -0.17023 634 ARG B CD  
2537 N NE  . ARG B 150 ? 0.85796 1.31942 1.18045 -0.30645 -0.34472 -0.13156 634 ARG B NE  
2538 C CZ  . ARG B 150 ? 0.91241 1.37577 1.18795 -0.29355 -0.34456 -0.12293 634 ARG B CZ  
2539 N NH1 . ARG B 150 ? 0.94927 1.42729 1.19060 -0.27889 -0.34692 -0.08493 634 ARG B NH1 
2540 N NH2 . ARG B 150 ? 0.94331 1.39176 1.20653 -0.29485 -0.34220 -0.15366 634 ARG B NH2 
2541 N N   . SER B 151 ? 0.68729 0.92214 1.14001 -0.36537 -0.27601 -0.09623 635 SER B N   
2542 C CA  . SER B 151 ? 0.75504 0.95931 1.23452 -0.38918 -0.26247 -0.10932 635 SER B CA  
2543 C C   . SER B 151 ? 0.78732 0.98980 1.28092 -0.39510 -0.24161 -0.07986 635 SER B C   
2544 O O   . SER B 151 ? 0.77618 1.00976 1.26758 -0.37943 -0.24059 -0.05605 635 SER B O   
2545 C CB  . SER B 151 ? 0.74619 0.99959 1.24765 -0.40495 -0.27396 -0.14655 635 SER B CB  
2546 O OG  . SER B 151 ? 0.72835 1.04126 1.25359 -0.40903 -0.27241 -0.14120 635 SER B OG  
2547 N N   . MET B 152 ? 0.73899 0.90565 1.24507 -0.41800 -0.22513 -0.08256 636 MET B N   
2548 C CA  . MET B 152 ? 0.78630 0.96567 1.30668 -0.42759 -0.20405 -0.06206 636 MET B CA  
2549 C C   . MET B 152 ? 0.82037 1.07508 1.37619 -0.43899 -0.20781 -0.07991 636 MET B C   
2550 O O   . MET B 152 ? 0.81614 1.10658 1.38996 -0.43954 -0.19566 -0.06817 636 MET B O   
2551 C CB  . MET B 152 ? 0.93280 1.05089 1.44787 -0.44935 -0.18495 -0.05540 636 MET B CB  
2552 C CG  . MET B 152 ? 1.15760 1.19814 1.64206 -0.43871 -0.18672 -0.04732 636 MET B CG  
2553 S SD  . MET B 152 ? 1.36610 1.38051 1.85407 -0.44603 -0.21021 -0.08902 636 MET B SD  
2554 C CE  . MET B 152 ? 1.36639 1.31009 1.82240 -0.41943 -0.21640 -0.08053 636 MET B CE  
2555 N N   . GLU B 153 ? 0.97975 1.26148 1.54772 -0.44881 -0.22382 -0.11206 637 GLU B N   
2556 C CA  . GLU B 153 ? 1.02618 1.39089 1.62544 -0.44932 -0.23489 -0.13146 637 GLU B CA  
2557 C C   . GLU B 153 ? 0.86738 1.27837 1.46503 -0.41813 -0.24584 -0.11194 637 GLU B C   
2558 O O   . GLU B 153 ? 0.74377 1.20049 1.36742 -0.41362 -0.24184 -0.10638 637 GLU B O   
2559 C CB  . GLU B 153 ? 1.15377 1.53809 1.75154 -0.45828 -0.25294 -0.16662 637 GLU B CB  
2560 C CG  . GLU B 153 ? 1.24605 1.69674 1.88149 -0.44226 -0.27438 -0.18686 637 GLU B CG  
2561 C CD  . GLU B 153 ? 1.32685 1.78642 1.99653 -0.46602 -0.28805 -0.16655 637 GLU B CD  
2562 O OE1 . GLU B 153 ? 1.36290 1.85350 2.03734 -0.48319 -0.30484 -0.18306 637 GLU B OE1 
2563 O OE2 . GLU B 153 ? 1.33589 1.80295 2.03298 -0.46713 -0.26575 -0.16240 637 GLU B OE2 
2564 N N   . VAL B 154 ? 0.82761 1.22488 1.39410 -0.39594 -0.26001 -0.10109 638 VAL B N   
2565 C CA  . VAL B 154 ? 0.78447 1.22399 1.34502 -0.36766 -0.27487 -0.08282 638 VAL B CA  
2566 C C   . VAL B 154 ? 0.67570 1.09405 1.23214 -0.35381 -0.26188 -0.04942 638 VAL B C   
2567 O O   . VAL B 154 ? 0.64663 1.10354 1.21233 -0.33286 -0.27219 -0.03674 638 VAL B O   
2568 C CB  . VAL B 154 ? 0.82314 1.26429 1.34817 -0.35245 -0.29492 -0.08509 638 VAL B CB  
2569 C CG1 . VAL B 154 ? 0.75242 1.12981 1.24094 -0.34652 -0.28804 -0.06704 638 VAL B CG1 
2570 C CG2 . VAL B 154 ? 0.86752 1.36352 1.38699 -0.32709 -0.31538 -0.07176 638 VAL B CG2 
2571 N N   . SER B 155 ? 0.64777 1.00672 1.19216 -0.36371 -0.24018 -0.03629 639 SER B N   
2572 C CA  . SER B 155 ? 0.68052 1.02560 1.22231 -0.35166 -0.22504 -0.00811 639 SER B CA  
2573 C C   . SER B 155 ? 0.62471 1.02327 1.20630 -0.35601 -0.21596 -0.01391 639 SER B C   
2574 O O   . SER B 155 ? 0.54872 0.97294 1.14121 -0.33551 -0.21800 -0.00038 639 SER B O   
2575 C CB  . SER B 155 ? 0.75135 1.02515 1.26891 -0.36182 -0.20239 0.00551  639 SER B CB  
2576 O OG  . SER B 155 ? 0.85467 1.08354 1.34549 -0.36311 -0.21136 -0.00179 639 SER B OG  
2577 N N   . THR B 156 ? 0.65255 1.07154 1.25868 -0.38235 -0.20728 -0.03713 640 THR B N   
2578 C CA  . THR B 156 ? 0.59557 1.07338 1.24222 -0.38924 -0.19752 -0.04825 640 THR B CA  
2579 C C   . THR B 156 ? 0.57649 1.12656 1.25149 -0.36611 -0.22155 -0.05929 640 THR B C   
2580 O O   . THR B 156 ? 0.56206 1.15619 1.26421 -0.35207 -0.21984 -0.05903 640 THR B O   
2581 C CB  . THR B 156 ? 0.71099 1.19209 1.37990 -0.42334 -0.18525 -0.07065 640 THR B CB  
2582 O OG1 . THR B 156 ? 0.76072 1.16475 1.39681 -0.44132 -0.17366 -0.06261 640 THR B OG1 
2583 C CG2 . THR B 156 ? 0.62970 1.14877 1.33588 -0.43291 -0.16732 -0.07279 640 THR B CG2 
2584 N N   . GLN B 157 ? 0.58599 1.15041 1.25471 -0.35955 -0.24527 -0.07040 641 GLN B N   
2585 C CA  . GLN B 157 ? 0.57562 1.20395 1.26541 -0.33434 -0.27072 -0.07748 641 GLN B CA  
2586 C C   . GLN B 157 ? 0.55269 1.16620 1.22350 -0.29980 -0.28417 -0.04808 641 GLN B C   
2587 O O   . GLN B 157 ? 0.56303 1.21990 1.25942 -0.27605 -0.29686 -0.04779 641 GLN B O   
2588 C CB  . GLN B 157 ? 0.62140 1.27028 1.30653 -0.33682 -0.29176 -0.09692 641 GLN B CB  
2589 C CG  . GLN B 157 ? 0.72571 1.38842 1.44868 -0.36479 -0.28766 -0.12679 641 GLN B CG  
2590 C CD  . GLN B 157 ? 0.85221 1.55531 1.62429 -0.36771 -0.28986 -0.12397 641 GLN B CD  
2591 O OE1 . GLN B 157 ? 0.88631 1.57805 1.67378 -0.39485 -0.27086 -0.12272 641 GLN B OE1 
2592 N NE2 . GLN B 157 ? 0.90103 1.65769 1.69101 -0.34361 -0.31390 -0.11951 641 GLN B NE2 
2593 N N   . LEU B 158 ? 0.54829 1.09924 1.17647 -0.29567 -0.28218 -0.02479 642 LEU B N   
2594 C CA  . LEU B 158 ? 0.53145 1.06297 1.13952 -0.26512 -0.29533 0.00367  642 LEU B CA  
2595 C C   . LEU B 158 ? 0.50888 1.03568 1.13797 -0.25563 -0.27939 0.01499  642 LEU B C   
2596 O O   . LEU B 158 ? 0.49900 1.03428 1.13521 -0.22642 -0.29450 0.02779  642 LEU B O   
2597 C CB  . LEU B 158 ? 0.53384 1.00820 1.08989 -0.26607 -0.29625 0.02177  642 LEU B CB  
2598 C CG  . LEU B 158 ? 0.55260 1.04435 1.08010 -0.25869 -0.32154 0.01819  642 LEU B CG  
2599 C CD1 . LEU B 158 ? 0.56096 1.01172 1.04558 -0.27083 -0.31660 0.01812  642 LEU B CD1 
2600 C CD2 . LEU B 158 ? 0.55260 1.05388 1.06522 -0.22786 -0.34479 0.04196  642 LEU B CD2 
2601 N N   . ALA B 159 ? 0.50612 1.01881 1.14340 -0.27956 -0.24933 0.00960  643 ALA B N   
2602 C CA  . ALA B 159 ? 0.48610 1.00441 1.14190 -0.27296 -0.23094 0.01637  643 ALA B CA  
2603 C C   . ALA B 159 ? 0.71888 1.31350 1.42631 -0.26043 -0.23865 -0.00588 643 ALA B C   
2604 O O   . ALA B 159 ? 0.64174 1.25105 1.36779 -0.23482 -0.24267 -0.00144 643 ALA B O   
2605 C CB  . ALA B 159 ? 0.49373 0.98124 1.13754 -0.30361 -0.19645 0.01658  643 ALA B CB  
2606 N N   . ARG B 160 ? 0.65642 1.30241 1.38889 -0.27685 -0.24174 -0.03304 644 ARG B N   
2607 C CA  . ARG B 160 ? 0.67899 1.40805 1.45955 -0.26668 -0.24874 -0.05809 644 ARG B CA  
2608 C C   . ARG B 160 ? 0.73672 1.49393 1.52616 -0.23123 -0.28594 -0.05749 644 ARG B C   
2609 O O   . ARG B 160 ? 0.90453 1.72616 1.72907 -0.21592 -0.29659 -0.06990 644 ARG B O   
2610 C CB  . ARG B 160 ? 0.78647 1.55609 1.58974 -0.29980 -0.23305 -0.08857 644 ARG B CB  
2611 C CG  . ARG B 160 ? 0.92181 1.68585 1.72435 -0.30836 -0.25031 -0.10057 644 ARG B CG  
2612 C CD  . ARG B 160 ? 1.03364 1.84752 1.88157 -0.31451 -0.27685 -0.08834 644 ARG B CD  
2613 N NE  . ARG B 160 ? 1.11691 1.98213 1.96876 -0.28083 -0.30420 -0.08437 644 ARG B NE  
2614 C CZ  . ARG B 160 ? 1.20236 2.07497 2.03113 -0.26736 -0.32832 -0.08245 644 ARG B CZ  
2615 N NH1 . ARG B 160 ? 1.21639 2.13130 2.05497 -0.23182 -0.35324 -0.08251 644 ARG B NH1 
2616 N NH2 . ARG B 160 ? 1.24339 2.07179 2.05046 -0.28477 -0.33158 -0.08316 644 ARG B NH2 
2617 N N   . ALA B 161 ? 0.60699 1.31757 1.36016 -0.21893 -0.30659 -0.03829 645 ALA B N   
2618 C CA  . ALA B 161 ? 0.58123 1.30642 1.33266 -0.18394 -0.34197 -0.03101 645 ALA B CA  
2619 C C   . ALA B 161 ? 0.58570 1.26499 1.32341 -0.15087 -0.35296 -0.00431 645 ALA B C   
2620 O O   . ALA B 161 ? 0.58734 1.28877 1.34730 -0.11867 -0.37325 -0.00606 645 ALA B O   
2621 C CB  . ALA B 161 ? 0.54454 1.25551 1.25889 -0.19119 -0.35901 -0.02560 645 ALA B CB  
2622 N N   . PHE B 162 ? 0.62148 1.23559 1.32134 -0.15870 -0.34023 0.02017  646 PHE B N   
2623 C CA  . PHE B 162 ? 0.66505 1.23159 1.34879 -0.13426 -0.34502 0.04554  646 PHE B CA  
2624 C C   . PHE B 162 ? 0.77271 1.32348 1.46528 -0.15129 -0.31054 0.04493  646 PHE B C   
2625 O O   . PHE B 162 ? 1.03045 1.54936 1.69447 -0.17919 -0.28998 0.05276  646 PHE B O   
2626 C CB  . PHE B 162 ? 0.65960 1.16994 1.28227 -0.13096 -0.35998 0.07702  646 PHE B CB  
2627 C CG  . PHE B 162 ? 0.75649 1.28776 1.35975 -0.12902 -0.38486 0.07563  646 PHE B CG  
2628 C CD1 . PHE B 162 ? 0.80686 1.34577 1.41004 -0.09986 -0.41468 0.08427  646 PHE B CD1 
2629 C CD2 . PHE B 162 ? 0.81660 1.36032 1.40228 -0.15640 -0.37829 0.06390  646 PHE B CD2 
2630 C CE1 . PHE B 162 ? 0.90289 1.46617 1.48728 -0.09919 -0.43638 0.08410  646 PHE B CE1 
2631 C CE2 . PHE B 162 ? 0.86659 1.43862 1.43655 -0.15467 -0.39997 0.05912  646 PHE B CE2 
2632 C CZ  . PHE B 162 ? 0.92246 1.50647 1.49077 -0.12663 -0.42849 0.07061  646 PHE B CZ  
2633 N N   . THR B 163 ? 0.65231 1.22707 1.38272 -0.13421 -0.30381 0.03361  647 THR B N   
2634 C CA  . THR B 163 ? 0.68164 1.26309 1.42482 -0.15527 -0.26713 0.02608  647 THR B CA  
2635 C C   . THR B 163 ? 0.60969 1.12310 1.31105 -0.16028 -0.25277 0.05650  647 THR B C   
2636 O O   . THR B 163 ? 0.66695 1.16021 1.36987 -0.13783 -0.25533 0.06719  647 THR B O   
2637 C CB  . THR B 163 ? 0.83041 1.46883 1.62387 -0.13707 -0.26188 0.00023  647 THR B CB  
2638 O OG1 . THR B 163 ? 0.89958 1.59884 1.72542 -0.12565 -0.28217 -0.02381 647 THR B OG1 
2639 C CG2 . THR B 163 ? 0.82904 1.49538 1.63133 -0.16873 -0.22235 -0.01233 647 THR B CG2 
2640 N N   . MET B 164 ? 0.47321 0.95113 1.13639 -0.18921 -0.23825 0.06803  648 MET B N   
2641 C CA  . MET B 164 ? 0.47714 0.88461 1.08212 -0.19171 -0.22556 0.09449  648 MET B CA  
2642 C C   . MET B 164 ? 0.43233 0.81891 1.01799 -0.22727 -0.20054 0.09314  648 MET B C   
2643 O O   . MET B 164 ? 0.45323 0.85970 1.04882 -0.24625 -0.20492 0.07716  648 MET B O   
2644 C CB  . MET B 164 ? 0.43950 0.81421 1.00253 -0.17607 -0.25357 0.11179  648 MET B CB  
2645 C CG  . MET B 164 ? 0.48608 0.82023 1.02008 -0.15182 -0.26009 0.13531  648 MET B CG  
2646 S SD  . MET B 164 ? 0.54188 0.85146 1.02468 -0.14392 -0.29407 0.15672  648 MET B SD  
2647 C CE  . MET B 164 ? 0.59868 0.94431 1.12616 -0.11454 -0.33630 0.15583  648 MET B CE  
2648 N N   . ASP B 165 ? 0.42978 0.77397 0.98666 -0.23480 -0.17487 0.10857  649 ASP B N   
2649 C CA  . ASP B 165 ? 0.49469 0.80097 1.02229 -0.26207 -0.15370 0.11010  649 ASP B CA  
2650 C C   . ASP B 165 ? 0.50059 0.77552 0.99900 -0.26630 -0.17222 0.11187  649 ASP B C   
2651 O O   . ASP B 165 ? 0.46293 0.71895 0.92926 -0.24432 -0.18779 0.12169  649 ASP B O   
2652 C CB  . ASP B 165 ? 0.48403 0.74518 0.97625 -0.26088 -0.12638 0.12819  649 ASP B CB  
2653 C CG  . ASP B 165 ? 0.45501 0.75245 0.97150 -0.25879 -0.10556 0.12242  649 ASP B CG  
2654 O OD1 . ASP B 165 ? 0.47108 0.82089 1.02383 -0.27131 -0.10071 0.10108  649 ASP B OD1 
2655 O OD2 . ASP B 165 ? 0.46312 0.74137 0.96159 -0.24558 -0.09341 0.13633  649 ASP B OD2 
2656 N N   . CYS B 166 ? 0.50851 0.77391 1.00435 -0.28902 -0.16613 0.09685  650 CYS B N   
2657 C CA  . CYS B 166 ? 0.53599 0.77561 1.00854 -0.29499 -0.18192 0.09087  650 CYS B CA  
2658 C C   . CYS B 166 ? 0.53565 0.71615 0.98024 -0.31019 -0.16271 0.09144  650 CYS B C   
2659 O O   . CYS B 166 ? 0.53419 0.70126 0.97991 -0.32130 -0.13873 0.09376  650 CYS B O   
2660 C CB  . CYS B 166 ? 0.54024 0.82598 1.04115 -0.30439 -0.20013 0.06585  650 CYS B CB  
2661 S SG  . CYS B 166 ? 0.49483 0.83988 1.01795 -0.27726 -0.22941 0.06807  650 CYS B SG  
2662 N N   . ILE B 167 ? 0.55045 0.69828 0.96866 -0.30922 -0.17548 0.08821  651 ILE B N   
2663 C CA  . ILE B 167 ? 0.56285 0.64962 0.95603 -0.31702 -0.16322 0.08754  651 ILE B CA  
2664 C C   . ILE B 167 ? 0.58226 0.65777 0.96339 -0.31791 -0.18525 0.06688  651 ILE B C   
2665 O O   . ILE B 167 ? 0.57087 0.67630 0.93418 -0.29970 -0.19992 0.06149  651 ILE B O   
2666 C CB  . ILE B 167 ? 0.55171 0.60085 0.91179 -0.30113 -0.14445 0.11289  651 ILE B CB  
2667 C CG1 . ILE B 167 ? 0.66926 0.65974 1.00877 -0.30720 -0.12940 0.11311  651 ILE B CG1 
2668 C CG2 . ILE B 167 ? 0.52682 0.57492 0.85575 -0.27940 -0.15632 0.12174  651 ILE B CG2 
2669 C CD1 . ILE B 167 ? 0.56880 0.53108 0.87590 -0.29058 -0.10794 0.13477  651 ILE B CD1 
2670 N N   . THR B 168 ? 0.70314 0.73712 1.08599 -0.33275 -0.18425 0.05110  652 THR B N   
2671 C CA  . THR B 168 ? 0.69374 0.71712 1.06736 -0.33094 -0.20339 0.02217  652 THR B CA  
2672 C C   . THR B 168 ? 0.68370 0.65269 1.02198 -0.31450 -0.19887 0.02524  652 THR B C   
2673 O O   . THR B 168 ? 0.64941 0.58068 0.97618 -0.31207 -0.18267 0.05133  652 THR B O   
2674 C CB  . THR B 168 ? 0.78630 0.79978 1.18968 -0.35558 -0.20920 -0.00534 652 THR B CB  
2675 O OG1 . THR B 168 ? 0.93024 0.87581 1.32562 -0.36196 -0.19486 0.00086  652 THR B OG1 
2676 C CG2 . THR B 168 ? 0.77251 0.83691 1.20579 -0.36991 -0.20266 -0.00625 652 THR B CG2 
2677 N N   . LEU B 169 ? 0.79764 0.56915 0.89274 -0.26806 -0.36517 0.03176  653 LEU B N   
2678 C CA  . LEU B 169 ? 0.84078 0.55794 0.88463 -0.25353 -0.36849 0.04638  653 LEU B CA  
2679 C C   . LEU B 169 ? 0.89266 0.54729 0.89758 -0.27050 -0.35426 0.05122  653 LEU B C   
2680 O O   . LEU B 169 ? 0.93651 0.54644 0.89540 -0.25571 -0.36098 0.06026  653 LEU B O   
2681 C CB  . LEU B 169 ? 0.92799 0.64521 0.95970 -0.23314 -0.39010 0.03941  653 LEU B CB  
2682 C CG  . LEU B 169 ? 1.04444 0.77516 1.07373 -0.20379 -0.40059 0.04611  653 LEU B CG  
2683 C CD1 . LEU B 169 ? 1.07511 0.77674 1.07218 -0.18401 -0.41373 0.04553  653 LEU B CD1 
2684 C CD2 . LEU B 169 ? 1.09305 0.81564 1.12353 -0.19903 -0.37937 0.05858  653 LEU B CD2 
2685 N N   . GLU B 170 ? 0.89310 0.53735 0.91463 -0.30050 -0.33401 0.04097  654 GLU B N   
2686 C CA  . GLU B 170 ? 1.03642 0.59408 1.00723 -0.31788 -0.31046 0.04940  654 GLU B CA  
2687 C C   . GLU B 170 ? 1.03912 0.56245 0.98935 -0.32703 -0.28118 0.06562  654 GLU B C   
2688 O O   . GLU B 170 ? 1.11266 0.54958 0.99842 -0.32743 -0.25029 0.07841  654 GLU B O   
2689 C CB  . GLU B 170 ? 1.03662 0.58612 1.03695 -0.34700 -0.28873 0.02555  654 GLU B CB  
2690 C CG  . GLU B 170 ? 0.98858 0.56960 1.00236 -0.33243 -0.31771 0.00694  654 GLU B CG  
2691 C CD  . GLU B 170 ? 1.02809 0.70824 1.11222 -0.32493 -0.33981 -0.01932 654 GLU B CD  
2692 O OE1 . GLU B 170 ? 0.95870 0.66370 1.03289 -0.29393 -0.37191 -0.02045 654 GLU B OE1 
2693 O OE2 . GLU B 170 ? 1.05935 0.78786 1.20352 -0.34677 -0.32461 -0.04016 654 GLU B OE2 
2694 N N   . GLY B 171 ? 0.94587 0.53341 0.93906 -0.32358 -0.28266 0.06639  655 GLY B N   
2695 C CA  . GLY B 171 ? 0.97469 0.54374 0.94483 -0.31832 -0.25504 0.08159  655 GLY B CA  
2696 C C   . GLY B 171 ? 0.97291 0.57404 1.00033 -0.35199 -0.22242 0.07346  655 GLY B C   
2697 O O   . GLY B 171 ? 0.98545 0.57975 0.99696 -0.34458 -0.20041 0.08686  655 GLY B O   
2698 N N   . ASP B 172 ? 0.98800 0.62959 1.08584 -0.38627 -0.21916 0.04575  656 ASP B N   
2699 C CA  . ASP B 172 ? 0.97443 0.65591 1.14206 -0.42119 -0.18513 0.02625  656 ASP B CA  
2700 C C   . ASP B 172 ? 0.90056 0.67530 1.11536 -0.40369 -0.20720 0.02256  656 ASP B C   
2701 O O   . ASP B 172 ? 0.85759 0.69030 1.09039 -0.37846 -0.24943 0.01487  656 ASP B O   
2702 C CB  . ASP B 172 ? 0.98674 0.70664 1.23107 -0.45384 -0.17643 -0.01988 656 ASP B CB  
2703 C CG  . ASP B 172 ? 1.07959 0.71190 1.27852 -0.46332 -0.15583 -0.01965 656 ASP B CG  
2704 O OD1 . ASP B 172 ? 1.05148 0.69860 1.23861 -0.44216 -0.19314 -0.02778 656 ASP B OD1 
2705 O OD2 . ASP B 172 ? 1.20232 0.74416 1.37186 -0.48857 -0.09747 -0.00963 656 ASP B OD2 
2706 N N   . GLN B 173 ? 0.91288 0.69330 1.13969 -0.41329 -0.17375 0.02949  657 GLN B N   
2707 C CA  . GLN B 173 ? 0.85314 0.70864 1.11161 -0.39316 -0.18987 0.03053  657 GLN B CA  
2708 C C   . GLN B 173 ? 0.84546 0.77838 1.19562 -0.42133 -0.17149 -0.00396 657 GLN B C   
2709 O O   . GLN B 173 ? 0.89764 0.81072 1.28429 -0.46306 -0.12759 -0.02322 657 GLN B O   
2710 C CB  . GLN B 173 ? 0.86626 0.67755 1.06246 -0.37045 -0.17366 0.06413  657 GLN B CB  
2711 C CG  . GLN B 173 ? 0.89808 0.62904 1.00511 -0.34317 -0.18161 0.08767  657 GLN B CG  
2712 C CD  . GLN B 173 ? 0.93281 0.62318 0.98110 -0.31836 -0.16192 0.10864  657 GLN B CD  
2713 O OE1 . GLN B 173 ? 1.08466 0.68826 1.05484 -0.30650 -0.13672 0.12385  657 GLN B OE1 
2714 N NE2 . GLN B 173 ? 0.88165 0.62968 0.95904 -0.30393 -0.17224 0.10840  657 GLN B NE2 
2715 N N   . VAL B 174 ? 0.78841 0.80679 1.17572 -0.39619 -0.20063 -0.01462 658 VAL B N   
2716 C CA  . VAL B 174 ? 0.77611 0.87764 1.24235 -0.40918 -0.18761 -0.04542 658 VAL B CA  
2717 C C   . VAL B 174 ? 0.74144 0.86225 1.18008 -0.37441 -0.19537 -0.01874 658 VAL B C   
2718 O O   . VAL B 174 ? 0.70910 0.83328 1.11033 -0.33432 -0.22832 -0.00267 658 VAL B O   
2719 C CB  . VAL B 174 ? 0.75305 0.95715 1.30045 -0.40373 -0.22264 -0.10193 658 VAL B CB  
2720 C CG1 . VAL B 174 ? 0.73743 1.04112 1.36604 -0.40562 -0.21652 -0.13922 658 VAL B CG1 
2721 C CG2 . VAL B 174 ? 0.79077 0.98284 1.38341 -0.44484 -0.21071 -0.13963 658 VAL B CG2 
2722 N N   . SER B 175 ? 0.81690 0.94274 1.27302 -0.39038 -0.15862 -0.01466 659 SER B N   
2723 C CA  . SER B 175 ? 0.73557 0.87205 1.16448 -0.36065 -0.16058 0.00987  659 SER B CA  
2724 C C   . SER B 175 ? 0.68963 0.92504 1.16855 -0.33300 -0.18969 -0.01539 659 SER B C   
2725 O O   . SER B 175 ? 0.68471 0.99471 1.22976 -0.33745 -0.20539 -0.05958 659 SER B O   
2726 C CB  . SER B 175 ? 0.80784 0.91284 1.23102 -0.38192 -0.10971 0.02271  659 SER B CB  
2727 O OG  . SER B 175 ? 0.86467 0.93754 1.22648 -0.34992 -0.11201 0.05609  659 SER B OG  
2728 N N   . HIS B 176 ? 0.93795 1.17329 1.38238 -0.29890 -0.19669 0.00849  660 HIS B N   
2729 C CA  . HIS B 176 ? 0.89226 1.20720 1.36676 -0.26456 -0.21705 -0.01060 660 HIS B CA  
2730 C C   . HIS B 176 ? 0.94782 1.33465 1.49424 -0.28582 -0.19561 -0.04076 660 HIS B C   
2731 O O   . HIS B 176 ? 1.01250 1.49036 1.61026 -0.26416 -0.21704 -0.07981 660 HIS B O   
2732 C CB  . HIS B 176 ? 0.81252 1.09486 1.22960 -0.22404 -0.22196 0.02214  660 HIS B CB  
2733 C CG  . HIS B 176 ? 0.86684 1.12029 1.26742 -0.23318 -0.19436 0.04461  660 HIS B CG  
2734 N ND1 . HIS B 176 ? 0.90088 1.07974 1.25468 -0.24263 -0.18176 0.06923  660 HIS B ND1 
2735 C CD2 . HIS B 176 ? 0.87484 1.16646 1.29390 -0.22523 -0.18096 0.04304  660 HIS B CD2 
2736 C CE1 . HIS B 176 ? 0.87376 1.04601 1.21648 -0.23867 -0.16266 0.08047  660 HIS B CE1 
2737 N NE2 . HIS B 176 ? 0.87784 1.11515 1.26020 -0.23127 -0.15980 0.06754  660 HIS B NE2 
2738 N N   . ARG B 177 ? 0.93762 1.28530 1.48698 -0.32346 -0.15166 -0.02755 661 ARG B N   
2739 C CA  . ARG B 177 ? 1.02937 1.44060 1.65536 -0.35051 -0.11981 -0.05930 661 ARG B CA  
2740 C C   . ARG B 177 ? 1.12448 1.57230 1.83556 -0.39673 -0.10235 -0.10958 661 ARG B C   
2741 O O   . ARG B 177 ? 1.14792 1.69026 1.95630 -0.41302 -0.09165 -0.16192 661 ARG B O   
2742 C CB  . ARG B 177 ? 1.09452 1.44139 1.68100 -0.36526 -0.07112 -0.02407 661 ARG B CB  
2743 C CG  . ARG B 177 ? 1.15707 1.46660 1.66629 -0.32219 -0.08738 0.01764  661 ARG B CG  
2744 C CD  . ARG B 177 ? 1.22556 1.60463 1.76251 -0.29815 -0.08938 0.00984  661 ARG B CD  
2745 N NE  . ARG B 177 ? 1.25858 1.73189 1.84576 -0.27197 -0.12631 -0.02549 661 ARG B NE  
2746 C CZ  . ARG B 177 ? 1.27165 1.82513 1.89957 -0.25135 -0.12978 -0.04748 661 ARG B CZ  
2747 N NH1 . ARG B 177 ? 1.30313 1.85584 1.93513 -0.26059 -0.09631 -0.03624 661 ARG B NH1 
2748 N NH2 . ARG B 177 ? 1.26195 1.89540 1.91878 -0.21379 -0.16802 -0.08210 661 ARG B NH2 
2749 N N   . GLY B 178 ? 1.22313 1.60335 1.90712 -0.41783 -0.09908 -0.10168 662 GLY B N   
2750 C CA  . GLY B 178 ? 1.25980 1.66844 2.02728 -0.46320 -0.08138 -0.15386 662 GLY B CA  
2751 C C   . GLY B 178 ? 1.34091 1.63652 2.08054 -0.51249 -0.01584 -0.13285 662 GLY B C   
2752 O O   . GLY B 178 ? 1.39375 1.69727 2.20108 -0.55464 0.02712  -0.17125 662 GLY B O   
2753 N N   . ALA B 179 ? 1.34401 1.52536 1.96534 -0.49359 -0.00789 -0.06980 663 ALA B N   
2754 C CA  . ALA B 179 ? 1.38585 1.43949 1.94447 -0.52047 0.05278  -0.04103 663 ALA B CA  
2755 C C   . ALA B 179 ? 1.33295 1.31945 1.83291 -0.51380 0.02700  -0.02738 663 ALA B C   
2756 O O   . ALA B 179 ? 1.09248 1.10142 1.55988 -0.47643 -0.03498 -0.01615 663 ALA B O   
2757 C CB  . ALA B 179 ? 1.37128 1.34462 1.82789 -0.49122 0.07902  0.01351  663 ALA B CB  
2758 N N   . LEU B 180 ? 1.48722 1.38389 1.97205 -0.55010 0.08173  -0.02868 664 LEU B N   
2759 C CA  . LEU B 180 ? 1.48443 1.30883 1.91069 -0.54539 0.06375  -0.01703 664 LEU B CA  
2760 C C   . LEU B 180 ? 1.60012 1.26696 1.89778 -0.53405 0.11671  0.03225  664 LEU B C   
2761 O O   . LEU B 180 ? 1.57561 1.17619 1.78220 -0.50200 0.08813  0.05945  664 LEU B O   
2762 C CB  . LEU B 180 ? 1.39728 1.26513 1.91764 -0.58363 0.06727  -0.07120 664 LEU B CB  
2763 C CG  . LEU B 180 ? 1.31216 1.13429 1.79502 -0.57791 0.03668  -0.07048 664 LEU B CG  
2764 C CD1 . LEU B 180 ? 1.16168 1.09986 1.73643 -0.57883 -0.01211 -0.12646 664 LEU B CD1 
2765 C CD2 . LEU B 180 ? 1.47238 1.16211 1.89153 -0.59266 0.10065  -0.05037 664 LEU B CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   497 ?   ?   ?   A . n 
A 1 2   PRO 2   498 ?   ?   ?   A . n 
A 1 3   ARG 3   499 499 ARG ARG A . n 
A 1 4   LYS 4   500 500 LYS LYS A . n 
A 1 5   ALA 5   501 501 ALA ALA A . n 
A 1 6   GLU 6   502 502 GLU GLU A . n 
A 1 7   ILE 7   503 503 ILE ILE A . n 
A 1 8   MET 8   504 504 MET MET A . n 
A 1 9   GLU 9   505 505 GLU GLU A . n 
A 1 10  SER 10  506 506 SER SER A . n 
A 1 11  ILE 11  507 507 ILE ILE A . n 
A 1 12  LYS 12  508 508 LYS LYS A . n 
A 1 13  ARG 13  509 509 ARG ARG A . n 
A 1 14  LEU 14  510 510 LEU LEU A . n 
A 1 15  TYR 15  511 511 TYR TYR A . n 
A 1 16  PRO 16  512 512 PRO PRO A . n 
A 1 17  GLY 17  513 513 GLY GLY A . n 
A 1 18  SER 18  514 514 SER SER A . n 
A 1 19  VAL 19  515 515 VAL VAL A . n 
A 1 20  TYR 20  516 516 TYR TYR A . n 
A 1 21  GLY 21  517 517 GLY GLY A . n 
A 1 22  ARG 22  518 518 ARG ARG A . n 
A 1 23  LEU 23  519 519 LEU LEU A . n 
A 1 24  ILE 24  520 520 ILE ILE A . n 
A 1 25  ASP 25  521 521 ASP ASP A . n 
A 1 26  LEU 26  522 522 LEU LEU A . n 
A 1 27  CYS 27  523 523 CYS CYS A . n 
A 1 28  GLN 28  524 524 GLN GLN A . n 
A 1 29  PRO 29  525 525 PRO PRO A . n 
A 1 30  THR 30  526 526 THR THR A . n 
A 1 31  GLN 31  527 527 GLN GLN A . n 
A 1 32  LYS 32  528 528 LYS LYS A . n 
A 1 33  LYS 33  529 529 LYS LYS A . n 
A 1 34  TYR 34  530 530 TYR TYR A . n 
A 1 35  GLN 35  531 531 GLN GLN A . n 
A 1 36  ILE 36  532 532 ILE ILE A . n 
A 1 37  ALA 37  533 533 ALA ALA A . n 
A 1 38  VAL 38  534 534 VAL VAL A . n 
A 1 39  THR 39  535 535 THR THR A . n 
A 1 40  LYS 40  536 536 LYS LYS A . n 
A 1 41  VAL 41  537 537 VAL VAL A . n 
A 1 42  LEU 42  538 538 LEU LEU A . n 
A 1 43  GLY 43  539 539 GLY GLY A . n 
A 1 44  LYS 44  540 540 LYS LYS A . n 
A 1 45  ASN 45  541 541 ASN ASN A . n 
A 1 46  MET 46  542 542 MET MET A . n 
A 1 47  ASP 47  543 543 ASP ASP A . n 
A 1 48  ALA 48  544 544 ALA ALA A . n 
A 1 49  ILE 49  545 545 ILE ILE A . n 
A 1 50  ILE 50  546 546 ILE ILE A . n 
A 1 51  VAL 51  547 547 VAL VAL A . n 
A 1 52  ASP 52  548 548 ASP ASP A . n 
A 1 53  SER 53  549 549 SER SER A . n 
A 1 54  GLU 54  550 550 GLU GLU A . n 
A 1 55  LYS 55  551 551 LYS LYS A . n 
A 1 56  THR 56  552 552 THR THR A . n 
A 1 57  GLY 57  553 553 GLY GLY A . n 
A 1 58  ARG 58  554 554 ARG ARG A . n 
A 1 59  ASP 59  555 555 ASP ASP A . n 
A 1 60  CYS 60  556 556 CYS CYS A . n 
A 1 61  ILE 61  557 557 ILE ILE A . n 
A 1 62  GLN 62  558 558 GLN GLN A . n 
A 1 63  TYR 63  559 559 TYR TYR A . n 
A 1 64  ILE 64  560 560 ILE ILE A . n 
A 1 65  LYS 65  561 561 LYS LYS A . n 
A 1 66  GLU 66  562 562 GLU GLU A . n 
A 1 67  GLN 67  563 563 GLN GLN A . n 
A 1 68  ARG 68  564 564 ARG ARG A . n 
A 1 69  GLY 69  565 565 GLY GLY A . n 
A 1 70  GLU 70  566 566 GLU GLU A . n 
A 1 71  PRO 71  567 567 PRO PRO A . n 
A 1 72  GLU 72  568 568 GLU GLU A . n 
A 1 73  THR 73  569 569 THR THR A . n 
A 1 74  PHE 74  570 570 PHE PHE A . n 
A 1 75  LEU 75  571 571 LEU LEU A . n 
A 1 76  PRO 76  572 572 PRO PRO A . n 
A 1 77  LEU 77  573 573 LEU LEU A . n 
A 1 78  ASP 78  574 574 ASP ASP A . n 
A 1 79  TYR 79  575 575 TYR TYR A . n 
A 1 80  LEU 80  576 576 LEU LEU A . n 
A 1 81  GLU 81  577 577 GLU GLU A . n 
A 1 82  VAL 82  578 578 VAL VAL A . n 
A 1 83  LYS 83  579 579 LYS LYS A . n 
A 1 84  PRO 84  580 580 PRO PRO A . n 
A 1 85  THR 85  581 581 THR THR A . n 
A 1 86  ASP 86  582 582 ASP ASP A . n 
A 1 87  GLU 87  583 583 GLU GLU A . n 
A 1 88  LYS 88  584 584 LYS LYS A . n 
A 1 89  LEU 89  585 585 LEU LEU A . n 
A 1 90  ARG 90  586 586 ARG ARG A . n 
A 1 91  GLU 91  587 587 GLU GLU A . n 
A 1 92  LEU 92  588 588 LEU LEU A . n 
A 1 93  LYS 93  589 589 LYS LYS A . n 
A 1 94  GLY 94  590 590 GLY GLY A . n 
A 1 95  ALA 95  591 591 ALA ALA A . n 
A 1 96  LYS 96  592 592 LYS LYS A . n 
A 1 97  LEU 97  593 593 LEU LEU A . n 
A 1 98  VAL 98  594 594 VAL VAL A . n 
A 1 99  ILE 99  595 595 ILE ILE A . n 
A 1 100 ASP 100 596 596 ASP ASP A . n 
A 1 101 VAL 101 597 597 VAL VAL A . n 
A 1 102 ILE 102 598 598 ILE ILE A . n 
A 1 103 ARG 103 599 599 ARG ARG A . n 
A 1 104 TYR 104 600 600 TYR TYR A . n 
A 1 105 GLU 105 601 601 GLU GLU A . n 
A 1 106 PRO 106 602 602 PRO PRO A . n 
A 1 107 PRO 107 603 603 PRO PRO A . n 
A 1 108 HIS 108 604 604 HIS HIS A . n 
A 1 109 ILE 109 605 605 ILE ILE A . n 
A 1 110 LYS 110 606 606 LYS LYS A . n 
A 1 111 LYS 111 607 607 LYS LYS A . n 
A 1 112 ALA 112 608 608 ALA ALA A . n 
A 1 113 LEU 113 609 609 LEU LEU A . n 
A 1 114 GLN 114 610 610 GLN GLN A . n 
A 1 115 TYR 115 611 611 TYR TYR A . n 
A 1 116 ALA 116 612 612 ALA ALA A . n 
A 1 117 CYS 117 613 613 CYS CYS A . n 
A 1 118 GLY 118 614 614 GLY GLY A . n 
A 1 119 ASN 119 615 615 ASN ASN A . n 
A 1 120 ALA 120 616 616 ALA ALA A . n 
A 1 121 LEU 121 617 617 LEU LEU A . n 
A 1 122 VAL 122 618 618 VAL VAL A . n 
A 1 123 CYS 123 619 619 CYS CYS A . n 
A 1 124 ASP 124 620 620 ASP ASP A . n 
A 1 125 ASN 125 621 621 ASN ASN A . n 
A 1 126 VAL 126 622 622 VAL VAL A . n 
A 1 127 GLU 127 623 623 GLU GLU A . n 
A 1 128 ASP 128 624 624 ASP ASP A . n 
A 1 129 ALA 129 625 625 ALA ALA A . n 
A 1 130 ARG 130 626 626 ARG ARG A . n 
A 1 131 ARG 131 627 627 ARG ARG A . n 
A 1 132 ILE 132 628 628 ILE ILE A . n 
A 1 133 ALA 133 629 629 ALA ALA A . n 
A 1 134 PHE 134 630 630 PHE PHE A . n 
A 1 135 GLY 135 631 631 GLY GLY A . n 
A 1 136 GLY 136 632 632 GLY GLY A . n 
A 1 137 HIS 137 633 633 HIS HIS A . n 
A 1 138 GLN 138 634 634 GLN GLN A . n 
A 1 139 ARG 139 635 635 ARG ARG A . n 
A 1 140 HIS 140 636 636 HIS HIS A . n 
A 1 141 LYS 141 637 637 LYS LYS A . n 
A 1 142 THR 142 638 638 THR THR A . n 
A 1 143 VAL 143 639 639 VAL VAL A . n 
A 1 144 ALA 144 640 640 ALA ALA A . n 
A 1 145 LEU 145 641 641 LEU LEU A . n 
A 1 146 ASP 146 642 642 ASP ASP A . n 
A 1 147 GLY 147 643 643 GLY GLY A . n 
A 1 148 THR 148 644 644 THR THR A . n 
A 1 149 LEU 149 645 645 LEU LEU A . n 
A 1 150 PHE 150 646 646 PHE PHE A . n 
A 1 151 GLN 151 647 647 GLN GLN A . n 
A 1 152 LYS 152 648 648 LYS LYS A . n 
A 1 153 SER 153 649 649 SER SER A . n 
A 1 154 GLY 154 650 650 GLY GLY A . n 
A 1 155 VAL 155 651 651 VAL VAL A . n 
A 1 156 ILE 156 652 652 ILE ILE A . n 
A 1 157 SER 157 653 653 SER SER A . n 
A 1 158 GLY 158 654 654 GLY GLY A . n 
A 1 159 GLY 159 655 655 GLY GLY A . n 
A 1 160 ALA 160 656 656 ALA ALA A . n 
A 1 161 SER 161 657 657 SER SER A . n 
A 1 162 ASP 162 658 658 ASP ASP A . n 
A 1 163 LEU 163 659 659 LEU LEU A . n 
A 1 164 LYS 164 660 660 LYS LYS A . n 
A 1 165 ALA 165 661 661 ALA ALA A . n 
A 1 166 LYS 166 662 662 LYS LYS A . n 
A 1 167 ALA 167 663 663 ALA ALA A . n 
A 1 168 ARG 168 664 664 ARG ARG A . n 
A 1 169 ARG 169 665 665 ARG ARG A . n 
A 1 170 TRP 170 666 666 TRP TRP A . n 
A 1 171 ASP 171 667 667 ASP ASP A . n 
A 1 172 GLU 172 668 668 GLU GLU A . n 
A 1 173 LYS 173 669 669 LYS LYS A . n 
A 1 174 ALA 174 670 670 ALA ALA A . n 
A 1 175 VAL 175 671 671 VAL VAL A . n 
A 1 176 ASP 176 672 672 ASP ASP A . n 
A 1 177 LYS 177 673 673 LYS LYS A . n 
A 1 178 LEU 178 674 674 LEU LEU A . n 
A 1 179 LYS 179 675 ?   ?   ?   A . n 
B 2 1   GLY 1   485 ?   ?   ?   B . n 
B 2 2   PRO 2   486 ?   ?   ?   B . n 
B 2 3   LEU 3   487 ?   ?   ?   B . n 
B 2 4   GLY 4   488 ?   ?   ?   B . n 
B 2 5   SER 5   489 ?   ?   ?   B . n 
B 2 6   GLY 6   490 ?   ?   ?   B . n 
B 2 7   ARG 7   491 ?   ?   ?   B . n 
B 2 8   PRO 8   492 ?   ?   ?   B . n 
B 2 9   LYS 9   493 ?   ?   ?   B . n 
B 2 10  GLN 10  494 ?   ?   ?   B . n 
B 2 11  GLN 11  495 ?   ?   ?   B . n 
B 2 12  LEU 12  496 ?   ?   ?   B . n 
B 2 13  LEU 13  497 ?   ?   ?   B . n 
B 2 14  ARG 14  498 ?   ?   ?   B . n 
B 2 15  ALA 15  499 ?   ?   ?   B . n 
B 2 16  ALA 16  500 500 ALA ALA B . n 
B 2 17  THR 17  501 501 THR THR B . n 
B 2 18  GLY 18  502 502 GLY GLY B . n 
B 2 19  LYS 19  503 503 LYS LYS B . n 
B 2 20  ALA 20  504 504 ALA ALA B . n 
B 2 21  ILE 21  505 505 ILE ILE B . n 
B 2 22  LEU 22  506 506 LEU LEU B . n 
B 2 23  ASN 23  507 507 ASN ASN B . n 
B 2 24  GLY 24  508 508 GLY GLY B . n 
B 2 25  ILE 25  509 509 ILE ILE B . n 
B 2 26  ASP 26  510 510 ASP ASP B . n 
B 2 27  SER 27  511 511 SER SER B . n 
B 2 28  ILE 28  512 512 ILE ILE B . n 
B 2 29  ASN 29  513 513 ASN ASN B . n 
B 2 30  LYS 30  514 514 LYS LYS B . n 
B 2 31  VAL 31  515 515 VAL VAL B . n 
B 2 32  LEU 32  516 516 LEU LEU B . n 
B 2 33  ASP 33  517 517 ASP ASP B . n 
B 2 34  HIS 34  518 518 HIS HIS B . n 
B 2 35  PHE 35  519 519 PHE PHE B . n 
B 2 36  ARG 36  520 520 ARG ARG B . n 
B 2 37  ARG 37  521 521 ARG ARG B . n 
B 2 38  LYS 38  522 522 LYS LYS B . n 
B 2 39  GLY 39  523 523 GLY GLY B . n 
B 2 40  ILE 40  524 524 ILE ILE B . n 
B 2 41  ASN 41  525 525 ASN ASN B . n 
B 2 42  GLN 42  526 526 GLN GLN B . n 
B 2 43  HIS 43  527 527 HIS HIS B . n 
B 2 44  VAL 44  528 528 VAL VAL B . n 
B 2 45  GLN 45  529 529 GLN GLN B . n 
B 2 46  ASN 46  530 530 ASN ASN B . n 
B 2 47  GLY 47  531 531 GLY GLY B . n 
B 2 48  TYR 48  532 532 TYR TYR B . n 
B 2 49  HIS 49  533 533 HIS HIS B . n 
B 2 50  GLY 50  534 534 GLY GLY B . n 
B 2 51  ILE 51  535 535 ILE ILE B . n 
B 2 52  VAL 52  536 536 VAL VAL B . n 
B 2 53  MET 53  537 537 MET MET B . n 
B 2 54  ASN 54  538 538 ASN ASN B . n 
B 2 55  ASN 55  539 539 ASN ASN B . n 
B 2 56  PHE 56  540 540 PHE PHE B . n 
B 2 57  GLU 57  541 541 GLU GLU B . n 
B 2 58  CYS 58  542 542 CYS CYS B . n 
B 2 59  GLU 59  543 543 GLU GLU B . n 
B 2 60  PRO 60  544 544 PRO PRO B . n 
B 2 61  ALA 61  545 545 ALA ALA B . n 
B 2 62  PHE 62  546 546 PHE PHE B . n 
B 2 63  TYR 63  547 547 TYR TYR B . n 
B 2 64  THR 64  548 548 THR THR B . n 
B 2 65  CYS 65  549 549 CYS CYS B . n 
B 2 66  VAL 66  550 550 VAL VAL B . n 
B 2 67  GLU 67  551 551 GLU GLU B . n 
B 2 68  VAL 68  552 552 VAL VAL B . n 
B 2 69  THR 69  553 553 THR THR B . n 
B 2 70  ALA 70  554 554 ALA ALA B . n 
B 2 71  GLY 71  555 555 GLY GLY B . n 
B 2 72  ASN 72  556 556 ASN ASN B . n 
B 2 73  ARG 73  557 557 ARG ARG B . n 
B 2 74  LEU 74  558 558 LEU LEU B . n 
B 2 75  PHE 75  559 559 PHE PHE B . n 
B 2 76  TYR 76  560 560 TYR TYR B . n 
B 2 77  HIS 77  561 561 HIS HIS B . n 
B 2 78  ILE 78  562 562 ILE ILE B . n 
B 2 79  VAL 79  563 563 VAL VAL B . n 
B 2 80  ASP 80  564 564 ASP ASP B . n 
B 2 81  SER 81  565 565 SER SER B . n 
B 2 82  ASP 82  566 566 ASP ASP B . n 
B 2 83  GLU 83  567 567 GLU GLU B . n 
B 2 84  VAL 84  568 568 VAL VAL B . n 
B 2 85  SER 85  569 569 SER SER B . n 
B 2 86  THR 86  570 570 THR THR B . n 
B 2 87  LYS 87  571 571 LYS LYS B . n 
B 2 88  ILE 88  572 572 ILE ILE B . n 
B 2 89  LEU 89  573 573 LEU LEU B . n 
B 2 90  MET 90  574 574 MET MET B . n 
B 2 91  GLU 91  575 575 GLU GLU B . n 
B 2 92  PHE 92  576 576 PHE PHE B . n 
B 2 93  ASN 93  577 577 ASN ASN B . n 
B 2 94  LYS 94  578 578 LYS LYS B . n 
B 2 95  MET 95  579 579 MET MET B . n 
B 2 96  ASN 96  580 580 ASN ASN B . n 
B 2 97  LEU 97  581 581 LEU LEU B . n 
B 2 98  PRO 98  582 582 PRO PRO B . n 
B 2 99  GLY 99  583 583 GLY GLY B . n 
B 2 100 GLU 100 584 584 GLU GLU B . n 
B 2 101 VAL 101 585 585 VAL VAL B . n 
B 2 102 THR 102 586 586 THR THR B . n 
B 2 103 PHE 103 587 587 PHE PHE B . n 
B 2 104 LEU 104 588 588 LEU LEU B . n 
B 2 105 PRO 105 589 589 PRO PRO B . n 
B 2 106 LEU 106 590 590 LEU LEU B . n 
B 2 107 ASN 107 591 591 ASN ASN B . n 
B 2 108 LYS 108 592 592 LYS LYS B . n 
B 2 109 LEU 109 593 593 LEU LEU B . n 
B 2 110 ASP 110 594 594 ASP ASP B . n 
B 2 111 VAL 111 595 595 VAL VAL B . n 
B 2 112 ARG 112 596 596 ARG ARG B . n 
B 2 113 ASP 113 597 597 ASP ASP B . n 
B 2 114 THR 114 598 598 THR THR B . n 
B 2 115 ALA 115 599 599 ALA ALA B . n 
B 2 116 TYR 116 600 600 TYR TYR B . n 
B 2 117 PRO 117 601 601 PRO PRO B . n 
B 2 118 GLU 118 602 602 GLU GLU B . n 
B 2 119 THR 119 603 603 THR THR B . n 
B 2 120 ASN 120 604 604 ASN ASN B . n 
B 2 121 ASP 121 605 605 ASP ASP B . n 
B 2 122 ALA 122 606 606 ALA ALA B . n 
B 2 123 ILE 123 607 607 ILE ILE B . n 
B 2 124 PRO 124 608 608 PRO PRO B . n 
B 2 125 MET 125 609 609 MET MET B . n 
B 2 126 ILE 126 610 610 ILE ILE B . n 
B 2 127 SER 127 611 611 SER SER B . n 
B 2 128 LYS 128 612 612 LYS LYS B . n 
B 2 129 LEU 129 613 613 LEU LEU B . n 
B 2 130 ARG 130 614 614 ARG ARG B . n 
B 2 131 TYR 131 615 615 TYR TYR B . n 
B 2 132 ASN 132 616 616 ASN ASN B . n 
B 2 133 PRO 133 617 617 PRO PRO B . n 
B 2 134 ARG 134 618 618 ARG ARG B . n 
B 2 135 PHE 135 619 619 PHE PHE B . n 
B 2 136 ASP 136 620 620 ASP ASP B . n 
B 2 137 LYS 137 621 621 LYS LYS B . n 
B 2 138 ALA 138 622 622 ALA ALA B . n 
B 2 139 PHE 139 623 623 PHE PHE B . n 
B 2 140 LYS 140 624 624 LYS LYS B . n 
B 2 141 HIS 141 625 625 HIS HIS B . n 
B 2 142 VAL 142 626 626 VAL VAL B . n 
B 2 143 PHE 143 627 627 PHE PHE B . n 
B 2 144 GLY 144 628 628 GLY GLY B . n 
B 2 145 LYS 145 629 629 LYS LYS B . n 
B 2 146 THR 146 630 630 THR THR B . n 
B 2 147 LEU 147 631 631 LEU LEU B . n 
B 2 148 ILE 148 632 632 ILE ILE B . n 
B 2 149 CYS 149 633 633 CYS CYS B . n 
B 2 150 ARG 150 634 634 ARG ARG B . n 
B 2 151 SER 151 635 635 SER SER B . n 
B 2 152 MET 152 636 636 MET MET B . n 
B 2 153 GLU 153 637 637 GLU GLU B . n 
B 2 154 VAL 154 638 638 VAL VAL B . n 
B 2 155 SER 155 639 639 SER SER B . n 
B 2 156 THR 156 640 640 THR THR B . n 
B 2 157 GLN 157 641 641 GLN GLN B . n 
B 2 158 LEU 158 642 642 LEU LEU B . n 
B 2 159 ALA 159 643 643 ALA ALA B . n 
B 2 160 ARG 160 644 644 ARG ARG B . n 
B 2 161 ALA 161 645 645 ALA ALA B . n 
B 2 162 PHE 162 646 646 PHE PHE B . n 
B 2 163 THR 163 647 647 THR THR B . n 
B 2 164 MET 164 648 648 MET MET B . n 
B 2 165 ASP 165 649 649 ASP ASP B . n 
B 2 166 CYS 166 650 650 CYS CYS B . n 
B 2 167 ILE 167 651 651 ILE ILE B . n 
B 2 168 THR 168 652 652 THR THR B . n 
B 2 169 LEU 169 653 653 LEU LEU B . n 
B 2 170 GLU 170 654 654 GLU GLU B . n 
B 2 171 GLY 171 655 655 GLY GLY B . n 
B 2 172 ASP 172 656 656 ASP ASP B . n 
B 2 173 GLN 173 657 657 GLN GLN B . n 
B 2 174 VAL 174 658 658 VAL VAL B . n 
B 2 175 SER 175 659 659 SER SER B . n 
B 2 176 HIS 176 660 660 HIS HIS B . n 
B 2 177 ARG 177 661 661 ARG ARG B . n 
B 2 178 GLY 178 662 662 GLY GLY B . n 
B 2 179 ALA 179 663 663 ALA ALA B . n 
B 2 180 LEU 180 664 664 LEU LEU B . n 
B 2 181 THR 181 665 ?   ?   ?   B . n 
B 2 182 GLY 182 666 ?   ?   ?   B . n 
B 2 183 GLY 183 667 ?   ?   ?   B . n 
B 2 184 TYR 184 668 ?   ?   ?   B . n 
B 2 185 TYR 185 669 ?   ?   ?   B . n 
B 2 186 ASP 186 670 ?   ?   ?   B . n 
B 2 187 THR 187 671 ?   ?   ?   B . n 
B 2 188 ARG 188 672 ?   ?   ?   B . n 
B 2 189 LYS 189 673 ?   ?   ?   B . n 
B 2 190 SER 190 674 ?   ?   ?   B . n 
B 2 191 ARG 191 675 ?   ?   ?   B . n 
B 2 192 LEU 192 676 ?   ?   ?   B . n 
B 2 193 GLU 193 677 ?   ?   ?   B . n 
B 2 194 LEU 194 678 ?   ?   ?   B . n 
B 2 195 GLN 195 679 ?   ?   ?   B . n 
B 2 196 LYS 196 680 ?   ?   ?   B . n 
B 2 197 ASP 197 681 ?   ?   ?   B . n 
B 2 198 VAL 198 682 ?   ?   ?   B . n 
B 2 199 ARG 199 683 ?   ?   ?   B . n 
B 2 200 LYS 200 684 ?   ?   ?   B . n 
B 2 201 ALA 201 685 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1   701 196 HOH HOH A . 
C 3 HOH 2   702 32  HOH HOH A . 
C 3 HOH 3   703 143 HOH HOH A . 
C 3 HOH 4   704 41  HOH HOH A . 
C 3 HOH 5   705 79  HOH HOH A . 
C 3 HOH 6   706 5   HOH HOH A . 
C 3 HOH 7   707 160 HOH HOH A . 
C 3 HOH 8   708 31  HOH HOH A . 
C 3 HOH 9   709 105 HOH HOH A . 
C 3 HOH 10  710 28  HOH HOH A . 
C 3 HOH 11  711 64  HOH HOH A . 
C 3 HOH 12  712 127 HOH HOH A . 
C 3 HOH 13  713 78  HOH HOH A . 
C 3 HOH 14  714 12  HOH HOH A . 
C 3 HOH 15  715 90  HOH HOH A . 
C 3 HOH 16  716 159 HOH HOH A . 
C 3 HOH 17  717 40  HOH HOH A . 
C 3 HOH 18  718 114 HOH HOH A . 
C 3 HOH 19  719 58  HOH HOH A . 
C 3 HOH 20  720 86  HOH HOH A . 
C 3 HOH 21  721 91  HOH HOH A . 
C 3 HOH 22  722 134 HOH HOH A . 
C 3 HOH 23  723 62  HOH HOH A . 
C 3 HOH 24  724 99  HOH HOH A . 
C 3 HOH 25  725 191 HOH HOH A . 
C 3 HOH 26  726 34  HOH HOH A . 
C 3 HOH 27  727 67  HOH HOH A . 
C 3 HOH 28  728 29  HOH HOH A . 
C 3 HOH 29  729 176 HOH HOH A . 
C 3 HOH 30  730 4   HOH HOH A . 
C 3 HOH 31  731 192 HOH HOH A . 
C 3 HOH 32  732 193 HOH HOH A . 
C 3 HOH 33  733 33  HOH HOH A . 
C 3 HOH 34  734 153 HOH HOH A . 
C 3 HOH 35  735 53  HOH HOH A . 
C 3 HOH 36  736 155 HOH HOH A . 
C 3 HOH 37  737 130 HOH HOH A . 
C 3 HOH 38  738 13  HOH HOH A . 
C 3 HOH 39  739 49  HOH HOH A . 
C 3 HOH 40  740 93  HOH HOH A . 
C 3 HOH 41  741 128 HOH HOH A . 
C 3 HOH 42  742 180 HOH HOH A . 
C 3 HOH 43  743 65  HOH HOH A . 
C 3 HOH 44  744 57  HOH HOH A . 
C 3 HOH 45  745 47  HOH HOH A . 
C 3 HOH 46  746 71  HOH HOH A . 
C 3 HOH 47  747 97  HOH HOH A . 
C 3 HOH 48  748 152 HOH HOH A . 
C 3 HOH 49  749 158 HOH HOH A . 
C 3 HOH 50  750 55  HOH HOH A . 
C 3 HOH 51  751 126 HOH HOH A . 
C 3 HOH 52  752 2   HOH HOH A . 
C 3 HOH 53  753 136 HOH HOH A . 
C 3 HOH 54  754 82  HOH HOH A . 
C 3 HOH 55  755 154 HOH HOH A . 
C 3 HOH 56  756 108 HOH HOH A . 
C 3 HOH 57  757 195 HOH HOH A . 
C 3 HOH 58  758 178 HOH HOH A . 
C 3 HOH 59  759 146 HOH HOH A . 
C 3 HOH 60  760 198 HOH HOH A . 
C 3 HOH 61  761 184 HOH HOH A . 
C 3 HOH 62  762 112 HOH HOH A . 
C 3 HOH 63  763 81  HOH HOH A . 
C 3 HOH 64  764 139 HOH HOH A . 
C 3 HOH 65  765 147 HOH HOH A . 
C 3 HOH 66  766 197 HOH HOH A . 
C 3 HOH 67  767 189 HOH HOH A . 
C 3 HOH 68  768 124 HOH HOH A . 
C 3 HOH 69  769 188 HOH HOH A . 
C 3 HOH 70  770 102 HOH HOH A . 
C 3 HOH 71  771 182 HOH HOH A . 
C 3 HOH 72  772 145 HOH HOH A . 
C 3 HOH 73  773 177 HOH HOH A . 
C 3 HOH 74  774 111 HOH HOH A . 
C 3 HOH 75  775 89  HOH HOH A . 
C 3 HOH 76  776 199 HOH HOH A . 
C 3 HOH 77  777 103 HOH HOH A . 
C 3 HOH 78  778 194 HOH HOH A . 
C 3 HOH 79  779 68  HOH HOH A . 
C 3 HOH 80  780 157 HOH HOH A . 
C 3 HOH 81  781 190 HOH HOH A . 
C 3 HOH 82  782 110 HOH HOH A . 
C 3 HOH 83  783 144 HOH HOH A . 
C 3 HOH 84  784 156 HOH HOH A . 
C 3 HOH 85  785 113 HOH HOH A . 
C 3 HOH 86  786 109 HOH HOH A . 
D 3 HOH 1   701 52  HOH HOH B . 
D 3 HOH 2   702 35  HOH HOH B . 
D 3 HOH 3   703 208 HOH HOH B . 
D 3 HOH 4   704 75  HOH HOH B . 
D 3 HOH 5   705 100 HOH HOH B . 
D 3 HOH 6   706 138 HOH HOH B . 
D 3 HOH 7   707 9   HOH HOH B . 
D 3 HOH 8   708 174 HOH HOH B . 
D 3 HOH 9   709 142 HOH HOH B . 
D 3 HOH 10  710 121 HOH HOH B . 
D 3 HOH 11  711 95  HOH HOH B . 
D 3 HOH 12  712 69  HOH HOH B . 
D 3 HOH 13  713 19  HOH HOH B . 
D 3 HOH 14  714 63  HOH HOH B . 
D 3 HOH 15  715 18  HOH HOH B . 
D 3 HOH 16  716 129 HOH HOH B . 
D 3 HOH 17  717 27  HOH HOH B . 
D 3 HOH 18  718 7   HOH HOH B . 
D 3 HOH 19  719 15  HOH HOH B . 
D 3 HOH 20  720 8   HOH HOH B . 
D 3 HOH 21  721 11  HOH HOH B . 
D 3 HOH 22  722 168 HOH HOH B . 
D 3 HOH 23  723 125 HOH HOH B . 
D 3 HOH 24  724 187 HOH HOH B . 
D 3 HOH 25  725 209 HOH HOH B . 
D 3 HOH 26  726 3   HOH HOH B . 
D 3 HOH 27  727 201 HOH HOH B . 
D 3 HOH 28  728 6   HOH HOH B . 
D 3 HOH 29  729 30  HOH HOH B . 
D 3 HOH 30  730 181 HOH HOH B . 
D 3 HOH 31  731 94  HOH HOH B . 
D 3 HOH 32  732 1   HOH HOH B . 
D 3 HOH 33  733 140 HOH HOH B . 
D 3 HOH 34  734 74  HOH HOH B . 
D 3 HOH 35  735 163 HOH HOH B . 
D 3 HOH 36  736 46  HOH HOH B . 
D 3 HOH 37  737 21  HOH HOH B . 
D 3 HOH 38  738 16  HOH HOH B . 
D 3 HOH 39  739 183 HOH HOH B . 
D 3 HOH 40  740 135 HOH HOH B . 
D 3 HOH 41  741 166 HOH HOH B . 
D 3 HOH 42  742 204 HOH HOH B . 
D 3 HOH 43  743 173 HOH HOH B . 
D 3 HOH 44  744 39  HOH HOH B . 
D 3 HOH 45  745 14  HOH HOH B . 
D 3 HOH 46  746 54  HOH HOH B . 
D 3 HOH 47  747 42  HOH HOH B . 
D 3 HOH 48  748 118 HOH HOH B . 
D 3 HOH 49  749 10  HOH HOH B . 
D 3 HOH 50  750 22  HOH HOH B . 
D 3 HOH 51  751 104 HOH HOH B . 
D 3 HOH 52  752 60  HOH HOH B . 
D 3 HOH 53  753 44  HOH HOH B . 
D 3 HOH 54  754 84  HOH HOH B . 
D 3 HOH 55  755 83  HOH HOH B . 
D 3 HOH 56  756 169 HOH HOH B . 
D 3 HOH 57  757 17  HOH HOH B . 
D 3 HOH 58  758 70  HOH HOH B . 
D 3 HOH 59  759 73  HOH HOH B . 
D 3 HOH 60  760 37  HOH HOH B . 
D 3 HOH 61  761 72  HOH HOH B . 
D 3 HOH 62  762 131 HOH HOH B . 
D 3 HOH 63  763 20  HOH HOH B . 
D 3 HOH 64  764 38  HOH HOH B . 
D 3 HOH 65  765 56  HOH HOH B . 
D 3 HOH 66  766 101 HOH HOH B . 
D 3 HOH 67  767 24  HOH HOH B . 
D 3 HOH 68  768 43  HOH HOH B . 
D 3 HOH 69  769 202 HOH HOH B . 
D 3 HOH 70  770 51  HOH HOH B . 
D 3 HOH 71  771 179 HOH HOH B . 
D 3 HOH 72  772 141 HOH HOH B . 
D 3 HOH 73  773 25  HOH HOH B . 
D 3 HOH 74  774 106 HOH HOH B . 
D 3 HOH 75  775 119 HOH HOH B . 
D 3 HOH 76  776 87  HOH HOH B . 
D 3 HOH 77  777 205 HOH HOH B . 
D 3 HOH 78  778 167 HOH HOH B . 
D 3 HOH 79  779 200 HOH HOH B . 
D 3 HOH 80  780 45  HOH HOH B . 
D 3 HOH 81  781 148 HOH HOH B . 
D 3 HOH 82  782 36  HOH HOH B . 
D 3 HOH 83  783 122 HOH HOH B . 
D 3 HOH 84  784 59  HOH HOH B . 
D 3 HOH 85  785 207 HOH HOH B . 
D 3 HOH 86  786 48  HOH HOH B . 
D 3 HOH 87  787 26  HOH HOH B . 
D 3 HOH 88  788 115 HOH HOH B . 
D 3 HOH 89  789 50  HOH HOH B . 
D 3 HOH 90  790 170 HOH HOH B . 
D 3 HOH 91  791 203 HOH HOH B . 
D 3 HOH 92  792 117 HOH HOH B . 
D 3 HOH 93  793 77  HOH HOH B . 
D 3 HOH 94  794 164 HOH HOH B . 
D 3 HOH 95  795 185 HOH HOH B . 
D 3 HOH 96  796 123 HOH HOH B . 
D 3 HOH 97  797 76  HOH HOH B . 
D 3 HOH 98  798 92  HOH HOH B . 
D 3 HOH 99  799 150 HOH HOH B . 
D 3 HOH 100 800 149 HOH HOH B . 
D 3 HOH 101 801 162 HOH HOH B . 
D 3 HOH 102 802 116 HOH HOH B . 
D 3 HOH 103 803 137 HOH HOH B . 
D 3 HOH 104 804 151 HOH HOH B . 
D 3 HOH 105 805 96  HOH HOH B . 
D 3 HOH 106 806 61  HOH HOH B . 
D 3 HOH 107 807 80  HOH HOH B . 
D 3 HOH 108 808 206 HOH HOH B . 
D 3 HOH 109 809 107 HOH HOH B . 
D 3 HOH 110 810 133 HOH HOH B . 
D 3 HOH 111 811 161 HOH HOH B . 
D 3 HOH 112 812 66  HOH HOH B . 
D 3 HOH 113 813 98  HOH HOH B . 
D 3 HOH 114 814 175 HOH HOH B . 
D 3 HOH 115 815 165 HOH HOH B . 
D 3 HOH 116 816 172 HOH HOH B . 
D 3 HOH 117 817 132 HOH HOH B . 
D 3 HOH 118 818 171 HOH HOH B . 
D 3 HOH 119 819 88  HOH HOH B . 
D 3 HOH 120 820 23  HOH HOH B . 
D 3 HOH 121 821 85  HOH HOH B . 
D 3 HOH 122 822 186 HOH HOH B . 
D 3 HOH 123 823 120 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 B ARG 596 ? B ARG 112 
2 1 B HOH 791 ? D HOH .   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-05-20 
2 'Structure model' 1 1 2020-05-27 
3 'Structure model' 1 2 2020-07-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
2 2 'Structure model' '_citation.title'                   
3 2 'Structure model' '_citation_author.identifier_ORCID' 
4 2 'Structure model' '_citation_author.name'             
5 3 'Structure model' '_citation.journal_volume'          
6 3 'Structure model' '_citation.page_first'              
7 3 'Structure model' '_citation.page_last'               
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' ? refined -3.83725282912 -22.7646713494 -30.9934366808  0.820622133986  ? -0.166650838957  ? 
0.0717828697127  ? 0.947644744987 ? 0.472186990922   ? 0.758586211559 ? 6.18526644391  ? 0.424312903525  ? -1.88166306254  ? 
6.91321215314  ? -2.10450413001  ? 6.24499812019  ? 0.254524991581   ? 0.233667349863   ? 0.283666238307   ? -0.273303160389 ? 
0.320336744124   ? 0.683127802739   ? -0.579199854051  ? -0.637715233224   ? -0.585904598116  ? 
2  'X-RAY DIFFRACTION' ? refined -14.0122968772 -40.0781572543 -29.7655890897  0.466209923949  ? -0.0784374721406 ? 
0.0614379821783  ? 0.6951995174   ? 0.335782714067   ? 0.385042793049 ? 1.05891506991  ? 1.24629784823   ? -1.25717048341  ? 
2.49576163932  ? -1.21642403806  ? 1.56079455261  ? -0.0612165213406 ? 0.165228407124   ? 0.0401320731183  ? -0.349633714547 ? 
0.126808747749   ? -0.0173479473339 ? -0.186189532153  ? -0.106848434216   ? -0.0614951002016 ? 
3  'X-RAY DIFFRACTION' ? refined -3.42322816355 -29.3408072802 -20.580786166   0.588124053772  ? -0.135693973538  ? 0.089960006389 
? 0.899354679583 ? 0.45390836442    ? 0.831653396126 ? 3.291524594    ? 1.23182518038   ? -0.936630960335 ? 6.95945197459  ? 
-0.16812234445  ? 2.96127292314  ? 0.275810590033   ? -0.190059578607  ? 0.376378380368   ? 0.679611285723  ? -0.183629843714  ? 
-0.0365649273023 ? -0.711963106387  ? 0.282480368719    ? -0.0851476769513 ? 
4  'X-RAY DIFFRACTION' ? refined -10.9644719121 -59.1327039885 -25.6772603453  0.505479648192  ? 0.0362754109761  ? 
0.0873733974138  ? 0.819655722271 ? 0.00814609956459 ? 0.688061511921 ? 3.93795465551  ? 3.75877429463   ? -4.24432167436  ? 
7.07541092466  ? -1.47536788146  ? 7.72794482732  ? -0.583942708933  ? 0.0687555345546  ? -1.22637646186   ? -0.424720432685 ? 
0.230845163952   ? -1.42076995654   ? 0.851715583772   ? 0.863658062693    ? 0.344647506522   ? 
5  'X-RAY DIFFRACTION' ? refined -5.34946123675 -44.0769982151 -28.4116808461  0.573217876014  ? -0.0775053588245 ? 0.194283951788 
? 0.867521317471 ? 0.302362936965   ? 0.534648768557 ? 2.0679624907   ? 0.759214454534  ? -0.790779306635 ? 2.2431431524   ? 
1.7248659194    ? 4.71685211227  ? -0.177702729725  ? 0.371240274941   ? -0.0193316465018 ? -0.98931766279  ? 0.213818239783   ? 
-0.632442103324  ? -0.429770388134  ? 0.0870137428827   ? -0.0397816629813 ? 
6  'X-RAY DIFFRACTION' ? refined -20.9218871716 -54.2994905454 -19.3460476808  0.196759499406  ? -0.0441156824394 ? 
0.0576573683482  ? 0.469961565017 ? 0.236215054007   ? 0.306336632826 ? 3.43346445176  ? 1.67997054651   ? -2.17188453658  ? 
2.34353986155  ? -1.17023884295  ? 3.33529734931  ? -0.297140492727  ? 0.236052336113   ? -0.255430214886  ? -0.323385095388 ? 
0.0843996735914  ? -0.200216573606  ? 0.41660984268    ? -0.0396928500441  ? 0.304192147144   ? 
7  'X-RAY DIFFRACTION' ? refined -24.0925925095 -37.7193399377 -29.9794945199  0.632593201126  ? -0.0495961436677 ? 
-0.0341021289514 ? 1.00078275851  ? 0.533888664097   ? 0.767382241036 ? 2.03451346568  ? 0.309679052407  ? -1.32222608553  ? 
0.366762098224 ? 0.0162858549163 ? 1.00753048253  ? 0.173943806457   ? 0.209414513003   ? 0.231299369827   ? -0.216366637313 ? 
-0.247997204438  ? -0.298648856234  ? -0.643787557655  ? 0.422246413428    ? 0.0755573449585  ? 
8  'X-RAY DIFFRACTION' ? refined -17.2298690006 -31.2536979242 -42.1288621544  1.24143687227   ? -0.100188384291  ? 
0.0613152150962  ? 1.41689330644  ? 0.655123867848   ? 1.06797375039  ? 0.260757442581 ? -0.982887999987 ? 0.724661108596  ? 
8.82317143528  ? -0.14603096296  ? 3.31960931188  ? 0.131806106947   ? 0.527325879385   ? 0.520540090732   ? -0.882901118912 ? 
-0.347831981708  ? -0.737611805441  ? -1.07183201795   ? 0.780211159634    ? 0.222009596068   ? 
9  'X-RAY DIFFRACTION' ? refined -38.9731219404 -40.0922903716 -16.4762648792  0.300085866026  ? 0.06602367372    ? 
-0.117630727641  ? 0.303609221451 ? 0.245657767338   ? 0.428591811851 ? 1.12239901404  ? -0.11021519158  ? 0.526342807062  ? 
1.14676029808  ? -0.338271635323 ? 0.905138274302 ? -0.0698120111375 ? 0.151517988846   ? 0.215665989665   ? -0.118535741204 ? 
-0.0422363021173 ? -0.0341334723641 ? -0.122386812351  ? 0.105606862272    ? 0.0898500948308  ? 
10 'X-RAY DIFFRACTION' ? refined -37.8358088216 -46.4101312684 -5.64832252784  0.0933792680199 ? 0.0253735980832  ? 
-0.0271112020555 ? 0.121914905226 ? 0.0555789771982  ? 0.302807586305 ? 4.22338424278  ? 2.63931602407   ? 3.95686157114   ? 
5.19437788495  ? 2.48245990771   ? 6.02139223336  ? -0.0618171477967 ? -0.131401289375  ? 0.508779508347   ? 0.0718164582644 ? 
-0.19120480396   ? 0.0145404278112  ? -0.238021157829  ? -0.157927509781   ? 0.229800808706   ? 
11 'X-RAY DIFFRACTION' ? refined -26.0535083818 -34.0640126375 0.0718302893115 0.426906767232  ? -0.151218137308  ? 
-0.133831160813  ? 0.260438046355 ? 0.116504535454   ? 0.716047037466 ? 1.01324819552  ? 1.12754348217   ? 0.0356521396605 ? 
1.6636908548   ? 0.846255145131  ? 1.5891512185   ? 0.0953681735161  ? -0.0279759084712 ? 0.357996098275   ? 0.0991032039475 ? 
-0.0755860900123 ? 0.275277072765   ? -0.461731292369  ? 0.194152754698    ? -0.0164115014889 ? 
12 'X-RAY DIFFRACTION' ? refined -31.9688019521 -49.2083370737 -15.5076835363  0.140710560933  ? 0.0112880416351  ? 
0.00472617631725 ? 0.280400790736 ? 0.278494152728   ? 0.275589610197 ? 0.470989213259 ? -0.33132594326  ? 0.567759524097  ? 
2.38630173395  ? -1.20039757779  ? 2.51396315405  ? -0.0141239704341 ? 0.179331837186   ? 0.132531925339   ? -0.297043569742 ? 
-0.0122552026024 ? 0.0310489518872  ? 0.00596300606549 ? -0.00728385008539 ? -0.0565010971275 ? 
13 'X-RAY DIFFRACTION' ? refined -15.4461852047 -47.2814310739 9.15132630052   0.578455684362  ? 0.0294898705082  ? 
-0.191910066447  ? 0.757880408294 ? 0.115565316799   ? 0.621873062208 ? 6.20958570549  ? 3.21143889318   ? 3.12808878781   ? 
5.39445777801  ? 6.26143076001   ? 7.37338339694  ? 0.223226239563   ? -0.613007449344  ? -0.0369354309678 ? 1.18314943487   ? 
0.187783915151   ? -1.01505461387   ? 0.866295733569   ? 0.953303720546    ? -0.416730631002  ? 
14 'X-RAY DIFFRACTION' ? refined -27.2662971179 -45.7044224378 4.17780091886   0.127014656795  ? -0.0396399850094 ? 
-0.107835286423  ? 0.144837175862 ? 0.0841597215264  ? 0.349257838469 ? 5.63305609659  ? 1.83891103517   ? -0.655701927396 ? 
2.58194045531  ? 0.759938732829  ? 1.87460200842  ? 0.0057358540171  ? -0.267055194179  ? 0.181095797982   ? 0.212869643268  ? 
-0.021413844272  ? -0.382327780073  ? -0.138540111097  ? 0.370447737953    ? -0.029132832076  ? 
15 'X-RAY DIFFRACTION' ? refined -11.556412932  -36.4305789652 7.97767130313   0.517342897244  ? -0.293942551028  ? 
-0.241862702984  ? 0.873518300888 ? 0.0478008679143  ? 1.04094855591  ? 5.7179381603   ? 1.52611075472   ? 2.12644125287   ? 
0.701977367556 ? 1.5915100796    ? 4.34804665568  ? 0.0601601259805  ? -0.649094191687  ? 0.427811890674   ? 0.266780702827  ? 
0.319667932553   ? -1.02770524163   ? -0.417384408976  ? 1.19223849041     ? -0.412521776394  ? 
16 'X-RAY DIFFRACTION' ? refined -12.141340148  -32.9255963073 1.7997376711    0.803655631678  ? -0.394059772884  ? 
-0.181687310527  ? 0.778546838182 ? 0.0100999509367  ? 1.15188635545  ? 4.60523250338  ? -5.86611085236  ? -4.11163085365  ? 
7.60590808103  ? 5.89098678182   ? 6.87418244997  ? 0.199253766525   ? -0.383067936202  ? 1.05662613794    ? -0.742248794927 ? 
0.58585599054    ? -1.68336599293   ? -1.08915657021   ? 1.39254984231     ? -0.813033438728  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 499 through 514 )
;
2  'X-RAY DIFFRACTION' 2  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 515 through 543 )
;
3  'X-RAY DIFFRACTION' 3  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 544 through 582 )
;
4  'X-RAY DIFFRACTION' 4  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 583 through 594 )
;
5  'X-RAY DIFFRACTION' 5  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 595 through 613 )
;
6  'X-RAY DIFFRACTION' 6  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 614 through 655 )
;
7  'X-RAY DIFFRACTION' 7  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 656 through 666 )
;
8  'X-RAY DIFFRACTION' 8  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 667 through 674 )
;
9  'X-RAY DIFFRACTION' 9  ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 500 through 522 )
;
10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 523 through 543 )
;
11 'X-RAY DIFFRACTION' 11 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 544 through 559 )
;
12 'X-RAY DIFFRACTION' 12 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 560 through 594 )
;
13 'X-RAY DIFFRACTION' 13 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 595 through 605 )
;
14 'X-RAY DIFFRACTION' 14 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 606 through 627 )
;
15 'X-RAY DIFFRACTION' 15 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 628 through 652 )
;
16 'X-RAY DIFFRACTION' 16 ? ? ? ? ? ? ? ? ? 
;chain 'B' and (resid 653 through 664 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.17.1_3660 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? .           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? .           4 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .           5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   CYS 
_pdbx_validate_close_contact.auth_seq_id_1    523 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    701 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 564 ? ? 64.23  -0.96  
2 1 ASP A 596 ? ? -73.01 20.96  
3 1 VAL A 671 ? ? -34.71 133.79 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       786 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.34 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 497 ? A GLY 1   
2  1 Y 1 A PRO 498 ? A PRO 2   
3  1 Y 1 A LYS 675 ? A LYS 179 
4  1 Y 1 B GLY 485 ? B GLY 1   
5  1 Y 1 B PRO 486 ? B PRO 2   
6  1 Y 1 B LEU 487 ? B LEU 3   
7  1 Y 1 B GLY 488 ? B GLY 4   
8  1 Y 1 B SER 489 ? B SER 5   
9  1 Y 1 B GLY 490 ? B GLY 6   
10 1 Y 1 B ARG 491 ? B ARG 7   
11 1 Y 1 B PRO 492 ? B PRO 8   
12 1 Y 1 B LYS 493 ? B LYS 9   
13 1 Y 1 B GLN 494 ? B GLN 10  
14 1 Y 1 B GLN 495 ? B GLN 11  
15 1 Y 1 B LEU 496 ? B LEU 12  
16 1 Y 1 B LEU 497 ? B LEU 13  
17 1 Y 1 B ARG 498 ? B ARG 14  
18 1 Y 1 B ALA 499 ? B ALA 15  
19 1 Y 1 B THR 665 ? B THR 181 
20 1 Y 1 B GLY 666 ? B GLY 182 
21 1 Y 1 B GLY 667 ? B GLY 183 
22 1 Y 1 B TYR 668 ? B TYR 184 
23 1 Y 1 B TYR 669 ? B TYR 185 
24 1 Y 1 B ASP 670 ? B ASP 186 
25 1 Y 1 B THR 671 ? B THR 187 
26 1 Y 1 B ARG 672 ? B ARG 188 
27 1 Y 1 B LYS 673 ? B LYS 189 
28 1 Y 1 B SER 674 ? B SER 190 
29 1 Y 1 B ARG 675 ? B ARG 191 
30 1 Y 1 B LEU 676 ? B LEU 192 
31 1 Y 1 B GLU 677 ? B GLU 193 
32 1 Y 1 B LEU 678 ? B LEU 194 
33 1 Y 1 B GLN 679 ? B GLN 195 
34 1 Y 1 B LYS 680 ? B LYS 196 
35 1 Y 1 B ASP 681 ? B ASP 197 
36 1 Y 1 B VAL 682 ? B VAL 198 
37 1 Y 1 B ARG 683 ? B ARG 199 
38 1 Y 1 B LYS 684 ? B LYS 200 
39 1 Y 1 B ALA 685 ? B ALA 201 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Cancer Prevention and Research Institute of Texas (CPRIT)' 'United States' ? 1 
'Welch Foundation'                                          'United States' ? 2 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
# 
_space_group.name_H-M_alt     'I 2 2 2' 
_space_group.name_Hall        'I 2 2' 
_space_group.IT_number        23 
_space_group.crystal_system   orthorhombic 
_space_group.id               1 
# 
loop_
_space_group_symop.id 
_space_group_symop.operation_xyz 
1 x,y,z               
2 x,-y,-z             
3 -x,y,-z             
4 -x,-y,z             
5 x+1/2,y+1/2,z+1/2   
6 x+1/2,-y+1/2,-z+1/2 
7 -x+1/2,y+1/2,-z+1/2 
8 -x+1/2,-y+1/2,z+1/2 
#