data_6YB9
# 
_entry.id   6YB9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.332 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6YB9         
WWPDB D_1292107321 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          6YB8 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6YB9 
_pdbx_database_status.recvd_initial_deposition_date   2020-03-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Skerlova, J.'  1 0000-0002-9579-4047 
'Unterlass, J.' 2 0000-0002-7504-8338 
'Gottmann, M.'  3 ?                   
'Homan, E.'     4 0000-0002-9057-1848 
'Helleday, T.'  5 0000-0002-7384-092X 
'Jemth, A.S.'   6 0000-0002-7550-1833 
'Stenmark, P.'  7 0000-0003-4777-3417 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            295 
_citation.language                  ? 
_citation.page_first                11656 
_citation.page_last                 11668 
_citation.title                     
'Crystal structures of human PAICS reveal substrate and product binding of an emerging cancer target.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA120.013695 
_citation.pdbx_database_id_PubMed   32571877 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Skerlova, J.'  1 ? 
primary 'Unterlass, J.' 2 ? 
primary 'Gottmann, M.'  3 ? 
primary 'Marttila, P.'  4 ? 
primary 'Homan, E.'     5 ? 
primary 'Helleday, T.'  6 ? 
primary 'Jemth, A.S.'   7 ? 
primary 'Stenmark, P.'  8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6YB9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     61.263 
_cell.length_a_esd                 ? 
_cell.length_b                     154.019 
_cell.length_b_esd                 ? 
_cell.length_c                     223.624 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6YB9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Multifunctional protein ADE2' 47135.102 2   6.3.2.6,4.1.1.21 ? ? ? 
2 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   2   ?                ? ? ? 
3 non-polymer syn 
;(2~{S})-2-[[5-azanyl-1-[(2~{R},3~{R},4~{S},5~{R})-3,4-bis(oxidanyl)-5-(phosphonooxymethyl)oxolan-2-yl]imidazol-4-yl]car bonylamino]butanedioic acid
;
454.283   2   ?                ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL 62.068    6   ?                ? ? ? 
5 non-polymer syn 'MAGNESIUM ION' 24.305    4   ?                ? ? ? 
6 water       nat water 18.015    286 ?                ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRK
CGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQT
EVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDG
IPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWS
KLRASILNTWISLKQADKKIRECNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRK
CGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQT
EVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDG
IPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWS
KLRASILNTWISLKQADKKIRECNL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   THR n 
1 4   ALA n 
1 5   GLU n 
1 6   VAL n 
1 7   LEU n 
1 8   ASN n 
1 9   ILE n 
1 10  GLY n 
1 11  LYS n 
1 12  LYS n 
1 13  LEU n 
1 14  TYR n 
1 15  GLU n 
1 16  GLY n 
1 17  LYS n 
1 18  THR n 
1 19  LYS n 
1 20  GLU n 
1 21  VAL n 
1 22  TYR n 
1 23  GLU n 
1 24  LEU n 
1 25  LEU n 
1 26  ASP n 
1 27  SER n 
1 28  PRO n 
1 29  GLY n 
1 30  LYS n 
1 31  VAL n 
1 32  LEU n 
1 33  LEU n 
1 34  GLN n 
1 35  SER n 
1 36  LYS n 
1 37  ASP n 
1 38  GLN n 
1 39  ILE n 
1 40  THR n 
1 41  ALA n 
1 42  GLY n 
1 43  ASN n 
1 44  ALA n 
1 45  ALA n 
1 46  ARG n 
1 47  LYS n 
1 48  ASN n 
1 49  HIS n 
1 50  LEU n 
1 51  GLU n 
1 52  GLY n 
1 53  LYS n 
1 54  ALA n 
1 55  ALA n 
1 56  ILE n 
1 57  SER n 
1 58  ASN n 
1 59  LYS n 
1 60  ILE n 
1 61  THR n 
1 62  SER n 
1 63  CYS n 
1 64  ILE n 
1 65  PHE n 
1 66  GLN n 
1 67  LEU n 
1 68  LEU n 
1 69  GLN n 
1 70  GLU n 
1 71  ALA n 
1 72  GLY n 
1 73  ILE n 
1 74  LYS n 
1 75  THR n 
1 76  ALA n 
1 77  PHE n 
1 78  THR n 
1 79  ARG n 
1 80  LYS n 
1 81  CYS n 
1 82  GLY n 
1 83  GLU n 
1 84  THR n 
1 85  ALA n 
1 86  PHE n 
1 87  ILE n 
1 88  ALA n 
1 89  PRO n 
1 90  GLN n 
1 91  CYS n 
1 92  GLU n 
1 93  MET n 
1 94  ILE n 
1 95  PRO n 
1 96  ILE n 
1 97  GLU n 
1 98  TRP n 
1 99  VAL n 
1 100 CYS n 
1 101 ARG n 
1 102 ARG n 
1 103 ILE n 
1 104 ALA n 
1 105 THR n 
1 106 GLY n 
1 107 SER n 
1 108 PHE n 
1 109 LEU n 
1 110 LYS n 
1 111 ARG n 
1 112 ASN n 
1 113 PRO n 
1 114 GLY n 
1 115 VAL n 
1 116 LYS n 
1 117 GLU n 
1 118 GLY n 
1 119 TYR n 
1 120 LYS n 
1 121 PHE n 
1 122 TYR n 
1 123 PRO n 
1 124 PRO n 
1 125 LYS n 
1 126 VAL n 
1 127 GLU n 
1 128 LEU n 
1 129 PHE n 
1 130 PHE n 
1 131 LYS n 
1 132 ASP n 
1 133 ASP n 
1 134 ALA n 
1 135 ASN n 
1 136 ASN n 
1 137 ASP n 
1 138 PRO n 
1 139 GLN n 
1 140 TRP n 
1 141 SER n 
1 142 GLU n 
1 143 GLU n 
1 144 GLN n 
1 145 LEU n 
1 146 ILE n 
1 147 ALA n 
1 148 ALA n 
1 149 LYS n 
1 150 PHE n 
1 151 CYS n 
1 152 PHE n 
1 153 ALA n 
1 154 GLY n 
1 155 LEU n 
1 156 LEU n 
1 157 ILE n 
1 158 GLY n 
1 159 GLN n 
1 160 THR n 
1 161 GLU n 
1 162 VAL n 
1 163 ASP n 
1 164 ILE n 
1 165 MET n 
1 166 SER n 
1 167 HIS n 
1 168 ALA n 
1 169 THR n 
1 170 GLN n 
1 171 ALA n 
1 172 ILE n 
1 173 PHE n 
1 174 GLU n 
1 175 ILE n 
1 176 LEU n 
1 177 GLU n 
1 178 LYS n 
1 179 SER n 
1 180 TRP n 
1 181 LEU n 
1 182 PRO n 
1 183 GLN n 
1 184 ASN n 
1 185 CYS n 
1 186 THR n 
1 187 LEU n 
1 188 VAL n 
1 189 ASP n 
1 190 MET n 
1 191 LYS n 
1 192 ILE n 
1 193 GLU n 
1 194 PHE n 
1 195 GLY n 
1 196 VAL n 
1 197 ASP n 
1 198 VAL n 
1 199 THR n 
1 200 THR n 
1 201 LYS n 
1 202 GLU n 
1 203 ILE n 
1 204 VAL n 
1 205 LEU n 
1 206 ALA n 
1 207 ASP n 
1 208 VAL n 
1 209 ILE n 
1 210 ASP n 
1 211 ASN n 
1 212 ASP n 
1 213 SER n 
1 214 TRP n 
1 215 ARG n 
1 216 LEU n 
1 217 TRP n 
1 218 PRO n 
1 219 SER n 
1 220 GLY n 
1 221 ASP n 
1 222 ARG n 
1 223 SER n 
1 224 GLN n 
1 225 GLN n 
1 226 LYS n 
1 227 ASP n 
1 228 LYS n 
1 229 GLN n 
1 230 SER n 
1 231 TYR n 
1 232 ARG n 
1 233 ASP n 
1 234 LEU n 
1 235 LYS n 
1 236 GLU n 
1 237 VAL n 
1 238 THR n 
1 239 PRO n 
1 240 GLU n 
1 241 GLY n 
1 242 LEU n 
1 243 GLN n 
1 244 MET n 
1 245 VAL n 
1 246 LYS n 
1 247 LYS n 
1 248 ASN n 
1 249 PHE n 
1 250 GLU n 
1 251 TRP n 
1 252 VAL n 
1 253 ALA n 
1 254 GLU n 
1 255 ARG n 
1 256 VAL n 
1 257 GLU n 
1 258 LEU n 
1 259 LEU n 
1 260 LEU n 
1 261 LYS n 
1 262 SER n 
1 263 GLU n 
1 264 SER n 
1 265 GLN n 
1 266 CYS n 
1 267 ARG n 
1 268 VAL n 
1 269 VAL n 
1 270 VAL n 
1 271 LEU n 
1 272 MET n 
1 273 GLY n 
1 274 SER n 
1 275 THR n 
1 276 SER n 
1 277 ASP n 
1 278 LEU n 
1 279 GLY n 
1 280 HIS n 
1 281 CYS n 
1 282 GLU n 
1 283 LYS n 
1 284 ILE n 
1 285 LYS n 
1 286 LYS n 
1 287 ALA n 
1 288 CYS n 
1 289 GLY n 
1 290 ASN n 
1 291 PHE n 
1 292 GLY n 
1 293 ILE n 
1 294 PRO n 
1 295 CYS n 
1 296 GLU n 
1 297 LEU n 
1 298 ARG n 
1 299 VAL n 
1 300 THR n 
1 301 SER n 
1 302 ALA n 
1 303 HIS n 
1 304 LYS n 
1 305 GLY n 
1 306 PRO n 
1 307 ASP n 
1 308 GLU n 
1 309 THR n 
1 310 LEU n 
1 311 ARG n 
1 312 ILE n 
1 313 LYS n 
1 314 ALA n 
1 315 GLU n 
1 316 TYR n 
1 317 GLU n 
1 318 GLY n 
1 319 ASP n 
1 320 GLY n 
1 321 ILE n 
1 322 PRO n 
1 323 THR n 
1 324 VAL n 
1 325 PHE n 
1 326 VAL n 
1 327 ALA n 
1 328 VAL n 
1 329 ALA n 
1 330 GLY n 
1 331 ARG n 
1 332 SER n 
1 333 ASN n 
1 334 GLY n 
1 335 LEU n 
1 336 GLY n 
1 337 PRO n 
1 338 VAL n 
1 339 MET n 
1 340 SER n 
1 341 GLY n 
1 342 ASN n 
1 343 THR n 
1 344 ALA n 
1 345 TYR n 
1 346 PRO n 
1 347 VAL n 
1 348 ILE n 
1 349 SER n 
1 350 CYS n 
1 351 PRO n 
1 352 PRO n 
1 353 LEU n 
1 354 THR n 
1 355 PRO n 
1 356 ASP n 
1 357 TRP n 
1 358 GLY n 
1 359 VAL n 
1 360 GLN n 
1 361 ASP n 
1 362 VAL n 
1 363 TRP n 
1 364 SER n 
1 365 SER n 
1 366 LEU n 
1 367 ARG n 
1 368 LEU n 
1 369 PRO n 
1 370 SER n 
1 371 GLY n 
1 372 LEU n 
1 373 GLY n 
1 374 CYS n 
1 375 SER n 
1 376 THR n 
1 377 VAL n 
1 378 LEU n 
1 379 SER n 
1 380 PRO n 
1 381 GLU n 
1 382 GLY n 
1 383 SER n 
1 384 ALA n 
1 385 GLN n 
1 386 PHE n 
1 387 ALA n 
1 388 ALA n 
1 389 GLN n 
1 390 ILE n 
1 391 PHE n 
1 392 GLY n 
1 393 LEU n 
1 394 SER n 
1 395 ASN n 
1 396 HIS n 
1 397 LEU n 
1 398 VAL n 
1 399 TRP n 
1 400 SER n 
1 401 LYS n 
1 402 LEU n 
1 403 ARG n 
1 404 ALA n 
1 405 SER n 
1 406 ILE n 
1 407 LEU n 
1 408 ASN n 
1 409 THR n 
1 410 TRP n 
1 411 ILE n 
1 412 SER n 
1 413 LEU n 
1 414 LYS n 
1 415 GLN n 
1 416 ALA n 
1 417 ASP n 
1 418 LYS n 
1 419 LYS n 
1 420 ILE n 
1 421 ARG n 
1 422 GLU n 
1 423 CYS n 
1 424 ASN n 
1 425 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   425 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PAICS, ADE2, AIRC, PAIS' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PUR6_HUMAN 
_struct_ref.pdbx_db_accession          P22234 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQEAGIKTAFTRK
CGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQT
EVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPE
GLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDG
IPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWS
KLRASILNTWISLKQADKKIRECNL
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6YB9 A 1 ? 425 ? P22234 1 ? 425 ? 1 425 
2 1 6YB9 B 1 ? 425 ? P22234 1 ? 425 ? 1 425 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ?                 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE ?                 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE ?                 'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2'          62.068  
GLN 'L-peptide linking' y GLUTAMINE ?                 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ?                 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ?                 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ?                 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ?                 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ?                 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ?                 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                 'Mg 2'              24.305  
OK8 non-polymer         . 
;(2~{S})-2-[[5-azanyl-1-[(2~{R},3~{R},4~{S},5~{R})-3,4-bis(oxidanyl)-5-(phosphonooxymethyl)oxolan-2-yl]imidazol-4-yl]car bonylamino]butanedioic acid
;
SAICAR            'C13 H19 N4 O12 P'  454.283 
PHE 'L-peptide linking' y PHENYLALANINE ?                 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ?                 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ?                 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ?                 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ?                 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ?                 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6YB9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.80 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.04 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;6 mg/ml PAICS with 5 mM SAICAR, 5 mM AMP-PNP, and 10 mM MgCl2; 0.1 M MES/imidazole pH 6.5, 10% w/v PEG 8000, 20% v/v ethylene glycol, 0.02 M sodium formate, 0.02 M ammonium acetate, 0.02 M trisodium citrate, 0.02 M sodium potassium L-tartrate, and 0.02 M sodium oxamate
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-02-15 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9686 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9686 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            39.747 
_reflns.entry_id                         6YB9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.4060 
_reflns.d_resolution_low                 47.330 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       41224 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.876 
_reflns.pdbx_Rmerge_I_obs                0.336 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.160 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.987 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.353 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.966 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.4060 2.550  ? 1.820  ? ? ? ? 6531 98.700 ? ? ? ? 1.049 ? ? ? ? ? ? ? ? 10.863 ? ? ? ? 1.100 ? ? 1 1 0.724 ? ? 
2.550  2.730  ? 2.400  ? ? ? ? 6235 99.900 ? ? ? ? 0.824 ? ? ? ? ? ? ? ? 10.928 ? ? ? ? 0.864 ? ? 2 1 0.834 ? ? 
2.730  2.940  ? 3.280  ? ? ? ? 5793 99.900 ? ? ? ? 0.615 ? ? ? ? ? ? ? ? 10.831 ? ? ? ? 0.645 ? ? 3 1 0.886 ? ? 
2.940  3.220  ? 4.350  ? ? ? ? 5391 99.800 ? ? ? ? 0.458 ? ? ? ? ? ? ? ? 10.828 ? ? ? ? 0.481 ? ? 4 1 0.922 ? ? 
3.220  3.600  ? 6.260  ? ? ? ? 4861 99.700 ? ? ? ? 0.336 ? ? ? ? ? ? ? ? 11.071 ? ? ? ? 0.352 ? ? 5 1 0.959 ? ? 
3.600  4.160  ? 8.310  ? ? ? ? 4289 99.100 ? ? ? ? 0.270 ? ? ? ? ? ? ? ? 11.058 ? ? ? ? 0.283 ? ? 6 1 0.951 ? ? 
4.160  5.080  ? 9.530  ? ? ? ? 3649 98.500 ? ? ? ? 0.247 ? ? ? ? ? ? ? ? 10.948 ? ? ? ? 0.259 ? ? 7 1 0.959 ? ? 
5.080  7.140  ? 8.680  ? ? ? ? 2831 97.400 ? ? ? ? 0.250 ? ? ? ? ? ? ? ? 10.726 ? ? ? ? 0.263 ? ? 8 1 0.954 ? ? 
7.140  47.330 ? 10.840 ? ? ? ? 1644 94.100 ? ? ? ? 0.214 ? ? ? ? ? ? ? ? 10.102 ? ? ? ? 0.225 ? ? 9 1 0.963 ? ? 
# 
_refine.aniso_B[1][1]                            -0.1900 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            2.7800 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -2.5900 
_refine.B_iso_max                                144.470 
_refine.B_iso_mean                               39.1670 
_refine.B_iso_min                                19.630 
_refine.correlation_coeff_Fo_to_Fc               0.9560 
_refine.correlation_coeff_Fo_to_Fc_free          0.9190 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6YB9 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.406 
_refine.ls_d_res_low                             47.3300 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     39161 
_refine.ls_number_reflns_R_free                  2061 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.0200 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1796 
_refine.ls_R_factor_R_free                       0.2293 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1770 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2h31 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.3410 
_refine.pdbx_overall_ESU_R_Free                  0.2370 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.3412 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.406 
_refine_hist.d_res_low                        47.3300 
_refine_hist.number_atoms_solvent             286 
_refine_hist.number_atoms_total               6964 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       838 
_refine_hist.pdbx_B_iso_mean_ligand           48.59 
_refine_hist.pdbx_B_iso_mean_solvent          38.72 
_refine_hist.pdbx_number_atoms_protein        6528 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         150 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.012  0.013  6808  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.035  0.017  6374  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.585  1.651  9220  ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 2.328  1.581  14868 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 6.270  5.000  836   ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 34.630 23.419 310   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 16.315 15.000 1208  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 14.615 15.000 32    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.072  0.200  894   ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.007  0.020  7436  ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.011  0.020  1320  ? r_gen_planes_other     ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1 ? ? 0.070 ? 0.050 1 'interatomic distance' ? A 12954 ? ? 1 
'X-RAY DIFFRACTION' 2 ? ? 0.070 ? 0.050 2 'interatomic distance' ? B 12954 ? ? 1 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.406 
_refine_ls_shell.d_res_low                        2.4680 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             146 
_refine_ls_shell.number_reflns_R_work             2788 
_refine_ls_shell.percent_reflns_obs               97.2200 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3360 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.2790 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_R_complete                  ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 0 0 A 7 A 425 ? ? ? ? ? ? ? ? ? 
1 2 0 0 B 7 B 425 ? ? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     6YB9 
_struct.title                        'Human octameric PAICS in complex with SAICAR, AMP-PNP, and magnesium' 
_struct.pdbx_descriptor              'Multifunctional protein ADE2 (E.C.6.3.2.6,4.1.1.21)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6YB9 
_struct_keywords.text            'de novo purine biosynthesis, nucleotide metabolism, cancer target, BIOSYNTHETIC PROTEIN' 
_struct_keywords.pdbx_keywords   'BIOSYNTHETIC PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 4 ? 
L N N 2 ? 
M N N 3 ? 
N N N 4 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 6 ? 
R N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 52  ? GLY A 72  ? GLY A 52  GLY A 72  1 ? 21 
HELX_P HELX_P2  AA2 GLY A 106 ? ASN A 112 ? GLY A 106 ASN A 112 1 ? 7  
HELX_P HELX_P3  AA3 ASP A 132 ? ASN A 136 ? ASP A 132 ASN A 136 5 ? 5  
HELX_P HELX_P4  AA4 SER A 141 ? LYS A 149 ? SER A 141 LYS A 149 1 ? 9  
HELX_P HELX_P5  AA5 GLY A 158 ? LEU A 181 ? GLY A 158 LEU A 181 1 ? 24 
HELX_P HELX_P6  AA6 GLY A 220 ? GLN A 225 ? GLY A 220 GLN A 225 5 ? 6  
HELX_P HELX_P7  AA7 LYS A 228 ? ASP A 233 ? LYS A 228 ASP A 233 1 ? 6  
HELX_P HELX_P8  AA8 THR A 238 ? VAL A 256 ? THR A 238 VAL A 256 1 ? 19 
HELX_P HELX_P9  AA9 GLU A 257 ? LYS A 261 ? GLU A 257 LYS A 261 5 ? 5  
HELX_P HELX_P10 AB1 SER A 274 ? SER A 276 ? SER A 274 SER A 276 5 ? 3  
HELX_P HELX_P11 AB2 ASP A 277 ? ASN A 290 ? ASP A 277 ASN A 290 1 ? 14 
HELX_P HELX_P12 AB3 GLY A 305 ? GLY A 318 ? GLY A 305 GLY A 318 1 ? 14 
HELX_P HELX_P13 AB4 GLY A 334 ? THR A 343 ? GLY A 334 THR A 343 1 ? 10 
HELX_P HELX_P14 AB5 TRP A 357 ? VAL A 362 ? TRP A 357 VAL A 362 1 ? 6  
HELX_P HELX_P15 AB6 VAL A 362 ? ARG A 367 ? VAL A 362 ARG A 367 1 ? 6  
HELX_P HELX_P16 AB7 SER A 379 ? LEU A 393 ? SER A 379 LEU A 393 1 ? 15 
HELX_P HELX_P17 AB8 ASN A 395 ? CYS A 423 ? ASN A 395 CYS A 423 1 ? 29 
HELX_P HELX_P18 AB9 GLY B 52  ? GLY B 72  ? GLY B 52  GLY B 72  1 ? 21 
HELX_P HELX_P19 AC1 GLY B 106 ? ASN B 112 ? GLY B 106 ASN B 112 1 ? 7  
HELX_P HELX_P20 AC2 SER B 141 ? ALA B 148 ? SER B 141 ALA B 148 1 ? 8  
HELX_P HELX_P21 AC3 GLY B 158 ? LEU B 181 ? GLY B 158 LEU B 181 1 ? 24 
HELX_P HELX_P22 AC4 GLY B 220 ? GLN B 225 ? GLY B 220 GLN B 225 5 ? 6  
HELX_P HELX_P23 AC5 LYS B 228 ? ASP B 233 ? LYS B 228 ASP B 233 1 ? 6  
HELX_P HELX_P24 AC6 THR B 238 ? VAL B 256 ? THR B 238 VAL B 256 1 ? 19 
HELX_P HELX_P25 AC7 GLU B 257 ? LYS B 261 ? GLU B 257 LYS B 261 5 ? 5  
HELX_P HELX_P26 AC8 SER B 274 ? SER B 276 ? SER B 274 SER B 276 5 ? 3  
HELX_P HELX_P27 AC9 ASP B 277 ? ASN B 290 ? ASP B 277 ASN B 290 1 ? 14 
HELX_P HELX_P28 AD1 GLY B 305 ? GLY B 318 ? GLY B 305 GLY B 318 1 ? 14 
HELX_P HELX_P29 AD2 GLY B 334 ? THR B 343 ? GLY B 334 THR B 343 1 ? 10 
HELX_P HELX_P30 AD3 TRP B 357 ? VAL B 362 ? TRP B 357 VAL B 362 1 ? 6  
HELX_P HELX_P31 AD4 VAL B 362 ? ARG B 367 ? VAL B 362 ARG B 367 1 ? 6  
HELX_P HELX_P32 AD5 SER B 379 ? LEU B 393 ? SER B 379 LEU B 393 1 ? 15 
HELX_P HELX_P33 AD6 ASN B 395 ? CYS B 423 ? ASN B 395 CYS B 423 1 ? 29 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A GLU 97  OE2 ? ? ? 1_555 J MG  . MG ? ? A GLU 97  A MG  508 1_555 ? ? ? ? ? ? ? 2.147 ? ? 
metalc2  metalc ? ? A ASP 137 OD2 ? ? ? 1_555 J MG  . MG ? ? A ASP 137 A MG  508 1_555 ? ? ? ? ? ? ? 2.966 ? ? 
metalc3  metalc ? ? C ANP .   O2B ? ? ? 1_555 I MG  . MG ? ? A ANP 501 A MG  507 1_555 ? ? ? ? ? ? ? 2.234 ? ? 
metalc4  metalc ? ? C ANP .   O2A ? ? ? 1_555 I MG  . MG ? ? A ANP 501 A MG  507 1_555 ? ? ? ? ? ? ? 2.865 ? ? 
metalc5  metalc ? ? D OK8 .   O11 ? ? ? 1_555 J MG  . MG ? ? A OK8 502 A MG  508 1_555 ? ? ? ? ? ? ? 2.996 ? ? 
metalc6  metalc ? ? B GLU 97  OE2 ? ? ? 1_555 P MG  . MG ? ? B GLU 97  B MG  706 1_555 ? ? ? ? ? ? ? 2.125 ? ? 
metalc7  metalc ? ? B ASP 137 OD2 ? ? ? 1_555 P MG  . MG ? ? B ASP 137 B MG  706 1_555 ? ? ? ? ? ? ? 2.875 ? ? 
metalc8  metalc ? ? L ANP .   O2B ? ? ? 1_555 O MG  . MG ? ? B ANP 702 B MG  705 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc9  metalc ? ? L ANP .   O2A ? ? ? 1_555 O MG  . MG ? ? B ANP 702 B MG  705 1_555 ? ? ? ? ? ? ? 2.649 ? ? 
metalc10 metalc ? ? M OK8 .   O11 ? ? ? 1_555 P MG  . MG ? ? B OK8 703 B MG  706 1_555 ? ? ? ? ? ? ? 2.775 ? ? 
metalc11 metalc ? ? O MG  .   MG  ? ? ? 1_555 R HOH . O  ? ? B MG  705 B HOH 826 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc12 metalc ? ? P MG  .   MG  ? ? ? 1_555 R HOH . O  ? ? B MG  706 B HOH 925 1_555 ? ? ? ? ? ? ? 2.959 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 122 A . ? TYR 122 A PRO 123 A ? PRO 123 A 1 -1.26 
2 TYR 122 B . ? TYR 122 B PRO 123 B ? PRO 123 B 1 -2.16 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 3 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 5 ? 
AA8 ? 2 ? 
AA9 ? 3 ? 
AB1 ? 5 ? 
AB2 ? 2 ? 
AB3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 9   ? GLU A 15  ? ILE A 9   GLU A 15  
AA1 2 LYS A 19  ? LEU A 24  ? LYS A 19  LEU A 24  
AA1 3 LYS A 30  ? SER A 35  ? LYS A 30  SER A 35  
AA1 4 ALA A 85  ? PRO A 89  ? ALA A 85  PRO A 89  
AA1 5 ARG A 79  ? LYS A 80  ? ARG A 79  LYS A 80  
AA2 1 GLN A 38  ? THR A 40  ? GLN A 38  THR A 40  
AA2 2 LYS A 47  ? HIS A 49  ? LYS A 47  HIS A 49  
AA3 1 CYS A 91  ? MET A 93  ? CYS A 91  MET A 93  
AA3 2 CYS A 185 ? ASP A 197 ? CYS A 185 ASP A 197 
AA3 3 ILE A 203 ? ALA A 206 ? ILE A 203 ALA A 206 
AA4 1 GLN A 139 ? TRP A 140 ? GLN A 139 TRP A 140 
AA4 2 LYS A 120 ? PHE A 130 ? LYS A 120 PHE A 130 
AA4 3 ILE A 96  ? ILE A 103 ? ILE A 96  ILE A 103 
AA4 4 CYS A 185 ? ASP A 197 ? CYS A 185 ASP A 197 
AA4 5 TRP A 214 ? PRO A 218 ? TRP A 214 PRO A 218 
AA5 1 CYS A 151 ? PHE A 152 ? CYS A 151 PHE A 152 
AA5 2 LEU A 155 ? LEU A 156 ? LEU A 155 LEU A 156 
AA6 1 CYS A 295 ? VAL A 299 ? CYS A 295 VAL A 299 
AA6 2 ARG A 267 ? MET A 272 ? ARG A 267 MET A 272 
AA6 3 THR A 323 ? VAL A 328 ? THR A 323 VAL A 328 
AA6 4 VAL A 347 ? SER A 349 ? VAL A 347 SER A 349 
AA6 5 SER A 375 ? THR A 376 ? SER A 375 THR A 376 
AA7 1 ILE B 9   ? GLU B 15  ? ILE B 9   GLU B 15  
AA7 2 LYS B 19  ? LEU B 24  ? LYS B 19  LEU B 24  
AA7 3 LYS B 30  ? SER B 35  ? LYS B 30  SER B 35  
AA7 4 ALA B 85  ? PRO B 89  ? ALA B 85  PRO B 89  
AA7 5 ARG B 79  ? LYS B 80  ? ARG B 79  LYS B 80  
AA8 1 GLN B 38  ? ALA B 41  ? GLN B 38  ALA B 41  
AA8 2 ARG B 46  ? HIS B 49  ? ARG B 46  HIS B 49  
AA9 1 CYS B 91  ? MET B 93  ? CYS B 91  MET B 93  
AA9 2 PHE B 194 ? ASP B 197 ? PHE B 194 ASP B 197 
AA9 3 ILE B 203 ? LEU B 205 ? ILE B 203 LEU B 205 
AB1 1 GLN B 139 ? TRP B 140 ? GLN B 139 TRP B 140 
AB1 2 LYS B 120 ? PHE B 130 ? LYS B 120 PHE B 130 
AB1 3 ILE B 96  ? ILE B 103 ? ILE B 96  ILE B 103 
AB1 4 CYS B 185 ? ILE B 192 ? CYS B 185 ILE B 192 
AB1 5 TRP B 214 ? PRO B 218 ? TRP B 214 PRO B 218 
AB2 1 CYS B 151 ? PHE B 152 ? CYS B 151 PHE B 152 
AB2 2 LEU B 155 ? LEU B 156 ? LEU B 155 LEU B 156 
AB3 1 CYS B 295 ? VAL B 299 ? CYS B 295 VAL B 299 
AB3 2 ARG B 267 ? MET B 272 ? ARG B 267 MET B 272 
AB3 3 THR B 323 ? VAL B 328 ? THR B 323 VAL B 328 
AB3 4 VAL B 347 ? SER B 349 ? VAL B 347 SER B 349 
AB3 5 SER B 375 ? THR B 376 ? SER B 375 THR B 376 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLY A 10  ? N GLY A 10  O GLU A 23  ? O GLU A 23  
AA1 2 3 N GLU A 20  ? N GLU A 20  O GLN A 34  ? O GLN A 34  
AA1 3 4 N VAL A 31  ? N VAL A 31  O ALA A 88  ? O ALA A 88  
AA1 4 5 O ILE A 87  ? O ILE A 87  N ARG A 79  ? N ARG A 79  
AA2 1 2 N ILE A 39  ? N ILE A 39  O ASN A 48  ? O ASN A 48  
AA3 1 2 N GLU A 92  ? N GLU A 92  O VAL A 196 ? O VAL A 196 
AA3 2 3 N GLY A 195 ? N GLY A 195 O VAL A 204 ? O VAL A 204 
AA4 1 2 O TRP A 140 ? O TRP A 140 N LEU A 128 ? N LEU A 128 
AA4 2 3 O PHE A 129 ? O PHE A 129 N GLU A 97  ? N GLU A 97  
AA4 3 4 N ARG A 102 ? N ARG A 102 O VAL A 188 ? O VAL A 188 
AA4 4 5 N THR A 186 ? N THR A 186 O TRP A 217 ? O TRP A 217 
AA5 1 2 N PHE A 152 ? N PHE A 152 O LEU A 155 ? O LEU A 155 
AA6 1 2 O GLU A 296 ? O GLU A 296 N VAL A 270 ? N VAL A 270 
AA6 2 3 N LEU A 271 ? N LEU A 271 O VAL A 328 ? O VAL A 328 
AA6 3 4 N ALA A 327 ? N ALA A 327 O ILE A 348 ? O ILE A 348 
AA6 4 5 N SER A 349 ? N SER A 349 O SER A 375 ? O SER A 375 
AA7 1 2 N GLY B 10  ? N GLY B 10  O GLU B 23  ? O GLU B 23  
AA7 2 3 N GLU B 20  ? N GLU B 20  O GLN B 34  ? O GLN B 34  
AA7 3 4 N VAL B 31  ? N VAL B 31  O ALA B 88  ? O ALA B 88  
AA7 4 5 O ILE B 87  ? O ILE B 87  N ARG B 79  ? N ARG B 79  
AA8 1 2 N ILE B 39  ? N ILE B 39  O ASN B 48  ? O ASN B 48  
AA9 1 2 N GLU B 92  ? N GLU B 92  O VAL B 196 ? O VAL B 196 
AA9 2 3 N GLY B 195 ? N GLY B 195 O VAL B 204 ? O VAL B 204 
AB1 1 2 O TRP B 140 ? O TRP B 140 N LEU B 128 ? N LEU B 128 
AB1 2 3 O PHE B 129 ? O PHE B 129 N GLU B 97  ? N GLU B 97  
AB1 3 4 N ARG B 102 ? N ARG B 102 O VAL B 188 ? O VAL B 188 
AB1 4 5 N THR B 186 ? N THR B 186 O TRP B 217 ? O TRP B 217 
AB2 1 2 N PHE B 152 ? N PHE B 152 O LEU B 155 ? O LEU B 155 
AB3 1 2 O GLU B 296 ? O GLU B 296 N VAL B 270 ? N VAL B 270 
AB3 2 3 N LEU B 271 ? N LEU B 271 O VAL B 328 ? O VAL B 328 
AB3 3 4 N ALA B 327 ? N ALA B 327 O ILE B 348 ? O ILE B 348 
AB3 4 5 N SER B 349 ? N SER B 349 O SER B 375 ? O SER B 375 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ANP 501 ? 17 'binding site for residue ANP A 501' 
AC2 Software A OK8 502 ? 20 'binding site for residue OK8 A 502' 
AC3 Software A EDO 503 ? 6  'binding site for residue EDO A 503' 
AC4 Software A EDO 504 ? 7  'binding site for residue EDO A 504' 
AC5 Software A EDO 505 ? 6  'binding site for residue EDO A 505' 
AC6 Software A EDO 506 ? 7  'binding site for residue EDO A 506' 
AC7 Software A MG  507 ? 2  'binding site for residue MG A 507'  
AC8 Software A MG  508 ? 3  'binding site for residue MG A 508'  
AC9 Software B EDO 701 ? 6  'binding site for residue EDO B 701' 
AD1 Software B ANP 702 ? 17 'binding site for residue ANP B 702' 
AD2 Software B OK8 703 ? 19 'binding site for residue OK8 B 703' 
AD3 Software B EDO 704 ? 3  'binding site for residue EDO B 704' 
AD4 Software B MG  705 ? 2  'binding site for residue MG B 705'  
AD5 Software B MG  706 ? 4  'binding site for residue MG B 706'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 17 TYR A 14  ? TYR A 14  . ? 1_555 ? 
2   AC1 17 GLY A 16  ? GLY A 16  . ? 1_555 ? 
3   AC1 17 LYS A 17  ? LYS A 17  . ? 1_555 ? 
4   AC1 17 THR A 18  ? THR A 18  . ? 1_555 ? 
5   AC1 17 LYS A 19  ? LYS A 19  . ? 1_555 ? 
6   AC1 17 VAL A 21  ? VAL A 21  . ? 1_555 ? 
7   AC1 17 LEU A 33  ? LEU A 33  . ? 1_555 ? 
8   AC1 17 PRO A 89  ? PRO A 89  . ? 1_555 ? 
9   AC1 17 CYS A 91  ? CYS A 91  . ? 1_555 ? 
10  AC1 17 MET A 93  ? MET A 93  . ? 1_555 ? 
11  AC1 17 LYS A 131 ? LYS A 131 . ? 1_555 ? 
12  AC1 17 ASP A 207 ? ASP A 207 . ? 1_555 ? 
13  AC1 17 MG  I .   ? MG  A 507 . ? 1_555 ? 
14  AC1 17 HOH Q .   ? HOH A 602 . ? 1_555 ? 
15  AC1 17 HOH Q .   ? HOH A 617 . ? 1_555 ? 
16  AC1 17 HOH Q .   ? HOH A 658 . ? 1_555 ? 
17  AC1 17 HOH Q .   ? HOH A 699 . ? 1_555 ? 
18  AC2 20 LYS A 17  ? LYS A 17  . ? 1_555 ? 
19  AC2 20 THR A 40  ? THR A 40  . ? 1_555 ? 
20  AC2 20 GLY A 42  ? GLY A 42  . ? 1_555 ? 
21  AC2 20 GLU A 97  ? GLU A 97  . ? 1_555 ? 
22  AC2 20 ARG A 101 ? ARG A 101 . ? 1_555 ? 
23  AC2 20 GLY A 106 ? GLY A 106 . ? 1_555 ? 
24  AC2 20 SER A 107 ? SER A 107 . ? 1_555 ? 
25  AC2 20 ASP A 189 ? ASP A 189 . ? 1_555 ? 
26  AC2 20 LYS A 191 ? LYS A 191 . ? 1_555 ? 
27  AC2 20 ASP A 212 ? ASP A 212 . ? 1_555 ? 
28  AC2 20 SER A 213 ? SER A 213 . ? 1_555 ? 
29  AC2 20 TRP A 214 ? TRP A 214 . ? 1_555 ? 
30  AC2 20 ARG A 215 ? ARG A 215 . ? 1_555 ? 
31  AC2 20 LYS A 228 ? LYS A 228 . ? 1_555 ? 
32  AC2 20 ARG A 232 ? ARG A 232 . ? 1_555 ? 
33  AC2 20 MG  J .   ? MG  A 508 . ? 1_555 ? 
34  AC2 20 HOH Q .   ? HOH A 621 . ? 1_555 ? 
35  AC2 20 HOH Q .   ? HOH A 686 . ? 1_555 ? 
36  AC2 20 HOH Q .   ? HOH A 689 . ? 1_555 ? 
37  AC2 20 HOH Q .   ? HOH A 694 . ? 1_555 ? 
38  AC3 6  LYS A 178 ? LYS A 178 . ? 1_555 ? 
39  AC3 6  GLU A 263 ? GLU A 263 . ? 1_555 ? 
40  AC3 6  GLY A 392 ? GLY A 392 . ? 1_555 ? 
41  AC3 6  ASN A 395 ? ASN A 395 . ? 1_555 ? 
42  AC3 6  HIS A 396 ? HIS A 396 . ? 1_555 ? 
43  AC3 6  HOH Q .   ? HOH A 618 . ? 1_555 ? 
44  AC4 7  ILE A 73  ? ILE A 73  . ? 1_555 ? 
45  AC4 7  LYS A 74  ? LYS A 74  . ? 1_555 ? 
46  AC4 7  ILE A 164 ? ILE A 164 . ? 1_555 ? 
47  AC4 7  ILE A 203 ? ILE A 203 . ? 1_555 ? 
48  AC4 7  LEU A 205 ? LEU A 205 . ? 1_555 ? 
49  AC4 7  ILE A 411 ? ILE A 411 . ? 1_555 ? 
50  AC4 7  HOH Q .   ? HOH A 680 . ? 1_555 ? 
51  AC5 6  LEU A 378 ? LEU A 378 . ? 1_555 ? 
52  AC5 6  SER A 379 ? SER A 379 . ? 1_555 ? 
53  AC5 6  HOH Q .   ? HOH A 604 . ? 1_555 ? 
54  AC5 6  LEU B 366 ? LEU B 366 . ? 1_555 ? 
55  AC5 6  ARG B 367 ? ARG B 367 . ? 1_555 ? 
56  AC5 6  LEU B 368 ? LEU B 368 . ? 1_555 ? 
57  AC6 7  GLU A 317 ? GLU A 317 . ? 1_555 ? 
58  AC6 7  GLY A 318 ? GLY A 318 . ? 1_555 ? 
59  AC6 7  ASP A 319 ? ASP A 319 . ? 1_555 ? 
60  AC6 7  GLY A 320 ? GLY A 320 . ? 1_555 ? 
61  AC6 7  HOH Q .   ? HOH A 648 . ? 1_555 ? 
62  AC6 7  GLU B 177 ? GLU B 177 . ? 1_555 ? 
63  AC6 7  LYS B 178 ? LYS B 178 . ? 1_555 ? 
64  AC7 2  ANP C .   ? ANP A 501 . ? 1_555 ? 
65  AC7 2  HOH Q .   ? HOH A 658 . ? 1_555 ? 
66  AC8 3  GLU A 97  ? GLU A 97  . ? 1_555 ? 
67  AC8 3  ASP A 137 ? ASP A 137 . ? 1_555 ? 
68  AC8 3  OK8 D .   ? OK8 A 502 . ? 1_555 ? 
69  AC9 6  GLU A 177 ? GLU A 177 . ? 1_555 ? 
70  AC9 6  LYS A 178 ? LYS A 178 . ? 1_555 ? 
71  AC9 6  HOH Q .   ? HOH A 636 . ? 1_555 ? 
72  AC9 6  GLU B 317 ? GLU B 317 . ? 1_555 ? 
73  AC9 6  GLY B 318 ? GLY B 318 . ? 1_555 ? 
74  AC9 6  GLY B 320 ? GLY B 320 . ? 1_555 ? 
75  AD1 17 TYR B 14  ? TYR B 14  . ? 1_555 ? 
76  AD1 17 GLY B 16  ? GLY B 16  . ? 1_555 ? 
77  AD1 17 LYS B 17  ? LYS B 17  . ? 1_555 ? 
78  AD1 17 THR B 18  ? THR B 18  . ? 1_555 ? 
79  AD1 17 LYS B 19  ? LYS B 19  . ? 1_555 ? 
80  AD1 17 VAL B 21  ? VAL B 21  . ? 1_555 ? 
81  AD1 17 LEU B 33  ? LEU B 33  . ? 1_555 ? 
82  AD1 17 PRO B 89  ? PRO B 89  . ? 1_555 ? 
83  AD1 17 CYS B 91  ? CYS B 91  . ? 1_555 ? 
84  AD1 17 MET B 93  ? MET B 93  . ? 1_555 ? 
85  AD1 17 LYS B 131 ? LYS B 131 . ? 1_555 ? 
86  AD1 17 ASP B 207 ? ASP B 207 . ? 1_555 ? 
87  AD1 17 MG  O .   ? MG  B 705 . ? 1_555 ? 
88  AD1 17 HOH R .   ? HOH B 805 . ? 1_555 ? 
89  AD1 17 HOH R .   ? HOH B 826 . ? 1_555 ? 
90  AD1 17 HOH R .   ? HOH B 829 . ? 1_555 ? 
91  AD1 17 HOH R .   ? HOH B 890 . ? 1_555 ? 
92  AD2 19 LYS B 17  ? LYS B 17  . ? 1_555 ? 
93  AD2 19 THR B 40  ? THR B 40  . ? 1_555 ? 
94  AD2 19 GLY B 42  ? GLY B 42  . ? 1_555 ? 
95  AD2 19 GLU B 97  ? GLU B 97  . ? 1_555 ? 
96  AD2 19 VAL B 99  ? VAL B 99  . ? 1_555 ? 
97  AD2 19 ARG B 101 ? ARG B 101 . ? 1_555 ? 
98  AD2 19 GLY B 106 ? GLY B 106 . ? 1_555 ? 
99  AD2 19 SER B 107 ? SER B 107 . ? 1_555 ? 
100 AD2 19 ASP B 189 ? ASP B 189 . ? 1_555 ? 
101 AD2 19 MET B 190 ? MET B 190 . ? 1_555 ? 
102 AD2 19 LYS B 191 ? LYS B 191 . ? 1_555 ? 
103 AD2 19 ASP B 212 ? ASP B 212 . ? 1_555 ? 
104 AD2 19 TRP B 214 ? TRP B 214 . ? 1_555 ? 
105 AD2 19 ARG B 215 ? ARG B 215 . ? 1_555 ? 
106 AD2 19 LYS B 228 ? LYS B 228 . ? 1_555 ? 
107 AD2 19 ARG B 232 ? ARG B 232 . ? 1_555 ? 
108 AD2 19 MG  P .   ? MG  B 706 . ? 1_555 ? 
109 AD2 19 HOH R .   ? HOH B 853 . ? 1_555 ? 
110 AD2 19 HOH R .   ? HOH B 865 . ? 1_555 ? 
111 AD3 3  SER B 274 ? SER B 274 . ? 1_555 ? 
112 AD3 3  THR B 275 ? THR B 275 . ? 1_555 ? 
113 AD3 3  HOH R .   ? HOH B 867 . ? 1_555 ? 
114 AD4 2  ANP L .   ? ANP B 702 . ? 1_555 ? 
115 AD4 2  HOH R .   ? HOH B 826 . ? 1_555 ? 
116 AD5 4  GLU B 97  ? GLU B 97  . ? 1_555 ? 
117 AD5 4  ASP B 137 ? ASP B 137 . ? 1_555 ? 
118 AD5 4  OK8 M .   ? OK8 B 703 . ? 1_555 ? 
119 AD5 4  HOH R .   ? HOH B 925 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6YB9 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.016323 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006493 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004472 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LEU A 1 7   ? -70.244 -49.008 51.065  1.00 79.90  ?  7   LEU A N     1 
ATOM   2    C  CA    . LEU A 1 7   ? -69.354 -50.197 51.311  1.00 83.80  ?  7   LEU A CA    1 
ATOM   3    C  C     . LEU A 1 7   ? -69.958 -51.069 52.429  1.00 77.05  ?  7   LEU A C     1 
ATOM   4    O  O     . LEU A 1 7   ? -70.023 -50.593 53.596  1.00 77.47  ?  7   LEU A O     1 
ATOM   5    C  CB    . LEU A 1 7   ? -67.958 -49.674 51.673  1.00 93.59  ?  7   LEU A CB    1 
ATOM   6    C  CG    . LEU A 1 7   ? -66.814 -50.693 51.696  1.00 95.62  ?  7   LEU A CG    1 
ATOM   7    C  CD1   . LEU A 1 7   ? -66.332 -51.045 50.294  1.00 84.96  ?  7   LEU A CD1   1 
ATOM   8    C  CD2   . LEU A 1 7   ? -65.656 -50.145 52.524  1.00 101.37 ?  7   LEU A CD2   1 
ATOM   9    N  N     . ASN A 1 8   ? -70.406 -52.285 52.094  1.00 70.21  ?  8   ASN A N     1 
ATOM   10   C  CA    . ASN A 1 8   ? -71.266 -53.114 52.987  1.00 74.04  ?  8   ASN A CA    1 
ATOM   11   C  C     . ASN A 1 8   ? -70.383 -54.110 53.762  1.00 72.06  ?  8   ASN A C     1 
ATOM   12   O  O     . ASN A 1 8   ? -70.105 -55.213 53.240  1.00 71.17  ?  8   ASN A O     1 
ATOM   13   C  CB    . ASN A 1 8   ? -72.405 -53.780 52.202  1.00 83.04  ?  8   ASN A CB    1 
ATOM   14   C  CG    . ASN A 1 8   ? -73.609 -54.149 53.053  1.00 91.70  ?  8   ASN A CG    1 
ATOM   15   O  OD1   . ASN A 1 8   ? -73.806 -53.599 54.137  1.00 87.84  ?  8   ASN A OD1   1 
ATOM   16   N  ND2   . ASN A 1 8   ? -74.429 -55.076 52.566  1.00 84.46  ?  8   ASN A ND2   1 
ATOM   17   N  N     . ILE A 1 9   ? -69.938 -53.718 54.959  1.00 63.74  ?  9   ILE A N     1 
ATOM   18   C  CA    . ILE A 1 9   ? -68.986 -54.499 55.799  1.00 63.37  ?  9   ILE A CA    1 
ATOM   19   C  C     . ILE A 1 9   ? -69.800 -55.535 56.552  1.00 63.47  ?  9   ILE A C     1 
ATOM   20   O  O     . ILE A 1 9   ? -70.853 -55.158 57.058  1.00 72.48  ?  9   ILE A O     1 
ATOM   21   C  CB    . ILE A 1 9   ? -68.168 -53.579 56.731  1.00 73.10  ?  9   ILE A CB    1 
ATOM   22   C  CG1   . ILE A 1 9   ? -67.359 -52.568 55.906  1.00 73.88  ?  9   ILE A CG1   1 
ATOM   23   C  CG2   . ILE A 1 9   ? -67.276 -54.380 57.680  1.00 76.59  ?  9   ILE A CG2   1 
ATOM   24   C  CD1   . ILE A 1 9   ? -66.709 -51.460 56.710  1.00 85.36  ?  9   ILE A CD1   1 
ATOM   25   N  N     . GLY A 1 10  ? -69.338 -56.790 56.576  1.00 66.39  ?  10  GLY A N     1 
ATOM   26   C  CA    . GLY A 1 10  ? -69.990 -57.908 57.294  1.00 56.59  ?  10  GLY A CA    1 
ATOM   27   C  C     . GLY A 1 10  ? -69.270 -58.214 58.598  1.00 52.37  ?  10  GLY A C     1 
ATOM   28   O  O     . GLY A 1 10  ? -68.759 -57.264 59.239  1.00 55.81  ?  10  GLY A O     1 
ATOM   29   N  N     . LYS A 1 11  ? -69.215 -59.483 58.988  1.00 53.82  ?  11  LYS A N     1 
ATOM   30   C  CA    . LYS A 1 11  ? -68.562 -59.916 60.260  1.00 66.55  ?  11  LYS A CA    1 
ATOM   31   C  C     . LYS A 1 11  ? -67.021 -59.787 60.176  1.00 59.41  ?  11  LYS A C     1 
ATOM   32   O  O     . LYS A 1 11  ? -66.432 -59.928 59.088  1.00 50.29  ?  11  LYS A O     1 
ATOM   33   C  CB    . LYS A 1 11  ? -68.972 -61.336 60.679  1.00 69.79  ?  11  LYS A CB    1 
ATOM   34   C  CG    . LYS A 1 11  ? -69.015 -62.391 59.582  1.00 77.54  ?  11  LYS A CG    1 
ATOM   35   C  CD    . LYS A 1 11  ? -69.252 -63.807 60.097  1.00 86.83  ?  11  LYS A CD    1 
ATOM   36   C  CE    . LYS A 1 11  ? -69.743 -64.756 59.017  1.00 91.59  ?  11  LYS A CE    1 
ATOM   37   N  NZ    . LYS A 1 11  ? -68.946 -66.007 59.006  1.00 94.44  ?  11  LYS A NZ    1 
ATOM   38   N  N     . LYS A 1 12  ? -66.395 -59.538 61.319  1.00 49.90  ?  12  LYS A N     1 
ATOM   39   C  CA    . LYS A 1 12  ? -64.946 -59.665 61.512  1.00 54.54  ?  12  LYS A CA    1 
ATOM   40   C  C     . LYS A 1 12  ? -64.622 -61.155 61.448  1.00 55.09  ?  12  LYS A C     1 
ATOM   41   O  O     . LYS A 1 12  ? -65.111 -61.872 62.336  1.00 54.01  ?  12  LYS A O     1 
ATOM   42   C  CB    . LYS A 1 12  ? -64.520 -59.021 62.831  1.00 59.11  ?  12  LYS A CB    1 
ATOM   43   C  CG    . LYS A 1 12  ? -63.020 -58.772 62.968  1.00 69.96  ?  12  LYS A CG    1 
ATOM   44   C  CD    . LYS A 1 12  ? -62.644 -57.576 63.840  1.00 69.80  ?  12  LYS A CD    1 
ATOM   45   C  CE    . LYS A 1 12  ? -62.746 -57.876 65.324  1.00 70.57  ?  12  LYS A CE    1 
ATOM   46   N  NZ    . LYS A 1 12  ? -62.526 -56.638 66.115  1.00 71.94  ?  12  LYS A NZ    1 
ATOM   47   N  N     . LEU A 1 13  ? -63.851 -61.592 60.434  1.00 50.72  ?  13  LEU A N     1 
ATOM   48   C  CA    . LEU A 1 13  ? -63.501 -63.021 60.231  1.00 58.18  ?  13  LEU A CA    1 
ATOM   49   C  C     . LEU A 1 13  ? -62.391 -63.438 61.204  1.00 59.56  ?  13  LEU A C     1 
ATOM   50   O  O     . LEU A 1 13  ? -62.531 -64.485 61.816  1.00 59.93  ?  13  LEU A O     1 
ATOM   51   C  CB    . LEU A 1 13  ? -63.089 -63.257 58.777  1.00 57.56  ?  13  LEU A CB    1 
ATOM   52   C  CG    . LEU A 1 13  ? -64.236 -63.306 57.770  1.00 59.21  ?  13  LEU A CG    1 
ATOM   53   C  CD1   . LEU A 1 13  ? -63.680 -63.610 56.384  1.00 56.03  ?  13  LEU A CD1   1 
ATOM   54   C  CD2   . LEU A 1 13  ? -65.284 -64.345 58.170  1.00 54.06  ?  13  LEU A CD2   1 
ATOM   55   N  N     . TYR A 1 14  ? -61.298 -62.681 61.252  1.00 65.42  ?  14  TYR A N     1 
ATOM   56   C  CA    . TYR A 1 14  ? -60.177 -62.851 62.212  1.00 69.85  ?  14  TYR A CA    1 
ATOM   57   C  C     . TYR A 1 14  ? -59.524 -61.486 62.430  1.00 60.91  ?  14  TYR A C     1 
ATOM   58   O  O     . TYR A 1 14  ? -59.768 -60.541 61.681  1.00 53.80  ?  14  TYR A O     1 
ATOM   59   C  CB    . TYR A 1 14  ? -59.139 -63.922 61.808  1.00 76.82  ?  14  TYR A CB    1 
ATOM   60   C  CG    . TYR A 1 14  ? -59.230 -64.498 60.410  1.00 87.45  ?  14  TYR A CG    1 
ATOM   61   C  CD1   . TYR A 1 14  ? -58.735 -63.796 59.324  1.00 87.06  ?  14  TYR A CD1   1 
ATOM   62   C  CD2   . TYR A 1 14  ? -59.804 -65.747 60.154  1.00 91.49  ?  14  TYR A CD2   1 
ATOM   63   C  CE1   . TYR A 1 14  ? -58.808 -64.306 58.031  1.00 86.13  ?  14  TYR A CE1   1 
ATOM   64   C  CE2   . TYR A 1 14  ? -59.884 -66.273 58.869  1.00 82.04  ?  14  TYR A CE2   1 
ATOM   65   C  CZ    . TYR A 1 14  ? -59.386 -65.543 57.801  1.00 87.33  ?  14  TYR A CZ    1 
ATOM   66   O  OH    . TYR A 1 14  ? -59.429 -66.012 56.523  1.00 87.40  ?  14  TYR A OH    1 
ATOM   67   N  N     . GLU A 1 15  ? -58.704 -61.429 63.471  1.00 55.74  ?  15  GLU A N     1 
ATOM   68   C  CA    . GLU A 1 15  ? -57.888 -60.258 63.841  1.00 55.04  ?  15  GLU A CA    1 
ATOM   69   C  C     . GLU A 1 15  ? -56.529 -60.757 64.347  1.00 48.17  ?  15  GLU A C     1 
ATOM   70   O  O     . GLU A 1 15  ? -56.481 -61.754 65.026  1.00 46.78  ?  15  GLU A O     1 
ATOM   71   C  CB    . GLU A 1 15  ? -58.629 -59.445 64.896  1.00 61.93  ?  15  GLU A CB    1 
ATOM   72   C  CG    . GLU A 1 15  ? -57.918 -58.154 65.243  1.00 66.13  ?  15  GLU A CG    1 
ATOM   73   C  CD    . GLU A 1 15  ? -58.611 -57.325 66.303  1.00 64.96  ?  15  GLU A CD    1 
ATOM   74   O  OE1   . GLU A 1 15  ? -59.747 -57.725 66.702  1.00 58.17  ?  15  GLU A OE1   1 
ATOM   75   O  OE2   . GLU A 1 15  ? -58.000 -56.303 66.729  1.00 48.85  ?  15  GLU A OE2   1 
ATOM   76   N  N     . GLY A 1 16  ? -55.440 -60.095 63.991  1.00 41.11  ?  16  GLY A N     1 
ATOM   77   C  CA    . GLY A 1 16  ? -54.113 -60.481 64.496  1.00 40.50  ?  16  GLY A CA    1 
ATOM   78   C  C     . GLY A 1 16  ? -53.417 -59.284 65.076  1.00 39.93  ?  16  GLY A C     1 
ATOM   79   O  O     . GLY A 1 16  ? -54.106 -58.351 65.460  1.00 44.89  ?  16  GLY A O     1 
ATOM   80   N  N     . LYS A 1 17  ? -52.095 -59.279 65.048  1.00 42.45  ?  17  LYS A N     1 
ATOM   81   C  CA    . LYS A 1 17  ? -51.271 -58.245 65.708  1.00 45.95  ?  17  LYS A CA    1 
ATOM   82   C  C     . LYS A 1 17  ? -51.415 -56.923 64.954  1.00 47.15  ?  17  LYS A C     1 
ATOM   83   O  O     . LYS A 1 17  ? -51.314 -55.879 65.635  1.00 50.07  ?  17  LYS A O     1 
ATOM   84   C  CB    . LYS A 1 17  ? -49.817 -58.712 65.819  1.00 48.72  ?  17  LYS A CB    1 
ATOM   85   C  CG    . LYS A 1 17  ? -49.472 -59.447 67.108  1.00 58.85  ?  17  LYS A CG    1 
ATOM   86   C  CD    . LYS A 1 17  ? -48.906 -60.842 66.925  1.00 67.97  ?  17  LYS A CD    1 
ATOM   87   C  CE    . LYS A 1 17  ? -47.569 -60.873 66.210  1.00 71.07  ?  17  LYS A CE    1 
ATOM   88   N  NZ    . LYS A 1 17  ? -47.000 -62.237 66.272  1.00 77.92  ?  17  LYS A NZ    1 
ATOM   89   N  N     . THR A 1 18  ? -51.619 -56.939 63.630  1.00 40.50  ?  18  THR A N     1 
ATOM   90   C  CA    . THR A 1 18  ? -51.562 -55.690 62.806  1.00 39.58  ?  18  THR A CA    1 
ATOM   91   C  C     . THR A 1 18  ? -52.753 -55.486 61.866  1.00 38.05  ?  18  THR A C     1 
ATOM   92   O  O     . THR A 1 18  ? -52.818 -54.396 61.268  1.00 36.48  ?  18  THR A O     1 
ATOM   93   C  CB    . THR A 1 18  ? -50.306 -55.613 61.931  1.00 44.26  ?  18  THR A CB    1 
ATOM   94   O  OG1   . THR A 1 18  ? -50.280 -56.757 61.066  1.00 40.86  ?  18  THR A OG1   1 
ATOM   95   C  CG2   . THR A 1 18  ? -49.054 -55.433 62.770  1.00 40.44  ?  18  THR A CG2   1 
ATOM   96   N  N     . LYS A 1 19  ? -53.671 -56.452 61.741  1.00 40.43  ?  19  LYS A N     1 
ATOM   97   C  CA    . LYS A 1 19  ? -54.738 -56.371 60.718  1.00 37.42  ?  19  LYS A CA    1 
ATOM   98   C  C     . LYS A 1 19  ? -55.999 -57.081 61.178  1.00 38.27  ?  19  LYS A C     1 
ATOM   99   O  O     . LYS A 1 19  ? -55.871 -58.173 61.750  1.00 33.23  ?  19  LYS A O     1 
ATOM   100  C  CB    . LYS A 1 19  ? -54.252 -56.979 59.400  1.00 37.37  ?  19  LYS A CB    1 
ATOM   101  C  CG    . LYS A 1 19  ? -53.356 -56.057 58.582  1.00 43.14  ?  19  LYS A CG    1 
ATOM   102  C  CD    . LYS A 1 19  ? -53.119 -56.549 57.164  1.00 46.09  ?  19  LYS A CD    1 
ATOM   103  C  CE    . LYS A 1 19  ? -52.859 -58.037 57.072  1.00 44.51  ?  19  LYS A CE    1 
ATOM   104  N  NZ    . LYS A 1 19  ? -51.575 -58.417 57.701  1.00 44.91  ?  19  LYS A NZ    1 
ATOM   105  N  N     . GLU A 1 20  ? -57.154 -56.460 60.870  1.00 38.05  ?  20  GLU A N     1 
ATOM   106  C  CA    . GLU A 1 20  ? -58.514 -57.032 61.014  1.00 37.85  ?  20  GLU A CA    1 
ATOM   107  C  C     . GLU A 1 20  ? -58.999 -57.368 59.617  1.00 36.20  ?  20  GLU A C     1 
ATOM   108  O  O     . GLU A 1 20  ? -58.834 -56.497 58.748  1.00 41.69  ?  20  GLU A O     1 
ATOM   109  C  CB    . GLU A 1 20  ? -59.457 -56.008 61.656  1.00 42.40  ?  20  GLU A CB    1 
ATOM   110  C  CG    . GLU A 1 20  ? -59.068 -55.609 63.083  1.00 48.46  ?  20  GLU A CG    1 
ATOM   111  C  CD    . GLU A 1 20  ? -59.715 -54.355 63.646  1.00 58.37  ?  20  GLU A CD    1 
ATOM   112  O  OE1   . GLU A 1 20  ? -60.191 -53.538 62.856  1.00 60.77  ?  20  GLU A OE1   1 
ATOM   113  O  OE2   . GLU A 1 20  ? -59.818 -54.249 64.889  1.00 75.10  ?  20  GLU A OE2   1 
ATOM   114  N  N     . VAL A 1 21  ? -59.513 -58.577 59.409  1.00 33.58  ?  21  VAL A N     1 
ATOM   115  C  CA    . VAL A 1 21  ? -60.052 -59.049 58.102  1.00 38.51  ?  21  VAL A CA    1 
ATOM   116  C  C     . VAL A 1 21  ? -61.573 -59.159 58.213  1.00 39.83  ?  21  VAL A C     1 
ATOM   117  O  O     . VAL A 1 21  ? -62.034 -59.889 59.134  1.00 42.61  ?  21  VAL A O     1 
ATOM   118  C  CB    . VAL A 1 21  ? -59.459 -60.414 57.719  1.00 41.97  ?  21  VAL A CB    1 
ATOM   119  C  CG1   . VAL A 1 21  ? -60.053 -60.953 56.411  1.00 41.61  ?  21  VAL A CG1   1 
ATOM   120  C  CG2   . VAL A 1 21  ? -57.939 -60.332 57.639  1.00 44.11  ?  21  VAL A CG2   1 
ATOM   121  N  N     . TYR A 1 22  ? -62.301 -58.490 57.311  1.00 39.59  ?  22  TYR A N     1 
ATOM   122  C  CA    . TYR A 1 22  ? -63.788 -58.394 57.320  1.00 44.98  ?  22  TYR A CA    1 
ATOM   123  C  C     . TYR A 1 22  ? -64.334 -59.020 56.044  1.00 45.68  ?  22  TYR A C     1 
ATOM   124  O  O     . TYR A 1 22  ? -63.702 -58.856 54.997  1.00 44.79  ?  22  TYR A O     1 
ATOM   125  C  CB    . TYR A 1 22  ? -64.275 -56.949 57.451  1.00 47.44  ?  22  TYR A CB    1 
ATOM   126  C  CG    . TYR A 1 22  ? -63.932 -56.251 58.745  1.00 49.91  ?  22  TYR A CG    1 
ATOM   127  C  CD1   . TYR A 1 22  ? -64.780 -56.302 59.843  1.00 62.50  ?  22  TYR A CD1   1 
ATOM   128  C  CD2   . TYR A 1 22  ? -62.770 -55.502 58.869  1.00 51.95  ?  22  TYR A CD2   1 
ATOM   129  C  CE1   . TYR A 1 22  ? -64.475 -55.655 61.037  1.00 55.00  ?  22  TYR A CE1   1 
ATOM   130  C  CE2   . TYR A 1 22  ? -62.470 -54.813 60.040  1.00 58.00  ?  22  TYR A CE2   1 
ATOM   131  C  CZ    . TYR A 1 22  ? -63.324 -54.895 61.129  1.00 57.06  ?  22  TYR A CZ    1 
ATOM   132  O  OH    . TYR A 1 22  ? -62.979 -54.261 62.282  1.00 63.25  ?  22  TYR A OH    1 
ATOM   133  N  N     . GLU A 1 23  ? -65.466 -59.711 56.143  1.00 48.06  ?  23  GLU A N     1 
ATOM   134  C  CA    . GLU A 1 23  ? -66.246 -60.157 54.963  1.00 54.75  ?  23  GLU A CA    1 
ATOM   135  C  C     . GLU A 1 23  ? -66.912 -58.910 54.329  1.00 54.11  ?  23  GLU A C     1 
ATOM   136  O  O     . GLU A 1 23  ? -67.161 -57.908 55.046  1.00 48.95  ?  23  GLU A O     1 
ATOM   137  C  CB    . GLU A 1 23  ? -67.247 -61.244 55.370  1.00 61.99  ?  23  GLU A CB    1 
ATOM   138  C  CG    . GLU A 1 23  ? -68.613 -60.679 55.719  1.00 79.63  ?  23  GLU A CG    1 
ATOM   139  C  CD    . GLU A 1 23  ? -69.697 -61.660 56.145  1.00 92.83  ?  23  GLU A CD    1 
ATOM   140  O  OE1   . GLU A 1 23  ? -70.520 -61.279 57.048  1.00 93.75  ?  23  GLU A OE1   1 
ATOM   141  O  OE2   . GLU A 1 23  ? -69.733 -62.785 55.579  1.00 71.42  ?  23  GLU A OE2   1 
ATOM   142  N  N     . LEU A 1 24  ? -67.137 -58.953 53.020  1.00 48.24  ?  24  LEU A N     1 
ATOM   143  C  CA    . LEU A 1 24  ? -67.816 -57.907 52.219  1.00 49.61  ?  24  LEU A CA    1 
ATOM   144  C  C     . LEU A 1 24  ? -69.079 -58.540 51.628  1.00 54.35  ?  24  LEU A C     1 
ATOM   145  O  O     . LEU A 1 24  ? -68.953 -59.434 50.737  1.00 52.94  ?  24  LEU A O     1 
ATOM   146  C  CB    . LEU A 1 24  ? -66.879 -57.427 51.098  1.00 44.59  ?  24  LEU A CB    1 
ATOM   147  C  CG    . LEU A 1 24  ? -65.648 -56.640 51.528  1.00 47.11  ?  24  LEU A CG    1 
ATOM   148  C  CD1   . LEU A 1 24  ? -64.739 -56.364 50.341  1.00 48.24  ?  24  LEU A CD1   1 
ATOM   149  C  CD2   . LEU A 1 24  ? -66.037 -55.332 52.191  1.00 49.69  ?  24  LEU A CD2   1 
ATOM   150  N  N     . LEU A 1 25  ? -70.249 -58.087 52.083  1.00 61.07  ?  25  LEU A N     1 
ATOM   151  C  CA    . LEU A 1 25  ? -71.556 -58.726 51.779  1.00 61.99  ?  25  LEU A CA    1 
ATOM   152  C  C     . LEU A 1 25  ? -71.911 -58.517 50.302  1.00 61.29  ?  25  LEU A C     1 
ATOM   153  O  O     . LEU A 1 25  ? -72.518 -59.434 49.746  1.00 66.30  ?  25  LEU A O     1 
ATOM   154  C  CB    . LEU A 1 25  ? -72.602 -58.147 52.730  1.00 68.40  ?  25  LEU A CB    1 
ATOM   155  C  CG    . LEU A 1 25  ? -72.350 -58.412 54.220  1.00 71.38  ?  25  LEU A CG    1 
ATOM   156  C  CD1   . LEU A 1 25  ? -73.081 -57.396 55.104  1.00 61.70  ?  25  LEU A CD1   1 
ATOM   157  C  CD2   . LEU A 1 25  ? -72.729 -59.852 54.568  1.00 66.90  ?  25  LEU A CD2   1 
ATOM   158  N  N     . ASP A 1 26  ? -71.474 -57.421 49.669  1.00 60.99  ?  26  ASP A N     1 
ATOM   159  C  CA    . ASP A 1 26  ? -71.775 -57.138 48.228  1.00 73.85  ?  26  ASP A CA    1 
ATOM   160  C  C     . ASP A 1 26  ? -70.714 -57.720 47.280  1.00 67.38  ?  26  ASP A C     1 
ATOM   161  O  O     . ASP A 1 26  ? -70.844 -57.532 46.071  1.00 59.86  ?  26  ASP A O     1 
ATOM   162  C  CB    . ASP A 1 26  ? -71.920 -55.636 47.963  1.00 84.28  ?  26  ASP A CB    1 
ATOM   163  C  CG    . ASP A 1 26  ? -73.189 -55.052 48.573  1.00 99.33  ?  26  ASP A CG    1 
ATOM   164  O  OD1   . ASP A 1 26  ? -74.197 -55.796 48.656  1.00 89.29  ?  26  ASP A OD1   1 
ATOM   165  O  OD2   . ASP A 1 26  ? -73.160 -53.861 48.966  1.00 101.82 ?  26  ASP A OD2   1 
ATOM   166  N  N     . SER A 1 27  ? -69.682 -58.381 47.807  1.00 71.35  ?  27  SER A N     1 
ATOM   167  C  CA    . SER A 1 27  ? -68.527 -58.889 47.020  1.00 61.99  ?  27  SER A CA    1 
ATOM   168  C  C     . SER A 1 27  ? -68.267 -60.347 47.363  1.00 56.88  ?  27  SER A C     1 
ATOM   169  O  O     . SER A 1 27  ? -67.560 -60.639 48.319  1.00 51.75  ?  27  SER A O     1 
ATOM   170  C  CB    . SER A 1 27  ? -67.306 -58.036 47.254  1.00 60.67  ?  27  SER A CB    1 
ATOM   171  O  OG    . SER A 1 27  ? -67.455 -56.780 46.615  1.00 56.51  ?  27  SER A OG    1 
ATOM   172  N  N     . PRO A 1 28  ? -68.795 -61.322 46.590  1.00 68.45  ?  28  PRO A N     1 
ATOM   173  C  CA    . PRO A 1 28  ? -68.516 -62.727 46.879  1.00 69.34  ?  28  PRO A CA    1 
ATOM   174  C  C     . PRO A 1 28  ? -67.008 -63.020 46.691  1.00 59.50  ?  28  PRO A C     1 
ATOM   175  O  O     . PRO A 1 28  ? -66.389 -62.553 45.725  1.00 52.89  ?  28  PRO A O     1 
ATOM   176  C  CB    . PRO A 1 28  ? -69.423 -63.482 45.886  1.00 71.05  ?  28  PRO A CB    1 
ATOM   177  C  CG    . PRO A 1 28  ? -69.601 -62.515 44.718  1.00 67.45  ?  28  PRO A CG    1 
ATOM   178  C  CD    . PRO A 1 28  ? -69.575 -61.138 45.351  1.00 69.69  ?  28  PRO A CD    1 
ATOM   179  N  N     . GLY A 1 29  ? -66.433 -63.743 47.642  1.00 51.57  ?  29  GLY A N     1 
ATOM   180  C  CA    . GLY A 1 29  ? -65.031 -64.183 47.570  1.00 50.18  ?  29  GLY A CA    1 
ATOM   181  C  C     . GLY A 1 29  ? -64.024 -63.058 47.777  1.00 44.44  ?  29  GLY A C     1 
ATOM   182  O  O     . GLY A 1 29  ? -62.865 -63.280 47.410  1.00 44.86  ?  29  GLY A O     1 
ATOM   183  N  N     . LYS A 1 30  ? -64.431 -61.913 48.333  1.00 36.52  ?  30  LYS A N     1 
ATOM   184  C  CA    . LYS A 1 30  ? -63.533 -60.761 48.611  1.00 37.52  ?  30  LYS A CA    1 
ATOM   185  C  C     . LYS A 1 30  ? -63.590 -60.384 50.091  1.00 39.01  ?  30  LYS A C     1 
ATOM   186  O  O     . LYS A 1 30  ? -64.593 -60.708 50.762  1.00 43.04  ?  30  LYS A O     1 
ATOM   187  C  CB    . LYS A 1 30  ? -63.874 -59.558 47.738  1.00 38.15  ?  30  LYS A CB    1 
ATOM   188  C  CG    . LYS A 1 30  ? -63.694 -59.777 46.240  1.00 42.48  ?  30  LYS A CG    1 
ATOM   189  C  CD    . LYS A 1 30  ? -63.025 -58.635 45.518  1.00 48.87  ?  30  LYS A CD    1 
ATOM   190  C  CE    . LYS A 1 30  ? -63.317 -58.606 44.032  1.00 47.84  ?  30  LYS A CE    1 
ATOM   191  N  NZ    . LYS A 1 30  ? -63.219 -59.977 43.495  1.00 54.41  ?  30  LYS A NZ    1 
ATOM   192  N  N     . VAL A 1 31  ? -62.517 -59.802 50.603  1.00 36.12  ?  31  VAL A N     1 
ATOM   193  C  CA    . VAL A 1 31  ? -62.421 -59.379 52.027  1.00 34.94  ?  31  VAL A CA    1 
ATOM   194  C  C     . VAL A 1 31  ? -61.720 -58.032 52.097  1.00 30.98  ?  31  VAL A C     1 
ATOM   195  O  O     . VAL A 1 31  ? -61.049 -57.659 51.133  1.00 36.47  ?  31  VAL A O     1 
ATOM   196  C  CB    . VAL A 1 31  ? -61.697 -60.411 52.905  1.00 38.02  ?  31  VAL A CB    1 
ATOM   197  C  CG1   . VAL A 1 31  ? -62.512 -61.679 53.029  1.00 43.61  ?  31  VAL A CG1   1 
ATOM   198  C  CG2   . VAL A 1 31  ? -60.296 -60.722 52.413  1.00 35.26  ?  31  VAL A CG2   1 
ATOM   199  N  N     . LEU A 1 32  ? -61.913 -57.355 53.211  1.00 33.12  ?  32  LEU A N     1 
ATOM   200  C  CA    . LEU A 1 32  ? -61.315 -56.030 53.525  1.00 36.36  ?  32  LEU A CA    1 
ATOM   201  C  C     . LEU A 1 32  ? -60.275 -56.226 54.633  1.00 37.14  ?  32  LEU A C     1 
ATOM   202  O  O     . LEU A 1 32  ? -60.647 -56.726 55.747  1.00 32.75  ?  32  LEU A O     1 
ATOM   203  C  CB    . LEU A 1 32  ? -62.413 -55.054 53.977  1.00 34.59  ?  32  LEU A CB    1 
ATOM   204  C  CG    . LEU A 1 32  ? -61.886 -53.696 54.418  1.00 34.74  ?  32  LEU A CG    1 
ATOM   205  C  CD1   . LEU A 1 32  ? -61.705 -52.776 53.233  1.00 36.58  ?  32  LEU A CD1   1 
ATOM   206  C  CD2   . LEU A 1 32  ? -62.798 -53.057 55.444  1.00 43.47  ?  32  LEU A CD2   1 
ATOM   207  N  N     . LEU A 1 33  ? -59.027 -55.841 54.350  1.00 31.90  ?  33  LEU A N     1 
ATOM   208  C  CA    . LEU A 1 33  ? -57.914 -55.962 55.305  1.00 34.50  ?  33  LEU A CA    1 
ATOM   209  C  C     . LEU A 1 33  ? -57.613 -54.564 55.831  1.00 36.42  ?  33  LEU A C     1 
ATOM   210  O  O     . LEU A 1 33  ? -57.068 -53.727 55.060  1.00 37.53  ?  33  LEU A O     1 
ATOM   211  C  CB    . LEU A 1 33  ? -56.717 -56.611 54.614  1.00 38.27  ?  33  LEU A CB    1 
ATOM   212  C  CG    . LEU A 1 33  ? -56.855 -58.107 54.333  1.00 38.10  ?  33  LEU A CG    1 
ATOM   213  C  CD1   . LEU A 1 33  ? -57.666 -58.376 53.097  1.00 43.00  ?  33  LEU A CD1   1 
ATOM   214  C  CD2   . LEU A 1 33  ? -55.493 -58.725 54.085  1.00 46.99  ?  33  LEU A CD2   1 
ATOM   215  N  N     . GLN A 1 34  ? -58.037 -54.332 57.079  1.00 36.46  ?  34  GLN A N     1 
ATOM   216  C  CA    . GLN A 1 34  ? -57.918 -53.058 57.820  1.00 34.09  ?  34  GLN A CA    1 
ATOM   217  C  C     . GLN A 1 34  ? -56.655 -53.153 58.661  1.00 34.05  ?  34  GLN A C     1 
ATOM   218  O  O     . GLN A 1 34  ? -56.570 -54.080 59.504  1.00 36.35  ?  34  GLN A O     1 
ATOM   219  C  CB    . GLN A 1 34  ? -59.167 -52.862 58.691  1.00 35.26  ?  34  GLN A CB    1 
ATOM   220  C  CG    . GLN A 1 34  ? -59.145 -51.645 59.583  1.00 32.74  ?  34  GLN A CG    1 
ATOM   221  C  CD    . GLN A 1 34  ? -59.135 -50.347 58.811  1.00 40.91  ?  34  GLN A CD    1 
ATOM   222  O  OE1   . GLN A 1 34  ? -58.169 -49.569 58.910  1.00 43.17  ?  34  GLN A OE1   1 
ATOM   223  N  NE2   . GLN A 1 34  ? -60.202 -50.084 58.063  1.00 38.36  ?  34  GLN A NE2   1 
ATOM   224  N  N     . SER A 1 35  ? -55.731 -52.215 58.457  1.00 33.32  ?  35  SER A N     1 
ATOM   225  C  CA    . SER A 1 35  ? -54.440 -52.150 59.171  1.00 34.52  ?  35  SER A CA    1 
ATOM   226  C  C     . SER A 1 35  ? -54.695 -51.456 60.506  1.00 41.01  ?  35  SER A C     1 
ATOM   227  O  O     . SER A 1 35  ? -55.651 -50.635 60.545  1.00 35.59  ?  35  SER A O     1 
ATOM   228  C  CB    . SER A 1 35  ? -53.376 -51.479 58.342  1.00 36.11  ?  35  SER A CB    1 
ATOM   229  O  OG    . SER A 1 35  ? -52.839 -52.370 57.382  1.00 31.56  ?  35  SER A OG    1 
ATOM   230  N  N     . LYS A 1 36  ? -53.887 -51.793 61.526  1.00 41.80  ?  36  LYS A N     1 
ATOM   231  C  CA    . LYS A 1 36  ? -53.919 -51.176 62.881  1.00 46.83  ?  36  LYS A CA    1 
ATOM   232  C  C     . LYS A 1 36  ? -52.624 -50.404 63.125  1.00 46.14  ?  36  LYS A C     1 
ATOM   233  O  O     . LYS A 1 36  ? -51.614 -50.772 62.487  1.00 43.88  ?  36  LYS A O     1 
ATOM   234  C  CB    . LYS A 1 36  ? -54.090 -52.277 63.921  1.00 48.19  ?  36  LYS A CB    1 
ATOM   235  C  CG    . LYS A 1 36  ? -55.458 -52.924 63.903  1.00 52.70  ?  36  LYS A CG    1 
ATOM   236  C  CD    . LYS A 1 36  ? -55.443 -54.369 64.332  1.00 54.32  ?  36  LYS A CD    1 
ATOM   237  C  CE    . LYS A 1 36  ? -54.936 -54.594 65.727  1.00 57.48  ?  36  LYS A CE    1 
ATOM   238  N  NZ    . LYS A 1 36  ? -55.202 -55.991 66.123  1.00 56.87  ?  36  LYS A NZ    1 
ATOM   239  N  N     . ASP A 1 37  ? -52.666 -49.387 63.997  1.00 44.48  ?  37  ASP A N     1 
ATOM   240  C  CA    . ASP A 1 37  ? -51.497 -48.548 64.378  1.00 40.60  ?  37  ASP A CA    1 
ATOM   241  C  C     . ASP A 1 37  ? -50.672 -49.301 65.434  1.00 43.42  ?  37  ASP A C     1 
ATOM   242  O  O     . ASP A 1 37  ? -50.333 -48.718 66.478  1.00 40.05  ?  37  ASP A O     1 
ATOM   243  C  CB    . ASP A 1 37  ? -51.909 -47.158 64.867  1.00 43.32  ?  37  ASP A CB    1 
ATOM   244  C  CG    . ASP A 1 37  ? -52.336 -46.207 63.745  1.00 59.34  ?  37  ASP A CG    1 
ATOM   245  O  OD1   . ASP A 1 37  ? -51.739 -46.255 62.651  1.00 62.22  ?  37  ASP A OD1   1 
ATOM   246  O  OD2   . ASP A 1 37  ? -53.284 -45.413 63.956  1.00 59.18  ?  37  ASP A OD2   1 
ATOM   247  N  N     . GLN A 1 38  ? -50.272 -50.533 65.133  1.00 42.02  ?  38  GLN A N     1 
ATOM   248  C  CA    . GLN A 1 38  ? -49.485 -51.399 66.029  1.00 40.92  ?  38  GLN A CA    1 
ATOM   249  C  C     . GLN A 1 38  ? -48.191 -51.831 65.322  1.00 45.44  ?  38  GLN A C     1 
ATOM   250  O  O     . GLN A 1 38  ? -48.247 -52.252 64.164  1.00 45.40  ?  38  GLN A O     1 
ATOM   251  C  CB    . GLN A 1 38  ? -50.310 -52.622 66.428  1.00 43.35  ?  38  GLN A CB    1 
ATOM   252  C  CG    . GLN A 1 38  ? -51.545 -52.320 67.277  1.00 53.42  ?  38  GLN A CG    1 
ATOM   253  C  CD    . GLN A 1 38  ? -51.209 -51.900 68.692  1.00 58.18  ?  38  GLN A CD    1 
ATOM   254  O  OE1   . GLN A 1 38  ? -50.383 -52.543 69.361  1.00 54.36  ?  38  GLN A OE1   1 
ATOM   255  N  NE2   . GLN A 1 38  ? -51.836 -50.805 69.127  1.00 57.91  ?  38  GLN A NE2   1 
ATOM   256  N  N     . ILE A 1 39  ? -47.058 -51.754 66.007  1.00 44.99  ?  39  ILE A N     1 
ATOM   257  C  CA    . ILE A 1 39  ? -45.794 -52.390 65.552  1.00 42.00  ?  39  ILE A CA    1 
ATOM   258  C  C     . ILE A 1 39  ? -45.422 -53.467 66.579  1.00 45.49  ?  39  ILE A C     1 
ATOM   259  O  O     . ILE A 1 39  ? -45.682 -53.260 67.767  1.00 47.34  ?  39  ILE A O     1 
ATOM   260  C  CB    . ILE A 1 39  ? -44.704 -51.317 65.351  1.00 44.71  ?  39  ILE A CB    1 
ATOM   261  C  CG1   . ILE A 1 39  ? -43.559 -51.854 64.493  1.00 45.42  ?  39  ILE A CG1   1 
ATOM   262  C  CG2   . ILE A 1 39  ? -44.232 -50.748 66.690  1.00 41.37  ?  39  ILE A CG2   1 
ATOM   263  C  CD1   . ILE A 1 39  ? -42.609 -50.759 64.007  1.00 48.67  ?  39  ILE A CD1   1 
ATOM   264  N  N     . THR A 1 40  ? -44.814 -54.570 66.153  1.00 43.74  ?  40  THR A N     1 
ATOM   265  C  CA    . THR A 1 40  ? -44.498 -55.732 67.021  1.00 46.04  ?  40  THR A CA    1 
ATOM   266  C  C     . THR A 1 40  ? -43.155 -56.290 66.580  1.00 43.44  ?  40  THR A C     1 
ATOM   267  O  O     . THR A 1 40  ? -42.761 -55.943 65.459  1.00 47.75  ?  40  THR A O     1 
ATOM   268  C  CB    . THR A 1 40  ? -45.618 -56.789 66.936  1.00 52.60  ?  40  THR A CB    1 
ATOM   269  O  OG1   . THR A 1 40  ? -45.616 -57.396 65.632  1.00 59.45  ?  40  THR A OG1   1 
ATOM   270  C  CG2   . THR A 1 40  ? -46.988 -56.201 67.215  1.00 52.78  ?  40  THR A CG2   1 
ATOM   271  N  N     . ALA A 1 41  ? -42.501 -57.107 67.408  1.00 45.31  ?  41  ALA A N     1 
ATOM   272  C  CA    . ALA A 1 41  ? -41.326 -57.923 67.011  1.00 47.68  ?  41  ALA A CA    1 
ATOM   273  C  C     . ALA A 1 41  ? -41.097 -59.044 68.026  1.00 47.84  ?  41  ALA A C     1 
ATOM   274  O  O     . ALA A 1 41  ? -41.275 -58.792 69.230  1.00 56.20  ?  41  ALA A O     1 
ATOM   275  C  CB    . ALA A 1 41  ? -40.113 -57.026 66.881  1.00 51.02  ?  41  ALA A CB    1 
ATOM   276  N  N     . GLY A 1 42  ? -40.636 -60.210 67.561  1.00 50.41  ?  42  GLY A N     1 
ATOM   277  C  CA    . GLY A 1 42  ? -40.414 -61.410 68.386  1.00 56.45  ?  42  GLY A CA    1 
ATOM   278  C  C     . GLY A 1 42  ? -41.715 -61.949 68.984  1.00 65.07  ?  42  GLY A C     1 
ATOM   279  O  O     . GLY A 1 42  ? -42.822 -61.515 68.578  1.00 58.52  ?  42  GLY A O     1 
ATOM   280  N  N     . ASN A 1 43  ? -41.585 -62.902 69.902  1.00 71.68  ?  43  ASN A N     1 
ATOM   281  C  CA    . ASN A 1 43  ? -42.720 -63.637 70.516  1.00 77.39  ?  43  ASN A CA    1 
ATOM   282  C  C     . ASN A 1 43  ? -42.761 -63.323 72.012  1.00 69.52  ?  43  ASN A C     1 
ATOM   283  O  O     . ASN A 1 43  ? -43.261 -64.167 72.756  1.00 70.38  ?  43  ASN A O     1 
ATOM   284  C  CB    . ASN A 1 43  ? -42.609 -65.134 70.200  1.00 86.56  ?  43  ASN A CB    1 
ATOM   285  C  CG    . ASN A 1 43  ? -42.943 -65.385 68.748  1.00 91.64  ?  43  ASN A CG    1 
ATOM   286  O  OD1   . ASN A 1 43  ? -43.994 -64.971 68.269  1.00 108.93 ?  43  ASN A OD1   1 
ATOM   287  N  ND2   . ASN A 1 43  ? -42.088 -66.136 68.073  1.00 77.28  ?  43  ASN A ND2   1 
ATOM   288  N  N     . ALA A 1 44  ? -42.183 -62.190 72.412  1.00 65.12  ?  44  ALA A N     1 
ATOM   289  C  CA    . ALA A 1 44  ? -42.175 -61.656 73.797  1.00 66.18  ?  44  ALA A CA    1 
ATOM   290  C  C     . ALA A 1 44  ? -42.982 -60.351 73.827  1.00 66.23  ?  44  ALA A C     1 
ATOM   291  O  O     . ALA A 1 44  ? -43.867 -60.186 72.968  1.00 64.67  ?  44  ALA A O     1 
ATOM   292  C  CB    . ALA A 1 44  ? -40.750 -61.448 74.278  1.00 69.20  ?  44  ALA A CB    1 
ATOM   293  N  N     . ALA A 1 45  ? -42.639 -59.420 74.726  1.00 59.67  ?  45  ALA A N     1 
ATOM   294  C  CA    . ALA A 1 45  ? -43.435 -58.203 75.019  1.00 65.41  ?  45  ALA A CA    1 
ATOM   295  C  C     . ALA A 1 45  ? -43.126 -57.039 74.056  1.00 52.87  ?  45  ALA A C     1 
ATOM   296  O  O     . ALA A 1 45  ? -43.587 -55.906 74.373  1.00 49.16  ?  45  ALA A O     1 
ATOM   297  C  CB    . ALA A 1 45  ? -43.195 -57.806 76.458  1.00 64.88  ?  45  ALA A CB    1 
ATOM   298  N  N     . ARG A 1 46  ? -42.399 -57.253 72.952  1.00 48.28  ?  46  ARG A N     1 
ATOM   299  C  CA    . ARG A 1 46  ? -42.034 -56.086 72.091  1.00 44.38  ?  46  ARG A CA    1 
ATOM   300  C  C     . ARG A 1 46  ? -43.236 -55.721 71.217  1.00 39.34  ?  46  ARG A C     1 
ATOM   301  O  O     . ARG A 1 46  ? -43.428 -56.342 70.176  1.00 37.69  ?  46  ARG A O     1 
ATOM   302  C  CB    . ARG A 1 46  ? -40.728 -56.223 71.310  1.00 47.29  ?  46  ARG A CB    1 
ATOM   303  C  CG    . ARG A 1 46  ? -40.285 -54.899 70.676  1.00 45.97  ?  46  ARG A CG    1 
ATOM   304  C  CD    . ARG A 1 46  ? -38.822 -54.856 70.287  1.00 49.20  ?  46  ARG A CD    1 
ATOM   305  N  NE    . ARG A 1 46  ? -37.998 -54.540 71.443  1.00 48.51  ?  46  ARG A NE    1 
ATOM   306  C  CZ    . ARG A 1 46  ? -36.735 -54.161 71.411  1.00 49.00  ?  46  ARG A CZ    1 
ATOM   307  N  NH1   . ARG A 1 46  ? -36.086 -54.026 70.272  1.00 58.54  ?  46  ARG A NH1   1 
ATOM   308  N  NH2   . ARG A 1 46  ? -36.116 -53.872 72.531  1.00 52.24  ?  46  ARG A NH2   1 
ATOM   309  N  N     . LYS A 1 47  ? -44.029 -54.769 71.704  1.00 38.06  ?  47  LYS A N     1 
ATOM   310  C  CA    . LYS A 1 47  ? -45.278 -54.282 71.080  1.00 41.35  ?  47  LYS A CA    1 
ATOM   311  C  C     . LYS A 1 47  ? -45.430 -52.808 71.420  1.00 39.60  ?  47  LYS A C     1 
ATOM   312  O  O     . LYS A 1 47  ? -45.058 -52.423 72.492  1.00 34.37  ?  47  LYS A O     1 
ATOM   313  C  CB    . LYS A 1 47  ? -46.493 -55.028 71.619  1.00 47.13  ?  47  LYS A CB    1 
ATOM   314  C  CG    . LYS A 1 47  ? -46.941 -56.214 70.796  1.00 48.25  ?  47  LYS A CG    1 
ATOM   315  C  CD    . LYS A 1 47  ? -46.844 -57.503 71.537  1.00 50.86  ?  47  LYS A CD    1 
ATOM   316  C  CE    . LYS A 1 47  ? -47.685 -58.602 70.896  1.00 55.39  ?  47  LYS A CE    1 
ATOM   317  N  NZ    . LYS A 1 47  ? -47.165 -59.939 71.279  1.00 54.20  ?  47  LYS A NZ    1 
ATOM   318  N  N     . ASN A 1 48  ? -45.974 -52.021 70.506  1.00 38.66  ?  48  ASN A N     1 
ATOM   319  C  CA    . ASN A 1 48  ? -46.120 -50.565 70.695  1.00 39.88  ?  48  ASN A CA    1 
ATOM   320  C  C     . ASN A 1 48  ? -47.236 -50.043 69.804  1.00 35.27  ?  48  ASN A C     1 
ATOM   321  O  O     . ASN A 1 48  ? -47.447 -50.568 68.704  1.00 38.60  ?  48  ASN A O     1 
ATOM   322  C  CB    . ASN A 1 48  ? -44.825 -49.810 70.399  1.00 44.02  ?  48  ASN A CB    1 
ATOM   323  C  CG    . ASN A 1 48  ? -43.766 -49.978 71.466  1.00 40.54  ?  48  ASN A CG    1 
ATOM   324  O  OD1   . ASN A 1 48  ? -42.820 -50.730 71.277  1.00 33.52  ?  48  ASN A OD1   1 
ATOM   325  N  ND2   . ASN A 1 48  ? -43.928 -49.265 72.568  1.00 38.52  ?  48  ASN A ND2   1 
ATOM   326  N  N     . HIS A 1 49  ? -47.940 -49.053 70.303  1.00 37.75  ?  49  HIS A N     1 
ATOM   327  C  CA    . HIS A 1 49  ? -48.761 -48.132 69.502  1.00 42.23  ?  49  HIS A CA    1 
ATOM   328  C  C     . HIS A 1 49  ? -47.784 -47.295 68.693  1.00 38.62  ?  49  HIS A C     1 
ATOM   329  O  O     . HIS A 1 49  ? -46.748 -46.960 69.227  1.00 39.75  ?  49  HIS A O     1 
ATOM   330  C  CB    . HIS A 1 49  ? -49.680 -47.275 70.385  1.00 44.20  ?  49  HIS A CB    1 
ATOM   331  C  CG    . HIS A 1 49  ? -50.679 -46.519 69.587  1.00 47.46  ?  49  HIS A CG    1 
ATOM   332  N  ND1   . HIS A 1 49  ? -50.513 -45.180 69.302  1.00 51.73  ?  49  HIS A ND1   1 
ATOM   333  C  CD2   . HIS A 1 49  ? -51.822 -46.913 68.974  1.00 51.43  ?  49  HIS A CD2   1 
ATOM   334  C  CE1   . HIS A 1 49  ? -51.545 -44.749 68.598  1.00 55.91  ?  49  HIS A CE1   1 
ATOM   335  N  NE2   . HIS A 1 49  ? -52.352 -45.793 68.368  1.00 56.34  ?  49  HIS A NE2   1 
ATOM   336  N  N     . LEU A 1 50  ? -48.093 -47.048 67.425  1.00 40.29  ?  50  LEU A N     1 
ATOM   337  C  CA    . LEU A 1 50  ? -47.335 -46.104 66.581  1.00 45.98  ?  50  LEU A CA    1 
ATOM   338  C  C     . LEU A 1 50  ? -48.333 -45.428 65.650  1.00 47.57  ?  50  LEU A C     1 
ATOM   339  O  O     . LEU A 1 50  ? -48.921 -46.126 64.818  1.00 52.37  ?  50  LEU A O     1 
ATOM   340  C  CB    . LEU A 1 50  ? -46.239 -46.865 65.830  1.00 47.28  ?  50  LEU A CB    1 
ATOM   341  C  CG    . LEU A 1 50  ? -45.223 -45.990 65.097  1.00 47.78  ?  50  LEU A CG    1 
ATOM   342  C  CD1   . LEU A 1 50  ? -44.505 -45.055 66.068  1.00 55.94  ?  50  LEU A CD1   1 
ATOM   343  C  CD2   . LEU A 1 50  ? -44.214 -46.840 64.358  1.00 44.19  ?  50  LEU A CD2   1 
ATOM   344  N  N     . GLU A 1 51  ? -48.555 -44.135 65.837  1.00 58.62  ?  51  GLU A N     1 
ATOM   345  C  CA    . GLU A 1 51  ? -49.591 -43.373 65.096  1.00 68.18  ?  51  GLU A CA    1 
ATOM   346  C  C     . GLU A 1 51  ? -49.138 -43.200 63.644  1.00 61.96  ?  51  GLU A C     1 
ATOM   347  O  O     . GLU A 1 51  ? -47.995 -42.747 63.457  1.00 57.61  ?  51  GLU A O     1 
ATOM   348  C  CB    . GLU A 1 51  ? -49.807 -42.027 65.786  1.00 71.30  ?  51  GLU A CB    1 
ATOM   349  C  CG    . GLU A 1 51  ? -50.924 -41.209 65.187  1.00 80.41  ?  51  GLU A CG    1 
ATOM   350  C  CD    . GLU A 1 51  ? -51.801 -40.598 66.260  1.00 92.90  ?  51  GLU A CD    1 
ATOM   351  O  OE1   . GLU A 1 51  ? -51.896 -41.213 67.364  1.00 89.32  ?  51  GLU A OE1   1 
ATOM   352  O  OE2   . GLU A 1 51  ? -52.367 -39.513 66.000  1.00 94.08  ?  51  GLU A OE2   1 
ATOM   353  N  N     . GLY A 1 52  ? -50.011 -43.550 62.682  1.00 55.72  ?  52  GLY A N     1 
ATOM   354  C  CA    . GLY A 1 52  ? -49.779 -43.392 61.226  1.00 51.67  ?  52  GLY A CA    1 
ATOM   355  C  C     . GLY A 1 52  ? -49.145 -44.621 60.590  1.00 49.58  ?  52  GLY A C     1 
ATOM   356  O  O     . GLY A 1 52  ? -49.016 -44.656 59.331  1.00 52.72  ?  52  GLY A O     1 
ATOM   357  N  N     . LYS A 1 53  ? -48.797 -45.622 61.400  1.00 41.97  ?  53  LYS A N     1 
ATOM   358  C  CA    . LYS A 1 53  ? -48.217 -46.899 60.907  1.00 43.95  ?  53  LYS A CA    1 
ATOM   359  C  C     . LYS A 1 53  ? -49.238 -47.578 59.988  1.00 43.48  ?  53  LYS A C     1 
ATOM   360  O  O     . LYS A 1 53  ? -48.837 -48.067 58.916  1.00 46.74  ?  53  LYS A O     1 
ATOM   361  C  CB    . LYS A 1 53  ? -47.792 -47.760 62.096  1.00 44.53  ?  53  LYS A CB    1 
ATOM   362  C  CG    . LYS A 1 53  ? -47.622 -49.245 61.832  1.00 47.31  ?  53  LYS A CG    1 
ATOM   363  C  CD    . LYS A 1 53  ? -46.360 -49.610 61.118  1.00 50.48  ?  53  LYS A CD    1 
ATOM   364  C  CE    . LYS A 1 53  ? -45.944 -51.053 61.356  1.00 54.37  ?  53  LYS A CE    1 
ATOM   365  N  NZ    . LYS A 1 53  ? -47.109 -51.988 61.387  1.00 55.43  ?  53  LYS A NZ    1 
ATOM   366  N  N     . ALA A 1 54  ? -50.515 -47.608 60.370  1.00 39.15  ?  54  ALA A N     1 
ATOM   367  C  CA    . ALA A 1 54  ? -51.591 -48.290 59.601  1.00 40.87  ?  54  ALA A CA    1 
ATOM   368  C  C     . ALA A 1 54  ? -51.626 -47.732 58.172  1.00 41.86  ?  54  ALA A C     1 
ATOM   369  O  O     . ALA A 1 54  ? -51.822 -48.544 57.257  1.00 40.04  ?  54  ALA A O     1 
ATOM   370  C  CB    . ALA A 1 54  ? -52.936 -48.136 60.285  1.00 42.40  ?  54  ALA A CB    1 
ATOM   371  N  N     . ALA A 1 55  ? -51.465 -46.408 58.011  1.00 35.08  ?  55  ALA A N     1 
ATOM   372  C  CA    . ALA A 1 55  ? -51.550 -45.675 56.728  1.00 37.34  ?  55  ALA A CA    1 
ATOM   373  C  C     . ALA A 1 55  ? -50.298 -45.946 55.888  1.00 38.37  ?  55  ALA A C     1 
ATOM   374  O  O     . ALA A 1 55  ? -50.376 -46.029 54.656  1.00 36.28  ?  55  ALA A O     1 
ATOM   375  C  CB    . ALA A 1 55  ? -51.706 -44.201 56.976  1.00 34.78  ?  55  ALA A CB    1 
ATOM   376  N  N     . ILE A 1 56  ? -49.166 -46.064 56.562  1.00 36.41  ?  56  ILE A N     1 
ATOM   377  C  CA    . ILE A 1 56  ? -47.851 -46.341 55.945  1.00 33.12  ?  56  ILE A CA    1 
ATOM   378  C  C     . ILE A 1 56  ? -47.829 -47.782 55.445  1.00 31.09  ?  56  ILE A C     1 
ATOM   379  O  O     . ILE A 1 56  ? -47.447 -47.957 54.266  1.00 34.34  ?  56  ILE A O     1 
ATOM   380  C  CB    . ILE A 1 56  ? -46.727 -46.012 56.931  1.00 34.96  ?  56  ILE A CB    1 
ATOM   381  C  CG1   . ILE A 1 56  ? -46.561 -44.496 57.061  1.00 35.29  ?  56  ILE A CG1   1 
ATOM   382  C  CG2   . ILE A 1 56  ? -45.419 -46.716 56.559  1.00 36.40  ?  56  ILE A CG2   1 
ATOM   383  C  CD1   . ILE A 1 56  ? -45.769 -44.072 58.304  1.00 39.00  ?  56  ILE A CD1   1 
ATOM   384  N  N     . SER A 1 57  ? -48.236 -48.755 56.254  1.00 31.26  ?  57  SER A N     1 
ATOM   385  C  CA    . SER A 1 57  ? -48.307 -50.193 55.851  1.00 37.16  ?  57  SER A CA    1 
ATOM   386  C  C     . SER A 1 57  ? -49.244 -50.349 54.654  1.00 35.47  ?  57  SER A C     1 
ATOM   387  O  O     . SER A 1 57  ? -48.880 -51.022 53.668  1.00 33.81  ?  57  SER A O     1 
ATOM   388  C  CB    . SER A 1 57  ? -48.734 -51.110 56.969  1.00 39.83  ?  57  SER A CB    1 
ATOM   389  O  OG    . SER A 1 57  ? -47.703 -51.180 57.948  1.00 52.58  ?  57  SER A OG    1 
ATOM   390  N  N     . ASN A 1 58  ? -50.412 -49.735 54.742  1.00 31.20  ?  58  ASN A N     1 
ATOM   391  C  CA    . ASN A 1 58  ? -51.444 -49.838 53.694  1.00 33.03  ?  58  ASN A CA    1 
ATOM   392  C  C     . ASN A 1 58  ? -50.910 -49.248 52.380  1.00 29.45  ?  58  ASN A C     1 
ATOM   393  O  O     . ASN A 1 58  ? -51.157 -49.827 51.319  1.00 28.22  ?  58  ASN A O     1 
ATOM   394  C  CB    . ASN A 1 58  ? -52.733 -49.146 54.120  1.00 33.10  ?  58  ASN A CB    1 
ATOM   395  C  CG    . ASN A 1 58  ? -53.897 -49.638 53.308  1.00 32.93  ?  58  ASN A CG    1 
ATOM   396  O  OD1   . ASN A 1 58  ? -54.148 -50.854 53.273  1.00 37.05  ?  58  ASN A OD1   1 
ATOM   397  N  ND2   . ASN A 1 58  ? -54.574 -48.703 52.657  1.00 30.67  ?  58  ASN A ND2   1 
ATOM   398  N  N     . LYS A 1 59  ? -50.238 -48.108 52.462  1.00 30.36  ?  59  LYS A N     1 
ATOM   399  C  CA    . LYS A 1 59  ? -49.726 -47.384 51.280  1.00 33.72  ?  59  LYS A CA    1 
ATOM   400  C  C     . LYS A 1 59  ? -48.635 -48.231 50.605  1.00 34.67  ?  59  LYS A C     1 
ATOM   401  O  O     . LYS A 1 59  ? -48.722 -48.444 49.396  1.00 37.77  ?  59  LYS A O     1 
ATOM   402  C  CB    . LYS A 1 59  ? -49.202 -46.011 51.651  1.00 33.64  ?  59  LYS A CB    1 
ATOM   403  C  CG    . LYS A 1 59  ? -48.506 -45.338 50.502  1.00 38.76  ?  59  LYS A CG    1 
ATOM   404  C  CD    . LYS A 1 59  ? -48.076 -43.943 50.805  1.00 47.82  ?  59  LYS A CD    1 
ATOM   405  C  CE    . LYS A 1 59  ? -47.701 -43.219 49.524  1.00 50.57  ?  59  LYS A CE    1 
ATOM   406  N  NZ    . LYS A 1 59  ? -47.232 -41.852 49.813  1.00 55.98  ?  59  LYS A NZ    1 
ATOM   407  N  N     . ILE A 1 60  ? -47.679 -48.745 51.373  1.00 31.99  ?  60  ILE A N     1 
ATOM   408  C  CA    . ILE A 1 60  ? -46.576 -49.577 50.836  1.00 29.48  ?  60  ILE A CA    1 
ATOM   409  C  C     . ILE A 1 60  ? -47.136 -50.841 50.178  1.00 29.09  ?  60  ILE A C     1 
ATOM   410  O  O     . ILE A 1 60  ? -46.816 -51.057 48.987  1.00 31.49  ?  60  ILE A O     1 
ATOM   411  C  CB    . ILE A 1 60  ? -45.556 -49.876 51.946  1.00 31.79  ?  60  ILE A CB    1 
ATOM   412  C  CG1   . ILE A 1 60  ? -44.894 -48.578 52.419  1.00 30.89  ?  60  ILE A CG1   1 
ATOM   413  C  CG2   . ILE A 1 60  ? -44.533 -50.936 51.490  1.00 30.62  ?  60  ILE A CG2   1 
ATOM   414  C  CD1   . ILE A 1 60  ? -44.014 -48.766 53.634  1.00 35.04  ?  60  ILE A CD1   1 
ATOM   415  N  N     . THR A 1 61  ? -47.944 -51.642 50.880  1.00 29.52  ?  61  THR A N     1 
ATOM   416  C  CA    . THR A 1 61  ? -48.507 -52.909 50.323  1.00 31.94  ?  61  THR A CA    1 
ATOM   417  C  C     . THR A 1 61  ? -49.316 -52.635 49.068  1.00 34.31  ?  61  THR A C     1 
ATOM   418  O  O     . THR A 1 61  ? -49.306 -53.476 48.145  1.00 35.75  ?  61  THR A O     1 
ATOM   419  C  CB    . THR A 1 61  ? -49.506 -53.628 51.222  1.00 33.38  ?  61  THR A CB    1 
ATOM   420  O  OG1   . THR A 1 61  ? -49.055 -53.543 52.557  1.00 56.01  ?  61  THR A OG1   1 
ATOM   421  C  CG2   . THR A 1 61  ? -49.579 -55.083 50.861  1.00 32.57  ?  61  THR A CG2   1 
ATOM   422  N  N     . SER A 1 62  ? -50.038 -51.516 49.054  1.00 34.04  ?  62  SER A N     1 
ATOM   423  C  CA    . SER A 1 62  ? -50.958 -51.187 47.946  1.00 32.87  ?  62  SER A CA    1 
ATOM   424  C  C     . SER A 1 62  ? -50.118 -50.852 46.712  1.00 31.36  ?  62  SER A C     1 
ATOM   425  O  O     . SER A 1 62  ? -50.446 -51.353 45.639  1.00 34.30  ?  62  SER A O     1 
ATOM   426  C  CB    . SER A 1 62  ? -51.913 -50.080 48.336  1.00 37.86  ?  62  SER A CB    1 
ATOM   427  O  OG    . SER A 1 62  ? -52.882 -50.561 49.274  1.00 40.44  ?  62  SER A OG    1 
ATOM   428  N  N     . CYS A 1 63  ? -49.085 -50.032 46.852  1.00 33.85  ?  63  CYS A N     1 
ATOM   429  C  CA    . CYS A 1 63  ? -48.093 -49.731 45.783  1.00 36.37  ?  63  CYS A CA    1 
ATOM   430  C  C     . CYS A 1 63  ? -47.359 -51.009 45.375  1.00 33.37  ?  63  CYS A C     1 
ATOM   431  O  O     . CYS A 1 63  ? -47.269 -51.254 44.182  1.00 36.02  ?  63  CYS A O     1 
ATOM   432  C  CB    . CYS A 1 63  ? -47.076 -48.677 46.207  1.00 39.20  ?  63  CYS A CB    1 
ATOM   433  S  SG    . CYS A 1 63  ? -47.875 -47.060 46.354  1.00 49.46  ?  63  CYS A SG    1 
ATOM   434  N  N     . ILE A 1 64  ? -46.835 -51.789 46.317  1.00 29.55  ?  64  ILE A N     1 
ATOM   435  C  CA    . ILE A 1 64  ? -46.021 -52.975 45.945  1.00 28.46  ?  64  ILE A CA    1 
ATOM   436  C  C     . ILE A 1 64  ? -46.922 -53.976 45.236  1.00 28.86  ?  64  ILE A C     1 
ATOM   437  O  O     . ILE A 1 64  ? -46.496 -54.531 44.229  1.00 33.87  ?  64  ILE A O     1 
ATOM   438  C  CB    . ILE A 1 64  ? -45.289 -53.557 47.158  1.00 29.28  ?  64  ILE A CB    1 
ATOM   439  C  CG1   . ILE A 1 64  ? -44.249 -52.582 47.715  1.00 30.66  ?  64  ILE A CG1   1 
ATOM   440  C  CG2   . ILE A 1 64  ? -44.677 -54.904 46.831  1.00 28.21  ?  64  ILE A CG2   1 
ATOM   441  C  CD1   . ILE A 1 64  ? -43.176 -52.169 46.737  1.00 30.50  ?  64  ILE A CD1   1 
ATOM   442  N  N     . PHE A 1 65  ? -48.139 -54.206 45.703  1.00 30.62  ?  65  PHE A N     1 
ATOM   443  C  CA    . PHE A 1 65  ? -49.040 -55.202 45.067  1.00 32.04  ?  65  PHE A CA    1 
ATOM   444  C  C     . PHE A 1 65  ? -49.435 -54.727 43.660  1.00 34.12  ?  65  PHE A C     1 
ATOM   445  O  O     . PHE A 1 65  ? -49.507 -55.579 42.734  1.00 32.25  ?  65  PHE A O     1 
ATOM   446  C  CB    . PHE A 1 65  ? -50.283 -55.474 45.912  1.00 33.52  ?  65  PHE A CB    1 
ATOM   447  C  CG    . PHE A 1 65  ? -50.093 -56.490 47.005  1.00 35.34  ?  65  PHE A CG    1 
ATOM   448  C  CD1   . PHE A 1 65  ? -48.936 -57.275 47.072  1.00 32.16  ?  65  PHE A CD1   1 
ATOM   449  C  CD2   . PHE A 1 65  ? -51.072 -56.652 47.980  1.00 34.60  ?  65  PHE A CD2   1 
ATOM   450  C  CE1   . PHE A 1 65  ? -48.757 -58.199 48.091  1.00 32.84  ?  65  PHE A CE1   1 
ATOM   451  C  CE2   . PHE A 1 65  ? -50.883 -57.587 49.002  1.00 34.28  ?  65  PHE A CE2   1 
ATOM   452  C  CZ    . PHE A 1 65  ? -49.739 -58.366 49.048  1.00 34.14  ?  65  PHE A CZ    1 
ATOM   453  N  N     . GLN A 1 66  ? -49.662 -53.426 43.478  1.00 29.68  ?  66  GLN A N     1 
ATOM   454  C  CA    . GLN A 1 66  ? -50.030 -52.875 42.153  1.00 35.45  ?  66  GLN A CA    1 
ATOM   455  C  C     . GLN A 1 66  ? -48.853 -53.066 41.192  1.00 37.30  ?  66  GLN A C     1 
ATOM   456  O  O     . GLN A 1 66  ? -49.097 -53.408 40.045  1.00 37.86  ?  66  GLN A O     1 
ATOM   457  C  CB    . GLN A 1 66  ? -50.407 -51.404 42.238  1.00 33.75  ?  66  GLN A CB    1 
ATOM   458  C  CG    . GLN A 1 66  ? -51.028 -50.867 40.964  1.00 39.59  ?  66  GLN A CG    1 
ATOM   459  C  CD    . GLN A 1 66  ? -51.204 -49.371 41.050  1.00 39.95  ?  66  GLN A CD    1 
ATOM   460  O  OE1   . GLN A 1 66  ? -51.497 -48.838 42.097  1.00 40.91  ?  66  GLN A OE1   1 
ATOM   461  N  NE2   . GLN A 1 66  ? -50.951 -48.679 39.968  1.00 39.79  ?  66  GLN A NE2   1 
ATOM   462  N  N     . LEU A 1 67  ? -47.630 -52.835 41.667  1.00 34.20  ?  67  LEU A N     1 
ATOM   463  C  CA    . LEU A 1 67  ? -46.383 -53.014 40.889  1.00 35.00  ?  67  LEU A CA    1 
ATOM   464  C  C     . LEU A 1 67  ? -46.248 -54.474 40.454  1.00 33.57  ?  67  LEU A C     1 
ATOM   465  O  O     . LEU A 1 67  ? -46.020 -54.739 39.281  1.00 38.65  ?  67  LEU A O     1 
ATOM   466  C  CB    . LEU A 1 67  ? -45.207 -52.612 41.781  1.00 35.19  ?  67  LEU A CB    1 
ATOM   467  C  CG    . LEU A 1 67  ? -43.820 -52.869 41.195  1.00 35.40  ?  67  LEU A CG    1 
ATOM   468  C  CD1   . LEU A 1 67  ? -43.542 -51.921 40.044  1.00 36.87  ?  67  LEU A CD1   1 
ATOM   469  C  CD2   . LEU A 1 67  ? -42.776 -52.668 42.252  1.00 39.29  ?  67  LEU A CD2   1 
ATOM   470  N  N     . LEU A 1 68  ? -46.372 -55.396 41.388  1.00 33.22  ?  68  LEU A N     1 
ATOM   471  C  CA    . LEU A 1 68  ? -46.211 -56.853 41.098  1.00 35.24  ?  68  LEU A CA    1 
ATOM   472  C  C     . LEU A 1 68  ? -47.354 -57.286 40.176  1.00 31.47  ?  68  LEU A C     1 
ATOM   473  O  O     . LEU A 1 68  ? -47.133 -58.060 39.276  1.00 28.31  ?  68  LEU A O     1 
ATOM   474  C  CB    . LEU A 1 68  ? -46.196 -57.626 42.422  1.00 33.47  ?  68  LEU A CB    1 
ATOM   475  C  CG    . LEU A 1 68  ? -44.949 -57.436 43.285  1.00 30.79  ?  68  LEU A CG    1 
ATOM   476  C  CD1   . LEU A 1 68  ? -45.085 -58.100 44.654  1.00 29.33  ?  68  LEU A CD1   1 
ATOM   477  C  CD2   . LEU A 1 68  ? -43.717 -57.974 42.571  1.00 35.43  ?  68  LEU A CD2   1 
ATOM   478  N  N     . GLN A 1 69  ? -48.549 -56.750 40.368  1.00 34.93  ?  69  GLN A N     1 
ATOM   479  C  CA    . GLN A 1 69  ? -49.734 -57.168 39.568  1.00 36.31  ?  69  GLN A CA    1 
ATOM   480  C  C     . GLN A 1 69  ? -49.591 -56.669 38.128  1.00 34.31  ?  69  GLN A C     1 
ATOM   481  O  O     . GLN A 1 69  ? -49.908 -57.466 37.231  1.00 32.78  ?  69  GLN A O     1 
ATOM   482  C  CB    . GLN A 1 69  ? -51.024 -56.659 40.205  1.00 43.33  ?  69  GLN A CB    1 
ATOM   483  C  CG    . GLN A 1 69  ? -52.143 -57.676 40.178  1.00 46.54  ?  69  GLN A CG    1 
ATOM   484  C  CD    . GLN A 1 69  ? -53.322 -57.261 41.025  1.00 42.64  ?  69  GLN A CD    1 
ATOM   485  O  OE1   . GLN A 1 69  ? -53.681 -56.090 41.098  1.00 36.48  ?  69  GLN A OE1   1 
ATOM   486  N  NE2   . GLN A 1 69  ? -53.963 -58.258 41.614  1.00 37.55  ?  69  GLN A NE2   1 
ATOM   487  N  N     . GLU A 1 70  ? -49.069 -55.451 37.930  1.00 34.38  ?  70  GLU A N     1 
ATOM   488  C  CA    . GLU A 1 70  ? -48.879 -54.808 36.604  1.00 38.96  ?  70  GLU A CA    1 
ATOM   489  C  C     . GLU A 1 70  ? -47.746 -55.495 35.831  1.00 36.16  ?  70  GLU A C     1 
ATOM   490  O  O     . GLU A 1 70  ? -47.792 -55.480 34.613  1.00 40.32  ?  70  GLU A O     1 
ATOM   491  C  CB    . GLU A 1 70  ? -48.765 -53.293 36.754  1.00 45.94  ?  70  GLU A CB    1 
ATOM   492  C  CG    . GLU A 1 70  ? -50.101 -52.700 37.204  1.00 56.85  ?  70  GLU A CG    1 
ATOM   493  C  CD    . GLU A 1 70  ? -50.242 -51.187 37.220  1.00 69.50  ?  70  GLU A CD    1 
ATOM   494  O  OE1   . GLU A 1 70  ? -49.216 -50.487 37.470  1.00 69.05  ?  70  GLU A OE1   1 
ATOM   495  O  OE2   . GLU A 1 70  ? -51.396 -50.709 37.004  1.00 67.18  ?  70  GLU A OE2   1 
ATOM   496  N  N     . ALA A 1 71  ? -46.776 -56.060 36.521  1.00 30.33  ?  71  ALA A N     1 
ATOM   497  C  CA    . ALA A 1 71  ? -45.745 -56.955 35.965  1.00 29.38  ?  71  ALA A CA    1 
ATOM   498  C  C     . ALA A 1 71  ? -46.345 -58.289 35.497  1.00 27.32  ?  71  ALA A C     1 
ATOM   499  O  O     . ALA A 1 71  ? -45.805 -58.875 34.529  1.00 31.03  ?  71  ALA A O     1 
ATOM   500  C  CB    . ALA A 1 71  ? -44.651 -57.206 36.978  1.00 30.31  ?  71  ALA A CB    1 
ATOM   501  N  N     . GLY A 1 72  ? -47.371 -58.800 36.162  1.00 27.35  ?  72  GLY A N     1 
ATOM   502  C  CA    . GLY A 1 72  ? -48.017 -60.089 35.788  1.00 28.56  ?  72  GLY A CA    1 
ATOM   503  C  C     . GLY A 1 72  ? -47.905 -61.159 36.866  1.00 29.66  ?  72  GLY A C     1 
ATOM   504  O  O     . GLY A 1 72  ? -48.223 -62.321 36.582  1.00 30.48  ?  72  GLY A O     1 
ATOM   505  N  N     . ILE A 1 73  ? -47.434 -60.796 38.069  1.00 29.00  ?  73  ILE A N     1 
ATOM   506  C  CA    . ILE A 1 73  ? -47.403 -61.711 39.245  1.00 28.44  ?  73  ILE A CA    1 
ATOM   507  C  C     . ILE A 1 73  ? -48.828 -61.872 39.745  1.00 29.56  ?  73  ILE A C     1 
ATOM   508  O  O     . ILE A 1 73  ? -49.487 -60.840 39.961  1.00 29.81  ?  73  ILE A O     1 
ATOM   509  C  CB    . ILE A 1 73  ? -46.455 -61.181 40.334  1.00 30.53  ?  73  ILE A CB    1 
ATOM   510  C  CG1   . ILE A 1 73  ? -45.013 -61.059 39.821  1.00 30.39  ?  73  ILE A CG1   1 
ATOM   511  C  CG2   . ILE A 1 73  ? -46.552 -62.007 41.608  1.00 31.26  ?  73  ILE A CG2   1 
ATOM   512  C  CD1   . ILE A 1 73  ? -44.359 -62.386 39.408  1.00 32.08  ?  73  ILE A CD1   1 
ATOM   513  N  N     . LYS A 1 74  ? -49.308 -63.107 39.914  1.00 31.41  ?  74  LYS A N     1 
ATOM   514  C  CA    . LYS A 1 74  ? -50.680 -63.371 40.412  1.00 33.56  ?  74  LYS A CA    1 
ATOM   515  C  C     . LYS A 1 74  ? -50.750 -62.969 41.873  1.00 34.63  ?  74  LYS A C     1 
ATOM   516  O  O     . LYS A 1 74  ? -50.027 -63.595 42.673  1.00 34.34  ?  74  LYS A O     1 
ATOM   517  C  CB    . LYS A 1 74  ? -51.042 -64.845 40.261  1.00 42.90  ?  74  LYS A CB    1 
ATOM   518  C  CG    . LYS A 1 74  ? -51.070 -65.342 38.831  1.00 52.99  ?  74  LYS A CG    1 
ATOM   519  C  CD    . LYS A 1 74  ? -51.959 -64.517 37.970  1.00 60.03  ?  74  LYS A CD    1 
ATOM   520  C  CE    . LYS A 1 74  ? -52.642 -65.366 36.910  1.00 72.37  ?  74  LYS A CE    1 
ATOM   521  N  NZ    . LYS A 1 74  ? -54.047 -64.928 36.725  1.00 77.16  ?  74  LYS A NZ    1 
ATOM   522  N  N     . THR A 1 75  ? -51.620 -62.024 42.226  1.00 27.46  ?  75  THR A N     1 
ATOM   523  C  CA    . THR A 1 75  ? -51.539 -61.415 43.574  1.00 30.79  ?  75  THR A CA    1 
ATOM   524  C  C     . THR A 1 75  ? -52.919 -61.197 44.155  1.00 30.82  ?  75  THR A C     1 
ATOM   525  O  O     . THR A 1 75  ? -53.751 -60.689 43.411  1.00 28.04  ?  75  THR A O     1 
ATOM   526  C  CB    . THR A 1 75  ? -50.840 -60.054 43.484  1.00 34.36  ?  75  THR A CB    1 
ATOM   527  O  OG1   . THR A 1 75  ? -49.598 -60.211 42.809  1.00 32.88  ?  75  THR A OG1   1 
ATOM   528  C  CG2   . THR A 1 75  ? -50.615 -59.416 44.833  1.00 37.10  ?  75  THR A CG2   1 
ATOM   529  N  N     . ALA A 1 76  ? -53.116 -61.485 45.447  1.00 30.73  ?  76  ALA A N     1 
ATOM   530  C  CA    . ALA A 1 76  ? -54.399 -61.227 46.146  1.00 29.79  ?  76  ALA A CA    1 
ATOM   531  C  C     . ALA A 1 76  ? -54.493 -59.731 46.498  1.00 33.14  ?  76  ALA A C     1 
ATOM   532  O  O     . ALA A 1 76  ? -54.166 -59.354 47.656  1.00 33.57  ?  76  ALA A O     1 
ATOM   533  C  CB    . ALA A 1 76  ? -54.551 -62.120 47.333  1.00 28.16  ?  76  ALA A CB    1 
ATOM   534  N  N     . PHE A 1 77  ? -54.860 -58.912 45.506  1.00 27.95  ?  77  PHE A N     1 
ATOM   535  C  CA    . PHE A 1 77  ? -55.093 -57.465 45.659  1.00 31.94  ?  77  PHE A CA    1 
ATOM   536  C  C     . PHE A 1 77  ? -56.122 -57.018 44.619  1.00 35.29  ?  77  PHE A C     1 
ATOM   537  O  O     . PHE A 1 77  ? -55.931 -57.311 43.428  1.00 29.11  ?  77  PHE A O     1 
ATOM   538  C  CB    . PHE A 1 77  ? -53.789 -56.697 45.470  1.00 37.64  ?  77  PHE A CB    1 
ATOM   539  C  CG    . PHE A 1 77  ? -53.918 -55.199 45.525  1.00 33.06  ?  77  PHE A CG    1 
ATOM   540  C  CD1   . PHE A 1 77  ? -54.059 -54.561 46.740  1.00 33.40  ?  77  PHE A CD1   1 
ATOM   541  C  CD2   . PHE A 1 77  ? -53.829 -54.432 44.381  1.00 34.54  ?  77  PHE A CD2   1 
ATOM   542  C  CE1   . PHE A 1 77  ? -54.160 -53.180 46.816  1.00 36.91  ?  77  PHE A CE1   1 
ATOM   543  C  CE2   . PHE A 1 77  ? -53.925 -53.040 44.450  1.00 40.23  ?  77  PHE A CE2   1 
ATOM   544  C  CZ    . PHE A 1 77  ? -54.086 -52.414 45.670  1.00 37.12  ?  77  PHE A CZ    1 
ATOM   545  N  N     . THR A 1 78  ? -57.163 -56.310 45.070  1.00 38.88  ?  78  THR A N     1 
ATOM   546  C  CA    . THR A 1 78  ? -58.224 -55.750 44.206  1.00 34.73  ?  78  THR A CA    1 
ATOM   547  C  C     . THR A 1 78  ? -57.965 -54.265 44.079  1.00 33.18  ?  78  THR A C     1 
ATOM   548  O  O     . THR A 1 78  ? -57.622 -53.854 43.006  1.00 36.82  ?  78  THR A O     1 
ATOM   549  C  CB    . THR A 1 78  ? -59.624 -56.067 44.730  1.00 35.14  ?  78  THR A CB    1 
ATOM   550  O  OG1   . THR A 1 78  ? -59.648 -57.445 45.078  1.00 34.68  ?  78  THR A OG1   1 
ATOM   551  C  CG2   . THR A 1 78  ? -60.702 -55.815 43.695  1.00 35.46  ?  78  THR A CG2   1 
ATOM   552  N  N     . ARG A 1 79  ? -58.058 -53.518 45.166  1.00 39.97  ?  79  ARG A N     1 
ATOM   553  C  CA    . ARG A 1 79  ? -57.778 -52.050 45.165  1.00 43.62  ?  79  ARG A CA    1 
ATOM   554  C  C     . ARG A 1 79  ? -57.577 -51.514 46.581  1.00 36.91  ?  79  ARG A C     1 
ATOM   555  O  O     . ARG A 1 79  ? -58.050 -52.134 47.560  1.00 40.03  ?  79  ARG A O     1 
ATOM   556  C  CB    . ARG A 1 79  ? -58.917 -51.264 44.498  1.00 46.01  ?  79  ARG A CB    1 
ATOM   557  C  CG    . ARG A 1 79  ? -60.257 -51.302 45.213  1.00 45.89  ?  79  ARG A CG    1 
ATOM   558  C  CD    . ARG A 1 79  ? -61.327 -50.558 44.407  1.00 48.67  ?  79  ARG A CD    1 
ATOM   559  N  NE    . ARG A 1 79  ? -62.658 -50.662 45.016  1.00 55.26  ?  79  ARG A NE    1 
ATOM   560  C  CZ    . ARG A 1 79  ? -63.076 -49.926 46.063  1.00 63.34  ?  79  ARG A CZ    1 
ATOM   561  N  NH1   . ARG A 1 79  ? -62.299 -49.001 46.607  1.00 59.96  ?  79  ARG A NH1   1 
ATOM   562  N  NH2   . ARG A 1 79  ? -64.274 -50.112 46.584  1.00 61.41  ?  79  ARG A NH2   1 
ATOM   563  N  N     . LYS A 1 80  ? -56.947 -50.357 46.664  1.00 38.02  ?  80  LYS A N     1 
ATOM   564  C  CA    . LYS A 1 80  ? -56.837 -49.552 47.908  1.00 40.49  ?  80  LYS A CA    1 
ATOM   565  C  C     . LYS A 1 80  ? -58.240 -49.074 48.288  1.00 44.58  ?  80  LYS A C     1 
ATOM   566  O  O     . LYS A 1 80  ? -59.047 -48.805 47.389  1.00 49.43  ?  80  LYS A O     1 
ATOM   567  C  CB    . LYS A 1 80  ? -55.890 -48.358 47.702  1.00 38.15  ?  80  LYS A CB    1 
ATOM   568  C  CG    . LYS A 1 80  ? -55.226 -47.880 48.974  1.00 38.46  ?  80  LYS A CG    1 
ATOM   569  C  CD    . LYS A 1 80  ? -54.364 -46.680 48.749  1.00 44.27  ?  80  LYS A CD    1 
ATOM   570  C  CE    . LYS A 1 80  ? -53.392 -46.470 49.895  1.00 48.27  ?  80  LYS A CE    1 
ATOM   571  N  NZ    . LYS A 1 80  ? -53.062 -45.043 50.068  1.00 52.30  ?  80  LYS A NZ    1 
ATOM   572  N  N     . CYS A 1 81  ? -58.507 -48.976 49.578  1.00 47.81  ?  81  CYS A N     1 
ATOM   573  C  CA    . CYS A 1 81  ? -59.830 -48.612 50.119  1.00 49.38  ?  81  CYS A CA    1 
ATOM   574  C  C     . CYS A 1 81  ? -59.640 -47.616 51.269  1.00 45.04  ?  81  CYS A C     1 
ATOM   575  O  O     . CYS A 1 81  ? -59.769 -47.993 52.436  1.00 55.34  ?  81  CYS A O     1 
ATOM   576  C  CB    . CYS A 1 81  ? -60.577 -49.861 50.558  1.00 50.19  ?  81  CYS A CB    1 
ATOM   577  S  SG    . CYS A 1 81  ? -62.242 -49.433 51.095  1.00 66.50  ?  81  CYS A SG    1 
ATOM   578  N  N     . GLY A 1 82  ? -59.257 -46.399 50.921  1.00 43.72  ?  82  GLY A N     1 
ATOM   579  C  CA    . GLY A 1 82  ? -58.948 -45.320 51.860  1.00 43.68  ?  82  GLY A CA    1 
ATOM   580  C  C     . GLY A 1 82  ? -57.541 -45.434 52.396  1.00 44.65  ?  82  GLY A C     1 
ATOM   581  O  O     . GLY A 1 82  ? -56.781 -46.265 51.896  1.00 48.96  ?  82  GLY A O     1 
ATOM   582  N  N     . GLU A 1 83  ? -57.229 -44.616 53.397  1.00 47.72  ?  83  GLU A N     1 
ATOM   583  C  CA    . GLU A 1 83  ? -55.877 -44.465 53.967  1.00 52.84  ?  83  GLU A CA    1 
ATOM   584  C  C     . GLU A 1 83  ? -55.348 -45.793 54.541  1.00 47.13  ?  83  GLU A C     1 
ATOM   585  O  O     . GLU A 1 83  ? -54.121 -46.015 54.421  1.00 50.63  ?  83  GLU A O     1 
ATOM   586  C  CB    . GLU A 1 83  ? -55.898 -43.359 55.017  1.00 65.28  ?  83  GLU A CB    1 
ATOM   587  C  CG    . GLU A 1 83  ? -55.749 -41.956 54.438  1.00 81.05  ?  83  GLU A CG    1 
ATOM   588  C  CD    . GLU A 1 83  ? -54.307 -41.636 54.048  1.00 96.79  ?  83  GLU A CD    1 
ATOM   589  O  OE1   . GLU A 1 83  ? -53.790 -42.309 53.128  1.00 102.44 ?  83  GLU A OE1   1 
ATOM   590  O  OE2   . GLU A 1 83  ? -53.674 -40.761 54.696  1.00 101.91 ?  83  GLU A OE2   1 
ATOM   591  N  N     . THR A 1 84  ? -56.187 -46.642 55.145  1.00 40.45  ?  84  THR A N     1 
ATOM   592  C  CA    . THR A 1 84  ? -55.716 -47.691 56.092  1.00 39.96  ?  84  THR A CA    1 
ATOM   593  C  C     . THR A 1 84  ? -56.271 -49.076 55.762  1.00 35.97  ?  84  THR A C     1 
ATOM   594  O  O     . THR A 1 84  ? -56.005 -50.017 56.558  1.00 40.99  ?  84  THR A O     1 
ATOM   595  C  CB    . THR A 1 84  ? -55.992 -47.312 57.559  1.00 42.46  ?  84  THR A CB    1 
ATOM   596  O  OG1   . THR A 1 84  ? -57.405 -47.282 57.760  1.00 39.08  ?  84  THR A OG1   1 
ATOM   597  C  CG2   . THR A 1 84  ? -55.380 -45.980 57.951  1.00 42.97  ?  84  THR A CG2   1 
ATOM   598  N  N     . ALA A 1 85  ? -56.930 -49.264 54.629  1.00 34.28  ?  85  ALA A N     1 
ATOM   599  C  CA    . ALA A 1 85  ? -57.388 -50.621 54.230  1.00 37.69  ?  85  ALA A CA    1 
ATOM   600  C  C     . ALA A 1 85  ? -57.182 -50.850 52.732  1.00 35.86  ?  85  ALA A C     1 
ATOM   601  O  O     . ALA A 1 85  ? -56.856 -49.896 51.993  1.00 31.91  ?  85  ALA A O     1 
ATOM   602  C  CB    . ALA A 1 85  ? -58.838 -50.828 54.583  1.00 34.91  ?  85  ALA A CB    1 
ATOM   603  N  N     . PHE A 1 86  ? -57.446 -52.084 52.334  1.00 32.57  ?  86  PHE A N     1 
ATOM   604  C  CA    . PHE A 1 86  ? -57.417 -52.551 50.944  1.00 30.94  ?  86  PHE A CA    1 
ATOM   605  C  C     . PHE A 1 86  ? -58.362 -53.757 50.841  1.00 30.83  ?  86  PHE A C     1 
ATOM   606  O  O     . PHE A 1 86  ? -58.613 -54.416 51.817  1.00 27.44  ?  86  PHE A O     1 
ATOM   607  C  CB    . PHE A 1 86  ? -55.977 -52.740 50.458  1.00 32.66  ?  86  PHE A CB    1 
ATOM   608  C  CG    . PHE A 1 86  ? -55.274 -54.023 50.826  1.00 32.35  ?  86  PHE A CG    1 
ATOM   609  C  CD1   . PHE A 1 86  ? -55.482 -55.170 50.095  1.00 32.82  ?  86  PHE A CD1   1 
ATOM   610  C  CD2   . PHE A 1 86  ? -54.369 -54.061 51.868  1.00 33.63  ?  86  PHE A CD2   1 
ATOM   611  C  CE1   . PHE A 1 86  ? -54.803 -56.340 50.415  1.00 38.45  ?  86  PHE A CE1   1 
ATOM   612  C  CE2   . PHE A 1 86  ? -53.692 -55.223 52.192  1.00 35.65  ?  86  PHE A CE2   1 
ATOM   613  C  CZ    . PHE A 1 86  ? -53.915 -56.369 51.469  1.00 38.09  ?  86  PHE A CZ    1 
ATOM   614  N  N     . ILE A 1 87  ? -58.929 -53.938 49.656  1.00 32.73  ?  87  ILE A N     1 
ATOM   615  C  CA    . ILE A 1 87  ? -59.808 -55.070 49.288  1.00 33.25  ?  87  ILE A CA    1 
ATOM   616  C  C     . ILE A 1 87  ? -58.898 -56.121 48.644  1.00 35.33  ?  87  ILE A C     1 
ATOM   617  O  O     . ILE A 1 87  ? -58.055 -55.756 47.767  1.00 36.92  ?  87  ILE A O     1 
ATOM   618  C  CB    . ILE A 1 87  ? -60.887 -54.641 48.275  1.00 34.24  ?  87  ILE A CB    1 
ATOM   619  C  CG1   . ILE A 1 87  ? -61.546 -53.284 48.568  1.00 40.69  ?  87  ILE A CG1   1 
ATOM   620  C  CG2   . ILE A 1 87  ? -61.885 -55.752 48.087  1.00 36.13  ?  87  ILE A CG2   1 
ATOM   621  C  CD1   . ILE A 1 87  ? -62.664 -53.293 49.527  1.00 42.13  ?  87  ILE A CD1   1 
ATOM   622  N  N     . ALA A 1 88  ? -59.119 -57.383 48.973  1.00 32.06  ?  88  ALA A N     1 
ATOM   623  C  CA    . ALA A 1 88  ? -58.375 -58.493 48.374  1.00 31.86  ?  88  ALA A CA    1 
ATOM   624  C  C     . ALA A 1 88  ? -59.332 -59.647 48.119  1.00 34.12  ?  88  ALA A C     1 
ATOM   625  O  O     . ALA A 1 88  ? -60.357 -59.783 48.778  1.00 30.20  ?  88  ALA A O     1 
ATOM   626  C  CB    . ALA A 1 88  ? -57.262 -58.891 49.310  1.00 32.69  ?  88  ALA A CB    1 
ATOM   627  N  N     . PRO A 1 89  ? -58.999 -60.513 47.148  1.00 35.69  ?  89  PRO A N     1 
ATOM   628  C  CA    . PRO A 1 89  ? -59.573 -61.845 47.100  1.00 32.67  ?  89  PRO A CA    1 
ATOM   629  C  C     . PRO A 1 89  ? -59.250 -62.568 48.412  1.00 35.10  ?  89  PRO A C     1 
ATOM   630  O  O     . PRO A 1 89  ? -58.133 -62.492 48.899  1.00 33.04  ?  89  PRO A O     1 
ATOM   631  C  CB    . PRO A 1 89  ? -58.866 -62.534 45.911  1.00 36.85  ?  89  PRO A CB    1 
ATOM   632  C  CG    . PRO A 1 89  ? -58.231 -61.393 45.108  1.00 37.33  ?  89  PRO A CG    1 
ATOM   633  C  CD    . PRO A 1 89  ? -58.001 -60.268 46.093  1.00 35.75  ?  89  PRO A CD    1 
ATOM   634  N  N     . GLN A 1 90  ? -60.257 -63.240 48.960  1.00 36.81  ?  90  GLN A N     1 
ATOM   635  C  CA    . GLN A 1 90  ? -60.122 -64.090 50.155  1.00 33.27  ?  90  GLN A CA    1 
ATOM   636  C  C     . GLN A 1 90  ? -59.250 -65.286 49.792  1.00 34.76  ?  90  GLN A C     1 
ATOM   637  O  O     . GLN A 1 90  ? -59.500 -65.923 48.744  1.00 34.14  ?  90  GLN A O     1 
ATOM   638  C  CB    . GLN A 1 90  ? -61.510 -64.471 50.639  1.00 38.28  ?  90  GLN A CB    1 
ATOM   639  C  CG    . GLN A 1 90  ? -61.514 -65.360 51.873  1.00 44.29  ?  90  GLN A CG    1 
ATOM   640  C  CD    . GLN A 1 90  ? -62.918 -65.566 52.401  1.00 47.20  ?  90  GLN A CD    1 
ATOM   641  O  OE1   . GLN A 1 90  ? -63.928 -65.417 51.699  1.00 46.78  ?  90  GLN A OE1   1 
ATOM   642  N  NE2   . GLN A 1 90  ? -62.980 -65.923 53.665  1.00 39.12  ?  90  GLN A NE2   1 
ATOM   643  N  N     . CYS A 1 91  ? -58.280 -65.586 50.645  1.00 32.14  ?  91  CYS A N     1 
ATOM   644  C  CA    . CYS A 1 91  ? -57.414 -66.768 50.475  1.00 37.45  ?  91  CYS A CA    1 
ATOM   645  C  C     . CYS A 1 91  ? -57.455 -67.627 51.740  1.00 37.21  ?  91  CYS A C     1 
ATOM   646  O  O     . CYS A 1 91  ? -57.655 -67.075 52.820  1.00 42.75  ?  91  CYS A O     1 
ATOM   647  C  CB    . CYS A 1 91  ? -55.990 -66.310 50.166  1.00 44.53  ?  91  CYS A CB    1 
ATOM   648  S  SG    . CYS A 1 91  ? -55.852 -65.368 48.618  1.00 46.92  ?  91  CYS A SG    1 
ATOM   649  N  N     . GLU A 1 92  ? -57.323 -68.938 51.579  1.00 38.72  ?  92  GLU A N     1 
ATOM   650  C  CA    . GLU A 1 92  ? -56.881 -69.882 52.641  1.00 40.96  ?  92  GLU A CA    1 
ATOM   651  C  C     . GLU A 1 92  ? -55.346 -69.821 52.652  1.00 38.59  ?  92  GLU A C     1 
ATOM   652  O  O     . GLU A 1 92  ? -54.686 -70.307 51.673  1.00 30.08  ?  92  GLU A O     1 
ATOM   653  C  CB    . GLU A 1 92  ? -57.374 -71.307 52.379  1.00 45.96  ?  92  GLU A CB    1 
ATOM   654  C  CG    . GLU A 1 92  ? -58.874 -71.475 52.526  1.00 57.49  ?  92  GLU A CG    1 
ATOM   655  C  CD    . GLU A 1 92  ? -59.344 -71.629 53.958  1.00 63.31  ?  92  GLU A CD    1 
ATOM   656  O  OE1   . GLU A 1 92  ? -60.288 -70.903 54.350  1.00 59.00  ?  92  GLU A OE1   1 
ATOM   657  O  OE2   . GLU A 1 92  ? -58.745 -72.471 54.675  1.00 69.57  ?  92  GLU A OE2   1 
ATOM   658  N  N     . MET A 1 93  ? -54.795 -69.209 53.696  1.00 36.45  ?  93  MET A N     1 
ATOM   659  C  CA    . MET A 1 93  ? -53.357 -68.884 53.751  1.00 35.11  ?  93  MET A CA    1 
ATOM   660  C  C     . MET A 1 93  ? -52.563 -70.157 54.046  1.00 32.78  ?  93  MET A C     1 
ATOM   661  O  O     . MET A 1 93  ? -53.023 -70.962 54.821  1.00 37.12  ?  93  MET A O     1 
ATOM   662  C  CB    . MET A 1 93  ? -53.117 -67.800 54.789  1.00 35.90  ?  93  MET A CB    1 
ATOM   663  C  CG    . MET A 1 93  ? -53.788 -66.505 54.400  1.00 37.79  ?  93  MET A CG    1 
ATOM   664  S  SD    . MET A 1 93  ? -53.115 -65.836 52.854  1.00 42.44  ?  93  MET A SD    1 
ATOM   665  C  CE    . MET A 1 93  ? -51.424 -65.564 53.370  1.00 42.79  ?  93  MET A CE    1 
ATOM   666  N  N     . ILE A 1 94  ? -51.471 -70.376 53.318  1.00 32.59  ?  94  ILE A N     1 
ATOM   667  C  CA    . ILE A 1 94  ? -50.512 -71.492 53.546  1.00 34.61  ?  94  ILE A CA    1 
ATOM   668  C  C     . ILE A 1 94  ? -49.572 -71.035 54.655  1.00 38.45  ?  94  ILE A C     1 
ATOM   669  O  O     . ILE A 1 94  ? -48.995 -69.946 54.594  1.00 40.84  ?  94  ILE A O     1 
ATOM   670  C  CB    . ILE A 1 94  ? -49.807 -71.836 52.232  1.00 39.16  ?  94  ILE A CB    1 
ATOM   671  C  CG1   . ILE A 1 94  ? -50.849 -72.323 51.220  1.00 42.96  ?  94  ILE A CG1   1 
ATOM   672  C  CG2   . ILE A 1 94  ? -48.711 -72.852 52.443  1.00 34.87  ?  94  ILE A CG2   1 
ATOM   673  C  CD1   . ILE A 1 94  ? -50.464 -72.136 49.778  1.00 41.11  ?  94  ILE A CD1   1 
ATOM   674  N  N     . PRO A 1 95  ? -49.449 -71.798 55.758  1.00 37.61  ?  95  PRO A N     1 
ATOM   675  C  CA    . PRO A 1 95  ? -48.798 -71.281 56.965  1.00 36.43  ?  95  PRO A CA    1 
ATOM   676  C  C     . PRO A 1 95  ? -47.283 -71.521 56.873  1.00 35.51  ?  95  PRO A C     1 
ATOM   677  O  O     . PRO A 1 95  ? -46.707 -72.234 57.686  1.00 36.49  ?  95  PRO A O     1 
ATOM   678  C  CB    . PRO A 1 95  ? -49.537 -72.095 58.044  1.00 38.64  ?  95  PRO A CB    1 
ATOM   679  C  CG    . PRO A 1 95  ? -49.676 -73.467 57.393  1.00 37.26  ?  95  PRO A CG    1 
ATOM   680  C  CD    . PRO A 1 95  ? -49.941 -73.175 55.922  1.00 36.54  ?  95  PRO A CD    1 
ATOM   681  N  N     . ILE A 1 96  ? -46.682 -70.907 55.859  1.00 30.74  ?  96  ILE A N     1 
ATOM   682  C  CA    . ILE A 1 96  ? -45.225 -70.928 55.582  1.00 31.21  ?  96  ILE A CA    1 
ATOM   683  C  C     . ILE A 1 96  ? -44.792 -69.487 55.340  1.00 29.74  ?  96  ILE A C     1 
ATOM   684  O  O     . ILE A 1 96  ? -45.514 -68.771 54.594  1.00 34.37  ?  96  ILE A O     1 
ATOM   685  C  CB    . ILE A 1 96  ? -44.896 -71.813 54.369  1.00 32.77  ?  96  ILE A CB    1 
ATOM   686  C  CG1   . ILE A 1 96  ? -45.259 -73.282 54.584  1.00 34.90  ?  96  ILE A CG1   1 
ATOM   687  C  CG2   . ILE A 1 96  ? -43.445 -71.646 54.005  1.00 34.60  ?  96  ILE A CG2   1 
ATOM   688  C  CD1   . ILE A 1 96  ? -44.435 -73.964 55.687  1.00 33.86  ?  96  ILE A CD1   1 
ATOM   689  N  N     . GLU A 1 97  ? -43.669 -69.096 55.933  1.00 26.38  ?  97  GLU A N     1 
ATOM   690  C  CA    . GLU A 1 97  ? -42.940 -67.860 55.564  1.00 29.66  ?  97  GLU A CA    1 
ATOM   691  C  C     . GLU A 1 97  ? -41.865 -68.246 54.531  1.00 31.91  ?  97  GLU A C     1 
ATOM   692  O  O     . GLU A 1 97  ? -40.985 -69.091 54.831  1.00 29.43  ?  97  GLU A O     1 
ATOM   693  C  CB    . GLU A 1 97  ? -42.380 -67.201 56.822  1.00 36.07  ?  97  GLU A CB    1 
ATOM   694  C  CG    . GLU A 1 97  ? -43.480 -66.677 57.757  1.00 41.45  ?  97  GLU A CG    1 
ATOM   695  C  CD    . GLU A 1 97  ? -43.026 -66.006 59.043  1.00 43.16  ?  97  GLU A CD    1 
ATOM   696  O  OE1   . GLU A 1 97  ? -43.895 -65.538 59.767  1.00 53.66  ?  97  GLU A OE1   1 
ATOM   697  O  OE2   . GLU A 1 97  ? -41.802 -66.007 59.357  1.00 54.10  ?  97  GLU A OE2   1 
ATOM   698  N  N     . TRP A 1 98  ? -41.984 -67.676 53.339  1.00 28.81  ?  98  TRP A N     1 
ATOM   699  C  CA    . TRP A 1 98  ? -41.052 -67.820 52.203  1.00 26.76  ?  98  TRP A CA    1 
ATOM   700  C  C     . TRP A 1 98  ? -40.076 -66.647 52.259  1.00 29.21  ?  98  TRP A C     1 
ATOM   701  O  O     . TRP A 1 98  ? -40.504 -65.508 52.091  1.00 26.00  ?  98  TRP A O     1 
ATOM   702  C  CB    . TRP A 1 98  ? -41.842 -67.867 50.890  1.00 25.49  ?  98  TRP A CB    1 
ATOM   703  C  CG    . TRP A 1 98  ? -42.748 -69.064 50.786  1.00 25.22  ?  98  TRP A CG    1 
ATOM   704  C  CD1   . TRP A 1 98  ? -44.011 -69.171 51.255  1.00 26.57  ?  98  TRP A CD1   1 
ATOM   705  C  CD2   . TRP A 1 98  ? -42.425 -70.358 50.227  1.00 28.61  ?  98  TRP A CD2   1 
ATOM   706  N  NE1   . TRP A 1 98  ? -44.506 -70.428 51.020  1.00 28.43  ?  98  TRP A NE1   1 
ATOM   707  C  CE2   . TRP A 1 98  ? -43.554 -71.178 50.411  1.00 26.90  ?  98  TRP A CE2   1 
ATOM   708  C  CE3   . TRP A 1 98  ? -41.268 -70.911 49.648  1.00 29.04  ?  98  TRP A CE3   1 
ATOM   709  C  CZ2   . TRP A 1 98  ? -43.571 -72.516 50.038  1.00 30.50  ?  98  TRP A CZ2   1 
ATOM   710  C  CZ3   . TRP A 1 98  ? -41.302 -72.227 49.230  1.00 29.77  ?  98  TRP A CZ3   1 
ATOM   711  C  CH2   . TRP A 1 98  ? -42.437 -73.021 49.434  1.00 28.00  ?  98  TRP A CH2   1 
ATOM   712  N  N     . VAL A 1 99  ? -38.800 -66.941 52.500  1.00 29.26  ?  99  VAL A N     1 
ATOM   713  C  CA    . VAL A 1 99  ? -37.745 -65.902 52.545  1.00 30.31  ?  99  VAL A CA    1 
ATOM   714  C  C     . VAL A 1 99  ? -36.861 -66.028 51.308  1.00 31.27  ?  99  VAL A C     1 
ATOM   715  O  O     . VAL A 1 99  ? -36.569 -67.155 50.872  1.00 31.14  ?  99  VAL A O     1 
ATOM   716  C  CB    . VAL A 1 99  ? -36.935 -66.033 53.839  1.00 29.98  ?  99  VAL A CB    1 
ATOM   717  C  CG1   . VAL A 1 99  ? -35.729 -65.087 53.859  1.00 32.04  ?  99  VAL A CG1   1 
ATOM   718  C  CG2   . VAL A 1 99  ? -37.839 -65.804 55.053  1.00 26.60  ?  99  VAL A CG2   1 
ATOM   719  N  N     . CYS A 1 100 ? -36.438 -64.889 50.786  1.00 28.51  ?  100 CYS A N     1 
ATOM   720  C  CA    . CYS A 1 100 ? -35.446 -64.805 49.701  1.00 27.97  ?  100 CYS A CA    1 
ATOM   721  C  C     . CYS A 1 100 ? -34.316 -63.868 50.126  1.00 25.96  ?  100 CYS A C     1 
ATOM   722  O  O     . CYS A 1 100 ? -34.624 -62.762 50.616  1.00 24.52  ?  100 CYS A O     1 
ATOM   723  C  CB    . CYS A 1 100 ? -36.084 -64.284 48.417  1.00 27.58  ?  100 CYS A CB    1 
ATOM   724  S  SG    . CYS A 1 100 ? -35.087 -64.751 46.981  1.00 33.18  ?  100 CYS A SG    1 
ATOM   725  N  N     . ARG A 1 101 ? -33.064 -64.271 49.877  1.00 24.55  ?  101 ARG A N     1 
ATOM   726  C  CA    . ARG A 1 101 ? -31.869 -63.509 50.300  1.00 26.88  ?  101 ARG A CA    1 
ATOM   727  C  C     . ARG A 1 101 ? -31.003 -63.209 49.081  1.00 28.14  ?  101 ARG A C     1 
ATOM   728  O  O     . ARG A 1 101 ? -30.715 -64.132 48.356  1.00 30.40  ?  101 ARG A O     1 
ATOM   729  C  CB    . ARG A 1 101 ? -31.091 -64.311 51.345  1.00 26.20  ?  101 ARG A CB    1 
ATOM   730  C  CG    . ARG A 1 101 ? -31.843 -64.577 52.630  1.00 26.27  ?  101 ARG A CG    1 
ATOM   731  C  CD    . ARG A 1 101 ? -31.001 -65.307 53.680  1.00 29.90  ?  101 ARG A CD    1 
ATOM   732  N  NE    . ARG A 1 101 ? -31.874 -65.958 54.645  1.00 27.74  ?  101 ARG A NE    1 
ATOM   733  C  CZ    . ARG A 1 101 ? -32.357 -65.388 55.720  1.00 27.44  ?  101 ARG A CZ    1 
ATOM   734  N  NH1   . ARG A 1 101 ? -31.997 -64.163 56.043  1.00 27.79  ?  101 ARG A NH1   1 
ATOM   735  N  NH2   . ARG A 1 101 ? -33.187 -66.073 56.498  1.00 32.85  ?  101 ARG A NH2   1 
ATOM   736  N  N     . ARG A 1 102 ? -30.607 -61.954 48.899  1.00 29.45  ?  102 ARG A N     1 
ATOM   737  C  CA    . ARG A 1 102 ? -29.456 -61.559 48.076  1.00 28.71  ?  102 ARG A CA    1 
ATOM   738  C  C     . ARG A 1 102 ? -28.195 -61.522 48.942  1.00 28.99  ?  102 ARG A C     1 
ATOM   739  O  O     . ARG A 1 102 ? -27.146 -61.925 48.422  1.00 28.95  ?  102 ARG A O     1 
ATOM   740  C  CB    . ARG A 1 102 ? -29.636 -60.188 47.437  1.00 29.88  ?  102 ARG A CB    1 
ATOM   741  C  CG    . ARG A 1 102 ? -28.442 -59.766 46.587  1.00 29.33  ?  102 ARG A CG    1 
ATOM   742  C  CD    . ARG A 1 102 ? -28.201 -60.745 45.454  1.00 29.84  ?  102 ARG A CD    1 
ATOM   743  N  NE    . ARG A 1 102 ? -29.159 -60.525 44.378  1.00 30.23  ?  102 ARG A NE    1 
ATOM   744  C  CZ    . ARG A 1 102 ? -29.326 -61.314 43.342  1.00 28.69  ?  102 ARG A CZ    1 
ATOM   745  N  NH1   . ARG A 1 102 ? -28.602 -62.407 43.176  1.00 30.12  ?  102 ARG A NH1   1 
ATOM   746  N  NH2   . ARG A 1 102 ? -30.216 -61.004 42.446  1.00 29.59  ?  102 ARG A NH2   1 
ATOM   747  N  N     . ILE A 1 103 ? -28.279 -61.050 50.185  1.00 27.91  ?  103 ILE A N     1 
ATOM   748  C  CA    . ILE A 1 103 ? -27.087 -60.819 51.067  1.00 29.29  ?  103 ILE A CA    1 
ATOM   749  C  C     . ILE A 1 103 ? -27.297 -61.581 52.376  1.00 29.50  ?  103 ILE A C     1 
ATOM   750  O  O     . ILE A 1 103 ? -28.375 -61.489 52.952  1.00 35.09  ?  103 ILE A O     1 
ATOM   751  C  CB    . ILE A 1 103 ? -26.854 -59.310 51.300  1.00 29.75  ?  103 ILE A CB    1 
ATOM   752  C  CG1   . ILE A 1 103 ? -26.563 -58.581 49.996  1.00 31.23  ?  103 ILE A CG1   1 
ATOM   753  C  CG2   . ILE A 1 103 ? -25.759 -59.049 52.307  1.00 30.79  ?  103 ILE A CG2   1 
ATOM   754  C  CD1   . ILE A 1 103 ? -26.690 -57.078 50.074  1.00 34.09  ?  103 ILE A CD1   1 
ATOM   755  N  N     . ALA A 1 104 ? -26.294 -62.319 52.821  1.00 29.25  ?  104 ALA A N     1 
ATOM   756  C  CA    . ALA A 1 104 ? -26.343 -63.079 54.089  1.00 29.21  ?  104 ALA A CA    1 
ATOM   757  C  C     . ALA A 1 104 ? -26.321 -62.090 55.257  1.00 30.82  ?  104 ALA A C     1 
ATOM   758  O  O     . ALA A 1 104 ? -25.342 -61.331 55.387  1.00 34.75  ?  104 ALA A O     1 
ATOM   759  C  CB    . ALA A 1 104 ? -25.214 -64.054 54.152  1.00 28.60  ?  104 ALA A CB    1 
ATOM   760  N  N     . THR A 1 105 ? -27.376 -62.102 56.068  1.00 31.85  ?  105 THR A N     1 
ATOM   761  C  CA    . THR A 1 105 ? -27.480 -61.347 57.345  1.00 35.44  ?  105 THR A CA    1 
ATOM   762  C  C     . THR A 1 105 ? -28.502 -62.051 58.239  1.00 30.83  ?  105 THR A C     1 
ATOM   763  O  O     . THR A 1 105 ? -29.012 -63.099 57.815  1.00 32.37  ?  105 THR A O     1 
ATOM   764  C  CB    . THR A 1 105 ? -27.819 -59.864 57.105  1.00 39.54  ?  105 THR A CB    1 
ATOM   765  O  OG1   . THR A 1 105 ? -27.775 -59.162 58.351  1.00 34.98  ?  105 THR A OG1   1 
ATOM   766  C  CG2   . THR A 1 105 ? -29.182 -59.651 56.479  1.00 36.98  ?  105 THR A CG2   1 
ATOM   767  N  N     . GLY A 1 106 ? -28.755 -61.505 59.424  1.00 27.38  ?  106 GLY A N     1 
ATOM   768  C  CA    . GLY A 1 106 ? -29.861 -61.973 60.285  1.00 26.01  ?  106 GLY A CA    1 
ATOM   769  C  C     . GLY A 1 106 ? -29.762 -63.453 60.608  1.00 25.59  ?  106 GLY A C     1 
ATOM   770  O  O     . GLY A 1 106 ? -28.688 -63.889 61.042  1.00 30.50  ?  106 GLY A O     1 
ATOM   771  N  N     . SER A 1 107 ? -30.842 -64.214 60.402  1.00 24.31  ?  107 SER A N     1 
ATOM   772  C  CA    . SER A 1 107 ? -30.933 -65.618 60.856  1.00 25.54  ?  107 SER A CA    1 
ATOM   773  C  C     . SER A 1 107 ? -30.025 -66.504 60.002  1.00 28.33  ?  107 SER A C     1 
ATOM   774  O  O     . SER A 1 107 ? -29.631 -67.616 60.468  1.00 29.73  ?  107 SER A O     1 
ATOM   775  C  CB    . SER A 1 107 ? -32.352 -66.101 60.873  1.00 27.90  ?  107 SER A CB    1 
ATOM   776  O  OG    . SER A 1 107 ? -32.865 -66.215 59.558  1.00 31.78  ?  107 SER A OG    1 
ATOM   777  N  N     . PHE A 1 108 ? -29.681 -66.072 58.792  1.00 30.04  ?  108 PHE A N     1 
ATOM   778  C  CA    . PHE A 1 108 ? -28.802 -66.915 57.954  1.00 28.59  ?  108 PHE A CA    1 
ATOM   779  C  C     . PHE A 1 108 ? -27.451 -67.109 58.645  1.00 30.79  ?  108 PHE A C     1 
ATOM   780  O  O     . PHE A 1 108 ? -26.950 -68.219 58.610  1.00 28.43  ?  108 PHE A O     1 
ATOM   781  C  CB    . PHE A 1 108 ? -28.637 -66.378 56.546  1.00 27.41  ?  108 PHE A CB    1 
ATOM   782  C  CG    . PHE A 1 108 ? -27.941 -67.382 55.679  1.00 26.97  ?  108 PHE A CG    1 
ATOM   783  C  CD1   . PHE A 1 108 ? -28.652 -68.374 55.032  1.00 31.44  ?  108 PHE A CD1   1 
ATOM   784  C  CD2   . PHE A 1 108 ? -26.570 -67.379 55.565  1.00 30.69  ?  108 PHE A CD2   1 
ATOM   785  C  CE1   . PHE A 1 108 ? -28.003 -69.315 54.265  1.00 28.05  ?  108 PHE A CE1   1 
ATOM   786  C  CE2   . PHE A 1 108 ? -25.922 -68.328 54.784  1.00 31.89  ?  108 PHE A CE2   1 
ATOM   787  C  CZ    . PHE A 1 108 ? -26.647 -69.285 54.142  1.00 27.95  ?  108 PHE A CZ    1 
ATOM   788  N  N     . LEU A 1 109 ? -26.890 -66.047 59.227  1.00 32.70  ?  109 LEU A N     1 
ATOM   789  C  CA    . LEU A 1 109 ? -25.595 -66.084 59.960  1.00 35.35  ?  109 LEU A CA    1 
ATOM   790  C  C     . LEU A 1 109 ? -25.728 -66.956 61.211  1.00 33.55  ?  109 LEU A C     1 
ATOM   791  O  O     . LEU A 1 109 ? -24.788 -67.692 61.494  1.00 36.68  ?  109 LEU A O     1 
ATOM   792  C  CB    . LEU A 1 109 ? -25.152 -64.668 60.345  1.00 35.84  ?  109 LEU A CB    1 
ATOM   793  C  CG    . LEU A 1 109 ? -25.069 -63.648 59.203  1.00 35.96  ?  109 LEU A CG    1 
ATOM   794  C  CD1   . LEU A 1 109 ? -24.562 -62.279 59.710  1.00 35.90  ?  109 LEU A CD1   1 
ATOM   795  C  CD2   . LEU A 1 109 ? -24.190 -64.180 58.086  1.00 35.53  ?  109 LEU A CD2   1 
ATOM   796  N  N     . LYS A 1 110 ? -26.827 -66.869 61.946  1.00 36.87  ?  110 LYS A N     1 
ATOM   797  C  CA    . LYS A 1 110 ? -27.014 -67.679 63.188  1.00 45.13  ?  110 LYS A CA    1 
ATOM   798  C  C     . LYS A 1 110 ? -27.045 -69.173 62.843  1.00 38.72  ?  110 LYS A C     1 
ATOM   799  O  O     . LYS A 1 110 ? -26.392 -69.951 63.545  1.00 38.87  ?  110 LYS A O     1 
ATOM   800  C  CB    . LYS A 1 110 ? -28.274 -67.239 63.941  1.00 54.14  ?  110 LYS A CB    1 
ATOM   801  C  CG    . LYS A 1 110 ? -28.056 -66.189 65.023  1.00 71.47  ?  110 LYS A CG    1 
ATOM   802  C  CD    . LYS A 1 110 ? -28.945 -66.414 66.274  1.00 95.24  ?  110 LYS A CD    1 
ATOM   803  C  CE    . LYS A 1 110 ? -28.311 -66.009 67.599  1.00 102.57 ?  110 LYS A CE    1 
ATOM   804  N  NZ    . LYS A 1 110 ? -28.434 -64.553 67.850  1.00 106.68 ?  110 LYS A NZ    1 
ATOM   805  N  N     . ARG A 1 111 ? -27.728 -69.553 61.772  1.00 34.45  ?  111 ARG A N     1 
ATOM   806  C  CA    . ARG A 1 111 ? -27.898 -70.982 61.367  1.00 36.10  ?  111 ARG A CA    1 
ATOM   807  C  C     . ARG A 1 111 ? -26.667 -71.492 60.595  1.00 36.29  ?  111 ARG A C     1 
ATOM   808  O  O     . ARG A 1 111 ? -26.527 -72.713 60.456  1.00 31.38  ?  111 ARG A O     1 
ATOM   809  C  CB    . ARG A 1 111 ? -29.190 -71.138 60.567  1.00 36.09  ?  111 ARG A CB    1 
ATOM   810  C  CG    . ARG A 1 111 ? -30.448 -71.169 61.423  1.00 36.17  ?  111 ARG A CG    1 
ATOM   811  C  CD    . ARG A 1 111 ? -31.741 -70.761 60.732  1.00 37.40  ?  111 ARG A CD    1 
ATOM   812  N  NE    . ARG A 1 111 ? -31.574 -71.023 59.327  1.00 45.58  ?  111 ARG A NE    1 
ATOM   813  C  CZ    . ARG A 1 111 ? -31.692 -70.163 58.337  1.00 40.72  ?  111 ARG A CZ    1 
ATOM   814  N  NH1   . ARG A 1 111 ? -32.034 -68.905 58.534  1.00 39.92  ?  111 ARG A NH1   1 
ATOM   815  N  NH2   . ARG A 1 111 ? -31.441 -70.586 57.130  1.00 44.08  ?  111 ARG A NH2   1 
ATOM   816  N  N     . ASN A 1 112 ? -25.801 -70.586 60.115  1.00 33.21  ?  112 ASN A N     1 
ATOM   817  C  CA    . ASN A 1 112 ? -24.575 -70.928 59.344  1.00 32.65  ?  112 ASN A CA    1 
ATOM   818  C  C     . ASN A 1 112 ? -23.363 -70.197 59.922  1.00 37.06  ?  112 ASN A C     1 
ATOM   819  O  O     . ASN A 1 112 ? -22.754 -69.372 59.225  1.00 35.85  ?  112 ASN A O     1 
ATOM   820  C  CB    . ASN A 1 112 ? -24.719 -70.570 57.868  1.00 30.15  ?  112 ASN A CB    1 
ATOM   821  C  CG    . ASN A 1 112 ? -25.860 -71.291 57.192  1.00 33.22  ?  112 ASN A CG    1 
ATOM   822  O  OD1   . ASN A 1 112 ? -25.649 -72.309 56.529  1.00 35.52  ?  112 ASN A OD1   1 
ATOM   823  N  ND2   . ASN A 1 112 ? -27.062 -70.751 57.337  1.00 33.79  ?  112 ASN A ND2   1 
ATOM   824  N  N     . PRO A 1 113 ? -22.953 -70.495 61.181  1.00 34.79  ?  113 PRO A N     1 
ATOM   825  C  CA    . PRO A 1 113 ? -21.762 -69.887 61.772  1.00 36.55  ?  113 PRO A CA    1 
ATOM   826  C  C     . PRO A 1 113 ? -20.544 -70.105 60.854  1.00 37.60  ?  113 PRO A C     1 
ATOM   827  O  O     . PRO A 1 113 ? -20.395 -71.187 60.304  1.00 36.67  ?  113 PRO A O     1 
ATOM   828  C  CB    . PRO A 1 113 ? -21.585 -70.588 63.141  1.00 38.67  ?  113 PRO A CB    1 
ATOM   829  C  CG    . PRO A 1 113 ? -22.436 -71.870 63.032  1.00 39.12  ?  113 PRO A CG    1 
ATOM   830  C  CD    . PRO A 1 113 ? -23.554 -71.507 62.073  1.00 39.75  ?  113 PRO A CD    1 
ATOM   831  N  N     . GLY A 1 114 ? -19.773 -69.028 60.641  1.00 35.82  ?  114 GLY A N     1 
ATOM   832  C  CA    . GLY A 1 114 ? -18.618 -68.988 59.738  1.00 33.09  ?  114 GLY A CA    1 
ATOM   833  C  C     . GLY A 1 114 ? -18.882 -68.136 58.524  1.00 32.28  ?  114 GLY A C     1 
ATOM   834  O  O     . GLY A 1 114 ? -17.941 -67.611 57.944  1.00 37.34  ?  114 GLY A O     1 
ATOM   835  N  N     . VAL A 1 115 ? -20.123 -68.054 58.085  1.00 32.39  ?  115 VAL A N     1 
ATOM   836  C  CA    . VAL A 1 115 ? -20.492 -67.160 56.964  1.00 29.99  ?  115 VAL A CA    1 
ATOM   837  C  C     . VAL A 1 115 ? -20.451 -65.750 57.526  1.00 32.77  ?  115 VAL A C     1 
ATOM   838  O  O     . VAL A 1 115 ? -20.932 -65.579 58.639  1.00 30.63  ?  115 VAL A O     1 
ATOM   839  C  CB    . VAL A 1 115 ? -21.857 -67.494 56.359  1.00 28.68  ?  115 VAL A CB    1 
ATOM   840  C  CG1   . VAL A 1 115 ? -22.213 -66.551 55.224  1.00 27.90  ?  115 VAL A CG1   1 
ATOM   841  C  CG2   . VAL A 1 115 ? -21.921 -68.937 55.887  1.00 31.37  ?  115 VAL A CG2   1 
ATOM   842  N  N     . LYS A 1 116 ? -19.848 -64.824 56.780  1.00 34.66  ?  116 LYS A N     1 
ATOM   843  C  CA    . LYS A 1 116 ? -19.682 -63.408 57.172  1.00 39.52  ?  116 LYS A CA    1 
ATOM   844  C  C     . LYS A 1 116 ? -20.870 -62.614 56.625  1.00 37.49  ?  116 LYS A C     1 
ATOM   845  O  O     . LYS A 1 116 ? -21.345 -62.933 55.499  1.00 41.67  ?  116 LYS A O     1 
ATOM   846  C  CB    . LYS A 1 116 ? -18.376 -62.856 56.586  1.00 52.85  ?  116 LYS A CB    1 
ATOM   847  C  CG    . LYS A 1 116 ? -17.118 -63.031 57.432  1.00 66.20  ?  116 LYS A CG    1 
ATOM   848  C  CD    . LYS A 1 116 ? -16.331 -64.289 57.168  1.00 82.13  ?  116 LYS A CD    1 
ATOM   849  C  CE    . LYS A 1 116 ? -15.123 -64.429 58.082  1.00 89.34  ?  116 LYS A CE    1 
ATOM   850  N  NZ    . LYS A 1 116 ? -14.845 -65.851 58.405  1.00 81.58  ?  116 LYS A NZ    1 
ATOM   851  N  N     . GLU A 1 117 ? -21.272 -61.557 57.320  1.00 35.44  ?  117 GLU A N     1 
ATOM   852  C  CA    . GLU A 1 117 ? -22.263 -60.600 56.803  1.00 41.55  ?  117 GLU A CA    1 
ATOM   853  C  C     . GLU A 1 117 ? -21.750 -60.077 55.454  1.00 41.32  ?  117 GLU A C     1 
ATOM   854  O  O     . GLU A 1 117 ? -20.601 -59.674 55.384  1.00 36.19  ?  117 GLU A O     1 
ATOM   855  C  CB    . GLU A 1 117 ? -22.436 -59.470 57.807  1.00 46.13  ?  117 GLU A CB    1 
ATOM   856  C  CG    . GLU A 1 117 ? -23.303 -58.350 57.280  1.00 56.40  ?  117 GLU A CG    1 
ATOM   857  C  CD    . GLU A 1 117 ? -24.516 -58.107 58.153  1.00 64.23  ?  117 GLU A CD    1 
ATOM   858  O  OE1   . GLU A 1 117 ? -24.722 -56.980 58.541  1.00 78.95  ?  117 GLU A OE1   1 
ATOM   859  O  OE2   . GLU A 1 117 ? -25.237 -59.059 58.443  1.00 81.48  ?  117 GLU A OE2   1 
ATOM   860  N  N     . GLY A 1 118 ? -22.591 -60.087 54.419  1.00 39.62  ?  118 GLY A N     1 
ATOM   861  C  CA    . GLY A 1 118 ? -22.246 -59.570 53.077  1.00 34.90  ?  118 GLY A CA    1 
ATOM   862  C  C     . GLY A 1 118 ? -22.053 -60.656 52.035  1.00 33.07  ?  118 GLY A C     1 
ATOM   863  O  O     . GLY A 1 118 ? -21.935 -60.313 50.856  1.00 33.49  ?  118 GLY A O     1 
ATOM   864  N  N     . TYR A 1 119 ? -22.028 -61.928 52.434  1.00 31.89  ?  119 TYR A N     1 
ATOM   865  C  CA    . TYR A 1 119 ? -21.978 -63.065 51.484  1.00 32.84  ?  119 TYR A CA    1 
ATOM   866  C  C     . TYR A 1 119 ? -23.142 -62.936 50.478  1.00 33.94  ?  119 TYR A C     1 
ATOM   867  O  O     . TYR A 1 119 ? -24.310 -62.855 50.886  1.00 32.82  ?  119 TYR A O     1 
ATOM   868  C  CB    . TYR A 1 119 ? -22.039 -64.407 52.205  1.00 29.67  ?  119 TYR A CB    1 
ATOM   869  C  CG    . TYR A 1 119 ? -21.837 -65.574 51.287  1.00 35.47  ?  119 TYR A CG    1 
ATOM   870  C  CD1   . TYR A 1 119 ? -22.866 -66.045 50.497  1.00 38.59  ?  119 TYR A CD1   1 
ATOM   871  C  CD2   . TYR A 1 119 ? -20.601 -66.149 51.122  1.00 42.02  ?  119 TYR A CD2   1 
ATOM   872  C  CE1   . TYR A 1 119 ? -22.707 -67.098 49.624  1.00 37.44  ?  119 TYR A CE1   1 
ATOM   873  C  CE2   . TYR A 1 119 ? -20.413 -67.205 50.247  1.00 43.95  ?  119 TYR A CE2   1 
ATOM   874  C  CZ    . TYR A 1 119 ? -21.472 -67.694 49.509  1.00 44.83  ?  119 TYR A CZ    1 
ATOM   875  O  OH    . TYR A 1 119 ? -21.261 -68.737 48.653  1.00 46.77  ?  119 TYR A OH    1 
ATOM   876  N  N     . LYS A 1 120 ? -22.839 -62.969 49.189  1.00 32.54  ?  120 LYS A N     1 
ATOM   877  C  CA    . LYS A 1 120 ? -23.867 -62.764 48.140  1.00 36.43  ?  120 LYS A CA    1 
ATOM   878  C  C     . LYS A 1 120 ? -24.357 -64.091 47.591  1.00 30.59  ?  120 LYS A C     1 
ATOM   879  O  O     . LYS A 1 120 ? -23.554 -64.969 47.310  1.00 39.00  ?  120 LYS A O     1 
ATOM   880  C  CB    . LYS A 1 120 ? -23.332 -61.910 47.002  1.00 42.69  ?  120 LYS A CB    1 
ATOM   881  C  CG    . LYS A 1 120 ? -22.829 -60.539 47.403  1.00 50.19  ?  120 LYS A CG    1 
ATOM   882  C  CD    . LYS A 1 120 ? -23.923 -59.539 47.587  1.00 64.34  ?  120 LYS A CD    1 
ATOM   883  C  CE    . LYS A 1 120 ? -23.833 -58.413 46.581  1.00 72.18  ?  120 LYS A CE    1 
ATOM   884  N  NZ    . LYS A 1 120 ? -24.155 -57.115 47.215  1.00 78.19  ?  120 LYS A NZ    1 
ATOM   885  N  N     . PHE A 1 121 ? -25.663 -64.203 47.435  1.00 29.35  ?  121 PHE A N     1 
ATOM   886  C  CA    . PHE A 1 121 ? -26.316 -65.407 46.864  1.00 31.03  ?  121 PHE A CA    1 
ATOM   887  C  C     . PHE A 1 121 ? -26.605 -65.173 45.372  1.00 29.54  ?  121 PHE A C     1 
ATOM   888  O  O     . PHE A 1 121 ? -27.351 -64.275 45.028  1.00 27.40  ?  121 PHE A O     1 
ATOM   889  C  CB    . PHE A 1 121 ? -27.563 -65.768 47.663  1.00 29.55  ?  121 PHE A CB    1 
ATOM   890  C  CG    . PHE A 1 121 ? -27.300 -66.056 49.118  1.00 24.56  ?  121 PHE A CG    1 
ATOM   891  C  CD1   . PHE A 1 121 ? -26.707 -67.245 49.512  1.00 23.89  ?  121 PHE A CD1   1 
ATOM   892  C  CD2   . PHE A 1 121 ? -27.700 -65.163 50.095  1.00 23.75  ?  121 PHE A CD2   1 
ATOM   893  C  CE1   . PHE A 1 121 ? -26.527 -67.537 50.853  1.00 23.02  ?  121 PHE A CE1   1 
ATOM   894  C  CE2   . PHE A 1 121 ? -27.505 -65.431 51.448  1.00 23.64  ?  121 PHE A CE2   1 
ATOM   895  C  CZ    . PHE A 1 121 ? -26.947 -66.636 51.826  1.00 23.96  ?  121 PHE A CZ    1 
ATOM   896  N  N     . TYR A 1 122 ? -25.952 -65.966 44.513  1.00 28.64  ?  122 TYR A N     1 
ATOM   897  C  CA    . TYR A 1 122 ? -26.202 -66.056 43.058  1.00 27.61  ?  122 TYR A CA    1 
ATOM   898  C  C     . TYR A 1 122 ? -26.557 -67.501 42.726  1.00 28.10  ?  122 TYR A C     1 
ATOM   899  O  O     . TYR A 1 122 ? -25.680 -68.364 42.792  1.00 31.69  ?  122 TYR A O     1 
ATOM   900  C  CB    . TYR A 1 122 ? -24.947 -65.586 42.317  1.00 28.06  ?  122 TYR A CB    1 
ATOM   901  C  CG    . TYR A 1 122 ? -24.376 -64.233 42.683  1.00 26.48  ?  122 TYR A CG    1 
ATOM   902  C  CD1   . TYR A 1 122 ? -25.075 -63.067 42.469  1.00 28.02  ?  122 TYR A CD1   1 
ATOM   903  C  CD2   . TYR A 1 122 ? -23.088 -64.110 43.144  1.00 31.44  ?  122 TYR A CD2   1 
ATOM   904  C  CE1   . TYR A 1 122 ? -24.560 -61.820 42.775  1.00 32.26  ?  122 TYR A CE1   1 
ATOM   905  C  CE2   . TYR A 1 122 ? -22.533 -62.873 43.456  1.00 32.63  ?  122 TYR A CE2   1 
ATOM   906  C  CZ    . TYR A 1 122 ? -23.277 -61.715 43.273  1.00 37.45  ?  122 TYR A CZ    1 
ATOM   907  O  OH    . TYR A 1 122 ? -22.767 -60.465 43.528  1.00 37.10  ?  122 TYR A OH    1 
ATOM   908  N  N     . PRO A 1 123 ? -27.835 -67.876 42.462  1.00 30.13  ?  123 PRO A N     1 
ATOM   909  C  CA    . PRO A 1 123 ? -28.990 -66.961 42.493  1.00 30.40  ?  123 PRO A CA    1 
ATOM   910  C  C     . PRO A 1 123 ? -29.489 -66.721 43.919  1.00 27.85  ?  123 PRO A C     1 
ATOM   911  O  O     . PRO A 1 123 ? -28.998 -67.345 44.852  1.00 29.49  ?  123 PRO A O     1 
ATOM   912  C  CB    . PRO A 1 123 ? -30.068 -67.684 41.652  1.00 29.29  ?  123 PRO A CB    1 
ATOM   913  C  CG    . PRO A 1 123 ? -29.748 -69.163 41.881  1.00 29.73  ?  123 PRO A CG    1 
ATOM   914  C  CD    . PRO A 1 123 ? -28.249 -69.263 42.177  1.00 28.56  ?  123 PRO A CD    1 
ATOM   915  N  N     . PRO A 1 124 ? -30.442 -65.786 44.128  1.00 27.94  ?  124 PRO A N     1 
ATOM   916  C  CA    . PRO A 1 124 ? -30.972 -65.522 45.466  1.00 24.45  ?  124 PRO A CA    1 
ATOM   917  C  C     . PRO A 1 124 ? -31.450 -66.827 46.135  1.00 27.86  ?  124 PRO A C     1 
ATOM   918  O  O     . PRO A 1 124 ? -32.067 -67.636 45.498  1.00 29.65  ?  124 PRO A O     1 
ATOM   919  C  CB    . PRO A 1 124 ? -32.144 -64.555 45.245  1.00 26.57  ?  124 PRO A CB    1 
ATOM   920  C  CG    . PRO A 1 124 ? -31.834 -63.905 43.891  1.00 28.81  ?  124 PRO A CG    1 
ATOM   921  C  CD    . PRO A 1 124 ? -31.075 -64.939 43.079  1.00 26.36  ?  124 PRO A CD    1 
ATOM   922  N  N     . LYS A 1 125 ? -31.110 -66.992 47.408  1.00 27.11  ?  125 LYS A N     1 
ATOM   923  C  CA    . LYS A 1 125 ? -31.433 -68.146 48.258  1.00 29.78  ?  125 LYS A CA    1 
ATOM   924  C  C     . LYS A 1 125 ? -32.886 -68.030 48.712  1.00 31.27  ?  125 LYS A C     1 
ATOM   925  O  O     . LYS A 1 125 ? -33.281 -66.973 49.274  1.00 31.86  ?  125 LYS A O     1 
ATOM   926  C  CB    . LYS A 1 125 ? -30.507 -68.150 49.483  1.00 35.94  ?  125 LYS A CB    1 
ATOM   927  C  CG    . LYS A 1 125 ? -30.632 -69.380 50.372  1.00 36.86  ?  125 LYS A CG    1 
ATOM   928  C  CD    . LYS A 1 125 ? -29.454 -70.303 50.222  1.00 41.20  ?  125 LYS A CD    1 
ATOM   929  C  CE    . LYS A 1 125 ? -29.702 -71.733 50.634  1.00 45.66  ?  125 LYS A CE    1 
ATOM   930  N  NZ    . LYS A 1 125 ? -28.560 -72.575 50.199  1.00 50.35  ?  125 LYS A NZ    1 
ATOM   931  N  N     . VAL A 1 126 ? -33.664 -69.099 48.511  1.00 33.21  ?  126 VAL A N     1 
ATOM   932  C  CA    . VAL A 1 126 ? -35.047 -69.254 49.042  1.00 31.40  ?  126 VAL A CA    1 
ATOM   933  C  C     . VAL A 1 126 ? -35.005 -70.206 50.246  1.00 30.61  ?  126 VAL A C     1 
ATOM   934  O  O     . VAL A 1 126 ? -34.369 -71.267 50.123  1.00 27.77  ?  126 VAL A O     1 
ATOM   935  C  CB    . VAL A 1 126 ? -35.994 -69.744 47.933  1.00 33.53  ?  126 VAL A CB    1 
ATOM   936  C  CG1   . VAL A 1 126 ? -37.439 -69.901 48.419  1.00 37.59  ?  126 VAL A CG1   1 
ATOM   937  C  CG2   . VAL A 1 126 ? -35.959 -68.819 46.752  1.00 30.41  ?  126 VAL A CG2   1 
ATOM   938  N  N     . GLU A 1 127 ? -35.656 -69.828 51.355  1.00 27.87  ?  127 GLU A N     1 
ATOM   939  C  CA    . GLU A 1 127 ? -35.875 -70.686 52.536  1.00 28.64  ?  127 GLU A CA    1 
ATOM   940  C  C     . GLU A 1 127 ? -37.343 -70.664 52.970  1.00 28.96  ?  127 GLU A C     1 
ATOM   941  O  O     . GLU A 1 127 ? -38.038 -69.634 52.727  1.00 27.72  ?  127 GLU A O     1 
ATOM   942  C  CB    . GLU A 1 127 ? -34.990 -70.207 53.688  1.00 31.92  ?  127 GLU A CB    1 
ATOM   943  C  CG    . GLU A 1 127 ? -33.523 -70.069 53.280  1.00 36.80  ?  127 GLU A CG    1 
ATOM   944  C  CD    . GLU A 1 127 ? -32.568 -69.648 54.389  1.00 34.32  ?  127 GLU A CD    1 
ATOM   945  O  OE1   . GLU A 1 127 ? -32.881 -68.651 55.059  1.00 32.20  ?  127 GLU A OE1   1 
ATOM   946  O  OE2   . GLU A 1 127 ? -31.511 -70.349 54.577  1.00 31.69  ?  127 GLU A OE2   1 
ATOM   947  N  N     . LEU A 1 128 ? -37.760 -71.740 53.637  1.00 30.84  ?  128 LEU A N     1 
ATOM   948  C  CA    . LEU A 1 128 ? -39.120 -71.938 54.208  1.00 32.57  ?  128 LEU A CA    1 
ATOM   949  C  C     . LEU A 1 128 ? -39.029 -71.936 55.725  1.00 33.01  ?  128 LEU A C     1 
ATOM   950  O  O     . LEU A 1 128 ? -38.157 -72.639 56.262  1.00 34.69  ?  128 LEU A O     1 
ATOM   951  C  CB    . LEU A 1 128 ? -39.678 -73.321 53.867  1.00 32.26  ?  128 LEU A CB    1 
ATOM   952  C  CG    . LEU A 1 128 ? -40.132 -73.548 52.467  1.00 36.07  ?  128 LEU A CG    1 
ATOM   953  C  CD1   . LEU A 1 128 ? -38.941 -73.782 51.565  1.00 38.08  ?  128 LEU A CD1   1 
ATOM   954  C  CD2   . LEU A 1 128 ? -41.051 -74.747 52.476  1.00 42.84  ?  128 LEU A CD2   1 
ATOM   955  N  N     . PHE A 1 129 ? -39.991 -71.291 56.361  1.00 34.32  ?  129 PHE A N     1 
ATOM   956  C  CA    . PHE A 1 129 ? -40.215 -71.341 57.814  1.00 35.70  ?  129 PHE A CA    1 
ATOM   957  C  C     . PHE A 1 129 ? -41.696 -71.648 58.057  1.00 32.87  ?  129 PHE A C     1 
ATOM   958  O  O     . PHE A 1 129 ? -42.562 -70.916 57.530  1.00 30.07  ?  129 PHE A O     1 
ATOM   959  C  CB    . PHE A 1 129 ? -39.738 -70.017 58.428  1.00 39.74  ?  129 PHE A CB    1 
ATOM   960  C  CG    . PHE A 1 129 ? -38.279 -69.706 58.181  1.00 39.62  ?  129 PHE A CG    1 
ATOM   961  C  CD1   . PHE A 1 129 ? -37.876 -69.122 56.987  1.00 40.39  ?  129 PHE A CD1   1 
ATOM   962  C  CD2   . PHE A 1 129 ? -37.308 -70.033 59.121  1.00 40.48  ?  129 PHE A CD2   1 
ATOM   963  C  CE1   . PHE A 1 129 ? -36.541 -68.854 56.745  1.00 41.33  ?  129 PHE A CE1   1 
ATOM   964  C  CE2   . PHE A 1 129 ? -35.975 -69.760 58.866  1.00 42.61  ?  129 PHE A CE2   1 
ATOM   965  C  CZ    . PHE A 1 129 ? -35.598 -69.174 57.683  1.00 41.44  ?  129 PHE A CZ    1 
ATOM   966  N  N     . PHE A 1 130 ? -41.961 -72.685 58.844  1.00 32.47  ?  130 PHE A N     1 
ATOM   967  C  CA    . PHE A 1 130 ? -43.322 -73.062 59.311  1.00 35.32  ?  130 PHE A CA    1 
ATOM   968  C  C     . PHE A 1 130 ? -43.802 -72.055 60.356  1.00 32.95  ?  130 PHE A C     1 
ATOM   969  O  O     . PHE A 1 130 ? -43.049 -71.760 61.259  1.00 36.49  ?  130 PHE A O     1 
ATOM   970  C  CB    . PHE A 1 130 ? -43.326 -74.496 59.815  1.00 36.71  ?  130 PHE A CB    1 
ATOM   971  C  CG    . PHE A 1 130 ? -44.605 -74.948 60.467  1.00 45.71  ?  130 PHE A CG    1 
ATOM   972  C  CD1   . PHE A 1 130 ? -45.776 -75.064 59.721  1.00 45.81  ?  130 PHE A CD1   1 
ATOM   973  C  CD2   . PHE A 1 130 ? -44.637 -75.285 61.826  1.00 53.97  ?  130 PHE A CD2   1 
ATOM   974  C  CE1   . PHE A 1 130 ? -46.953 -75.488 60.323  1.00 53.11  ?  130 PHE A CE1   1 
ATOM   975  C  CE2   . PHE A 1 130 ? -45.815 -75.727 62.426  1.00 51.63  ?  130 PHE A CE2   1 
ATOM   976  C  CZ    . PHE A 1 130 ? -46.974 -75.815 61.675  1.00 56.34  ?  130 PHE A CZ    1 
ATOM   977  N  N     . LYS A 1 131 ? -45.020 -71.529 60.208  1.00 39.60  ?  131 LYS A N     1 
ATOM   978  C  CA    . LYS A 1 131 ? -45.624 -70.510 61.122  1.00 44.51  ?  131 LYS A CA    1 
ATOM   979  C  C     . LYS A 1 131 ? -46.140 -71.203 62.397  1.00 50.99  ?  131 LYS A C     1 
ATOM   980  O  O     . LYS A 1 131 ? -47.083 -72.044 62.310  1.00 46.14  ?  131 LYS A O     1 
ATOM   981  C  CB    . LYS A 1 131 ? -46.745 -69.724 60.438  1.00 41.17  ?  131 LYS A CB    1 
ATOM   982  C  CG    . LYS A 1 131 ? -46.265 -68.756 59.381  1.00 40.73  ?  131 LYS A CG    1 
ATOM   983  C  CD    . LYS A 1 131 ? -47.372 -68.031 58.644  1.00 45.07  ?  131 LYS A CD    1 
ATOM   984  C  CE    . LYS A 1 131 ? -48.030 -66.969 59.470  1.00 41.29  ?  131 LYS A CE    1 
ATOM   985  N  NZ    . LYS A 1 131 ? -47.081 -65.871 59.704  1.00 47.22  ?  131 LYS A NZ    1 
ATOM   986  N  N     . ASP A 1 132 ? -45.506 -70.864 63.522  1.00 62.28  ?  132 ASP A N     1 
ATOM   987  C  CA    . ASP A 1 132 ? -45.754 -71.420 64.878  1.00 78.06  ?  132 ASP A CA    1 
ATOM   988  C  C     . ASP A 1 132 ? -44.923 -70.561 65.841  1.00 86.32  ?  132 ASP A C     1 
ATOM   989  O  O     . ASP A 1 132 ? -43.684 -70.738 65.858  1.00 79.21  ?  132 ASP A O     1 
ATOM   990  C  CB    . ASP A 1 132 ? -45.404 -72.911 64.894  1.00 83.47  ?  132 ASP A CB    1 
ATOM   991  C  CG    . ASP A 1 132 ? -45.502 -73.598 66.240  1.00 91.77  ?  132 ASP A CG    1 
ATOM   992  O  OD1   . ASP A 1 132 ? -46.177 -73.042 67.135  1.00 101.86 ?  132 ASP A OD1   1 
ATOM   993  O  OD2   . ASP A 1 132 ? -44.904 -74.688 66.376  1.00 79.37  ?  132 ASP A OD2   1 
ATOM   994  N  N     . ASP A 1 133 ? -45.583 -69.656 66.581  1.00 106.56 ?  133 ASP A N     1 
ATOM   995  C  CA    . ASP A 1 133 ? -44.963 -68.706 67.553  1.00 104.40 ?  133 ASP A CA    1 
ATOM   996  C  C     . ASP A 1 133 ? -44.355 -69.483 68.740  1.00 100.51 ?  133 ASP A C     1 
ATOM   997  O  O     . ASP A 1 133 ? -43.254 -69.104 69.193  1.00 88.81  ?  133 ASP A O     1 
ATOM   998  C  CB    . ASP A 1 133 ? -45.983 -67.663 68.022  1.00 101.46 ?  133 ASP A CB    1 
ATOM   999  C  CG    . ASP A 1 133 ? -46.494 -66.722 66.933  1.00 109.31 ?  133 ASP A CG    1 
ATOM   1000 O  OD1   . ASP A 1 133 ? -45.832 -66.592 65.880  1.00 91.74  ?  133 ASP A OD1   1 
ATOM   1001 O  OD2   . ASP A 1 133 ? -47.559 -66.112 67.149  1.00 113.60 ?  133 ASP A OD2   1 
ATOM   1002 N  N     . ALA A 1 134 ? -45.027 -70.555 69.184  1.00 88.80  ?  134 ALA A N     1 
ATOM   1003 C  CA    . ALA A 1 134 ? -44.576 -71.491 70.249  1.00 81.51  ?  134 ALA A CA    1 
ATOM   1004 C  C     . ALA A 1 134 ? -43.104 -71.893 70.054  1.00 82.56  ?  134 ALA A C     1 
ATOM   1005 O  O     . ALA A 1 134 ? -42.390 -71.917 71.082  1.00 91.81  ?  134 ALA A O     1 
ATOM   1006 C  CB    . ALA A 1 134 ? -45.472 -72.713 70.302  1.00 80.34  ?  134 ALA A CB    1 
ATOM   1007 N  N     . ASN A 1 135 ? -42.667 -72.192 68.811  1.00 77.31  ?  135 ASN A N     1 
ATOM   1008 C  CA    . ASN A 1 135 ? -41.295 -72.695 68.483  1.00 70.31  ?  135 ASN A CA    1 
ATOM   1009 C  C     . ASN A 1 135 ? -40.473 -71.671 67.674  1.00 62.18  ?  135 ASN A C     1 
ATOM   1010 O  O     . ASN A 1 135 ? -39.487 -72.099 67.031  1.00 55.49  ?  135 ASN A O     1 
ATOM   1011 C  CB    . ASN A 1 135 ? -41.334 -74.036 67.738  1.00 70.12  ?  135 ASN A CB    1 
ATOM   1012 C  CG    . ASN A 1 135 ? -41.922 -75.151 68.574  1.00 75.79  ?  135 ASN A CG    1 
ATOM   1013 O  OD1   . ASN A 1 135 ? -43.064 -75.054 69.008  1.00 78.94  ?  135 ASN A OD1   1 
ATOM   1014 N  ND2   . ASN A 1 135 ? -41.138 -76.174 68.861  1.00 80.55  ?  135 ASN A ND2   1 
ATOM   1015 N  N     . ASN A 1 136 ? -40.863 -70.390 67.678  1.00 59.89  ?  136 ASN A N     1 
ATOM   1016 C  CA    . ASN A 1 136 ? -40.113 -69.257 67.056  1.00 64.83  ?  136 ASN A CA    1 
ATOM   1017 C  C     . ASN A 1 136 ? -39.964 -69.429 65.531  1.00 57.10  ?  136 ASN A C     1 
ATOM   1018 O  O     . ASN A 1 136 ? -39.006 -68.855 64.982  1.00 61.96  ?  136 ASN A O     1 
ATOM   1019 C  CB    . ASN A 1 136 ? -38.740 -69.056 67.716  1.00 75.11  ?  136 ASN A CB    1 
ATOM   1020 C  CG    . ASN A 1 136 ? -38.827 -68.776 69.203  1.00 84.77  ?  136 ASN A CG    1 
ATOM   1021 O  OD1   . ASN A 1 136 ? -39.724 -68.069 69.658  1.00 100.12 ?  136 ASN A OD1   1 
ATOM   1022 N  ND2   . ASN A 1 136 ? -37.890 -69.309 69.970  1.00 72.16  ?  136 ASN A ND2   1 
ATOM   1023 N  N     . ASP A 1 137 ? -40.894 -70.129 64.854  1.00 50.91  ?  137 ASP A N     1 
ATOM   1024 C  CA    . ASP A 1 137 ? -40.989 -70.275 63.365  1.00 43.13  ?  137 ASP A CA    1 
ATOM   1025 C  C     . ASP A 1 137 ? -39.802 -71.093 62.861  1.00 37.00  ?  137 ASP A C     1 
ATOM   1026 O  O     . ASP A 1 137 ? -38.877 -70.564 62.258  1.00 35.68  ?  137 ASP A O     1 
ATOM   1027 C  CB    . ASP A 1 137 ? -41.053 -68.932 62.613  1.00 48.57  ?  137 ASP A CB    1 
ATOM   1028 C  CG    . ASP A 1 137 ? -42.355 -68.142 62.759  1.00 58.37  ?  137 ASP A CG    1 
ATOM   1029 O  OD1   . ASP A 1 137 ? -43.373 -68.737 63.251  1.00 50.88  ?  137 ASP A OD1   1 
ATOM   1030 O  OD2   . ASP A 1 137 ? -42.322 -66.907 62.418  1.00 59.05  ?  137 ASP A OD2   1 
ATOM   1031 N  N     . PRO A 1 138 ? -39.791 -72.422 63.068  1.00 33.26  ?  138 PRO A N     1 
ATOM   1032 C  CA    . PRO A 1 138 ? -38.652 -73.250 62.670  1.00 33.13  ?  138 PRO A CA    1 
ATOM   1033 C  C     . PRO A 1 138 ? -38.499 -73.399 61.144  1.00 32.46  ?  138 PRO A C     1 
ATOM   1034 O  O     . PRO A 1 138 ? -39.462 -73.508 60.455  1.00 34.36  ?  138 PRO A O     1 
ATOM   1035 C  CB    . PRO A 1 138 ? -38.968 -74.618 63.282  1.00 32.69  ?  138 PRO A CB    1 
ATOM   1036 C  CG    . PRO A 1 138 ? -40.502 -74.631 63.326  1.00 35.35  ?  138 PRO A CG    1 
ATOM   1037 C  CD    . PRO A 1 138 ? -40.880 -73.205 63.676  1.00 37.04  ?  138 PRO A CD    1 
ATOM   1038 N  N     . GLN A 1 139 ? -37.263 -73.431 60.670  1.00 31.37  ?  139 GLN A N     1 
ATOM   1039 C  CA    . GLN A 1 139 ? -36.954 -73.701 59.253  1.00 36.34  ?  139 GLN A CA    1 
ATOM   1040 C  C     . GLN A 1 139 ? -37.506 -75.086 58.897  1.00 29.59  ?  139 GLN A C     1 
ATOM   1041 O  O     . GLN A 1 139 ? -37.346 -76.015 59.711  1.00 28.02  ?  139 GLN A O     1 
ATOM   1042 C  CB    . GLN A 1 139 ? -35.457 -73.596 58.957  1.00 34.63  ?  139 GLN A CB    1 
ATOM   1043 C  CG    . GLN A 1 139 ? -35.145 -73.971 57.503  1.00 38.53  ?  139 GLN A CG    1 
ATOM   1044 C  CD    . GLN A 1 139 ? -33.756 -73.553 57.110  1.00 36.04  ?  139 GLN A CD    1 
ATOM   1045 O  OE1   . GLN A 1 139 ? -32.935 -73.312 57.990  1.00 33.72  ?  139 GLN A OE1   1 
ATOM   1046 N  NE2   . GLN A 1 139 ? -33.535 -73.382 55.803  1.00 33.90  ?  139 GLN A NE2   1 
ATOM   1047 N  N     . TRP A 1 140 ? -38.155 -75.174 57.740  1.00 27.64  ?  140 TRP A N     1 
ATOM   1048 C  CA    . TRP A 1 140 ? -38.657 -76.433 57.148  1.00 26.96  ?  140 TRP A CA    1 
ATOM   1049 C  C     . TRP A 1 140 ? -37.870 -76.675 55.869  1.00 29.17  ?  140 TRP A C     1 
ATOM   1050 O  O     . TRP A 1 140 ? -37.412 -75.692 55.232  1.00 30.32  ?  140 TRP A O     1 
ATOM   1051 C  CB    . TRP A 1 140 ? -40.165 -76.361 56.897  1.00 30.07  ?  140 TRP A CB    1 
ATOM   1052 C  CG    . TRP A 1 140 ? -41.033 -76.887 58.008  1.00 35.44  ?  140 TRP A CG    1 
ATOM   1053 C  CD1   . TRP A 1 140 ? -40.724 -76.927 59.335  1.00 35.54  ?  140 TRP A CD1   1 
ATOM   1054 C  CD2   . TRP A 1 140 ? -42.374 -77.392 57.900  1.00 36.95  ?  140 TRP A CD2   1 
ATOM   1055 N  NE1   . TRP A 1 140 ? -41.748 -77.448 60.052  1.00 36.05  ?  140 TRP A NE1   1 
ATOM   1056 C  CE2   . TRP A 1 140 ? -42.778 -77.752 59.205  1.00 40.60  ?  140 TRP A CE2   1 
ATOM   1057 C  CE3   . TRP A 1 140 ? -43.264 -77.592 56.841  1.00 36.32  ?  140 TRP A CE3   1 
ATOM   1058 C  CZ2   . TRP A 1 140 ? -44.035 -78.294 59.481  1.00 36.85  ?  140 TRP A CZ2   1 
ATOM   1059 C  CZ3   . TRP A 1 140 ? -44.506 -78.129 57.109  1.00 34.54  ?  140 TRP A CZ3   1 
ATOM   1060 C  CH2   . TRP A 1 140 ? -44.869 -78.493 58.403  1.00 38.31  ?  140 TRP A CH2   1 
ATOM   1061 N  N     . SER A 1 141 ? -37.675 -77.937 55.536  1.00 31.15  ?  141 SER A N     1 
ATOM   1062 C  CA    . SER A 1 141 ? -37.207 -78.391 54.199  1.00 30.48  ?  141 SER A CA    1 
ATOM   1063 C  C     . SER A 1 141 ? -38.441 -78.505 53.282  1.00 30.02  ?  141 SER A C     1 
ATOM   1064 O  O     . SER A 1 141 ? -39.548 -78.604 53.791  1.00 35.01  ?  141 SER A O     1 
ATOM   1065 C  CB    . SER A 1 141 ? -36.483 -79.673 54.330  1.00 25.99  ?  141 SER A CB    1 
ATOM   1066 O  OG    . SER A 1 141 ? -37.413 -80.699 54.697  1.00 32.11  ?  141 SER A OG    1 
ATOM   1067 N  N     . GLU A 1 142 ? -38.259 -78.458 51.977  1.00 32.13  ?  142 GLU A N     1 
ATOM   1068 C  CA    . GLU A 1 142 ? -39.306 -78.772 50.975  1.00 34.90  ?  142 GLU A CA    1 
ATOM   1069 C  C     . GLU A 1 142 ? -39.890 -80.160 51.310  1.00 35.55  ?  142 GLU A C     1 
ATOM   1070 O  O     . GLU A 1 142 ? -41.099 -80.316 51.189  1.00 33.38  ?  142 GLU A O     1 
ATOM   1071 C  CB    . GLU A 1 142 ? -38.733 -78.730 49.558  1.00 33.67  ?  142 GLU A CB    1 
ATOM   1072 C  CG    . GLU A 1 142 ? -38.439 -77.337 49.045  1.00 40.72  ?  142 GLU A CG    1 
ATOM   1073 C  CD    . GLU A 1 142 ? -37.917 -77.278 47.602  1.00 55.78  ?  142 GLU A CD    1 
ATOM   1074 O  OE1   . GLU A 1 142 ? -37.257 -78.271 47.141  1.00 62.45  ?  142 GLU A OE1   1 
ATOM   1075 O  OE2   . GLU A 1 142 ? -38.148 -76.233 46.919  1.00 57.36  ?  142 GLU A OE2   1 
ATOM   1076 N  N     . GLU A 1 143 ? -39.070 -81.128 51.747  1.00 35.77  ?  143 GLU A N     1 
ATOM   1077 C  CA    . GLU A 1 143 ? -39.520 -82.513 52.039  1.00 34.01  ?  143 GLU A CA    1 
ATOM   1078 C  C     . GLU A 1 143 ? -40.543 -82.471 53.196  1.00 35.42  ?  143 GLU A C     1 
ATOM   1079 O  O     . GLU A 1 143 ? -41.518 -83.210 53.161  1.00 34.50  ?  143 GLU A O     1 
ATOM   1080 C  CB    . GLU A 1 143 ? -38.315 -83.406 52.387  1.00 36.04  ?  143 GLU A CB    1 
ATOM   1081 C  CG    . GLU A 1 143 ? -37.441 -83.765 51.205  1.00 41.25  ?  143 GLU A CG    1 
ATOM   1082 C  CD    . GLU A 1 143 ? -36.430 -82.707 50.744  1.00 46.25  ?  143 GLU A CD    1 
ATOM   1083 O  OE1   . GLU A 1 143 ? -36.291 -81.686 51.428  1.00 40.51  ?  143 GLU A OE1   1 
ATOM   1084 O  OE2   . GLU A 1 143 ? -35.789 -82.910 49.676  1.00 51.32  ?  143 GLU A OE2   1 
ATOM   1085 N  N     . GLN A 1 144 ? -40.324 -81.626 54.205  1.00 33.90  ?  144 GLN A N     1 
ATOM   1086 C  CA    . GLN A 1 144 ? -41.237 -81.495 55.356  1.00 35.15  ?  144 GLN A CA    1 
ATOM   1087 C  C     . GLN A 1 144 ? -42.577 -80.919 54.888  1.00 38.82  ?  144 GLN A C     1 
ATOM   1088 O  O     . GLN A 1 144 ? -43.621 -81.399 55.429  1.00 36.34  ?  144 GLN A O     1 
ATOM   1089 C  CB    . GLN A 1 144 ? -40.648 -80.571 56.430  1.00 34.80  ?  144 GLN A CB    1 
ATOM   1090 C  CG    . GLN A 1 144 ? -39.857 -81.335 57.459  1.00 37.21  ?  144 GLN A CG    1 
ATOM   1091 C  CD    . GLN A 1 144 ? -39.059 -80.436 58.370  1.00 38.05  ?  144 GLN A CD    1 
ATOM   1092 O  OE1   . GLN A 1 144 ? -38.284 -79.592 57.913  1.00 32.07  ?  144 GLN A OE1   1 
ATOM   1093 N  NE2   . GLN A 1 144 ? -39.232 -80.662 59.662  1.00 33.77  ?  144 GLN A NE2   1 
ATOM   1094 N  N     . LEU A 1 145 ? -42.551 -79.906 53.997  1.00 31.70  ?  145 LEU A N     1 
ATOM   1095 C  CA    . LEU A 1 145 ? -43.788 -79.254 53.518  1.00 31.35  ?  145 LEU A CA    1 
ATOM   1096 C  C     . LEU A 1 145 ? -44.583 -80.256 52.681  1.00 31.32  ?  145 LEU A C     1 
ATOM   1097 O  O     . LEU A 1 145 ? -45.793 -80.364 52.860  1.00 35.90  ?  145 LEU A O     1 
ATOM   1098 C  CB    . LEU A 1 145 ? -43.451 -78.009 52.717  1.00 31.69  ?  145 LEU A CB    1 
ATOM   1099 C  CG    . LEU A 1 145 ? -44.665 -77.217 52.238  1.00 35.08  ?  145 LEU A CG    1 
ATOM   1100 C  CD1   . LEU A 1 145 ? -45.630 -76.931 53.386  1.00 39.72  ?  145 LEU A CD1   1 
ATOM   1101 C  CD2   . LEU A 1 145 ? -44.245 -75.911 51.577  1.00 36.05  ?  145 LEU A CD2   1 
ATOM   1102 N  N     . ILE A 1 146 ? -43.921 -81.014 51.824  1.00 33.64  ?  146 ILE A N     1 
ATOM   1103 C  CA    . ILE A 1 146 ? -44.613 -82.057 51.020  1.00 37.42  ?  146 ILE A CA    1 
ATOM   1104 C  C     . ILE A 1 146 ? -45.250 -83.089 51.973  1.00 40.96  ?  146 ILE A C     1 
ATOM   1105 O  O     . ILE A 1 146 ? -46.414 -83.434 51.772  1.00 40.64  ?  146 ILE A O     1 
ATOM   1106 C  CB    . ILE A 1 146 ? -43.655 -82.690 49.996  1.00 35.06  ?  146 ILE A CB    1 
ATOM   1107 C  CG1   . ILE A 1 146 ? -43.149 -81.634 49.016  1.00 36.39  ?  146 ILE A CG1   1 
ATOM   1108 C  CG2   . ILE A 1 146 ? -44.366 -83.835 49.272  1.00 34.35  ?  146 ILE A CG2   1 
ATOM   1109 C  CD1   . ILE A 1 146 ? -42.050 -82.102 48.115  1.00 37.36  ?  146 ILE A CD1   1 
ATOM   1110 N  N     . ALA A 1 147 ? -44.517 -83.558 52.983  1.00 39.62  ?  147 ALA A N     1 
ATOM   1111 C  CA    . ALA A 1 147 ? -44.967 -84.629 53.895  1.00 39.88  ?  147 ALA A CA    1 
ATOM   1112 C  C     . ALA A 1 147 ? -46.113 -84.139 54.792  1.00 35.12  ?  147 ALA A C     1 
ATOM   1113 O  O     . ALA A 1 147 ? -46.848 -84.963 55.311  1.00 37.21  ?  147 ALA A O     1 
ATOM   1114 C  CB    . ALA A 1 147 ? -43.807 -85.143 54.704  1.00 43.82  ?  147 ALA A CB    1 
ATOM   1115 N  N     . ALA A 1 148 ? -46.301 -82.839 54.952  1.00 40.44  ?  148 ALA A N     1 
ATOM   1116 C  CA    . ALA A 1 148 ? -47.417 -82.277 55.763  1.00 37.88  ?  148 ALA A CA    1 
ATOM   1117 C  C     . ALA A 1 148 ? -48.772 -82.525 55.076  1.00 40.52  ?  148 ALA A C     1 
ATOM   1118 O  O     . ALA A 1 148 ? -49.770 -82.535 55.766  1.00 42.96  ?  148 ALA A O     1 
ATOM   1119 C  CB    . ALA A 1 148 ? -47.207 -80.814 56.035  1.00 37.02  ?  148 ALA A CB    1 
ATOM   1120 N  N     . LYS A 1 149 ? -48.796 -82.735 53.756  1.00 44.86  ?  149 LYS A N     1 
ATOM   1121 C  CA    . LYS A 1 149 ? -50.030 -83.085 52.991  1.00 44.08  ?  149 LYS A CA    1 
ATOM   1122 C  C     . LYS A 1 149 ? -51.127 -82.054 53.312  1.00 40.76  ?  149 LYS A C     1 
ATOM   1123 O  O     . LYS A 1 149 ? -52.293 -82.421 53.539  1.00 36.38  ?  149 LYS A O     1 
ATOM   1124 C  CB    . LYS A 1 149 ? -50.422 -84.533 53.308  1.00 45.91  ?  149 LYS A CB    1 
ATOM   1125 C  CG    . LYS A 1 149 ? -49.694 -85.538 52.433  1.00 49.47  ?  149 LYS A CG    1 
ATOM   1126 C  CD    . LYS A 1 149 ? -49.674 -86.957 52.994  1.00 57.50  ?  149 LYS A CD    1 
ATOM   1127 C  CE    . LYS A 1 149 ? -48.558 -87.814 52.423  1.00 67.83  ?  149 LYS A CE    1 
ATOM   1128 N  NZ    . LYS A 1 149 ? -48.986 -88.635 51.258  1.00 71.65  ?  149 LYS A NZ    1 
ATOM   1129 N  N     . PHE A 1 150 ? -50.734 -80.790 53.384  1.00 35.40  ?  150 PHE A N     1 
ATOM   1130 C  CA    . PHE A 1 150 ? -51.644 -79.650 53.608  1.00 36.76  ?  150 PHE A CA    1 
ATOM   1131 C  C     . PHE A 1 150 ? -52.622 -79.593 52.443  1.00 39.83  ?  150 PHE A C     1 
ATOM   1132 O  O     . PHE A 1 150 ? -52.233 -79.808 51.269  1.00 36.96  ?  150 PHE A O     1 
ATOM   1133 C  CB    . PHE A 1 150 ? -50.886 -78.320 53.693  1.00 38.30  ?  150 PHE A CB    1 
ATOM   1134 C  CG    . PHE A 1 150 ? -50.160 -78.059 54.987  1.00 35.56  ?  150 PHE A CG    1 
ATOM   1135 C  CD1   . PHE A 1 150 ? -50.719 -78.397 56.204  1.00 38.04  ?  150 PHE A CD1   1 
ATOM   1136 C  CD2   . PHE A 1 150 ? -48.957 -77.380 54.986  1.00 34.88  ?  150 PHE A CD2   1 
ATOM   1137 C  CE1   . PHE A 1 150 ? -50.072 -78.095 57.397  1.00 40.85  ?  150 PHE A CE1   1 
ATOM   1138 C  CE2   . PHE A 1 150 ? -48.308 -77.065 56.167  1.00 39.78  ?  150 PHE A CE2   1 
ATOM   1139 C  CZ    . PHE A 1 150 ? -48.867 -77.434 57.377  1.00 42.67  ?  150 PHE A CZ    1 
ATOM   1140 N  N     . CYS A 1 151 ? -53.855 -79.229 52.777  1.00 44.66  ?  151 CYS A N     1 
ATOM   1141 C  CA    . CYS A 1 151 ? -54.970 -79.011 51.837  1.00 44.22  ?  151 CYS A CA    1 
ATOM   1142 C  C     . CYS A 1 151 ? -55.635 -77.694 52.216  1.00 40.95  ?  151 CYS A C     1 
ATOM   1143 O  O     . CYS A 1 151 ? -55.963 -77.508 53.399  1.00 47.63  ?  151 CYS A O     1 
ATOM   1144 C  CB    . CYS A 1 151 ? -55.940 -80.182 51.905  1.00 48.63  ?  151 CYS A CB    1 
ATOM   1145 S  SG    . CYS A 1 151 ? -56.974 -80.269 50.431  1.00 62.39  ?  151 CYS A SG    1 
ATOM   1146 N  N     . PHE A 1 152 ? -55.765 -76.797 51.262  1.00 38.37  ?  152 PHE A N     1 
ATOM   1147 C  CA    . PHE A 1 152 ? -56.342 -75.442 51.466  1.00 40.41  ?  152 PHE A CA    1 
ATOM   1148 C  C     . PHE A 1 152 ? -57.290 -75.131 50.302  1.00 42.96  ?  152 PHE A C     1 
ATOM   1149 O  O     . PHE A 1 152 ? -56.807 -75.165 49.126  1.00 40.15  ?  152 PHE A O     1 
ATOM   1150 C  CB    . PHE A 1 152 ? -55.215 -74.405 51.563  1.00 37.50  ?  152 PHE A CB    1 
ATOM   1151 C  CG    . PHE A 1 152 ? -54.405 -74.542 52.819  1.00 35.47  ?  152 PHE A CG    1 
ATOM   1152 C  CD1   . PHE A 1 152 ? -54.978 -74.227 54.043  1.00 43.49  ?  152 PHE A CD1   1 
ATOM   1153 C  CD2   . PHE A 1 152 ? -53.096 -74.985 52.790  1.00 36.28  ?  152 PHE A CD2   1 
ATOM   1154 C  CE1   . PHE A 1 152 ? -54.255 -74.342 55.220  1.00 38.76  ?  152 PHE A CE1   1 
ATOM   1155 C  CE2   . PHE A 1 152 ? -52.386 -75.140 53.963  1.00 35.66  ?  152 PHE A CE2   1 
ATOM   1156 C  CZ    . PHE A 1 152 ? -52.971 -74.819 55.167  1.00 40.32  ?  152 PHE A CZ    1 
ATOM   1157 N  N     . ALA A 1 153 ? -58.573 -74.862 50.595  1.00 43.16  ?  153 ALA A N     1 
ATOM   1158 C  CA    . ALA A 1 153 ? -59.616 -74.597 49.574  1.00 39.00  ?  153 ALA A CA    1 
ATOM   1159 C  C     . ALA A 1 153 ? -59.590 -75.712 48.528  1.00 36.68  ?  153 ALA A C     1 
ATOM   1160 O  O     . ALA A 1 153 ? -59.789 -75.417 47.328  1.00 36.56  ?  153 ALA A O     1 
ATOM   1161 C  CB    . ALA A 1 153 ? -59.373 -73.244 48.927  1.00 39.76  ?  153 ALA A CB    1 
ATOM   1162 N  N     . GLY A 1 154 ? -59.279 -76.940 48.970  1.00 40.85  ?  154 GLY A N     1 
ATOM   1163 C  CA    . GLY A 1 154 ? -59.364 -78.178 48.163  1.00 36.93  ?  154 GLY A CA    1 
ATOM   1164 C  C     . GLY A 1 154 ? -58.092 -78.498 47.388  1.00 38.56  ?  154 GLY A C     1 
ATOM   1165 O  O     . GLY A 1 154 ? -58.058 -79.578 46.806  1.00 41.10  ?  154 GLY A O     1 
ATOM   1166 N  N     . LEU A 1 155 ? -57.108 -77.588 47.331  1.00 35.64  ?  155 LEU A N     1 
ATOM   1167 C  CA    . LEU A 1 155 ? -55.797 -77.810 46.669  1.00 35.13  ?  155 LEU A CA    1 
ATOM   1168 C  C     . LEU A 1 155 ? -54.821 -78.491 47.653  1.00 37.64  ?  155 LEU A C     1 
ATOM   1169 O  O     . LEU A 1 155 ? -54.431 -77.847 48.659  1.00 32.66  ?  155 LEU A O     1 
ATOM   1170 C  CB    . LEU A 1 155 ? -55.264 -76.467 46.184  1.00 37.06  ?  155 LEU A CB    1 
ATOM   1171 C  CG    . LEU A 1 155 ? -53.927 -76.504 45.444  1.00 42.03  ?  155 LEU A CG    1 
ATOM   1172 C  CD1   . LEU A 1 155 ? -54.027 -77.359 44.188  1.00 38.04  ?  155 LEU A CD1   1 
ATOM   1173 C  CD2   . LEU A 1 155 ? -53.450 -75.091 45.090  1.00 39.68  ?  155 LEU A CD2   1 
ATOM   1174 N  N     . LEU A 1 156 ? -54.458 -79.755 47.372  1.00 35.73  ?  156 LEU A N     1 
ATOM   1175 C  CA    . LEU A 1 156 ? -53.383 -80.509 48.063  1.00 31.90  ?  156 LEU A CA    1 
ATOM   1176 C  C     . LEU A 1 156 ? -52.058 -79.808 47.746  1.00 33.30  ?  156 LEU A C     1 
ATOM   1177 O  O     . LEU A 1 156 ? -51.805 -79.587 46.549  1.00 35.81  ?  156 LEU A O     1 
ATOM   1178 C  CB    . LEU A 1 156 ? -53.381 -81.969 47.588  1.00 31.57  ?  156 LEU A CB    1 
ATOM   1179 C  CG    . LEU A 1 156 ? -52.220 -82.838 48.123  1.00 39.16  ?  156 LEU A CG    1 
ATOM   1180 C  CD1   . LEU A 1 156 ? -52.301 -83.034 49.637  1.00 37.13  ?  156 LEU A CD1   1 
ATOM   1181 C  CD2   . LEU A 1 156 ? -52.193 -84.210 47.453  1.00 45.19  ?  156 LEU A CD2   1 
ATOM   1182 N  N     . ILE A 1 157 ? -51.252 -79.433 48.754  1.00 33.21  ?  157 ILE A N     1 
ATOM   1183 C  CA    . ILE A 1 157 ? -49.923 -78.787 48.510  1.00 30.19  ?  157 ILE A CA    1 
ATOM   1184 C  C     . ILE A 1 157 ? -48.868 -79.883 48.357  1.00 30.85  ?  157 ILE A C     1 
ATOM   1185 O  O     . ILE A 1 157 ? -48.386 -80.404 49.380  1.00 32.98  ?  157 ILE A O     1 
ATOM   1186 C  CB    . ILE A 1 157 ? -49.584 -77.775 49.606  1.00 37.85  ?  157 ILE A CB    1 
ATOM   1187 C  CG1   . ILE A 1 157 ? -50.713 -76.753 49.809  1.00 40.91  ?  157 ILE A CG1   1 
ATOM   1188 C  CG2   . ILE A 1 157 ? -48.252 -77.098 49.328  1.00 36.22  ?  157 ILE A CG2   1 
ATOM   1189 C  CD1   . ILE A 1 157 ? -51.053 -75.928 48.606  1.00 39.74  ?  157 ILE A CD1   1 
ATOM   1190 N  N     . GLY A 1 158 ? -48.571 -80.249 47.105  1.00 31.40  ?  158 GLY A N     1 
ATOM   1191 C  CA    . GLY A 1 158 ? -47.623 -81.305 46.697  1.00 32.40  ?  158 GLY A CA    1 
ATOM   1192 C  C     . GLY A 1 158 ? -46.353 -80.727 46.069  1.00 34.86  ?  158 GLY A C     1 
ATOM   1193 O  O     . GLY A 1 158 ? -46.149 -79.494 46.124  1.00 34.25  ?  158 GLY A O     1 
ATOM   1194 N  N     . GLN A 1 159 ? -45.538 -81.595 45.479  1.00 32.89  ?  159 GLN A N     1 
ATOM   1195 C  CA    . GLN A 1 159 ? -44.215 -81.244 44.914  1.00 34.29  ?  159 GLN A CA    1 
ATOM   1196 C  C     . GLN A 1 159 ? -44.446 -80.069 43.948  1.00 30.54  ?  159 GLN A C     1 
ATOM   1197 O  O     . GLN A 1 159 ? -43.754 -79.051 44.069  1.00 26.40  ?  159 GLN A O     1 
ATOM   1198 C  CB    . GLN A 1 159 ? -43.548 -82.499 44.334  1.00 38.63  ?  159 GLN A CB    1 
ATOM   1199 C  CG    . GLN A 1 159 ? -42.794 -82.306 43.028  1.00 51.35  ?  159 GLN A CG    1 
ATOM   1200 C  CD    . GLN A 1 159 ? -41.632 -81.379 43.236  1.00 59.37  ?  159 GLN A CD    1 
ATOM   1201 O  OE1   . GLN A 1 159 ? -41.109 -81.319 44.356  1.00 68.13  ?  159 GLN A OE1   1 
ATOM   1202 N  NE2   . GLN A 1 159 ? -41.272 -80.633 42.185  1.00 46.29  ?  159 GLN A NE2   1 
ATOM   1203 N  N     . THR A 1 160 ? -45.400 -80.189 43.038  1.00 25.62  ?  160 THR A N     1 
ATOM   1204 C  CA    . THR A 1 160 ? -45.718 -79.143 42.031  1.00 29.60  ?  160 THR A CA    1 
ATOM   1205 C  C     . THR A 1 160 ? -45.980 -77.782 42.697  1.00 28.36  ?  160 THR A C     1 
ATOM   1206 O  O     . THR A 1 160 ? -45.450 -76.748 42.230  1.00 29.00  ?  160 THR A O     1 
ATOM   1207 C  CB    . THR A 1 160 ? -46.907 -79.555 41.160  1.00 31.42  ?  160 THR A CB    1 
ATOM   1208 O  OG1   . THR A 1 160 ? -46.487 -80.665 40.381  1.00 28.26  ?  160 THR A OG1   1 
ATOM   1209 C  CG2   . THR A 1 160 ? -47.367 -78.439 40.249  1.00 33.62  ?  160 THR A CG2   1 
ATOM   1210 N  N     . GLU A 1 161 ? -46.773 -77.770 43.757  1.00 30.32  ?  161 GLU A N     1 
ATOM   1211 C  CA    . GLU A 1 161 ? -47.249 -76.516 44.381  1.00 33.86  ?  161 GLU A CA    1 
ATOM   1212 C  C     . GLU A 1 161 ? -46.087 -75.855 45.141  1.00 30.08  ?  161 GLU A C     1 
ATOM   1213 O  O     . GLU A 1 161 ? -45.981 -74.607 45.130  1.00 28.28  ?  161 GLU A O     1 
ATOM   1214 C  CB    . GLU A 1 161 ? -48.441 -76.841 45.267  1.00 36.71  ?  161 GLU A CB    1 
ATOM   1215 C  CG    . GLU A 1 161 ? -49.704 -77.182 44.495  1.00 38.47  ?  161 GLU A CG    1 
ATOM   1216 C  CD    . GLU A 1 161 ? -49.725 -78.539 43.810  1.00 44.39  ?  161 GLU A CD    1 
ATOM   1217 O  OE1   . GLU A 1 161 ? -49.127 -79.532 44.354  1.00 36.60  ?  161 GLU A OE1   1 
ATOM   1218 O  OE2   . GLU A 1 161 ? -50.362 -78.614 42.714  1.00 47.48  ?  161 GLU A OE2   1 
ATOM   1219 N  N     . VAL A 1 162 ? -45.262 -76.676 45.779  1.00 23.67  ?  162 VAL A N     1 
ATOM   1220 C  CA    . VAL A 1 162 ? -44.071 -76.229 46.545  1.00 25.26  ?  162 VAL A CA    1 
ATOM   1221 C  C     . VAL A 1 162 ? -43.029 -75.661 45.574  1.00 30.77  ?  162 VAL A C     1 
ATOM   1222 O  O     . VAL A 1 162 ? -42.480 -74.577 45.840  1.00 27.26  ?  162 VAL A O     1 
ATOM   1223 C  CB    . VAL A 1 162 ? -43.521 -77.406 47.350  1.00 24.60  ?  162 VAL A CB    1 
ATOM   1224 C  CG1   . VAL A 1 162 ? -42.189 -77.064 47.960  1.00 25.22  ?  162 VAL A CG1   1 
ATOM   1225 C  CG2   . VAL A 1 162 ? -44.506 -77.798 48.442  1.00 27.78  ?  162 VAL A CG2   1 
ATOM   1226 N  N     . ASP A 1 163 ? -42.803 -76.353 44.458  1.00 31.33  ?  163 ASP A N     1 
ATOM   1227 C  CA    . ASP A 1 163 ? -41.867 -75.918 43.398  1.00 34.88  ?  163 ASP A CA    1 
ATOM   1228 C  C     . ASP A 1 163 ? -42.370 -74.576 42.858  1.00 34.25  ?  163 ASP A C     1 
ATOM   1229 O  O     . ASP A 1 163 ? -41.545 -73.668 42.636  1.00 34.14  ?  163 ASP A O     1 
ATOM   1230 C  CB    . ASP A 1 163 ? -41.671 -77.036 42.369  1.00 43.14  ?  163 ASP A CB    1 
ATOM   1231 C  CG    . ASP A 1 163 ? -40.323 -77.073 41.652  1.00 58.70  ?  163 ASP A CG    1 
ATOM   1232 O  OD1   . ASP A 1 163 ? -39.411 -76.306 42.048  1.00 72.35  ?  163 ASP A OD1   1 
ATOM   1233 O  OD2   . ASP A 1 163 ? -40.181 -77.883 40.683  1.00 68.94  ?  163 ASP A OD2   1 
ATOM   1234 N  N     . ILE A 1 164 ? -43.678 -74.389 42.730  1.00 32.05  ?  164 ILE A N     1 
ATOM   1235 C  CA    . ILE A 1 164 ? -44.241 -73.111 42.202  1.00 29.35  ?  164 ILE A CA    1 
ATOM   1236 C  C     . ILE A 1 164 ? -44.018 -71.972 43.200  1.00 27.21  ?  164 ILE A C     1 
ATOM   1237 O  O     . ILE A 1 164 ? -43.600 -70.877 42.783  1.00 29.41  ?  164 ILE A O     1 
ATOM   1238 C  CB    . ILE A 1 164 ? -45.713 -73.288 41.825  1.00 31.14  ?  164 ILE A CB    1 
ATOM   1239 C  CG1   . ILE A 1 164 ? -45.863 -74.078 40.520  1.00 31.77  ?  164 ILE A CG1   1 
ATOM   1240 C  CG2   . ILE A 1 164 ? -46.416 -71.950 41.735  1.00 31.87  ?  164 ILE A CG2   1 
ATOM   1241 C  CD1   . ILE A 1 164 ? -47.267 -74.569 40.245  1.00 27.76  ?  164 ILE A CD1   1 
ATOM   1242 N  N     . MET A 1 165 ? -44.266 -72.189 44.470  1.00 27.76  ?  165 MET A N     1 
ATOM   1243 C  CA    . MET A 1 165 ? -44.104 -71.121 45.495  1.00 28.17  ?  165 MET A CA    1 
ATOM   1244 C  C     . MET A 1 165 ? -42.641 -70.721 45.626  1.00 26.42  ?  165 MET A C     1 
ATOM   1245 O  O     . MET A 1 165 ? -42.334 -69.528 45.824  1.00 24.88  ?  165 MET A O     1 
ATOM   1246 C  CB    . MET A 1 165 ? -44.642 -71.588 46.850  1.00 30.92  ?  165 MET A CB    1 
ATOM   1247 C  CG    . MET A 1 165 ? -46.167 -71.705 46.893  1.00 34.90  ?  165 MET A CG    1 
ATOM   1248 S  SD    . MET A 1 165 ? -46.773 -72.721 48.266  1.00 37.51  ?  165 MET A SD    1 
ATOM   1249 C  CE    . MET A 1 165 ? -47.122 -71.305 49.267  1.00 42.74  ?  165 MET A CE    1 
ATOM   1250 N  N     . SER A 1 166 ? -41.754 -71.686 45.470  1.00 27.93  ?  166 SER A N     1 
ATOM   1251 C  CA    . SER A 1 166 ? -40.286 -71.507 45.560  1.00 31.78  ?  166 SER A CA    1 
ATOM   1252 C  C     . SER A 1 166 ? -39.765 -70.642 44.413  1.00 26.98  ?  166 SER A C     1 
ATOM   1253 O  O     . SER A 1 166 ? -39.016 -69.701 44.644  1.00 31.37  ?  166 SER A O     1 
ATOM   1254 C  CB    . SER A 1 166 ? -39.619 -72.872 45.576  1.00 36.68  ?  166 SER A CB    1 
ATOM   1255 O  OG    . SER A 1 166 ? -38.325 -72.774 46.127  1.00 44.73  ?  166 SER A OG    1 
ATOM   1256 N  N     . HIS A 1 167 ? -40.146 -70.968 43.201  1.00 28.97  ?  167 HIS A N     1 
ATOM   1257 C  CA    . HIS A 1 167 ? -39.786 -70.204 41.983  1.00 29.67  ?  167 HIS A CA    1 
ATOM   1258 C  C     . HIS A 1 167 ? -40.426 -68.825 42.042  1.00 27.74  ?  167 HIS A C     1 
ATOM   1259 O  O     . HIS A 1 167 ? -39.766 -67.841 41.683  1.00 28.92  ?  167 HIS A O     1 
ATOM   1260 C  CB    . HIS A 1 167 ? -40.168 -70.977 40.729  1.00 30.41  ?  167 HIS A CB    1 
ATOM   1261 C  CG    . HIS A 1 167 ? -39.164 -72.022 40.367  1.00 36.25  ?  167 HIS A CG    1 
ATOM   1262 N  ND1   . HIS A 1 167 ? -38.933 -73.156 41.165  1.00 37.53  ?  167 HIS A ND1   1 
ATOM   1263 C  CD2   . HIS A 1 167 ? -38.322 -72.120 39.321  1.00 37.85  ?  167 HIS A CD2   1 
ATOM   1264 C  CE1   . HIS A 1 167 ? -38.015 -73.903 40.603  1.00 37.08  ?  167 HIS A CE1   1 
ATOM   1265 N  NE2   . HIS A 1 167 ? -37.637 -73.300 39.481  1.00 39.90  ?  167 HIS A NE2   1 
ATOM   1266 N  N     . ALA A 1 168 ? -41.669 -68.744 42.459  1.00 24.80  ?  168 ALA A N     1 
ATOM   1267 C  CA    . ALA A 1 168 ? -42.379 -67.444 42.540  1.00 27.76  ?  168 ALA A CA    1 
ATOM   1268 C  C     . ALA A 1 168 ? -41.677 -66.543 43.547  1.00 25.47  ?  168 ALA A C     1 
ATOM   1269 O  O     . ALA A 1 168 ? -41.621 -65.343 43.307  1.00 25.49  ?  168 ALA A O     1 
ATOM   1270 C  CB    . ALA A 1 168 ? -43.834 -67.654 42.901  1.00 30.24  ?  168 ALA A CB    1 
ATOM   1271 N  N     . THR A 1 169 ? -41.198 -67.093 44.667  1.00 28.13  ?  169 THR A N     1 
ATOM   1272 C  CA    . THR A 1 169 ? -40.533 -66.285 45.735  1.00 27.47  ?  169 THR A CA    1 
ATOM   1273 C  C     . THR A 1 169 ? -39.275 -65.590 45.187  1.00 26.10  ?  169 THR A C     1 
ATOM   1274 O  O     . THR A 1 169 ? -39.108 -64.394 45.359  1.00 25.26  ?  169 THR A O     1 
ATOM   1275 C  CB    . THR A 1 169 ? -40.203 -67.139 46.955  1.00 30.57  ?  169 THR A CB    1 
ATOM   1276 O  OG1   . THR A 1 169 ? -41.401 -67.719 47.470  1.00 24.49  ?  169 THR A OG1   1 
ATOM   1277 C  CG2   . THR A 1 169 ? -39.510 -66.318 48.028  1.00 29.82  ?  169 THR A CG2   1 
ATOM   1278 N  N     . GLN A 1 170 ? -38.450 -66.331 44.474  1.00 31.17  ?  170 GLN A N     1 
ATOM   1279 C  CA    . GLN A 1 170 ? -37.245 -65.797 43.795  1.00 30.52  ?  170 GLN A CA    1 
ATOM   1280 C  C     . GLN A 1 170 ? -37.638 -64.673 42.818  1.00 32.94  ?  170 GLN A C     1 
ATOM   1281 O  O     . GLN A 1 170 ? -37.013 -63.590 42.868  1.00 32.48  ?  170 GLN A O     1 
ATOM   1282 C  CB    . GLN A 1 170 ? -36.531 -66.958 43.127  1.00 34.46  ?  170 GLN A CB    1 
ATOM   1283 C  CG    . GLN A 1 170 ? -35.065 -66.692 42.796  1.00 43.33  ?  170 GLN A CG    1 
ATOM   1284 C  CD    . GLN A 1 170 ? -34.404 -67.978 42.355  1.00 40.69  ?  170 GLN A CD    1 
ATOM   1285 O  OE1   . GLN A 1 170 ? -34.683 -68.476 41.280  1.00 43.79  ?  170 GLN A OE1   1 
ATOM   1286 N  NE2   . GLN A 1 170 ? -33.571 -68.544 43.200  1.00 38.24  ?  170 GLN A NE2   1 
ATOM   1287 N  N     . ALA A 1 171 ? -38.635 -64.893 41.957  1.00 29.59  ?  171 ALA A N     1 
ATOM   1288 C  CA    . ALA A 1 171 ? -39.057 -63.927 40.912  1.00 30.21  ?  171 ALA A CA    1 
ATOM   1289 C  C     . ALA A 1 171 ? -39.588 -62.643 41.554  1.00 25.81  ?  171 ALA A C     1 
ATOM   1290 O  O     . ALA A 1 171 ? -39.237 -61.541 41.117  1.00 25.60  ?  171 ALA A O     1 
ATOM   1291 C  CB    . ALA A 1 171 ? -40.089 -64.551 39.985  1.00 32.91  ?  171 ALA A CB    1 
ATOM   1292 N  N     . ILE A 1 172 ? -40.397 -62.783 42.589  1.00 26.12  ?  172 ILE A N     1 
ATOM   1293 C  CA    . ILE A 1 172 ? -40.981 -61.614 43.308  1.00 26.63  ?  172 ILE A CA    1 
ATOM   1294 C  C     . ILE A 1 172 ? -39.840 -60.800 43.926  1.00 28.73  ?  172 ILE A C     1 
ATOM   1295 O  O     . ILE A 1 172 ? -39.844 -59.560 43.797  1.00 30.40  ?  172 ILE A O     1 
ATOM   1296 C  CB    . ILE A 1 172 ? -42.029 -62.080 44.322  1.00 26.24  ?  172 ILE A CB    1 
ATOM   1297 C  CG1   . ILE A 1 172 ? -43.247 -62.657 43.597  1.00 26.01  ?  172 ILE A CG1   1 
ATOM   1298 C  CG2   . ILE A 1 172 ? -42.414 -60.937 45.229  1.00 27.25  ?  172 ILE A CG2   1 
ATOM   1299 C  CD1   . ILE A 1 172 ? -44.097 -63.543 44.419  1.00 27.33  ?  172 ILE A CD1   1 
ATOM   1300 N  N     . PHE A 1 173 ? -38.855 -61.472 44.512  1.00 26.41  ?  173 PHE A N     1 
ATOM   1301 C  CA    . PHE A 1 173 ? -37.695 -60.810 45.139  1.00 28.91  ?  173 PHE A CA    1 
ATOM   1302 C  C     . PHE A 1 173 ? -36.916 -60.021 44.082  1.00 30.91  ?  173 PHE A C     1 
ATOM   1303 O  O     . PHE A 1 173 ? -36.591 -58.811 44.318  1.00 24.18  ?  173 PHE A O     1 
ATOM   1304 C  CB    . PHE A 1 173 ? -36.804 -61.814 45.876  1.00 29.12  ?  173 PHE A CB    1 
ATOM   1305 C  CG    . PHE A 1 173 ? -35.546 -61.162 46.375  1.00 29.17  ?  173 PHE A CG    1 
ATOM   1306 C  CD1   . PHE A 1 173 ? -35.536 -60.484 47.581  1.00 29.96  ?  173 PHE A CD1   1 
ATOM   1307 C  CD2   . PHE A 1 173 ? -34.408 -61.129 45.580  1.00 30.00  ?  173 PHE A CD2   1 
ATOM   1308 C  CE1   . PHE A 1 173 ? -34.391 -59.819 48.012  1.00 27.76  ?  173 PHE A CE1   1 
ATOM   1309 C  CE2   . PHE A 1 173 ? -33.273 -60.456 46.014  1.00 30.33  ?  173 PHE A CE2   1 
ATOM   1310 C  CZ    . PHE A 1 173 ? -33.264 -59.823 47.235  1.00 29.27  ?  173 PHE A CZ    1 
ATOM   1311 N  N     . GLU A 1 174 ? -36.601 -60.677 42.962  1.00 28.67  ?  174 GLU A N     1 
ATOM   1312 C  CA    . GLU A 1 174 ? -35.805 -60.060 41.863  1.00 31.94  ?  174 GLU A CA    1 
ATOM   1313 C  C     . GLU A 1 174 ? -36.534 -58.830 41.307  1.00 28.38  ?  174 GLU A C     1 
ATOM   1314 O  O     . GLU A 1 174 ? -35.869 -57.861 41.006  1.00 32.13  ?  174 GLU A O     1 
ATOM   1315 C  CB    . GLU A 1 174 ? -35.454 -61.082 40.795  1.00 32.42  ?  174 GLU A CB    1 
ATOM   1316 C  CG    . GLU A 1 174 ? -34.441 -62.102 41.246  1.00 35.73  ?  174 GLU A CG    1 
ATOM   1317 C  CD    . GLU A 1 174 ? -34.366 -63.323 40.319  1.00 51.40  ?  174 GLU A CD    1 
ATOM   1318 O  OE1   . GLU A 1 174 ? -34.311 -63.182 39.057  1.00 63.58  ?  174 GLU A OE1   1 
ATOM   1319 O  OE2   . GLU A 1 174 ? -34.331 -64.418 40.837  1.00 54.39  ?  174 GLU A OE2   1 
ATOM   1320 N  N     . ILE A 1 175 ? -37.851 -58.883 41.167  1.00 26.97  ?  175 ILE A N     1 
ATOM   1321 C  CA    . ILE A 1 175 ? -38.654 -57.733 40.665  1.00 26.52  ?  175 ILE A CA    1 
ATOM   1322 C  C     . ILE A 1 175 ? -38.554 -56.584 41.664  1.00 27.86  ?  175 ILE A C     1 
ATOM   1323 O  O     . ILE A 1 175 ? -38.281 -55.436 41.201  1.00 27.78  ?  175 ILE A O     1 
ATOM   1324 C  CB    . ILE A 1 175 ? -40.099 -58.141 40.382  1.00 26.32  ?  175 ILE A CB    1 
ATOM   1325 C  CG1   . ILE A 1 175 ? -40.167 -59.047 39.156  1.00 31.13  ?  175 ILE A CG1   1 
ATOM   1326 C  CG2   . ILE A 1 175 ? -40.997 -56.923 40.230  1.00 25.17  ?  175 ILE A CG2   1 
ATOM   1327 C  CD1   . ILE A 1 175 ? -41.452 -59.826 39.076  1.00 30.87  ?  175 ILE A CD1   1 
ATOM   1328 N  N     . LEU A 1 176 ? -38.768 -56.856 42.962  1.00 24.98  ?  176 LEU A N     1 
ATOM   1329 C  CA    . LEU A 1 176 ? -38.709 -55.778 43.988  1.00 30.31  ?  176 LEU A CA    1 
ATOM   1330 C  C     . LEU A 1 176 ? -37.282 -55.243 44.095  1.00 28.72  ?  176 LEU A C     1 
ATOM   1331 O  O     . LEU A 1 176 ? -37.138 -54.021 44.222  1.00 27.27  ?  176 LEU A O     1 
ATOM   1332 C  CB    . LEU A 1 176 ? -39.222 -56.286 45.337  1.00 31.82  ?  176 LEU A CB    1 
ATOM   1333 C  CG    . LEU A 1 176 ? -40.721 -56.634 45.341  1.00 36.69  ?  176 LEU A CG    1 
ATOM   1334 C  CD1   . LEU A 1 176 ? -41.199 -56.899 46.751  1.00 38.95  ?  176 LEU A CD1   1 
ATOM   1335 C  CD2   . LEU A 1 176 ? -41.590 -55.543 44.700  1.00 34.22  ?  176 LEU A CD2   1 
ATOM   1336 N  N     . GLU A 1 177 ? -36.290 -56.128 44.003  1.00 27.90  ?  177 GLU A N     1 
ATOM   1337 C  CA    . GLU A 1 177 ? -34.847 -55.783 44.027  1.00 29.87  ?  177 GLU A CA    1 
ATOM   1338 C  C     . GLU A 1 177 ? -34.550 -54.795 42.896  1.00 28.51  ?  177 GLU A C     1 
ATOM   1339 O  O     . GLU A 1 177 ? -33.975 -53.740 43.169  1.00 26.78  ?  177 GLU A O     1 
ATOM   1340 C  CB    . GLU A 1 177 ? -33.987 -57.048 43.905  1.00 30.81  ?  177 GLU A CB    1 
ATOM   1341 C  CG    . GLU A 1 177 ? -32.482 -56.804 44.032  1.00 31.64  ?  177 GLU A CG    1 
ATOM   1342 C  CD    . GLU A 1 177 ? -31.606 -58.047 43.818  1.00 36.30  ?  177 GLU A CD    1 
ATOM   1343 O  OE1   . GLU A 1 177 ? -31.921 -58.857 42.873  1.00 30.11  ?  177 GLU A OE1   1 
ATOM   1344 O  OE2   . GLU A 1 177 ? -30.621 -58.221 44.604  1.00 32.23  ?  177 GLU A OE2   1 
ATOM   1345 N  N     . LYS A 1 178 ? -34.933 -55.132 41.665  1.00 32.12  ?  178 LYS A N     1 
ATOM   1346 C  CA    . LYS A 1 178 ? -34.672 -54.279 40.477  1.00 30.16  ?  178 LYS A CA    1 
ATOM   1347 C  C     . LYS A 1 178 ? -35.426 -52.955 40.624  1.00 29.30  ?  178 LYS A C     1 
ATOM   1348 O  O     . LYS A 1 178 ? -34.914 -51.932 40.188  1.00 37.22  ?  178 LYS A O     1 
ATOM   1349 C  CB    . LYS A 1 178 ? -35.112 -54.982 39.198  1.00 32.90  ?  178 LYS A CB    1 
ATOM   1350 C  CG    . LYS A 1 178 ? -34.685 -54.254 37.920  1.00 35.49  ?  178 LYS A CG    1 
ATOM   1351 C  CD    . LYS A 1 178 ? -33.230 -54.489 37.582  1.00 35.14  ?  178 LYS A CD    1 
ATOM   1352 C  CE    . LYS A 1 178 ? -33.007 -55.923 37.147  1.00 36.83  ?  178 LYS A CE    1 
ATOM   1353 N  NZ    . LYS A 1 178 ? -31.605 -56.146 36.810  1.00 41.73  ?  178 LYS A NZ    1 
ATOM   1354 N  N     . SER A 1 179 ? -36.603 -52.966 41.226  1.00 31.72  ?  179 SER A N     1 
ATOM   1355 C  CA    . SER A 1 179 ? -37.492 -51.772 41.334  1.00 31.42  ?  179 SER A CA    1 
ATOM   1356 C  C     . SER A 1 179 ? -36.961 -50.762 42.358  1.00 32.24  ?  179 SER A C     1 
ATOM   1357 O  O     . SER A 1 179 ? -37.211 -49.562 42.185  1.00 33.64  ?  179 SER A O     1 
ATOM   1358 C  CB    . SER A 1 179 ? -38.907 -52.199 41.608  1.00 33.06  ?  179 SER A CB    1 
ATOM   1359 O  OG    . SER A 1 179 ? -39.374 -53.109 40.596  1.00 33.02  ?  179 SER A OG    1 
ATOM   1360 N  N     . TRP A 1 180 ? -36.217 -51.213 43.383  1.00 35.14  ?  180 TRP A N     1 
ATOM   1361 C  CA    . TRP A 1 180 ? -35.627 -50.326 44.426  1.00 34.37  ?  180 TRP A CA    1 
ATOM   1362 C  C     . TRP A 1 180 ? -34.294 -49.707 43.962  1.00 38.22  ?  180 TRP A C     1 
ATOM   1363 O  O     . TRP A 1 180 ? -33.904 -48.666 44.503  1.00 34.23  ?  180 TRP A O     1 
ATOM   1364 C  CB    . TRP A 1 180 ? -35.451 -51.096 45.733  1.00 33.09  ?  180 TRP A CB    1 
ATOM   1365 C  CG    . TRP A 1 180 ? -36.673 -51.077 46.595  1.00 33.46  ?  180 TRP A CG    1 
ATOM   1366 C  CD1   . TRP A 1 180 ? -37.463 -52.140 46.941  1.00 28.77  ?  180 TRP A CD1   1 
ATOM   1367 C  CD2   . TRP A 1 180 ? -37.266 -49.917 47.212  1.00 34.32  ?  180 TRP A CD2   1 
ATOM   1368 N  NE1   . TRP A 1 180 ? -38.502 -51.720 47.715  1.00 30.20  ?  180 TRP A NE1   1 
ATOM   1369 C  CE2   . TRP A 1 180 ? -38.403 -50.369 47.915  1.00 31.31  ?  180 TRP A CE2   1 
ATOM   1370 C  CE3   . TRP A 1 180 ? -36.931 -48.559 47.253  1.00 33.67  ?  180 TRP A CE3   1 
ATOM   1371 C  CZ2   . TRP A 1 180 ? -39.215 -49.504 48.639  1.00 32.56  ?  180 TRP A CZ2   1 
ATOM   1372 C  CZ3   . TRP A 1 180 ? -37.735 -47.702 47.974  1.00 32.13  ?  180 TRP A CZ3   1 
ATOM   1373 C  CH2   . TRP A 1 180 ? -38.857 -48.175 48.658  1.00 33.71  ?  180 TRP A CH2   1 
ATOM   1374 N  N     . LEU A 1 181 ? -33.631 -50.330 42.990  1.00 44.07  ?  181 LEU A N     1 
ATOM   1375 C  CA    . LEU A 1 181 ? -32.280 -49.952 42.501  1.00 45.76  ?  181 LEU A CA    1 
ATOM   1376 C  C     . LEU A 1 181 ? -32.246 -48.482 42.069  1.00 49.14  ?  181 LEU A C     1 
ATOM   1377 O  O     . LEU A 1 181 ? -31.353 -47.755 42.495  1.00 51.26  ?  181 LEU A O     1 
ATOM   1378 C  CB    . LEU A 1 181 ? -31.885 -50.886 41.353  1.00 46.23  ?  181 LEU A CB    1 
ATOM   1379 C  CG    . LEU A 1 181 ? -30.396 -51.226 41.258  1.00 54.86  ?  181 LEU A CG    1 
ATOM   1380 C  CD1   . LEU A 1 181 ? -29.848 -51.768 42.574  1.00 48.70  ?  181 LEU A CD1   1 
ATOM   1381 C  CD2   . LEU A 1 181 ? -30.128 -52.220 40.127  1.00 56.76  ?  181 LEU A CD2   1 
ATOM   1382 N  N     . PRO A 1 182 ? -33.190 -47.973 41.238  1.00 46.30  ?  182 PRO A N     1 
ATOM   1383 C  CA    . PRO A 1 182 ? -33.167 -46.577 40.810  1.00 43.94  ?  182 PRO A CA    1 
ATOM   1384 C  C     . PRO A 1 182 ? -33.236 -45.559 41.964  1.00 48.57  ?  182 PRO A C     1 
ATOM   1385 O  O     . PRO A 1 182 ? -32.928 -44.409 41.708  1.00 43.16  ?  182 PRO A O     1 
ATOM   1386 C  CB    . PRO A 1 182 ? -34.417 -46.385 39.935  1.00 42.29  ?  182 PRO A CB    1 
ATOM   1387 C  CG    . PRO A 1 182 ? -34.822 -47.781 39.556  1.00 50.18  ?  182 PRO A CG    1 
ATOM   1388 C  CD    . PRO A 1 182 ? -34.338 -48.688 40.678  1.00 49.16  ?  182 PRO A CD    1 
ATOM   1389 N  N     . GLN A 1 183 ? -33.689 -45.978 43.156  1.00 43.93  ?  183 GLN A N     1 
ATOM   1390 C  CA    . GLN A 1 183 ? -33.741 -45.121 44.368  1.00 46.53  ?  183 GLN A CA    1 
ATOM   1391 C  C     . GLN A 1 183 ? -32.432 -45.251 45.172  1.00 42.72  ?  183 GLN A C     1 
ATOM   1392 O  O     . GLN A 1 183 ? -32.395 -44.726 46.274  1.00 43.52  ?  183 GLN A O     1 
ATOM   1393 C  CB    . GLN A 1 183 ? -34.898 -45.533 45.283  1.00 57.38  ?  183 GLN A CB    1 
ATOM   1394 C  CG    . GLN A 1 183 ? -36.246 -45.639 44.589  1.00 56.15  ?  183 GLN A CG    1 
ATOM   1395 C  CD    . GLN A 1 183 ? -36.709 -44.281 44.145  1.00 58.90  ?  183 GLN A CD    1 
ATOM   1396 O  OE1   . GLN A 1 183 ? -36.944 -43.398 44.974  1.00 69.23  ?  183 GLN A OE1   1 
ATOM   1397 N  NE2   . GLN A 1 183 ? -36.835 -44.122 42.840  1.00 46.10  ?  183 GLN A NE2   1 
ATOM   1398 N  N     . ASN A 1 184 ? -31.432 -45.960 44.639  1.00 43.02  ?  184 ASN A N     1 
ATOM   1399 C  CA    . ASN A 1 184 ? -30.112 -46.264 45.257  1.00 45.95  ?  184 ASN A CA    1 
ATOM   1400 C  C     . ASN A 1 184 ? -30.367 -46.954 46.604  1.00 44.06  ?  184 ASN A C     1 
ATOM   1401 O  O     . ASN A 1 184 ? -29.643 -46.623 47.570  1.00 36.85  ?  184 ASN A O     1 
ATOM   1402 C  CB    . ASN A 1 184 ? -29.183 -45.037 45.391  1.00 57.77  ?  184 ASN A CB    1 
ATOM   1403 C  CG    . ASN A 1 184 ? -29.011 -44.265 44.086  1.00 66.47  ?  184 ASN A CG    1 
ATOM   1404 O  OD1   . ASN A 1 184 ? -28.302 -44.692 43.178  1.00 72.09  ?  184 ASN A OD1   1 
ATOM   1405 N  ND2   . ASN A 1 184 ? -29.671 -43.122 43.949  1.00 62.77  ?  184 ASN A ND2   1 
ATOM   1406 N  N     . CYS A 1 185 ? -31.321 -47.903 46.652  1.00 38.89  ?  185 CYS A N     1 
ATOM   1407 C  CA    . CYS A 1 185 ? -31.595 -48.779 47.822  1.00 35.75  ?  185 CYS A CA    1 
ATOM   1408 C  C     . CYS A 1 185 ? -31.301 -50.234 47.485  1.00 35.37  ?  185 CYS A C     1 
ATOM   1409 O  O     . CYS A 1 185 ? -31.798 -50.701 46.432  1.00 36.51  ?  185 CYS A O     1 
ATOM   1410 C  CB    . CYS A 1 185 ? -33.032 -48.681 48.294  1.00 35.14  ?  185 CYS A CB    1 
ATOM   1411 S  SG    . CYS A 1 185 ? -33.489 -47.031 48.870  1.00 43.83  ?  185 CYS A SG    1 
ATOM   1412 N  N     . THR A 1 186 ? -30.562 -50.914 48.361  1.00 30.29  ?  186 THR A N     1 
ATOM   1413 C  CA    . THR A 1 186 ? -30.295 -52.364 48.239  1.00 32.98  ?  186 THR A CA    1 
ATOM   1414 C  C     . THR A 1 186 ? -31.384 -53.149 48.981  1.00 34.04  ?  186 THR A C     1 
ATOM   1415 O  O     . THR A 1 186 ? -31.475 -53.005 50.205  1.00 37.25  ?  186 THR A O     1 
ATOM   1416 C  CB    . THR A 1 186 ? -28.929 -52.732 48.820  1.00 32.39  ?  186 THR A CB    1 
ATOM   1417 O  OG1   . THR A 1 186 ? -27.935 -51.962 48.161  1.00 31.65  ?  186 THR A OG1   1 
ATOM   1418 C  CG2   . THR A 1 186 ? -28.628 -54.212 48.719  1.00 31.83  ?  186 THR A CG2   1 
ATOM   1419 N  N     . LEU A 1 187 ? -32.193 -53.927 48.264  1.00 33.27  ?  187 LEU A N     1 
ATOM   1420 C  CA    . LEU A 1 187 ? -33.092 -54.923 48.883  1.00 27.05  ?  187 LEU A CA    1 
ATOM   1421 C  C     . LEU A 1 187 ? -32.222 -56.154 49.208  1.00 28.39  ?  187 LEU A C     1 
ATOM   1422 O  O     . LEU A 1 187 ? -31.702 -56.817 48.299  1.00 29.53  ?  187 LEU A O     1 
ATOM   1423 C  CB    . LEU A 1 187 ? -34.280 -55.211 47.963  1.00 27.67  ?  187 LEU A CB    1 
ATOM   1424 C  CG    . LEU A 1 187 ? -35.378 -56.080 48.563  1.00 27.98  ?  187 LEU A CG    1 
ATOM   1425 C  CD1   . LEU A 1 187 ? -36.163 -55.309 49.572  1.00 24.21  ?  187 LEU A CD1   1 
ATOM   1426 C  CD2   . LEU A 1 187 ? -36.288 -56.606 47.462  1.00 30.97  ?  187 LEU A CD2   1 
ATOM   1427 N  N     . VAL A 1 188 ? -32.005 -56.380 50.501  1.00 24.32  ?  188 VAL A N     1 
ATOM   1428 C  CA    . VAL A 1 188 ? -31.113 -57.410 51.069  1.00 25.28  ?  188 VAL A CA    1 
ATOM   1429 C  C     . VAL A 1 188 ? -31.831 -58.762 51.084  1.00 27.86  ?  188 VAL A C     1 
ATOM   1430 O  O     . VAL A 1 188 ? -31.224 -59.757 50.665  1.00 28.14  ?  188 VAL A O     1 
ATOM   1431 C  CB    . VAL A 1 188 ? -30.752 -56.950 52.484  1.00 27.65  ?  188 VAL A CB    1 
ATOM   1432 C  CG1   . VAL A 1 188 ? -30.075 -58.031 53.292  1.00 27.93  ?  188 VAL A CG1   1 
ATOM   1433 C  CG2   . VAL A 1 188 ? -29.909 -55.683 52.406  1.00 31.58  ?  188 VAL A CG2   1 
ATOM   1434 N  N     . ASP A 1 189 ? -33.057 -58.793 51.613  1.00 28.11  ?  189 ASP A N     1 
ATOM   1435 C  CA    . ASP A 1 189 ? -33.889 -60.016 51.737  1.00 30.79  ?  189 ASP A CA    1 
ATOM   1436 C  C     . ASP A 1 189 ? -35.353 -59.619 51.959  1.00 28.42  ?  189 ASP A C     1 
ATOM   1437 O  O     . ASP A 1 189 ? -35.618 -58.443 52.091  1.00 26.60  ?  189 ASP A O     1 
ATOM   1438 C  CB    . ASP A 1 189 ? -33.364 -60.927 52.845  1.00 31.46  ?  189 ASP A CB    1 
ATOM   1439 C  CG    . ASP A 1 189 ? -33.258 -60.227 54.184  1.00 33.23  ?  189 ASP A CG    1 
ATOM   1440 O  OD1   . ASP A 1 189 ? -34.052 -59.275 54.414  1.00 38.13  ?  189 ASP A OD1   1 
ATOM   1441 O  OD2   . ASP A 1 189 ? -32.360 -60.624 54.979  1.00 31.25  ?  189 ASP A OD2   1 
ATOM   1442 N  N     . MET A 1 190 ? -36.248 -60.596 51.986  1.00 26.77  ?  190 MET A N     1 
ATOM   1443 C  CA    . MET A 1 190 ? -37.685 -60.364 52.223  1.00 31.30  ?  190 MET A CA    1 
ATOM   1444 C  C     . MET A 1 190 ? -38.388 -61.661 52.601  1.00 28.73  ?  190 MET A C     1 
ATOM   1445 O  O     . MET A 1 190 ? -37.844 -62.711 52.391  1.00 27.03  ?  190 MET A O     1 
ATOM   1446 C  CB    . MET A 1 190 ? -38.381 -59.748 51.014  1.00 32.27  ?  190 MET A CB    1 
ATOM   1447 C  CG    . MET A 1 190 ? -38.535 -60.693 49.890  1.00 43.49  ?  190 MET A CG    1 
ATOM   1448 S  SD    . MET A 1 190 ? -39.576 -60.081 48.527  1.00 51.72  ?  190 MET A SD    1 
ATOM   1449 C  CE    . MET A 1 190 ? -39.813 -61.687 47.740  1.00 50.20  ?  190 MET A CE    1 
ATOM   1450 N  N     . LYS A 1 191 ? -39.560 -61.515 53.178  1.00 28.42  ?  191 LYS A N     1 
ATOM   1451 C  CA    . LYS A 1 191 ? -40.488 -62.600 53.519  1.00 29.59  ?  191 LYS A CA    1 
ATOM   1452 C  C     . LYS A 1 191 ? -41.837 -62.279 52.882  1.00 28.87  ?  191 LYS A C     1 
ATOM   1453 O  O     . LYS A 1 191 ? -42.293 -61.142 52.965  1.00 31.31  ?  191 LYS A O     1 
ATOM   1454 C  CB    . LYS A 1 191 ? -40.619 -62.677 55.043  1.00 31.89  ?  191 LYS A CB    1 
ATOM   1455 C  CG    . LYS A 1 191 ? -41.472 -63.822 55.581  1.00 34.70  ?  191 LYS A CG    1 
ATOM   1456 C  CD    . LYS A 1 191 ? -42.921 -63.515 55.673  1.00 37.54  ?  191 LYS A CD    1 
ATOM   1457 C  CE    . LYS A 1 191 ? -43.248 -62.544 56.784  1.00 40.07  ?  191 LYS A CE    1 
ATOM   1458 N  NZ    . LYS A 1 191 ? -44.705 -62.303 56.873  1.00 41.18  ?  191 LYS A NZ    1 
ATOM   1459 N  N     . ILE A 1 192 ? -42.481 -63.281 52.321  1.00 31.88  ?  192 ILE A N     1 
ATOM   1460 C  CA    . ILE A 1 192 ? -43.847 -63.194 51.720  1.00 31.68  ?  192 ILE A CA    1 
ATOM   1461 C  C     . ILE A 1 192 ? -44.592 -64.439 52.155  1.00 29.23  ?  192 ILE A C     1 
ATOM   1462 O  O     . ILE A 1 192 ? -43.929 -65.439 52.576  1.00 26.81  ?  192 ILE A O     1 
ATOM   1463 C  CB    . ILE A 1 192 ? -43.755 -63.103 50.174  1.00 31.75  ?  192 ILE A CB    1 
ATOM   1464 C  CG1   . ILE A 1 192 ? -43.148 -64.367 49.560  1.00 33.14  ?  192 ILE A CG1   1 
ATOM   1465 C  CG2   . ILE A 1 192 ? -42.973 -61.857 49.764  1.00 30.82  ?  192 ILE A CG2   1 
ATOM   1466 C  CD1   . ILE A 1 192 ? -43.143 -64.385 48.032  1.00 33.57  ?  192 ILE A CD1   1 
ATOM   1467 N  N     . GLU A 1 193 ? -45.908 -64.413 52.011  1.00 30.28  ?  193 GLU A N     1 
ATOM   1468 C  CA    . GLU A 1 193 ? -46.752 -65.619 52.260  1.00 28.98  ?  193 GLU A CA    1 
ATOM   1469 C  C     . GLU A 1 193 ? -47.663 -65.781 51.054  1.00 27.33  ?  193 GLU A C     1 
ATOM   1470 O  O     . GLU A 1 193 ? -47.987 -64.759 50.406  1.00 23.61  ?  193 GLU A O     1 
ATOM   1471 C  CB    . GLU A 1 193 ? -47.523 -65.473 53.565  1.00 31.13  ?  193 GLU A CB    1 
ATOM   1472 C  CG    . GLU A 1 193 ? -46.645 -65.066 54.735  1.00 39.57  ?  193 GLU A CG    1 
ATOM   1473 C  CD    . GLU A 1 193 ? -47.327 -64.983 56.100  1.00 43.40  ?  193 GLU A CD    1 
ATOM   1474 O  OE1   . GLU A 1 193 ? -48.563 -65.272 56.159  1.00 41.11  ?  193 GLU A OE1   1 
ATOM   1475 O  OE2   . GLU A 1 193 ? -46.608 -64.638 57.108  1.00 40.20  ?  193 GLU A OE2   1 
ATOM   1476 N  N     . PHE A 1 194 ? -48.012 -67.018 50.741  1.00 28.86  ?  194 PHE A N     1 
ATOM   1477 C  CA    . PHE A 1 194 ? -48.985 -67.363 49.677  1.00 32.84  ?  194 PHE A CA    1 
ATOM   1478 C  C     . PHE A 1 194 ? -50.250 -67.934 50.313  1.00 33.30  ?  194 PHE A C     1 
ATOM   1479 O  O     . PHE A 1 194 ? -50.226 -68.454 51.444  1.00 29.87  ?  194 PHE A O     1 
ATOM   1480 C  CB    . PHE A 1 194 ? -48.407 -68.385 48.700  1.00 32.37  ?  194 PHE A CB    1 
ATOM   1481 C  CG    . PHE A 1 194 ? -47.169 -67.932 47.965  1.00 34.27  ?  194 PHE A CG    1 
ATOM   1482 C  CD1   . PHE A 1 194 ? -45.913 -68.128 48.511  1.00 35.51  ?  194 PHE A CD1   1 
ATOM   1483 C  CD2   . PHE A 1 194 ? -47.255 -67.344 46.720  1.00 34.09  ?  194 PHE A CD2   1 
ATOM   1484 C  CE1   . PHE A 1 194 ? -44.774 -67.732 47.829  1.00 35.76  ?  194 PHE A CE1   1 
ATOM   1485 C  CE2   . PHE A 1 194 ? -46.115 -66.929 46.050  1.00 35.26  ?  194 PHE A CE2   1 
ATOM   1486 C  CZ    . PHE A 1 194 ? -44.880 -67.147 46.596  1.00 34.80  ?  194 PHE A CZ    1 
ATOM   1487 N  N     . GLY A 1 195 ? -51.355 -67.800 49.571  1.00 36.05  ?  195 GLY A N     1 
ATOM   1488 C  CA    . GLY A 1 195 ? -52.611 -68.488 49.889  1.00 30.75  ?  195 GLY A CA    1 
ATOM   1489 C  C     . GLY A 1 195 ? -53.233 -69.056 48.662  1.00 31.27  ?  195 GLY A C     1 
ATOM   1490 O  O     . GLY A 1 195 ? -52.720 -68.713 47.549  1.00 30.59  ?  195 GLY A O     1 
ATOM   1491 N  N     . VAL A 1 196 ? -54.283 -69.864 48.859  1.00 28.52  ?  196 VAL A N     1 
ATOM   1492 C  CA    . VAL A 1 196 ? -55.164 -70.362 47.771  1.00 28.11  ?  196 VAL A CA    1 
ATOM   1493 C  C     . VAL A 1 196 ? -56.414 -69.469 47.739  1.00 31.22  ?  196 VAL A C     1 
ATOM   1494 O  O     . VAL A 1 196 ? -57.122 -69.384 48.753  1.00 29.88  ?  196 VAL A O     1 
ATOM   1495 C  CB    . VAL A 1 196 ? -55.487 -71.844 47.972  1.00 29.95  ?  196 VAL A CB    1 
ATOM   1496 C  CG1   . VAL A 1 196 ? -56.194 -72.426 46.779  1.00 31.47  ?  196 VAL A CG1   1 
ATOM   1497 C  CG2   . VAL A 1 196 ? -54.240 -72.668 48.280  1.00 31.77  ?  196 VAL A CG2   1 
ATOM   1498 N  N     . ASP A 1 197 ? -56.610 -68.797 46.598  1.00 33.37  ?  197 ASP A N     1 
ATOM   1499 C  CA    . ASP A 1 197 ? -57.797 -67.960 46.307  1.00 36.54  ?  197 ASP A CA    1 
ATOM   1500 C  C     . ASP A 1 197 ? -58.991 -68.915 46.378  1.00 36.65  ?  197 ASP A C     1 
ATOM   1501 O  O     . ASP A 1 197 ? -58.991 -69.925 45.651  1.00 35.41  ?  197 ASP A O     1 
ATOM   1502 C  CB    . ASP A 1 197 ? -57.678 -67.278 44.939  1.00 46.38  ?  197 ASP A CB    1 
ATOM   1503 C  CG    . ASP A 1 197 ? -58.860 -66.401 44.569  1.00 55.91  ?  197 ASP A CG    1 
ATOM   1504 O  OD1   . ASP A 1 197 ? -60.038 -66.842 44.794  1.00 59.33  ?  197 ASP A OD1   1 
ATOM   1505 O  OD2   . ASP A 1 197 ? -58.574 -65.270 44.067  1.00 55.86  ?  197 ASP A OD2   1 
ATOM   1506 N  N     . VAL A 1 198 ? -59.960 -68.598 47.223  1.00 36.59  ?  198 VAL A N     1 
ATOM   1507 C  CA    . VAL A 1 198 ? -61.111 -69.516 47.494  1.00 41.12  ?  198 VAL A CA    1 
ATOM   1508 C  C     . VAL A 1 198 ? -61.980 -69.634 46.227  1.00 41.39  ?  198 VAL A C     1 
ATOM   1509 O  O     . VAL A 1 198 ? -62.670 -70.668 46.092  1.00 43.29  ?  198 VAL A O     1 
ATOM   1510 C  CB    . VAL A 1 198 ? -61.932 -69.087 48.730  1.00 39.62  ?  198 VAL A CB    1 
ATOM   1511 C  CG1   . VAL A 1 198 ? -61.058 -69.049 49.973  1.00 38.09  ?  198 VAL A CG1   1 
ATOM   1512 C  CG2   . VAL A 1 198 ? -62.620 -67.747 48.529  1.00 37.45  ?  198 VAL A CG2   1 
ATOM   1513 N  N     . THR A 1 199 ? -61.943 -68.647 45.316  1.00 35.82  ?  199 THR A N     1 
ATOM   1514 C  CA    . THR A 1 199 ? -62.782 -68.663 44.086  1.00 38.62  ?  199 THR A CA    1 
ATOM   1515 C  C     . THR A 1 199 ? -62.026 -69.358 42.947  1.00 40.84  ?  199 THR A C     1 
ATOM   1516 O  O     . THR A 1 199 ? -62.564 -70.314 42.398  1.00 41.93  ?  199 THR A O     1 
ATOM   1517 C  CB    . THR A 1 199 ? -63.282 -67.270 43.675  1.00 41.08  ?  199 THR A CB    1 
ATOM   1518 O  OG1   . THR A 1 199 ? -63.853 -66.631 44.824  1.00 40.59  ?  199 THR A OG1   1 
ATOM   1519 C  CG2   . THR A 1 199 ? -64.300 -67.354 42.556  1.00 39.26  ?  199 THR A CG2   1 
ATOM   1520 N  N     . THR A 1 200 ? -60.820 -68.896 42.599  1.00 46.29  ?  200 THR A N     1 
ATOM   1521 C  CA    . THR A 1 200 ? -60.037 -69.405 41.438  1.00 40.97  ?  200 THR A CA    1 
ATOM   1522 C  C     . THR A 1 200 ? -59.275 -70.691 41.790  1.00 39.23  ?  200 THR A C     1 
ATOM   1523 O  O     . THR A 1 200 ? -59.018 -71.455 40.868  1.00 34.36  ?  200 THR A O     1 
ATOM   1524 C  CB    . THR A 1 200 ? -59.117 -68.321 40.863  1.00 43.33  ?  200 THR A CB    1 
ATOM   1525 O  OG1   . THR A 1 200 ? -58.120 -68.007 41.828  1.00 36.63  ?  200 THR A OG1   1 
ATOM   1526 C  CG2   . THR A 1 200 ? -59.889 -67.083 40.451  1.00 42.54  ?  200 THR A CG2   1 
ATOM   1527 N  N     . LYS A 1 201 ? -58.914 -70.917 43.068  1.00 40.51  ?  201 LYS A N     1 
ATOM   1528 C  CA    . LYS A 1 201 ? -58.142 -72.115 43.512  1.00 41.25  ?  201 LYS A CA    1 
ATOM   1529 C  C     . LYS A 1 201 ? -56.682 -71.996 43.045  1.00 43.41  ?  201 LYS A C     1 
ATOM   1530 O  O     . LYS A 1 201 ? -55.941 -73.004 43.073  1.00 46.79  ?  201 LYS A O     1 
ATOM   1531 C  CB    . LYS A 1 201 ? -58.775 -73.409 42.980  1.00 41.46  ?  201 LYS A CB    1 
ATOM   1532 C  CG    . LYS A 1 201 ? -60.213 -73.638 43.407  1.00 45.13  ?  201 LYS A CG    1 
ATOM   1533 C  CD    . LYS A 1 201 ? -60.432 -73.264 44.871  1.00 50.65  ?  201 LYS A CD    1 
ATOM   1534 C  CE    . LYS A 1 201 ? -61.790 -73.692 45.381  1.00 53.75  ?  201 LYS A CE    1 
ATOM   1535 N  NZ    . LYS A 1 201 ? -62.856 -73.295 44.429  1.00 52.82  ?  201 LYS A NZ    1 
ATOM   1536 N  N     . GLU A 1 202 ? -56.272 -70.803 42.626  1.00 44.13  ?  202 GLU A N     1 
ATOM   1537 C  CA    . GLU A 1 202 ? -54.871 -70.520 42.235  1.00 46.76  ?  202 GLU A CA    1 
ATOM   1538 C  C     . GLU A 1 202 ? -54.079 -70.230 43.513  1.00 41.75  ?  202 GLU A C     1 
ATOM   1539 O  O     . GLU A 1 202 ? -54.622 -69.523 44.399  1.00 33.41  ?  202 GLU A O     1 
ATOM   1540 C  CB    . GLU A 1 202 ? -54.795 -69.288 41.340  1.00 55.46  ?  202 GLU A CB    1 
ATOM   1541 C  CG    . GLU A 1 202 ? -54.753 -69.542 39.848  1.00 68.75  ?  202 GLU A CG    1 
ATOM   1542 C  CD    . GLU A 1 202 ? -54.067 -68.382 39.121  1.00 83.20  ?  202 GLU A CD    1 
ATOM   1543 O  OE1   . GLU A 1 202 ? -53.391 -67.562 39.792  1.00 67.81  ?  202 GLU A OE1   1 
ATOM   1544 O  OE2   . GLU A 1 202 ? -54.193 -68.296 37.883  1.00 108.90 ?  202 GLU A OE2   1 
ATOM   1545 N  N     . ILE A 1 203 ? -52.834 -70.702 43.582  1.00 32.21  ?  203 ILE A N     1 
ATOM   1546 C  CA    . ILE A 1 203 ? -51.867 -70.175 44.573  1.00 33.20  ?  203 ILE A CA    1 
ATOM   1547 C  C     . ILE A 1 203 ? -51.467 -68.767 44.127  1.00 29.07  ?  203 ILE A C     1 
ATOM   1548 O  O     . ILE A 1 203 ? -51.007 -68.619 42.950  1.00 31.62  ?  203 ILE A O     1 
ATOM   1549 C  CB    . ILE A 1 203 ? -50.647 -71.082 44.735  1.00 33.10  ?  203 ILE A CB    1 
ATOM   1550 C  CG1   . ILE A 1 203 ? -51.036 -72.477 45.209  1.00 34.62  ?  203 ILE A CG1   1 
ATOM   1551 C  CG2   . ILE A 1 203 ? -49.688 -70.437 45.697  1.00 34.40  ?  203 ILE A CG2   1 
ATOM   1552 C  CD1   . ILE A 1 203 ? -49.864 -73.406 45.390  1.00 36.50  ?  203 ILE A CD1   1 
ATOM   1553 N  N     . VAL A 1 204 ? -51.584 -67.797 45.042  1.00 26.10  ?  204 VAL A N     1 
ATOM   1554 C  CA    . VAL A 1 204 ? -51.264 -66.362 44.792  1.00 24.82  ?  204 VAL A CA    1 
ATOM   1555 C  C     . VAL A 1 204 ? -50.519 -65.825 46.003  1.00 21.95  ?  204 VAL A C     1 
ATOM   1556 O  O     . VAL A 1 204 ? -50.770 -66.293 47.137  1.00 22.06  ?  204 VAL A O     1 
ATOM   1557 C  CB    . VAL A 1 204 ? -52.530 -65.524 44.517  1.00 31.34  ?  204 VAL A CB    1 
ATOM   1558 C  CG1   . VAL A 1 204 ? -53.301 -66.016 43.304  1.00 30.12  ?  204 VAL A CG1   1 
ATOM   1559 C  CG2   . VAL A 1 204 ? -53.478 -65.494 45.713  1.00 33.90  ?  204 VAL A CG2   1 
ATOM   1560 N  N     . LEU A 1 205 ? -49.615 -64.884 45.754  1.00 21.85  ?  205 LEU A N     1 
ATOM   1561 C  CA    . LEU A 1 205 ? -49.027 -63.956 46.750  1.00 23.43  ?  205 LEU A CA    1 
ATOM   1562 C  C     . LEU A 1 205 ? -50.199 -63.288 47.471  1.00 25.37  ?  205 LEU A C     1 
ATOM   1563 O  O     . LEU A 1 205 ? -51.142 -62.890 46.776  1.00 29.59  ?  205 LEU A O     1 
ATOM   1564 C  CB    . LEU A 1 205 ? -48.183 -62.908 46.009  1.00 21.76  ?  205 LEU A CB    1 
ATOM   1565 C  CG    . LEU A 1 205 ? -47.629 -61.777 46.847  1.00 24.73  ?  205 LEU A CG    1 
ATOM   1566 C  CD1   . LEU A 1 205 ? -46.676 -62.282 47.919  1.00 26.89  ?  205 LEU A CD1   1 
ATOM   1567 C  CD2   . LEU A 1 205 ? -46.950 -60.736 45.967  1.00 24.91  ?  205 LEU A CD2   1 
ATOM   1568 N  N     . ALA A 1 206 ? -50.137 -63.223 48.790  1.00 26.29  ?  206 ALA A N     1 
ATOM   1569 C  CA    . ALA A 1 206 ? -51.214 -62.721 49.658  1.00 27.00  ?  206 ALA A CA    1 
ATOM   1570 C  C     . ALA A 1 206 ? -50.593 -62.101 50.895  1.00 26.57  ?  206 ALA A C     1 
ATOM   1571 O  O     . ALA A 1 206 ? -49.431 -61.654 50.788  1.00 31.44  ?  206 ALA A O     1 
ATOM   1572 C  CB    . ALA A 1 206 ? -52.171 -63.809 50.001  1.00 29.99  ?  206 ALA A CB    1 
ATOM   1573 N  N     . ASP A 1 207 ? -51.357 -61.978 51.976  1.00 28.01  ?  207 ASP A N     1 
ATOM   1574 C  CA    . ASP A 1 207 ? -50.976 -61.162 53.149  1.00 31.60  ?  207 ASP A CA    1 
ATOM   1575 C  C     . ASP A 1 207 ? -50.637 -59.771 52.635  1.00 29.20  ?  207 ASP A C     1 
ATOM   1576 O  O     . ASP A 1 207 ? -51.439 -59.229 51.846  1.00 27.72  ?  207 ASP A O     1 
ATOM   1577 C  CB    . ASP A 1 207 ? -49.853 -61.802 53.983  1.00 38.83  ?  207 ASP A CB    1 
ATOM   1578 C  CG    . ASP A 1 207 ? -49.770 -61.224 55.401  1.00 46.71  ?  207 ASP A CG    1 
ATOM   1579 O  OD1   . ASP A 1 207 ? -50.805 -61.180 56.074  1.00 47.76  ?  207 ASP A OD1   1 
ATOM   1580 O  OD2   . ASP A 1 207 ? -48.674 -60.792 55.825  1.00 59.27  ?  207 ASP A OD2   1 
ATOM   1581 N  N     . VAL A 1 208 ? -49.524 -59.221 53.111  1.00 28.81  ?  208 VAL A N     1 
ATOM   1582 C  CA    . VAL A 1 208 ? -48.990 -57.896 52.712  1.00 30.82  ?  208 VAL A CA    1 
ATOM   1583 C  C     . VAL A 1 208 ? -47.502 -58.038 52.360  1.00 31.88  ?  208 VAL A C     1 
ATOM   1584 O  O     . VAL A 1 208 ? -46.873 -59.070 52.658  1.00 27.32  ?  208 VAL A O     1 
ATOM   1585 C  CB    . VAL A 1 208 ? -49.212 -56.828 53.804  1.00 32.75  ?  208 VAL A CB    1 
ATOM   1586 C  CG1   . VAL A 1 208 ? -50.671 -56.628 54.105  1.00 33.87  ?  208 VAL A CG1   1 
ATOM   1587 C  CG2   . VAL A 1 208 ? -48.454 -57.122 55.083  1.00 32.02  ?  208 VAL A CG2   1 
ATOM   1588 N  N     . ILE A 1 209 ? -46.980 -57.028 51.668  1.00 31.74  ?  209 ILE A N     1 
ATOM   1589 C  CA    . ILE A 1 209 ? -45.525 -56.731 51.625  1.00 31.85  ?  209 ILE A CA    1 
ATOM   1590 C  C     . ILE A 1 209 ? -45.381 -55.302 52.126  1.00 32.75  ?  209 ILE A C     1 
ATOM   1591 O  O     . ILE A 1 209 ? -45.839 -54.389 51.416  1.00 32.48  ?  209 ILE A O     1 
ATOM   1592 C  CB    . ILE A 1 209 ? -44.945 -56.933 50.217  1.00 31.27  ?  209 ILE A CB    1 
ATOM   1593 C  CG1   . ILE A 1 209 ? -44.975 -58.404 49.817  1.00 28.70  ?  209 ILE A CG1   1 
ATOM   1594 C  CG2   . ILE A 1 209 ? -43.542 -56.329 50.124  1.00 35.85  ?  209 ILE A CG2   1 
ATOM   1595 C  CD1   . ILE A 1 209 ? -44.559 -58.626 48.361  1.00 28.84  ?  209 ILE A CD1   1 
ATOM   1596 N  N     . ASP A 1 210 ? -44.808 -55.116 53.317  1.00 34.13  ?  210 ASP A N     1 
ATOM   1597 C  CA    . ASP A 1 210 ? -44.636 -53.738 53.864  1.00 41.41  ?  210 ASP A CA    1 
ATOM   1598 C  C     . ASP A 1 210 ? -43.225 -53.594 54.436  1.00 32.58  ?  210 ASP A C     1 
ATOM   1599 O  O     . ASP A 1 210 ? -42.383 -54.401 54.156  1.00 35.88  ?  210 ASP A O     1 
ATOM   1600 C  CB    . ASP A 1 210 ? -45.774 -53.378 54.840  1.00 41.15  ?  210 ASP A CB    1 
ATOM   1601 C  CG    . ASP A 1 210 ? -45.760 -54.194 56.116  1.00 53.10  ?  210 ASP A CG    1 
ATOM   1602 O  OD1   . ASP A 1 210 ? -44.691 -54.820 56.430  1.00 57.65  ?  210 ASP A OD1   1 
ATOM   1603 O  OD2   . ASP A 1 210 ? -46.816 -54.218 56.786  1.00 64.15  ?  210 ASP A OD2   1 
ATOM   1604 N  N     . ASN A 1 211 ? -43.017 -52.596 55.255  1.00 33.67  ?  211 ASN A N     1 
ATOM   1605 C  CA    . ASN A 1 211 ? -41.690 -52.231 55.788  1.00 38.48  ?  211 ASN A CA    1 
ATOM   1606 C  C     . ASN A 1 211 ? -41.253 -53.257 56.837  1.00 33.20  ?  211 ASN A C     1 
ATOM   1607 O  O     . ASN A 1 211 ? -40.098 -53.208 57.208  1.00 36.43  ?  211 ASN A O     1 
ATOM   1608 C  CB    . ASN A 1 211 ? -41.711 -50.783 56.294  1.00 43.10  ?  211 ASN A CB    1 
ATOM   1609 C  CG    . ASN A 1 211 ? -40.353 -50.136 56.203  1.00 43.74  ?  211 ASN A CG    1 
ATOM   1610 O  OD1   . ASN A 1 211 ? -39.587 -50.434 55.293  1.00 46.46  ?  211 ASN A OD1   1 
ATOM   1611 N  ND2   . ASN A 1 211 ? -40.038 -49.276 57.147  1.00 49.09  ?  211 ASN A ND2   1 
ATOM   1612 N  N     . ASP A 1 212 ? -42.094 -54.230 57.160  1.00 33.85  ?  212 ASP A N     1 
ATOM   1613 C  CA    . ASP A 1 212 ? -41.691 -55.299 58.102  1.00 34.34  ?  212 ASP A CA    1 
ATOM   1614 C  C     . ASP A 1 212 ? -41.291 -56.536 57.296  1.00 36.53  ?  212 ASP A C     1 
ATOM   1615 O  O     . ASP A 1 212 ? -40.677 -57.413 57.852  1.00 35.17  ?  212 ASP A O     1 
ATOM   1616 C  CB    . ASP A 1 212 ? -42.840 -55.738 59.013  1.00 41.54  ?  212 ASP A CB    1 
ATOM   1617 C  CG    . ASP A 1 212 ? -43.661 -54.649 59.684  1.00 55.28  ?  212 ASP A CG    1 
ATOM   1618 O  OD1   . ASP A 1 212 ? -43.227 -53.513 59.731  1.00 59.47  ?  212 ASP A OD1   1 
ATOM   1619 O  OD2   . ASP A 1 212 ? -44.732 -54.964 60.169  1.00 63.02  ?  212 ASP A OD2   1 
ATOM   1620 N  N     . SER A 1 213 ? -41.597 -56.543 56.006  1.00 32.08  ?  213 SER A N     1 
ATOM   1621 C  CA    . SER A 1 213 ? -41.434 -57.707 55.109  1.00 33.44  ?  213 SER A CA    1 
ATOM   1622 C  C     . SER A 1 213 ? -39.989 -57.874 54.616  1.00 32.23  ?  213 SER A C     1 
ATOM   1623 O  O     . SER A 1 213 ? -39.667 -58.978 54.232  1.00 38.11  ?  213 SER A O     1 
ATOM   1624 C  CB    . SER A 1 213 ? -42.356 -57.587 53.944  1.00 36.09  ?  213 SER A CB    1 
ATOM   1625 O  OG    . SER A 1 213 ? -43.688 -57.608 54.392  1.00 35.28  ?  213 SER A OG    1 
ATOM   1626 N  N     . TRP A 1 214 ? -39.191 -56.818 54.594  1.00 27.99  ?  214 TRP A N     1 
ATOM   1627 C  CA    . TRP A 1 214 ? -37.896 -56.786 53.888  1.00 30.46  ?  214 TRP A CA    1 
ATOM   1628 C  C     . TRP A 1 214 ? -36.825 -56.066 54.726  1.00 33.41  ?  214 TRP A C     1 
ATOM   1629 O  O     . TRP A 1 214 ? -37.154 -55.465 55.741  1.00 33.51  ?  214 TRP A O     1 
ATOM   1630 C  CB    . TRP A 1 214 ? -38.060 -56.104 52.520  1.00 28.84  ?  214 TRP A CB    1 
ATOM   1631 C  CG    . TRP A 1 214 ? -38.665 -54.729 52.547  1.00 29.57  ?  214 TRP A CG    1 
ATOM   1632 C  CD1   . TRP A 1 214 ? -38.480 -53.764 53.498  1.00 31.39  ?  214 TRP A CD1   1 
ATOM   1633 C  CD2   . TRP A 1 214 ? -39.493 -54.123 51.532  1.00 29.13  ?  214 TRP A CD2   1 
ATOM   1634 N  NE1   . TRP A 1 214 ? -39.151 -52.620 53.150  1.00 32.65  ?  214 TRP A NE1   1 
ATOM   1635 C  CE2   . TRP A 1 214 ? -39.778 -52.812 51.944  1.00 30.57  ?  214 TRP A CE2   1 
ATOM   1636 C  CE3   . TRP A 1 214 ? -40.017 -54.546 50.322  1.00 31.49  ?  214 TRP A CE3   1 
ATOM   1637 C  CZ2   . TRP A 1 214 ? -40.631 -51.973 51.236  1.00 31.53  ?  214 TRP A CZ2   1 
ATOM   1638 C  CZ3   . TRP A 1 214 ? -40.822 -53.695 49.589  1.00 33.64  ?  214 TRP A CZ3   1 
ATOM   1639 C  CH2   . TRP A 1 214 ? -41.132 -52.429 50.044  1.00 31.78  ?  214 TRP A CH2   1 
ATOM   1640 N  N     . ARG A 1 215 ? -35.588 -56.097 54.240  1.00 32.76  ?  215 ARG A N     1 
ATOM   1641 C  CA    . ARG A 1 215 ? -34.455 -55.258 54.721  1.00 32.09  ?  215 ARG A CA    1 
ATOM   1642 C  C     . ARG A 1 215 ? -33.987 -54.392 53.559  1.00 30.21  ?  215 ARG A C     1 
ATOM   1643 O  O     . ARG A 1 215 ? -33.746 -54.947 52.473  1.00 30.12  ?  215 ARG A O     1 
ATOM   1644 C  CB    . ARG A 1 215 ? -33.352 -56.126 55.335  1.00 29.58  ?  215 ARG A CB    1 
ATOM   1645 C  CG    . ARG A 1 215 ? -33.758 -56.804 56.644  1.00 26.67  ?  215 ARG A CG    1 
ATOM   1646 C  CD    . ARG A 1 215 ? -32.559 -57.511 57.223  1.00 32.45  ?  215 ARG A CD    1 
ATOM   1647 N  NE    . ARG A 1 215 ? -32.823 -58.166 58.484  1.00 36.26  ?  215 ARG A NE    1 
ATOM   1648 C  CZ    . ARG A 1 215 ? -32.897 -59.481 58.705  1.00 36.06  ?  215 ARG A CZ    1 
ATOM   1649 N  NH1   . ARG A 1 215 ? -32.681 -60.367 57.758  1.00 35.23  ?  215 ARG A NH1   1 
ATOM   1650 N  NH2   . ARG A 1 215 ? -33.169 -59.916 59.910  1.00 33.91  ?  215 ARG A NH2   1 
ATOM   1651 N  N     . LEU A 1 216 ? -34.036 -53.070 53.755  1.00 35.93  ?  216 LEU A N     1 
ATOM   1652 C  CA    . LEU A 1 216 ? -33.771 -52.002 52.748  1.00 31.48  ?  216 LEU A CA    1 
ATOM   1653 C  C     . LEU A 1 216 ? -32.588 -51.179 53.262  1.00 35.39  ?  216 LEU A C     1 
ATOM   1654 O  O     . LEU A 1 216 ? -32.723 -50.563 54.344  1.00 35.57  ?  216 LEU A O     1 
ATOM   1655 C  CB    . LEU A 1 216 ? -34.992 -51.095 52.649  1.00 37.13  ?  216 LEU A CB    1 
ATOM   1656 C  CG    . LEU A 1 216 ? -35.860 -51.127 51.400  1.00 41.19  ?  216 LEU A CG    1 
ATOM   1657 C  CD1   . LEU A 1 216 ? -36.704 -49.846 51.326  1.00 42.25  ?  216 LEU A CD1   1 
ATOM   1658 C  CD2   . LEU A 1 216 ? -35.057 -51.284 50.139  1.00 44.99  ?  216 LEU A CD2   1 
ATOM   1659 N  N     . TRP A 1 217 ? -31.474 -51.185 52.542  1.00 35.33  ?  217 TRP A N     1 
ATOM   1660 C  CA    . TRP A 1 217 ? -30.262 -50.427 52.924  1.00 37.17  ?  217 TRP A CA    1 
ATOM   1661 C  C     . TRP A 1 217 ? -30.003 -49.384 51.846  1.00 37.93  ?  217 TRP A C     1 
ATOM   1662 O  O     . TRP A 1 217 ? -29.525 -49.753 50.773  1.00 38.72  ?  217 TRP A O     1 
ATOM   1663 C  CB    . TRP A 1 217 ? -29.039 -51.347 53.055  1.00 35.65  ?  217 TRP A CB    1 
ATOM   1664 C  CG    . TRP A 1 217 ? -29.156 -52.408 54.087  1.00 32.10  ?  217 TRP A CG    1 
ATOM   1665 C  CD1   . TRP A 1 217 ? -30.119 -52.548 55.034  1.00 29.59  ?  217 TRP A CD1   1 
ATOM   1666 C  CD2   . TRP A 1 217 ? -28.223 -53.474 54.295  1.00 31.62  ?  217 TRP A CD2   1 
ATOM   1667 N  NE1   . TRP A 1 217 ? -29.862 -53.657 55.795  1.00 29.19  ?  217 TRP A NE1   1 
ATOM   1668 C  CE2   . TRP A 1 217 ? -28.697 -54.227 55.386  1.00 28.72  ?  217 TRP A CE2   1 
ATOM   1669 C  CE3   . TRP A 1 217 ? -27.054 -53.881 53.643  1.00 33.24  ?  217 TRP A CE3   1 
ATOM   1670 C  CZ2   . TRP A 1 217 ? -28.055 -55.378 55.834  1.00 35.45  ?  217 TRP A CZ2   1 
ATOM   1671 C  CZ3   . TRP A 1 217 ? -26.401 -55.009 54.095  1.00 34.39  ?  217 TRP A CZ3   1 
ATOM   1672 C  CH2   . TRP A 1 217 ? -26.901 -55.755 55.174  1.00 36.67  ?  217 TRP A CH2   1 
ATOM   1673 N  N     . PRO A 1 218 ? -30.255 -48.082 52.109  1.00 36.38  ?  218 PRO A N     1 
ATOM   1674 C  CA    . PRO A 1 218 ? -29.790 -47.015 51.207  1.00 37.26  ?  218 PRO A CA    1 
ATOM   1675 C  C     . PRO A 1 218 ? -28.278 -47.136 50.973  1.00 33.02  ?  218 PRO A C     1 
ATOM   1676 O  O     . PRO A 1 218 ? -27.549 -47.374 51.942  1.00 34.61  ?  218 PRO A O     1 
ATOM   1677 C  CB    . PRO A 1 218 ? -30.164 -45.702 51.937  1.00 38.79  ?  218 PRO A CB    1 
ATOM   1678 C  CG    . PRO A 1 218 ? -31.279 -46.137 52.908  1.00 36.82  ?  218 PRO A CG    1 
ATOM   1679 C  CD    . PRO A 1 218 ? -30.948 -47.568 53.302  1.00 33.57  ?  218 PRO A CD    1 
ATOM   1680 N  N     . SER A 1 219 ? -27.850 -47.039 49.712  1.00 33.88  ?  219 SER A N     1 
ATOM   1681 C  CA    . SER A 1 219 ? -26.427 -47.115 49.269  1.00 38.37  ?  219 SER A CA    1 
ATOM   1682 C  C     . SER A 1 219 ? -25.749 -48.424 49.733  1.00 37.70  ?  219 SER A C     1 
ATOM   1683 O  O     . SER A 1 219 ? -24.532 -48.438 49.853  1.00 37.99  ?  219 SER A O     1 
ATOM   1684 C  CB    . SER A 1 219 ? -25.641 -45.882 49.744  1.00 38.87  ?  219 SER A CB    1 
ATOM   1685 O  OG    . SER A 1 219 ? -26.309 -44.692 49.356  1.00 41.67  ?  219 SER A OG    1 
ATOM   1686 N  N     . GLY A 1 220 ? -26.505 -49.487 49.998  1.00 38.82  ?  220 GLY A N     1 
ATOM   1687 C  CA    . GLY A 1 220 ? -25.968 -50.761 50.516  1.00 41.54  ?  220 GLY A CA    1 
ATOM   1688 C  C     . GLY A 1 220 ? -25.429 -50.660 51.939  1.00 43.41  ?  220 GLY A C     1 
ATOM   1689 O  O     . GLY A 1 220 ? -24.747 -51.619 52.359  1.00 35.58  ?  220 GLY A O     1 
ATOM   1690 N  N     . ASP A 1 221 ? -25.780 -49.602 52.694  1.00 45.46  ?  221 ASP A N     1 
ATOM   1691 C  CA    . ASP A 1 221 ? -25.192 -49.315 54.044  1.00 49.93  ?  221 ASP A CA    1 
ATOM   1692 C  C     . ASP A 1 221 ? -26.160 -49.714 55.175  1.00 46.92  ?  221 ASP A C     1 
ATOM   1693 O  O     . ASP A 1 221 ? -27.084 -48.943 55.495  1.00 47.19  ?  221 ASP A O     1 
ATOM   1694 C  CB    . ASP A 1 221 ? -24.770 -47.844 54.167  1.00 53.18  ?  221 ASP A CB    1 
ATOM   1695 C  CG    . ASP A 1 221 ? -24.077 -47.486 55.474  1.00 51.72  ?  221 ASP A CG    1 
ATOM   1696 O  OD1   . ASP A 1 221 ? -23.951 -48.381 56.359  1.00 44.34  ?  221 ASP A OD1   1 
ATOM   1697 O  OD2   . ASP A 1 221 ? -23.663 -46.318 55.586  1.00 52.51  ?  221 ASP A OD2   1 
ATOM   1698 N  N     . ARG A 1 222 ? -25.871 -50.838 55.820  1.00 41.88  ?  222 ARG A N     1 
ATOM   1699 C  CA    . ARG A 1 222 ? -26.696 -51.469 56.875  1.00 41.98  ?  222 ARG A CA    1 
ATOM   1700 C  C     . ARG A 1 222 ? -27.031 -50.462 57.965  1.00 40.68  ?  222 ARG A C     1 
ATOM   1701 O  O     . ARG A 1 222 ? -28.104 -50.590 58.561  1.00 49.06  ?  222 ARG A O     1 
ATOM   1702 C  CB    . ARG A 1 222 ? -25.901 -52.629 57.468  1.00 47.11  ?  222 ARG A CB    1 
ATOM   1703 C  CG    . ARG A 1 222 ? -26.651 -53.384 58.556  1.00 57.60  ?  222 ARG A CG    1 
ATOM   1704 C  CD    . ARG A 1 222 ? -25.992 -54.727 58.795  1.00 63.77  ?  222 ARG A CD    1 
ATOM   1705 N  NE    . ARG A 1 222 ? -26.162 -55.117 60.180  1.00 65.12  ?  222 ARG A NE    1 
ATOM   1706 C  CZ    . ARG A 1 222 ? -25.383 -54.711 61.175  1.00 66.41  ?  222 ARG A CZ    1 
ATOM   1707 N  NH1   . ARG A 1 222 ? -24.346 -53.922 60.959  1.00 65.99  ?  222 ARG A NH1   1 
ATOM   1708 N  NH2   . ARG A 1 222 ? -25.653 -55.102 62.401  1.00 74.30  ?  222 ARG A NH2   1 
ATOM   1709 N  N     . SER A 1 223 ? -26.118 -49.543 58.269  1.00 41.92  ?  223 SER A N     1 
ATOM   1710 C  CA    . SER A 1 223 ? -26.257 -48.561 59.377  1.00 46.14  ?  223 SER A CA    1 
ATOM   1711 C  C     . SER A 1 223 ? -27.359 -47.553 59.008  1.00 46.88  ?  223 SER A C     1 
ATOM   1712 O  O     . SER A 1 223 ? -27.902 -46.960 59.933  1.00 43.27  ?  223 SER A O     1 
ATOM   1713 C  CB    . SER A 1 223 ? -24.919 -47.876 59.707  1.00 48.19  ?  223 SER A CB    1 
ATOM   1714 O  OG    . SER A 1 223 ? -24.660 -46.772 58.812  1.00 52.78  ?  223 SER A OG    1 
ATOM   1715 N  N     . GLN A 1 224 ? -27.679 -47.391 57.705  1.00 52.31  ?  224 GLN A N     1 
ATOM   1716 C  CA    . GLN A 1 224 ? -28.794 -46.535 57.187  1.00 46.84  ?  224 GLN A CA    1 
ATOM   1717 C  C     . GLN A 1 224 ? -30.096 -47.347 56.992  1.00 41.16  ?  224 GLN A C     1 
ATOM   1718 O  O     . GLN A 1 224 ? -31.025 -46.819 56.361  1.00 40.01  ?  224 GLN A O     1 
ATOM   1719 C  CB    . GLN A 1 224 ? -28.382 -45.891 55.855  1.00 51.02  ?  224 GLN A CB    1 
ATOM   1720 C  CG    . GLN A 1 224 ? -27.335 -44.789 55.955  1.00 53.31  ?  224 GLN A CG    1 
ATOM   1721 C  CD    . GLN A 1 224 ? -26.920 -44.324 54.577  1.00 55.44  ?  224 GLN A CD    1 
ATOM   1722 O  OE1   . GLN A 1 224 ? -27.720 -43.816 53.794  1.00 62.70  ?  224 GLN A OE1   1 
ATOM   1723 N  NE2   . GLN A 1 224 ? -25.650 -44.501 54.259  1.00 52.12  ?  224 GLN A NE2   1 
ATOM   1724 N  N     . GLN A 1 225 ? -30.188 -48.576 57.503  1.00 34.65  ?  225 GLN A N     1 
ATOM   1725 C  CA    . GLN A 1 225 ? -31.377 -49.460 57.345  1.00 38.21  ?  225 GLN A CA    1 
ATOM   1726 C  C     . GLN A 1 225 ? -32.654 -48.682 57.657  1.00 38.71  ?  225 GLN A C     1 
ATOM   1727 O  O     . GLN A 1 225 ? -32.686 -47.995 58.698  1.00 41.36  ?  225 GLN A O     1 
ATOM   1728 C  CB    . GLN A 1 225 ? -31.258 -50.718 58.206  1.00 38.76  ?  225 GLN A CB    1 
ATOM   1729 C  CG    . GLN A 1 225 ? -31.183 -50.460 59.700  1.00 40.89  ?  225 GLN A CG    1 
ATOM   1730 C  CD    . GLN A 1 225 ? -30.934 -51.720 60.484  1.00 40.06  ?  225 GLN A CD    1 
ATOM   1731 O  OE1   . GLN A 1 225 ? -30.748 -52.798 59.927  1.00 37.93  ?  225 GLN A OE1   1 
ATOM   1732 N  NE2   . GLN A 1 225 ? -30.926 -51.581 61.800  1.00 39.87  ?  225 GLN A NE2   1 
ATOM   1733 N  N     . LYS A 1 226 ? -33.649 -48.769 56.759  1.00 40.41  ?  226 LYS A N     1 
ATOM   1734 C  CA    . LYS A 1 226 ? -34.909 -47.985 56.824  1.00 40.93  ?  226 LYS A CA    1 
ATOM   1735 C  C     . LYS A 1 226 ? -36.090 -48.896 57.206  1.00 44.34  ?  226 LYS A C     1 
ATOM   1736 O  O     . LYS A 1 226 ? -37.204 -48.356 57.470  1.00 42.72  ?  226 LYS A O     1 
ATOM   1737 C  CB    . LYS A 1 226 ? -35.132 -47.296 55.479  1.00 43.00  ?  226 LYS A CB    1 
ATOM   1738 C  CG    . LYS A 1 226 ? -34.203 -46.121 55.225  1.00 44.54  ?  226 LYS A CG    1 
ATOM   1739 C  CD    . LYS A 1 226 ? -34.433 -44.938 56.166  1.00 48.26  ?  226 LYS A CD    1 
ATOM   1740 C  CE    . LYS A 1 226 ? -33.522 -43.763 55.894  1.00 49.94  ?  226 LYS A CE    1 
ATOM   1741 N  NZ    . LYS A 1 226 ? -32.155 -44.040 56.371  1.00 52.19  ?  226 LYS A NZ    1 
ATOM   1742 N  N     . ASP A 1 227 ? -35.869 -50.211 57.260  1.00 36.39  ?  227 ASP A N     1 
ATOM   1743 C  CA    . ASP A 1 227 ? -36.937 -51.220 57.482  1.00 35.15  ?  227 ASP A CA    1 
ATOM   1744 C  C     . ASP A 1 227 ? -37.177 -51.414 58.993  1.00 37.57  ?  227 ASP A C     1 
ATOM   1745 O  O     . ASP A 1 227 ? -36.540 -50.704 59.800  1.00 32.67  ?  227 ASP A O     1 
ATOM   1746 C  CB    . ASP A 1 227 ? -36.530 -52.519 56.785  1.00 40.25  ?  227 ASP A CB    1 
ATOM   1747 C  CG    . ASP A 1 227 ? -35.248 -53.135 57.341  1.00 47.48  ?  227 ASP A CG    1 
ATOM   1748 O  OD1   . ASP A 1 227 ? -34.102 -52.721 56.894  1.00 39.09  ?  227 ASP A OD1   1 
ATOM   1749 O  OD2   . ASP A 1 227 ? -35.400 -54.010 58.234  1.00 44.42  ?  227 ASP A OD2   1 
ATOM   1750 N  N     . LYS A 1 228 ? -38.006 -52.397 59.367  1.00 36.64  ?  228 LYS A N     1 
ATOM   1751 C  CA    . LYS A 1 228 ? -38.385 -52.695 60.780  1.00 39.82  ?  228 LYS A CA    1 
ATOM   1752 C  C     . LYS A 1 228 ? -37.202 -53.247 61.595  1.00 40.05  ?  228 LYS A C     1 
ATOM   1753 O  O     . LYS A 1 228 ? -37.322 -53.320 62.816  1.00 41.16  ?  228 LYS A O     1 
ATOM   1754 C  CB    . LYS A 1 228 ? -39.545 -53.700 60.806  1.00 43.59  ?  228 LYS A CB    1 
ATOM   1755 C  CG    . LYS A 1 228 ? -40.070 -54.045 62.201  1.00 43.70  ?  228 LYS A CG    1 
ATOM   1756 C  CD    . LYS A 1 228 ? -41.467 -54.637 62.181  1.00 41.56  ?  228 LYS A CD    1 
ATOM   1757 C  CE    . LYS A 1 228 ? -41.529 -56.018 62.786  1.00 43.41  ?  228 LYS A CE    1 
ATOM   1758 N  NZ    . LYS A 1 228 ? -42.831 -56.679 62.564  1.00 46.95  ?  228 LYS A NZ    1 
ATOM   1759 N  N     . GLN A 1 229 ? -36.114 -53.668 60.958  1.00 40.00  ?  229 GLN A N     1 
ATOM   1760 C  CA    . GLN A 1 229 ? -34.894 -54.134 61.671  1.00 40.87  ?  229 GLN A CA    1 
ATOM   1761 C  C     . GLN A 1 229 ? -34.414 -53.013 62.603  1.00 41.75  ?  229 GLN A C     1 
ATOM   1762 O  O     . GLN A 1 229 ? -33.813 -53.352 63.624  1.00 43.11  ?  229 GLN A O     1 
ATOM   1763 C  CB    . GLN A 1 229 ? -33.780 -54.529 60.695  1.00 37.34  ?  229 GLN A CB    1 
ATOM   1764 C  CG    . GLN A 1 229 ? -32.634 -55.294 61.337  1.00 34.80  ?  229 GLN A CG    1 
ATOM   1765 C  CD    . GLN A 1 229 ? -33.073 -56.600 61.950  1.00 35.24  ?  229 GLN A CD    1 
ATOM   1766 O  OE1   . GLN A 1 229 ? -33.857 -57.346 61.388  1.00 33.27  ?  229 GLN A OE1   1 
ATOM   1767 N  NE2   . GLN A 1 229 ? -32.591 -56.884 63.136  1.00 31.94  ?  229 GLN A NE2   1 
ATOM   1768 N  N     . SER A 1 230 ? -34.680 -51.742 62.275  1.00 38.49  ?  230 SER A N     1 
ATOM   1769 C  CA    . SER A 1 230 ? -34.253 -50.578 63.098  1.00 42.35  ?  230 SER A CA    1 
ATOM   1770 C  C     . SER A 1 230 ? -34.947 -50.643 64.471  1.00 41.45  ?  230 SER A C     1 
ATOM   1771 O  O     . SER A 1 230 ? -34.323 -50.223 65.452  1.00 47.55  ?  230 SER A O     1 
ATOM   1772 C  CB    . SER A 1 230 ? -34.480 -49.241 62.376  1.00 41.93  ?  230 SER A CB    1 
ATOM   1773 O  OG    . SER A 1 230 ? -35.852 -49.034 62.009  1.00 41.69  ?  230 SER A OG    1 
ATOM   1774 N  N     . TYR A 1 231 ? -36.165 -51.189 64.528  1.00 36.75  ?  231 TYR A N     1 
ATOM   1775 C  CA    . TYR A 1 231 ? -36.993 -51.383 65.749  1.00 33.69  ?  231 TYR A CA    1 
ATOM   1776 C  C     . TYR A 1 231 ? -36.573 -52.666 66.456  1.00 35.05  ?  231 TYR A C     1 
ATOM   1777 O  O     . TYR A 1 231 ? -36.484 -52.643 67.690  1.00 35.90  ?  231 TYR A O     1 
ATOM   1778 C  CB    . TYR A 1 231 ? -38.473 -51.404 65.372  1.00 33.26  ?  231 TYR A CB    1 
ATOM   1779 C  CG    . TYR A 1 231 ? -39.488 -51.724 66.446  1.00 35.15  ?  231 TYR A CG    1 
ATOM   1780 C  CD1   . TYR A 1 231 ? -39.765 -50.835 67.461  1.00 36.12  ?  231 TYR A CD1   1 
ATOM   1781 C  CD2   . TYR A 1 231 ? -40.242 -52.877 66.398  1.00 34.60  ?  231 TYR A CD2   1 
ATOM   1782 C  CE1   . TYR A 1 231 ? -40.699 -51.120 68.436  1.00 35.14  ?  231 TYR A CE1   1 
ATOM   1783 C  CE2   . TYR A 1 231 ? -41.190 -53.175 67.359  1.00 36.09  ?  231 TYR A CE2   1 
ATOM   1784 C  CZ    . TYR A 1 231 ? -41.443 -52.280 68.370  1.00 36.12  ?  231 TYR A CZ    1 
ATOM   1785 O  OH    . TYR A 1 231 ? -42.412 -52.551 69.293  1.00 36.23  ?  231 TYR A OH    1 
ATOM   1786 N  N     . ARG A 1 232 ? -36.356 -53.759 65.719  1.00 39.60  ?  232 ARG A N     1 
ATOM   1787 C  CA    . ARG A 1 232 ? -35.880 -55.057 66.296  1.00 35.50  ?  232 ARG A CA    1 
ATOM   1788 C  C     . ARG A 1 232 ? -34.547 -54.853 67.024  1.00 40.52  ?  232 ARG A C     1 
ATOM   1789 O  O     . ARG A 1 232 ? -34.362 -55.523 68.047  1.00 38.62  ?  232 ARG A O     1 
ATOM   1790 C  CB    . ARG A 1 232 ? -35.691 -56.132 65.231  1.00 37.71  ?  232 ARG A CB    1 
ATOM   1791 C  CG    . ARG A 1 232 ? -36.949 -56.469 64.429  1.00 39.01  ?  232 ARG A CG    1 
ATOM   1792 C  CD    . ARG A 1 232 ? -36.801 -57.766 63.641  1.00 38.75  ?  232 ARG A CD    1 
ATOM   1793 N  NE    . ARG A 1 232 ? -37.881 -57.944 62.669  1.00 40.39  ?  232 ARG A NE    1 
ATOM   1794 C  CZ    . ARG A 1 232 ? -37.792 -57.703 61.341  1.00 45.29  ?  232 ARG A CZ    1 
ATOM   1795 N  NH1   . ARG A 1 232 ? -38.872 -57.868 60.592  1.00 43.50  ?  232 ARG A NH1   1 
ATOM   1796 N  NH2   . ARG A 1 232 ? -36.663 -57.278 60.762  1.00 40.60  ?  232 ARG A NH2   1 
ATOM   1797 N  N     . ASP A 1 233 ? -33.673 -53.942 66.551  1.00 47.36  ?  233 ASP A N     1 
ATOM   1798 C  CA    . ASP A 1 233 ? -32.242 -53.794 66.974  1.00 47.38  ?  233 ASP A CA    1 
ATOM   1799 C  C     . ASP A 1 233 ? -32.129 -52.989 68.280  1.00 45.90  ?  233 ASP A C     1 
ATOM   1800 O  O     . ASP A 1 233 ? -31.121 -53.147 68.980  1.00 43.81  ?  233 ASP A O     1 
ATOM   1801 C  CB    . ASP A 1 233 ? -31.359 -53.200 65.853  1.00 47.64  ?  233 ASP A CB    1 
ATOM   1802 C  CG    . ASP A 1 233 ? -30.841 -54.208 64.804  1.00 52.72  ?  233 ASP A CG    1 
ATOM   1803 O  OD1   . ASP A 1 233 ? -31.100 -55.441 64.944  1.00 51.16  ?  233 ASP A OD1   1 
ATOM   1804 O  OD2   . ASP A 1 233 ? -30.170 -53.769 63.826  1.00 50.30  ?  233 ASP A OD2   1 
ATOM   1805 N  N     . LEU A 1 234 ? -33.118 -52.161 68.613  1.00 49.08  ?  234 LEU A N     1 
ATOM   1806 C  CA    . LEU A 1 234 ? -33.154 -51.328 69.859  1.00 46.15  ?  234 LEU A CA    1 
ATOM   1807 C  C     . LEU A 1 234 ? -32.932 -52.230 71.082  1.00 45.26  ?  234 LEU A C     1 
ATOM   1808 O  O     . LEU A 1 234 ? -33.675 -53.193 71.218  1.00 40.69  ?  234 LEU A O     1 
ATOM   1809 C  CB    . LEU A 1 234 ? -34.499 -50.594 69.960  1.00 37.88  ?  234 LEU A CB    1 
ATOM   1810 C  CG    . LEU A 1 234 ? -34.763 -49.554 68.870  1.00 36.33  ?  234 LEU A CG    1 
ATOM   1811 C  CD1   . LEU A 1 234 ? -36.100 -48.846 69.077  1.00 37.09  ?  234 LEU A CD1   1 
ATOM   1812 C  CD2   . LEU A 1 234 ? -33.634 -48.530 68.831  1.00 35.79  ?  234 LEU A CD2   1 
ATOM   1813 N  N     . LYS A 1 235 ? -31.951 -51.927 71.935  1.00 46.77  ?  235 LYS A N     1 
ATOM   1814 C  CA    . LYS A 1 235 ? -31.778 -52.632 73.237  1.00 58.54  ?  235 LYS A CA    1 
ATOM   1815 C  C     . LYS A 1 235 ? -33.057 -52.418 74.069  1.00 54.84  ?  235 LYS A C     1 
ATOM   1816 O  O     . LYS A 1 235 ? -33.630 -53.423 74.578  1.00 47.14  ?  235 LYS A O     1 
ATOM   1817 C  CB    . LYS A 1 235 ? -30.542 -52.119 73.980  1.00 66.35  ?  235 LYS A CB    1 
ATOM   1818 C  CG    . LYS A 1 235 ? -29.200 -52.459 73.343  1.00 79.94  ?  235 LYS A CG    1 
ATOM   1819 C  CD    . LYS A 1 235 ? -28.077 -52.729 74.363  1.00 106.97 ?  235 LYS A CD    1 
ATOM   1820 C  CE    . LYS A 1 235 ? -28.017 -51.799 75.572  1.00 115.64 ?  235 LYS A CE    1 
ATOM   1821 N  NZ    . LYS A 1 235 ? -27.832 -50.371 75.200  1.00 108.50 ?  235 LYS A NZ    1 
ATOM   1822 N  N     . GLU A 1 236 ? -33.506 -51.157 74.151  1.00 48.78  ?  236 GLU A N     1 
ATOM   1823 C  CA    . GLU A 1 236 ? -34.668 -50.705 74.947  1.00 47.87  ?  236 GLU A CA    1 
ATOM   1824 C  C     . GLU A 1 236 ? -35.483 -49.788 74.037  1.00 42.20  ?  236 GLU A C     1 
ATOM   1825 O  O     . GLU A 1 236 ? -34.897 -49.008 73.325  1.00 38.95  ?  236 GLU A O     1 
ATOM   1826 C  CB    . GLU A 1 236 ? -34.127 -50.045 76.226  1.00 63.16  ?  236 GLU A CB    1 
ATOM   1827 C  CG    . GLU A 1 236 ? -35.139 -49.407 77.174  1.00 63.65  ?  236 GLU A CG    1 
ATOM   1828 C  CD    . GLU A 1 236 ? -34.512 -48.398 78.165  1.00 69.55  ?  236 GLU A CD    1 
ATOM   1829 O  OE1   . GLU A 1 236 ? -33.256 -48.380 78.315  1.00 68.84  ?  236 GLU A OE1   1 
ATOM   1830 O  OE2   . GLU A 1 236 ? -35.269 -47.605 78.800  1.00 66.68  ?  236 GLU A OE2   1 
ATOM   1831 N  N     . VAL A 1 237 ? -36.800 -49.939 74.032  1.00 40.37  ?  237 VAL A N     1 
ATOM   1832 C  CA    . VAL A 1 237 ? -37.735 -49.048 73.290  1.00 44.04  ?  237 VAL A CA    1 
ATOM   1833 C  C     . VAL A 1 237 ? -38.073 -47.838 74.170  1.00 47.25  ?  237 VAL A C     1 
ATOM   1834 O  O     . VAL A 1 237 ? -38.797 -47.984 75.159  1.00 53.13  ?  237 VAL A O     1 
ATOM   1835 C  CB    . VAL A 1 237 ? -39.003 -49.800 72.833  1.00 46.26  ?  237 VAL A CB    1 
ATOM   1836 C  CG1   . VAL A 1 237 ? -39.894 -48.918 71.973  1.00 41.15  ?  237 VAL A CG1   1 
ATOM   1837 C  CG2   . VAL A 1 237 ? -38.655 -51.089 72.084  1.00 46.84  ?  237 VAL A CG2   1 
ATOM   1838 N  N     . THR A 1 238 ? -37.561 -46.680 73.788  1.00 45.42  ?  238 THR A N     1 
ATOM   1839 C  CA    . THR A 1 238 ? -37.816 -45.358 74.389  1.00 49.39  ?  238 THR A CA    1 
ATOM   1840 C  C     . THR A 1 238 ? -38.701 -44.582 73.421  1.00 57.25  ?  238 THR A C     1 
ATOM   1841 O  O     . THR A 1 238 ? -38.814 -44.961 72.257  1.00 60.07  ?  238 THR A O     1 
ATOM   1842 C  CB    . THR A 1 238 ? -36.482 -44.639 74.674  1.00 53.87  ?  238 THR A CB    1 
ATOM   1843 O  OG1   . THR A 1 238 ? -35.811 -44.307 73.461  1.00 55.14  ?  238 THR A OG1   1 
ATOM   1844 C  CG2   . THR A 1 238 ? -35.508 -45.465 75.496  1.00 49.58  ?  238 THR A CG2   1 
ATOM   1845 N  N     . PRO A 1 239 ? -39.361 -43.478 73.853  1.00 66.50  ?  239 PRO A N     1 
ATOM   1846 C  CA    . PRO A 1 239 ? -40.131 -42.648 72.925  1.00 61.21  ?  239 PRO A CA    1 
ATOM   1847 C  C     . PRO A 1 239 ? -39.240 -41.992 71.850  1.00 64.22  ?  239 PRO A C     1 
ATOM   1848 O  O     . PRO A 1 239 ? -39.712 -41.804 70.741  1.00 58.32  ?  239 PRO A O     1 
ATOM   1849 C  CB    . PRO A 1 239 ? -40.799 -41.594 73.825  1.00 63.17  ?  239 PRO A CB    1 
ATOM   1850 C  CG    . PRO A 1 239 ? -40.692 -42.153 75.241  1.00 61.47  ?  239 PRO A CG    1 
ATOM   1851 C  CD    . PRO A 1 239 ? -39.415 -42.965 75.236  1.00 64.16  ?  239 PRO A CD    1 
ATOM   1852 N  N     . GLU A 1 240 ? -37.991 -41.648 72.186  1.00 63.58  ?  240 GLU A N     1 
ATOM   1853 C  CA    . GLU A 1 240 ? -37.003 -41.110 71.208  1.00 65.37  ?  240 GLU A CA    1 
ATOM   1854 C  C     . GLU A 1 240 ? -36.644 -42.218 70.184  1.00 66.41  ?  240 GLU A C     1 
ATOM   1855 O  O     . GLU A 1 240 ? -36.437 -41.889 68.982  1.00 48.82  ?  240 GLU A O     1 
ATOM   1856 C  CB    . GLU A 1 240 ? -35.807 -40.543 71.970  1.00 73.55  ?  240 GLU A CB    1 
ATOM   1857 C  CG    . GLU A 1 240 ? -34.638 -40.119 71.097  1.00 88.92  ?  240 GLU A CG    1 
ATOM   1858 C  CD    . GLU A 1 240 ? -33.358 -39.812 71.872  1.00 100.15 ?  240 GLU A CD    1 
ATOM   1859 O  OE1   . GLU A 1 240 ? -32.492 -39.076 71.328  1.00 79.14  ?  240 GLU A OE1   1 
ATOM   1860 O  OE2   . GLU A 1 240 ? -33.214 -40.318 73.023  1.00 104.30 ?  240 GLU A OE2   1 
ATOM   1861 N  N     . GLY A 1 241 ? -36.569 -43.475 70.637  1.00 59.79  ?  241 GLY A N     1 
ATOM   1862 C  CA    . GLY A 1 241 ? -36.321 -44.666 69.806  1.00 56.29  ?  241 GLY A CA    1 
ATOM   1863 C  C     . GLY A 1 241 ? -37.442 -44.914 68.797  1.00 58.39  ?  241 GLY A C     1 
ATOM   1864 O  O     . GLY A 1 241 ? -37.145 -45.289 67.660  1.00 52.78  ?  241 GLY A O     1 
ATOM   1865 N  N     . LEU A 1 242 ? -38.700 -44.766 69.210  1.00 52.79  ?  242 LEU A N     1 
ATOM   1866 C  CA    . LEU A 1 242 ? -39.891 -44.978 68.346  1.00 49.40  ?  242 LEU A CA    1 
ATOM   1867 C  C     . LEU A 1 242 ? -40.019 -43.869 67.300  1.00 44.36  ?  242 LEU A C     1 
ATOM   1868 O  O     . LEU A 1 242 ? -40.595 -44.185 66.260  1.00 44.42  ?  242 LEU A O     1 
ATOM   1869 C  CB    . LEU A 1 242 ? -41.160 -44.983 69.195  1.00 54.29  ?  242 LEU A CB    1 
ATOM   1870 C  CG    . LEU A 1 242 ? -41.691 -46.332 69.629  1.00 56.64  ?  242 LEU A CG    1 
ATOM   1871 C  CD1   . LEU A 1 242 ? -42.967 -46.145 70.440  1.00 57.57  ?  242 LEU A CD1   1 
ATOM   1872 C  CD2   . LEU A 1 242 ? -41.947 -47.216 68.427  1.00 56.75  ?  242 LEU A CD2   1 
ATOM   1873 N  N     . GLN A 1 243 ? -39.573 -42.631 67.578  1.00 42.43  ?  243 GLN A N     1 
ATOM   1874 C  CA    . GLN A 1 243 ? -39.645 -41.495 66.616  1.00 49.71  ?  243 GLN A CA    1 
ATOM   1875 C  C     . GLN A 1 243 ? -38.654 -41.726 65.464  1.00 48.47  ?  243 GLN A C     1 
ATOM   1876 O  O     . GLN A 1 243 ? -39.026 -41.410 64.321  1.00 43.80  ?  243 GLN A O     1 
ATOM   1877 C  CB    . GLN A 1 243 ? -39.462 -40.124 67.274  1.00 54.49  ?  243 GLN A CB    1 
ATOM   1878 C  CG    . GLN A 1 243 ? -40.716 -39.658 68.025  1.00 78.99  ?  243 GLN A CG    1 
ATOM   1879 C  CD    . GLN A 1 243 ? -42.040 -39.856 67.295  1.00 92.57  ?  243 GLN A CD    1 
ATOM   1880 O  OE1   . GLN A 1 243 ? -42.307 -39.226 66.267  1.00 84.88  ?  243 GLN A OE1   1 
ATOM   1881 N  NE2   . GLN A 1 243 ? -42.895 -40.734 67.820  1.00 83.16  ?  243 GLN A NE2   1 
ATOM   1882 N  N     . MET A 1 244 ? -37.477 -42.286 65.759  1.00 43.74  ?  244 MET A N     1 
ATOM   1883 C  CA    . MET A 1 244 ? -36.484 -42.724 64.753  1.00 48.41  ?  244 MET A CA    1 
ATOM   1884 C  C     . MET A 1 244 ? -37.102 -43.818 63.866  1.00 46.63  ?  244 MET A C     1 
ATOM   1885 O  O     . MET A 1 244 ? -37.063 -43.667 62.639  1.00 41.02  ?  244 MET A O     1 
ATOM   1886 C  CB    . MET A 1 244 ? -35.210 -43.255 65.407  1.00 53.51  ?  244 MET A CB    1 
ATOM   1887 C  CG    . MET A 1 244 ? -34.126 -43.637 64.394  1.00 66.14  ?  244 MET A CG    1 
ATOM   1888 S  SD    . MET A 1 244 ? -33.183 -45.092 64.912  1.00 73.31  ?  244 MET A SD    1 
ATOM   1889 C  CE    . MET A 1 244 ? -34.463 -46.342 64.742  1.00 70.25  ?  244 MET A CE    1 
ATOM   1890 N  N     . VAL A 1 245 ? -37.670 -44.866 64.463  1.00 43.96  ?  245 VAL A N     1 
ATOM   1891 C  CA    . VAL A 1 245 ? -38.380 -45.955 63.722  1.00 39.63  ?  245 VAL A CA    1 
ATOM   1892 C  C     . VAL A 1 245 ? -39.456 -45.329 62.829  1.00 44.25  ?  245 VAL A C     1 
ATOM   1893 O  O     . VAL A 1 245 ? -39.511 -45.676 61.630  1.00 45.60  ?  245 VAL A O     1 
ATOM   1894 C  CB    . VAL A 1 245 ? -38.968 -47.011 64.674  1.00 34.78  ?  245 VAL A CB    1 
ATOM   1895 C  CG1   . VAL A 1 245 ? -39.930 -47.957 63.960  1.00 33.33  ?  245 VAL A CG1   1 
ATOM   1896 C  CG2   . VAL A 1 245 ? -37.860 -47.821 65.342  1.00 36.64  ?  245 VAL A CG2   1 
ATOM   1897 N  N     . LYS A 1 246 ? -40.261 -44.414 63.368  1.00 41.85  ?  246 LYS A N     1 
ATOM   1898 C  CA    . LYS A 1 246 ? -41.380 -43.815 62.601  1.00 46.29  ?  246 LYS A CA    1 
ATOM   1899 C  C     . LYS A 1 246 ? -40.833 -43.065 61.381  1.00 45.46  ?  246 LYS A C     1 
ATOM   1900 O  O     . LYS A 1 246 ? -41.460 -43.196 60.300  1.00 41.68  ?  246 LYS A O     1 
ATOM   1901 C  CB    . LYS A 1 246 ? -42.244 -42.878 63.443  1.00 53.91  ?  246 LYS A CB    1 
ATOM   1902 C  CG    . LYS A 1 246 ? -43.471 -42.379 62.690  1.00 62.79  ?  246 LYS A CG    1 
ATOM   1903 C  CD    . LYS A 1 246 ? -44.415 -41.537 63.516  1.00 83.94  ?  246 LYS A CD    1 
ATOM   1904 C  CE    . LYS A 1 246 ? -45.481 -40.892 62.653  1.00 83.03  ?  246 LYS A CE    1 
ATOM   1905 N  NZ    . LYS A 1 246 ? -46.470 -40.159 63.475  1.00 86.35  ?  246 LYS A NZ    1 
ATOM   1906 N  N     . LYS A 1 247 ? -39.733 -42.314 61.543  1.00 44.49  ?  247 LYS A N     1 
ATOM   1907 C  CA    . LYS A 1 247 ? -39.095 -41.525 60.442  1.00 48.57  ?  247 LYS A CA    1 
ATOM   1908 C  C     . LYS A 1 247 ? -38.554 -42.467 59.350  1.00 41.77  ?  247 LYS A C     1 
ATOM   1909 O  O     . LYS A 1 247 ? -38.730 -42.137 58.173  1.00 36.80  ?  247 LYS A O     1 
ATOM   1910 C  CB    . LYS A 1 247 ? -38.052 -40.547 60.991  1.00 49.58  ?  247 LYS A CB    1 
ATOM   1911 C  CG    . LYS A 1 247 ? -38.683 -39.193 61.287  1.00 60.69  ?  247 LYS A CG    1 
ATOM   1912 C  CD    . LYS A 1 247 ? -37.752 -38.112 61.755  1.00 71.91  ?  247 LYS A CD    1 
ATOM   1913 C  CE    . LYS A 1 247 ? -38.497 -36.812 62.000  1.00 77.83  ?  247 LYS A CE    1 
ATOM   1914 N  NZ    . LYS A 1 247 ? -37.993 -36.124 63.222  1.00 76.80  ?  247 LYS A NZ    1 
ATOM   1915 N  N     . ASN A 1 248 ? -37.977 -43.609 59.742  1.00 35.99  ?  248 ASN A N     1 
ATOM   1916 C  CA    . ASN A 1 248 ? -37.553 -44.684 58.815  1.00 38.68  ?  248 ASN A CA    1 
ATOM   1917 C  C     . ASN A 1 248 ? -38.762 -45.182 57.996  1.00 39.08  ?  248 ASN A C     1 
ATOM   1918 O  O     . ASN A 1 248 ? -38.660 -45.233 56.757  1.00 40.68  ?  248 ASN A O     1 
ATOM   1919 C  CB    . ASN A 1 248 ? -36.851 -45.811 59.559  1.00 36.31  ?  248 ASN A CB    1 
ATOM   1920 C  CG    . ASN A 1 248 ? -35.484 -45.426 60.075  1.00 38.78  ?  248 ASN A CG    1 
ATOM   1921 O  OD1   . ASN A 1 248 ? -34.881 -44.459 59.601  1.00 45.52  ?  248 ASN A OD1   1 
ATOM   1922 N  ND2   . ASN A 1 248 ? -34.986 -46.188 61.042  1.00 40.81  ?  248 ASN A ND2   1 
ATOM   1923 N  N     . PHE A 1 249 ? -39.887 -45.474 58.642  1.00 36.23  ?  249 PHE A N     1 
ATOM   1924 C  CA    . PHE A 1 249 ? -41.137 -45.915 57.960  1.00 36.94  ?  249 PHE A CA    1 
ATOM   1925 C  C     . PHE A 1 249 ? -41.656 -44.811 57.037  1.00 33.63  ?  249 PHE A C     1 
ATOM   1926 O  O     . PHE A 1 249 ? -42.110 -45.138 55.943  1.00 41.01  ?  249 PHE A O     1 
ATOM   1927 C  CB    . PHE A 1 249 ? -42.207 -46.337 58.975  1.00 37.49  ?  249 PHE A CB    1 
ATOM   1928 C  CG    . PHE A 1 249 ? -42.016 -47.727 59.504  1.00 37.08  ?  249 PHE A CG    1 
ATOM   1929 C  CD1   . PHE A 1 249 ? -40.875 -48.079 60.216  1.00 41.45  ?  249 PHE A CD1   1 
ATOM   1930 C  CD2   . PHE A 1 249 ? -42.952 -48.703 59.242  1.00 43.03  ?  249 PHE A CD2   1 
ATOM   1931 C  CE1   . PHE A 1 249 ? -40.674 -49.381 60.653  1.00 38.95  ?  249 PHE A CE1   1 
ATOM   1932 C  CE2   . PHE A 1 249 ? -42.768 -49.992 59.720  1.00 43.30  ?  249 PHE A CE2   1 
ATOM   1933 C  CZ    . PHE A 1 249 ? -41.630 -50.327 60.421  1.00 41.06  ?  249 PHE A CZ    1 
ATOM   1934 N  N     . GLU A 1 250 ? -41.563 -43.547 57.448  1.00 37.64  ?  250 GLU A N     1 
ATOM   1935 C  CA    . GLU A 1 250 ? -42.008 -42.372 56.642  1.00 40.39  ?  250 GLU A CA    1 
ATOM   1936 C  C     . GLU A 1 250 ? -41.104 -42.234 55.416  1.00 39.43  ?  250 GLU A C     1 
ATOM   1937 O  O     . GLU A 1 250 ? -41.592 -41.913 54.332  1.00 42.77  ?  250 GLU A O     1 
ATOM   1938 C  CB    . GLU A 1 250 ? -41.979 -41.069 57.450  1.00 40.75  ?  250 GLU A CB    1 
ATOM   1939 C  CG    . GLU A 1 250 ? -43.278 -40.787 58.156  1.00 51.02  ?  250 GLU A CG    1 
ATOM   1940 C  CD    . GLU A 1 250 ? -43.222 -39.811 59.329  1.00 68.79  ?  250 GLU A CD    1 
ATOM   1941 O  OE1   . GLU A 1 250 ? -42.117 -39.268 59.657  1.00 72.28  ?  250 GLU A OE1   1 
ATOM   1942 O  OE2   . GLU A 1 250 ? -44.299 -39.581 59.915  1.00 79.71  ?  250 GLU A OE2   1 
ATOM   1943 N  N     . TRP A 1 251 ? -39.814 -42.438 55.613  1.00 39.31  ?  251 TRP A N     1 
ATOM   1944 C  CA    . TRP A 1 251 ? -38.808 -42.379 54.533  1.00 40.43  ?  251 TRP A CA    1 
ATOM   1945 C  C     . TRP A 1 251 ? -39.206 -43.356 53.419  1.00 37.12  ?  251 TRP A C     1 
ATOM   1946 O  O     . TRP A 1 251 ? -39.167 -42.978 52.233  1.00 33.92  ?  251 TRP A O     1 
ATOM   1947 C  CB    . TRP A 1 251 ? -37.427 -42.663 55.116  1.00 41.41  ?  251 TRP A CB    1 
ATOM   1948 C  CG    . TRP A 1 251 ? -36.309 -42.337 54.175  1.00 50.07  ?  251 TRP A CG    1 
ATOM   1949 C  CD1   . TRP A 1 251 ? -35.602 -41.165 54.110  1.00 45.97  ?  251 TRP A CD1   1 
ATOM   1950 C  CD2   . TRP A 1 251 ? -35.774 -43.210 53.157  1.00 44.07  ?  251 TRP A CD2   1 
ATOM   1951 N  NE1   . TRP A 1 251 ? -34.656 -41.259 53.128  1.00 53.17  ?  251 TRP A NE1   1 
ATOM   1952 C  CE2   . TRP A 1 251 ? -34.733 -42.497 52.526  1.00 48.81  ?  251 TRP A CE2   1 
ATOM   1953 C  CE3   . TRP A 1 251 ? -36.081 -44.496 52.708  1.00 39.29  ?  251 TRP A CE3   1 
ATOM   1954 C  CZ2   . TRP A 1 251 ? -33.987 -43.044 51.480  1.00 40.67  ?  251 TRP A CZ2   1 
ATOM   1955 C  CZ3   . TRP A 1 251 ? -35.330 -45.036 51.687  1.00 43.61  ?  251 TRP A CZ3   1 
ATOM   1956 C  CH2   . TRP A 1 251 ? -34.301 -44.316 51.084  1.00 37.23  ?  251 TRP A CH2   1 
ATOM   1957 N  N     . VAL A 1 252 ? -39.611 -44.564 53.789  1.00 34.04  ?  252 VAL A N     1 
ATOM   1958 C  CA    . VAL A 1 252 ? -39.974 -45.598 52.791  1.00 33.50  ?  252 VAL A CA    1 
ATOM   1959 C  C     . VAL A 1 252 ? -41.325 -45.231 52.161  1.00 33.20  ?  252 VAL A C     1 
ATOM   1960 O  O     . VAL A 1 252 ? -41.467 -45.372 50.941  1.00 36.46  ?  252 VAL A O     1 
ATOM   1961 C  CB    . VAL A 1 252 ? -39.979 -46.992 53.423  1.00 30.70  ?  252 VAL A CB    1 
ATOM   1962 C  CG1   . VAL A 1 252 ? -40.344 -48.033 52.396  1.00 34.05  ?  252 VAL A CG1   1 
ATOM   1963 C  CG2   . VAL A 1 252 ? -38.657 -47.352 54.039  1.00 32.57  ?  252 VAL A CG2   1 
ATOM   1964 N  N     . ALA A 1 253 ? -42.298 -44.818 52.966  1.00 33.04  ?  253 ALA A N     1 
ATOM   1965 C  CA    . ALA A 1 253 ? -43.646 -44.411 52.514  1.00 33.33  ?  253 ALA A CA    1 
ATOM   1966 C  C     . ALA A 1 253 ? -43.547 -43.285 51.470  1.00 36.60  ?  253 ALA A C     1 
ATOM   1967 O  O     . ALA A 1 253 ? -44.366 -43.249 50.544  1.00 38.73  ?  253 ALA A O     1 
ATOM   1968 C  CB    . ALA A 1 253 ? -44.454 -43.965 53.699  1.00 36.11  ?  253 ALA A CB    1 
ATOM   1969 N  N     . GLU A 1 254 ? -42.591 -42.371 51.616  1.00 39.29  ?  254 GLU A N     1 
ATOM   1970 C  CA    . GLU A 1 254 ? -42.445 -41.187 50.722  1.00 43.94  ?  254 GLU A CA    1 
ATOM   1971 C  C     . GLU A 1 254 ? -41.795 -41.562 49.390  1.00 43.24  ?  254 GLU A C     1 
ATOM   1972 O  O     . GLU A 1 254 ? -41.977 -40.819 48.422  1.00 38.03  ?  254 GLU A O     1 
ATOM   1973 C  CB    . GLU A 1 254 ? -41.670 -40.076 51.428  1.00 54.42  ?  254 GLU A CB    1 
ATOM   1974 C  CG    . GLU A 1 254 ? -42.583 -39.222 52.302  1.00 66.94  ?  254 GLU A CG    1 
ATOM   1975 C  CD    . GLU A 1 254 ? -41.885 -38.137 53.123  1.00 82.49  ?  254 GLU A CD    1 
ATOM   1976 O  OE1   . GLU A 1 254 ? -41.021 -37.382 52.549  1.00 74.44  ?  254 GLU A OE1   1 
ATOM   1977 O  OE2   . GLU A 1 254 ? -42.209 -38.029 54.334  1.00 65.64  ?  254 GLU A OE2   1 
ATOM   1978 N  N     . ARG A 1 255 ? -41.068 -42.677 49.336  1.00 42.25  ?  255 ARG A N     1 
ATOM   1979 C  CA    . ARG A 1 255 ? -40.368 -43.117 48.111  1.00 40.91  ?  255 ARG A CA    1 
ATOM   1980 C  C     . ARG A 1 255 ? -41.089 -44.262 47.377  1.00 38.74  ?  255 ARG A C     1 
ATOM   1981 O  O     . ARG A 1 255 ? -40.759 -44.465 46.220  1.00 38.07  ?  255 ARG A O     1 
ATOM   1982 C  CB    . ARG A 1 255 ? -38.952 -43.527 48.483  1.00 43.13  ?  255 ARG A CB    1 
ATOM   1983 C  CG    . ARG A 1 255 ? -37.988 -42.358 48.455  1.00 46.13  ?  255 ARG A CG    1 
ATOM   1984 C  CD    . ARG A 1 255 ? -36.905 -42.484 49.509  1.00 47.14  ?  255 ARG A CD    1 
ATOM   1985 N  NE    . ARG A 1 255 ? -36.199 -41.217 49.637  1.00 55.39  ?  255 ARG A NE    1 
ATOM   1986 C  CZ    . ARG A 1 255 ? -36.435 -40.271 50.557  1.00 53.65  ?  255 ARG A CZ    1 
ATOM   1987 N  NH1   . ARG A 1 255 ? -37.337 -40.413 51.515  1.00 53.77  ?  255 ARG A NH1   1 
ATOM   1988 N  NH2   . ARG A 1 255 ? -35.728 -39.170 50.515  1.00 57.99  ?  255 ARG A NH2   1 
ATOM   1989 N  N     . VAL A 1 256 ? -41.993 -45.015 48.009  1.00 38.59  ?  256 VAL A N     1 
ATOM   1990 C  CA    . VAL A 1 256 ? -42.429 -46.322 47.445  1.00 32.93  ?  256 VAL A CA    1 
ATOM   1991 C  C     . VAL A 1 256 ? -43.246 -46.086 46.173  1.00 37.79  ?  256 VAL A C     1 
ATOM   1992 O  O     . VAL A 1 256 ? -43.221 -46.974 45.322  1.00 40.38  ?  256 VAL A O     1 
ATOM   1993 C  CB    . VAL A 1 256 ? -43.192 -47.182 48.464  1.00 37.75  ?  256 VAL A CB    1 
ATOM   1994 C  CG1   . VAL A 1 256 ? -44.587 -46.656 48.775  1.00 38.21  ?  256 VAL A CG1   1 
ATOM   1995 C  CG2   . VAL A 1 256 ? -43.251 -48.634 48.013  1.00 40.66  ?  256 VAL A CG2   1 
ATOM   1996 N  N     . GLU A 1 257 ? -43.971 -44.971 46.048  1.00 40.71  ?  257 GLU A N     1 
ATOM   1997 C  CA    . GLU A 1 257 ? -44.825 -44.680 44.856  1.00 44.39  ?  257 GLU A CA    1 
ATOM   1998 C  C     . GLU A 1 257 ? -43.970 -44.447 43.602  1.00 41.22  ?  257 GLU A C     1 
ATOM   1999 O  O     . GLU A 1 257 ? -44.487 -44.671 42.495  1.00 43.84  ?  257 GLU A O     1 
ATOM   2000 C  CB    . GLU A 1 257 ? -45.696 -43.438 45.038  1.00 52.97  ?  257 GLU A CB    1 
ATOM   2001 C  CG    . GLU A 1 257 ? -47.160 -43.780 45.232  1.00 70.11  ?  257 GLU A CG    1 
ATOM   2002 C  CD    . GLU A 1 257 ? -48.089 -42.578 45.199  1.00 78.75  ?  257 GLU A CD    1 
ATOM   2003 O  OE1   . GLU A 1 257 ? -48.158 -41.840 46.235  1.00 66.64  ?  257 GLU A OE1   1 
ATOM   2004 O  OE2   . GLU A 1 257 ? -48.715 -42.382 44.128  1.00 80.02  ?  257 GLU A OE2   1 
ATOM   2005 N  N     . LEU A 1 258 ? -42.721 -44.012 43.762  1.00 37.27  ?  258 LEU A N     1 
ATOM   2006 C  CA    . LEU A 1 258 ? -41.773 -43.812 42.639  1.00 37.92  ?  258 LEU A CA    1 
ATOM   2007 C  C     . LEU A 1 258 ? -41.436 -45.153 41.971  1.00 33.67  ?  258 LEU A C     1 
ATOM   2008 O  O     . LEU A 1 258 ? -40.994 -45.114 40.843  1.00 41.00  ?  258 LEU A O     1 
ATOM   2009 C  CB    . LEU A 1 258 ? -40.497 -43.102 43.121  1.00 37.13  ?  258 LEU A CB    1 
ATOM   2010 C  CG    . LEU A 1 258 ? -40.673 -41.818 43.945  1.00 38.57  ?  258 LEU A CG    1 
ATOM   2011 C  CD1   . LEU A 1 258 ? -39.316 -41.316 44.425  1.00 38.73  ?  258 LEU A CD1   1 
ATOM   2012 C  CD2   . LEU A 1 258 ? -41.401 -40.710 43.170  1.00 37.69  ?  258 LEU A CD2   1 
ATOM   2013 N  N     . LEU A 1 259 ? -41.665 -46.291 42.617  1.00 33.76  ?  259 LEU A N     1 
ATOM   2014 C  CA    . LEU A 1 259 ? -41.420 -47.638 42.006  1.00 35.08  ?  259 LEU A CA    1 
ATOM   2015 C  C     . LEU A 1 259 ? -42.418 -47.896 40.885  1.00 34.89  ?  259 LEU A C     1 
ATOM   2016 O  O     . LEU A 1 259 ? -42.131 -48.765 40.043  1.00 32.92  ?  259 LEU A O     1 
ATOM   2017 C  CB    . LEU A 1 259 ? -41.503 -48.760 43.045  1.00 38.52  ?  259 LEU A CB    1 
ATOM   2018 C  CG    . LEU A 1 259 ? -40.201 -49.108 43.769  1.00 37.89  ?  259 LEU A CG    1 
ATOM   2019 C  CD1   . LEU A 1 259 ? -39.580 -47.875 44.431  1.00 41.30  ?  259 LEU A CD1   1 
ATOM   2020 C  CD2   . LEU A 1 259 ? -40.419 -50.210 44.794  1.00 36.53  ?  259 LEU A CD2   1 
ATOM   2021 N  N     . LEU A 1 260 ? -43.504 -47.135 40.814  1.00 36.55  ?  260 LEU A N     1 
ATOM   2022 C  CA    . LEU A 1 260 ? -44.539 -47.315 39.767  1.00 39.56  ?  260 LEU A CA    1 
ATOM   2023 C  C     . LEU A 1 260 ? -44.219 -46.489 38.513  1.00 37.72  ?  260 LEU A C     1 
ATOM   2024 O  O     . LEU A 1 260 ? -44.907 -46.694 37.474  1.00 33.19  ?  260 LEU A O     1 
ATOM   2025 C  CB    . LEU A 1 260 ? -45.907 -46.954 40.356  1.00 40.70  ?  260 LEU A CB    1 
ATOM   2026 C  CG    . LEU A 1 260 ? -46.469 -47.935 41.393  1.00 44.54  ?  260 LEU A CG    1 
ATOM   2027 C  CD1   . LEU A 1 260 ? -47.789 -47.416 41.960  1.00 49.93  ?  260 LEU A CD1   1 
ATOM   2028 C  CD2   . LEU A 1 260 ? -46.718 -49.318 40.824  1.00 44.04  ?  260 LEU A CD2   1 
ATOM   2029 N  N     . LYS A 1 261 ? -43.236 -45.592 38.636  1.00 42.91  ?  261 LYS A N     1 
ATOM   2030 C  CA    . LYS A 1 261 ? -42.877 -44.644 37.552  1.00 49.47  ?  261 LYS A CA    1 
ATOM   2031 C  C     . LYS A 1 261 ? -41.684 -45.127 36.720  1.00 45.66  ?  261 LYS A C     1 
ATOM   2032 O  O     . LYS A 1 261 ? -40.670 -45.571 37.293  1.00 37.10  ?  261 LYS A O     1 
ATOM   2033 C  CB    . LYS A 1 261 ? -42.595 -43.256 38.137  1.00 70.77  ?  261 LYS A CB    1 
ATOM   2034 C  CG    . LYS A 1 261 ? -43.734 -42.252 38.008  1.00 84.60  ?  261 LYS A CG    1 
ATOM   2035 C  CD    . LYS A 1 261 ? -44.915 -42.783 37.224  1.00 86.89  ?  261 LYS A CD    1 
ATOM   2036 C  CE    . LYS A 1 261 ? -46.163 -41.941 37.387  1.00 96.76  ?  261 LYS A CE    1 
ATOM   2037 N  NZ    . LYS A 1 261 ? -47.337 -42.766 37.756  1.00 101.98 ?  261 LYS A NZ    1 
ATOM   2038 N  N     . SER A 1 262 ? -41.857 -45.019 35.402  1.00 52.19  ?  262 SER A N     1 
ATOM   2039 C  CA    . SER A 1 262 ? -40.878 -45.295 34.328  1.00 62.21  ?  262 SER A CA    1 
ATOM   2040 C  C     . SER A 1 262 ? -39.744 -44.269 34.396  1.00 52.65  ?  262 SER A C     1 
ATOM   2041 O  O     . SER A 1 262 ? -40.007 -43.065 34.232  1.00 46.81  ?  262 SER A O     1 
ATOM   2042 C  CB    . SER A 1 262 ? -41.602 -45.290 32.957  1.00 66.68  ?  262 SER A CB    1 
ATOM   2043 O  OG    . SER A 1 262 ? -41.312 -46.467 32.188  1.00 65.63  ?  262 SER A OG    1 
ATOM   2044 N  N     . GLU A 1 263 ? -38.522 -44.738 34.535  1.00 52.15  ?  263 GLU A N     1 
ATOM   2045 C  CA    . GLU A 1 263 ? -37.351 -43.820 34.662  1.00 64.24  ?  263 GLU A CA    1 
ATOM   2046 C  C     . GLU A 1 263 ? -36.894 -43.352 33.255  1.00 65.01  ?  263 GLU A C     1 
ATOM   2047 O  O     . GLU A 1 263 ? -36.320 -42.280 33.149  1.00 60.43  ?  263 GLU A O     1 
ATOM   2048 C  CB    . GLU A 1 263 ? -36.260 -44.514 35.512  1.00 66.18  ?  263 GLU A CB    1 
ATOM   2049 C  CG    . GLU A 1 263 ? -35.606 -45.755 34.894  1.00 62.12  ?  263 GLU A CG    1 
ATOM   2050 C  CD    . GLU A 1 263 ? -36.049 -47.143 35.384  1.00 60.58  ?  263 GLU A CD    1 
ATOM   2051 O  OE1   . GLU A 1 263 ? -37.251 -47.413 35.483  1.00 60.02  ?  263 GLU A OE1   1 
ATOM   2052 O  OE2   . GLU A 1 263 ? -35.180 -47.977 35.615  1.00 50.52  ?  263 GLU A OE2   1 
ATOM   2053 N  N     . SER A 1 264 ? -37.182 -44.146 32.228  1.00 50.37  ?  264 SER A N     1 
ATOM   2054 C  CA    . SER A 1 264 ? -36.678 -43.995 30.842  1.00 52.73  ?  264 SER A CA    1 
ATOM   2055 C  C     . SER A 1 264 ? -37.781 -44.313 29.831  1.00 46.71  ?  264 SER A C     1 
ATOM   2056 O  O     . SER A 1 264 ? -38.558 -45.248 30.079  1.00 45.67  ?  264 SER A O     1 
ATOM   2057 C  CB    . SER A 1 264 ? -35.477 -44.892 30.589  1.00 55.46  ?  264 SER A CB    1 
ATOM   2058 O  OG    . SER A 1 264 ? -35.886 -46.250 30.436  1.00 49.86  ?  264 SER A OG    1 
ATOM   2059 N  N     . GLN A 1 265 ? -37.815 -43.572 28.722  1.00 38.16  ?  265 GLN A N     1 
ATOM   2060 C  CA    . GLN A 1 265 ? -38.813 -43.750 27.639  1.00 44.31  ?  265 GLN A CA    1 
ATOM   2061 C  C     . GLN A 1 265 ? -38.325 -44.809 26.628  1.00 38.40  ?  265 GLN A C     1 
ATOM   2062 O  O     . GLN A 1 265 ? -37.126 -44.984 26.427  1.00 38.99  ?  265 GLN A O     1 
ATOM   2063 C  CB    . GLN A 1 265 ? -39.087 -42.419 26.932  1.00 49.02  ?  265 GLN A CB    1 
ATOM   2064 C  CG    . GLN A 1 265 ? -39.585 -41.301 27.832  1.00 54.58  ?  265 GLN A CG    1 
ATOM   2065 C  CD    . GLN A 1 265 ? -40.200 -40.191 27.011  1.00 64.78  ?  265 GLN A CD    1 
ATOM   2066 O  OE1   . GLN A 1 265 ? -39.673 -39.073 26.938  1.00 57.33  ?  265 GLN A OE1   1 
ATOM   2067 N  NE2   . GLN A 1 265 ? -41.309 -40.524 26.351  1.00 62.28  ?  265 GLN A NE2   1 
ATOM   2068 N  N     . CYS A 1 266 ? -39.269 -45.522 26.035  1.00 39.30  ?  266 CYS A N     1 
ATOM   2069 C  CA    . CYS A 1 266 ? -39.056 -46.679 25.141  1.00 37.89  ?  266 CYS A CA    1 
ATOM   2070 C  C     . CYS A 1 266 ? -39.979 -46.493 23.947  1.00 37.54  ?  266 CYS A C     1 
ATOM   2071 O  O     . CYS A 1 266 ? -41.105 -46.074 24.166  1.00 35.28  ?  266 CYS A O     1 
ATOM   2072 C  CB    . CYS A 1 266 ? -39.463 -47.979 25.801  1.00 40.12  ?  266 CYS A CB    1 
ATOM   2073 S  SG    . CYS A 1 266 ? -38.615 -48.231 27.367  1.00 60.19  ?  266 CYS A SG    1 
ATOM   2074 N  N     . ARG A 1 267 ? -39.521 -46.886 22.761  1.00 33.69  ?  267 ARG A N     1 
ATOM   2075 C  CA    . ARG A 1 267 ? -40.336 -46.859 21.534  1.00 33.44  ?  267 ARG A CA    1 
ATOM   2076 C  C     . ARG A 1 267 ? -39.789 -47.899 20.559  1.00 35.08  ?  267 ARG A C     1 
ATOM   2077 O  O     . ARG A 1 267 ? -38.552 -47.976 20.392  1.00 37.53  ?  267 ARG A O     1 
ATOM   2078 C  CB    . ARG A 1 267 ? -40.252 -45.448 20.962  1.00 33.94  ?  267 ARG A CB    1 
ATOM   2079 C  CG    . ARG A 1 267 ? -40.956 -45.258 19.632  1.00 35.10  ?  267 ARG A CG    1 
ATOM   2080 C  CD    . ARG A 1 267 ? -41.022 -43.776 19.355  1.00 30.31  ?  267 ARG A CD    1 
ATOM   2081 N  NE    . ARG A 1 267 ? -39.697 -43.289 19.060  1.00 29.09  ?  267 ARG A NE    1 
ATOM   2082 C  CZ    . ARG A 1 267 ? -39.408 -42.015 18.838  1.00 28.87  ?  267 ARG A CZ    1 
ATOM   2083 N  NH1   . ARG A 1 267 ? -40.340 -41.079 18.896  1.00 28.25  ?  267 ARG A NH1   1 
ATOM   2084 N  NH2   . ARG A 1 267 ? -38.178 -41.675 18.552  1.00 30.69  ?  267 ARG A NH2   1 
ATOM   2085 N  N     . VAL A 1 268 ? -40.687 -48.676 19.943  1.00 32.22  ?  268 VAL A N     1 
ATOM   2086 C  CA    . VAL A 1 268 ? -40.382 -49.531 18.773  1.00 29.98  ?  268 VAL A CA    1 
ATOM   2087 C  C     . VAL A 1 268 ? -40.998 -48.851 17.546  1.00 34.67  ?  268 VAL A C     1 
ATOM   2088 O  O     . VAL A 1 268 ? -42.151 -48.376 17.661  1.00 31.38  ?  268 VAL A O     1 
ATOM   2089 C  CB    . VAL A 1 268 ? -40.916 -50.949 18.970  1.00 33.12  ?  268 VAL A CB    1 
ATOM   2090 C  CG1   . VAL A 1 268 ? -40.670 -51.784 17.728  1.00 31.72  ?  268 VAL A CG1   1 
ATOM   2091 C  CG2   . VAL A 1 268 ? -40.340 -51.615 20.208  1.00 33.03  ?  268 VAL A CG2   1 
ATOM   2092 N  N     . VAL A 1 269 ? -40.215 -48.727 16.468  1.00 30.00  ?  269 VAL A N     1 
ATOM   2093 C  CA    . VAL A 1 269 ? -40.685 -48.256 15.145  1.00 32.90  ?  269 VAL A CA    1 
ATOM   2094 C  C     . VAL A 1 269 ? -40.555 -49.430 14.189  1.00 31.35  ?  269 VAL A C     1 
ATOM   2095 O  O     . VAL A 1 269 ? -39.423 -49.887 13.959  1.00 33.70  ?  269 VAL A O     1 
ATOM   2096 C  CB    . VAL A 1 269 ? -39.885 -47.050 14.640  1.00 35.65  ?  269 VAL A CB    1 
ATOM   2097 C  CG1   . VAL A 1 269 ? -40.297 -46.672 13.232  1.00 36.56  ?  269 VAL A CG1   1 
ATOM   2098 C  CG2   . VAL A 1 269 ? -40.031 -45.863 15.561  1.00 36.63  ?  269 VAL A CG2   1 
ATOM   2099 N  N     . VAL A 1 270 ? -41.675 -49.912 13.677  1.00 29.50  ?  270 VAL A N     1 
ATOM   2100 C  CA    . VAL A 1 270 ? -41.702 -51.029 12.698  1.00 28.24  ?  270 VAL A CA    1 
ATOM   2101 C  C     . VAL A 1 270 ? -41.797 -50.417 11.314  1.00 26.63  ?  270 VAL A C     1 
ATOM   2102 O  O     . VAL A 1 270 ? -42.786 -49.779 11.039  1.00 32.64  ?  270 VAL A O     1 
ATOM   2103 C  CB    . VAL A 1 270 ? -42.876 -51.970 12.991  1.00 31.60  ?  270 VAL A CB    1 
ATOM   2104 C  CG1   . VAL A 1 270 ? -42.965 -53.092 11.978  1.00 36.86  ?  270 VAL A CG1   1 
ATOM   2105 C  CG2   . VAL A 1 270 ? -42.760 -52.527 14.404  1.00 30.88  ?  270 VAL A CG2   1 
ATOM   2106 N  N     . LEU A 1 271 ? -40.781 -50.594 10.505  1.00 25.51  ?  271 LEU A N     1 
ATOM   2107 C  CA    . LEU A 1 271 ? -40.721 -50.123 9.127   1.00 28.19  ?  271 LEU A CA    1 
ATOM   2108 C  C     . LEU A 1 271 ? -41.044 -51.309 8.225   1.00 31.38  ?  271 LEU A C     1 
ATOM   2109 O  O     . LEU A 1 271 ? -40.296 -52.316 8.313   1.00 32.78  ?  271 LEU A O     1 
ATOM   2110 C  CB    . LEU A 1 271 ? -39.311 -49.597 8.842   1.00 31.67  ?  271 LEU A CB    1 
ATOM   2111 C  CG    . LEU A 1 271 ? -38.818 -48.477 9.749   1.00 33.92  ?  271 LEU A CG    1 
ATOM   2112 C  CD1   . LEU A 1 271 ? -37.362 -48.168 9.447   1.00 39.45  ?  271 LEU A CD1   1 
ATOM   2113 C  CD2   . LEU A 1 271 ? -39.659 -47.216 9.577   1.00 37.97  ?  271 LEU A CD2   1 
ATOM   2114 N  N     . MET A 1 272 ? -42.073 -51.174 7.378   1.00 30.66  ?  272 MET A N     1 
ATOM   2115 C  CA    . MET A 1 272 ? -42.486 -52.232 6.416   1.00 35.93  ?  272 MET A CA    1 
ATOM   2116 C  C     . MET A 1 272 ? -42.310 -51.708 4.988   1.00 33.51  ?  272 MET A C     1 
ATOM   2117 O  O     . MET A 1 272 ? -42.716 -50.526 4.692   1.00 28.29  ?  272 MET A O     1 
ATOM   2118 C  CB    . MET A 1 272 ? -43.928 -52.707 6.651   1.00 37.31  ?  272 MET A CB    1 
ATOM   2119 C  CG    . MET A 1 272 ? -44.992 -51.774 6.136   1.00 42.60  ?  272 MET A CG    1 
ATOM   2120 S  SD    . MET A 1 272 ? -46.658 -52.214 6.770   1.00 48.86  ?  272 MET A SD    1 
ATOM   2121 C  CE    . MET A 1 272 ? -46.528 -51.539 8.420   1.00 47.26  ?  272 MET A CE    1 
ATOM   2122 N  N     . GLY A 1 273 ? -41.722 -52.545 4.133   1.00 35.28  ?  273 GLY A N     1 
ATOM   2123 C  CA    . GLY A 1 273 ? -41.536 -52.256 2.685   1.00 44.99  ?  273 GLY A CA    1 
ATOM   2124 C  C     . GLY A 1 273 ? -42.849 -52.223 1.878   1.00 41.61  ?  273 GLY A C     1 
ATOM   2125 O  O     . GLY A 1 273 ? -42.890 -51.554 0.842   1.00 43.13  ?  273 GLY A O     1 
ATOM   2126 N  N     . SER A 1 274 ? -43.908 -52.859 2.378   1.00 41.26  ?  274 SER A N     1 
ATOM   2127 C  CA    . SER A 1 274 ? -45.182 -53.080 1.646   1.00 42.67  ?  274 SER A CA    1 
ATOM   2128 C  C     . SER A 1 274 ? -46.343 -53.186 2.649   1.00 40.07  ?  274 SER A C     1 
ATOM   2129 O  O     . SER A 1 274 ? -46.168 -53.843 3.717   1.00 42.36  ?  274 SER A O     1 
ATOM   2130 C  CB    . SER A 1 274 ? -45.009 -54.341 0.790   1.00 40.31  ?  274 SER A CB    1 
ATOM   2131 O  OG    . SER A 1 274 ? -46.173 -54.730 0.106   1.00 39.21  ?  274 SER A OG    1 
ATOM   2132 N  N     . THR A 1 275 ? -47.499 -52.640 2.286   1.00 39.89  ?  275 THR A N     1 
ATOM   2133 C  CA    . THR A 1 275 ? -48.746 -52.704 3.098   1.00 40.39  ?  275 THR A CA    1 
ATOM   2134 C  C     . THR A 1 275 ? -49.341 -54.115 3.095   1.00 36.47  ?  275 THR A C     1 
ATOM   2135 O  O     . THR A 1 275 ? -50.259 -54.355 3.910   1.00 38.74  ?  275 THR A O     1 
ATOM   2136 C  CB    . THR A 1 275 ? -49.791 -51.697 2.611   1.00 45.75  ?  275 THR A CB    1 
ATOM   2137 O  OG1   . THR A 1 275 ? -50.024 -51.969 1.225   1.00 43.22  ?  275 THR A OG1   1 
ATOM   2138 C  CG2   . THR A 1 275 ? -49.363 -50.259 2.836   1.00 48.70  ?  275 THR A CG2   1 
ATOM   2139 N  N     . SER A 1 276 ? -48.845 -55.012 2.247   1.00 32.89  ?  276 SER A N     1 
ATOM   2140 C  CA    . SER A 1 276 ? -49.280 -56.437 2.256   1.00 44.77  ?  276 SER A CA    1 
ATOM   2141 C  C     . SER A 1 276 ? -48.714 -57.180 3.483   1.00 42.22  ?  276 SER A C     1 
ATOM   2142 O  O     . SER A 1 276 ? -49.251 -58.240 3.830   1.00 48.84  ?  276 SER A O     1 
ATOM   2143 C  CB    . SER A 1 276 ? -48.916 -57.142 0.962   1.00 47.58  ?  276 SER A CB    1 
ATOM   2144 O  OG    . SER A 1 276 ? -47.507 -57.255 0.845   1.00 55.92  ?  276 SER A OG    1 
ATOM   2145 N  N     . ASP A 1 277 ? -47.679 -56.641 4.136   1.00 41.39  ?  277 ASP A N     1 
ATOM   2146 C  CA    . ASP A 1 277 ? -47.029 -57.247 5.325   1.00 39.96  ?  277 ASP A CA    1 
ATOM   2147 C  C     . ASP A 1 277 ? -47.602 -56.594 6.590   1.00 43.77  ?  277 ASP A C     1 
ATOM   2148 O  O     . ASP A 1 277 ? -47.067 -56.850 7.687   1.00 45.58  ?  277 ASP A O     1 
ATOM   2149 C  CB    . ASP A 1 277 ? -45.508 -57.168 5.207   1.00 50.06  ?  277 ASP A CB    1 
ATOM   2150 C  CG    . ASP A 1 277 ? -44.920 -57.971 4.040   1.00 54.75  ?  277 ASP A CG    1 
ATOM   2151 O  OD1   . ASP A 1 277 ? -45.336 -59.160 3.839   1.00 54.66  ?  277 ASP A OD1   1 
ATOM   2152 O  OD2   . ASP A 1 277 ? -44.036 -57.408 3.334   1.00 54.08  ?  277 ASP A OD2   1 
ATOM   2153 N  N     . LEU A 1 278 ? -48.702 -55.843 6.461   1.00 36.81  ?  278 LEU A N     1 
ATOM   2154 C  CA    . LEU A 1 278 ? -49.366 -55.166 7.594   1.00 37.25  ?  278 LEU A CA    1 
ATOM   2155 C  C     . LEU A 1 278 ? -49.791 -56.162 8.692   1.00 41.25  ?  278 LEU A C     1 
ATOM   2156 O  O     . LEU A 1 278 ? -49.554 -55.868 9.872   1.00 39.55  ?  278 LEU A O     1 
ATOM   2157 C  CB    . LEU A 1 278 ? -50.576 -54.400 7.065   1.00 40.78  ?  278 LEU A CB    1 
ATOM   2158 C  CG    . LEU A 1 278 ? -51.393 -53.682 8.124   1.00 40.68  ?  278 LEU A CG    1 
ATOM   2159 C  CD1   . LEU A 1 278 ? -50.530 -52.640 8.794   1.00 46.01  ?  278 LEU A CD1   1 
ATOM   2160 C  CD2   . LEU A 1 278 ? -52.634 -53.039 7.541   1.00 41.76  ?  278 LEU A CD2   1 
ATOM   2161 N  N     . GLY A 1 279 ? -50.418 -57.280 8.338   1.00 41.39  ?  279 GLY A N     1 
ATOM   2162 C  CA    . GLY A 1 279 ? -50.792 -58.329 9.304   1.00 36.51  ?  279 GLY A CA    1 
ATOM   2163 C  C     . GLY A 1 279 ? -49.608 -58.716 10.186  1.00 39.78  ?  279 GLY A C     1 
ATOM   2164 O  O     . GLY A 1 279 ? -49.760 -58.789 11.401  1.00 45.17  ?  279 GLY A O     1 
ATOM   2165 N  N     . HIS A 1 280 ? -48.446 -58.942 9.602   1.00 35.59  ?  280 HIS A N     1 
ATOM   2166 C  CA    . HIS A 1 280 ? -47.230 -59.367 10.325  1.00 36.62  ?  280 HIS A CA    1 
ATOM   2167 C  C     . HIS A 1 280 ? -46.820 -58.230 11.270  1.00 36.15  ?  280 HIS A C     1 
ATOM   2168 O  O     . HIS A 1 280 ? -46.451 -58.523 12.412  1.00 44.63  ?  280 HIS A O     1 
ATOM   2169 C  CB    . HIS A 1 280 ? -46.169 -59.792 9.303   1.00 36.56  ?  280 HIS A CB    1 
ATOM   2170 C  CG    . HIS A 1 280 ? -44.834 -60.173 9.855   1.00 35.66  ?  280 HIS A CG    1 
ATOM   2171 N  ND1   . HIS A 1 280 ? -44.475 -61.500 10.047  1.00 32.86  ?  280 HIS A ND1   1 
ATOM   2172 C  CD2   . HIS A 1 280 ? -43.745 -59.425 10.143  1.00 34.60  ?  280 HIS A CD2   1 
ATOM   2173 C  CE1   . HIS A 1 280 ? -43.225 -61.554 10.459  1.00 38.19  ?  280 HIS A CE1   1 
ATOM   2174 N  NE2   . HIS A 1 280 ? -42.752 -60.288 10.543  1.00 38.19  ?  280 HIS A NE2   1 
ATOM   2175 N  N     . CYS A 1 281 ? -46.891 -56.981 10.837  1.00 34.62  ?  281 CYS A N     1 
ATOM   2176 C  CA    . CYS A 1 281 ? -46.512 -55.795 11.660  1.00 39.30  ?  281 CYS A CA    1 
ATOM   2177 C  C     . CYS A 1 281 ? -47.529 -55.565 12.791  1.00 37.85  ?  281 CYS A C     1 
ATOM   2178 O  O     . CYS A 1 281 ? -47.129 -55.125 13.859  1.00 40.96  ?  281 CYS A O     1 
ATOM   2179 C  CB    . CYS A 1 281 ? -46.361 -54.547 10.794  1.00 38.17  ?  281 CYS A CB    1 
ATOM   2180 S  SG    . CYS A 1 281 ? -45.079 -54.750 9.523   1.00 39.64  ?  281 CYS A SG    1 
ATOM   2181 N  N     . GLU A 1 282 ? -48.803 -55.846 12.568  1.00 39.36  ?  282 GLU A N     1 
ATOM   2182 C  CA    . GLU A 1 282 ? -49.849 -55.754 13.628  1.00 43.45  ?  282 GLU A CA    1 
ATOM   2183 C  C     . GLU A 1 282 ? -49.493 -56.694 14.794  1.00 36.90  ?  282 GLU A C     1 
ATOM   2184 O  O     . GLU A 1 282 ? -49.706 -56.296 15.939  1.00 35.79  ?  282 GLU A O     1 
ATOM   2185 C  CB    . GLU A 1 282 ? -51.248 -56.062 13.074  1.00 45.14  ?  282 GLU A CB    1 
ATOM   2186 C  CG    . GLU A 1 282 ? -51.763 -55.052 12.045  1.00 53.48  ?  282 GLU A CG    1 
ATOM   2187 C  CD    . GLU A 1 282 ? -52.193 -53.688 12.576  1.00 63.38  ?  282 GLU A CD    1 
ATOM   2188 O  OE1   . GLU A 1 282 ? -51.953 -53.416 13.786  1.00 69.24  ?  282 GLU A OE1   1 
ATOM   2189 O  OE2   . GLU A 1 282 ? -52.797 -52.904 11.792  1.00 59.11  ?  282 GLU A OE2   1 
ATOM   2190 N  N     . LYS A 1 283 ? -48.988 -57.903 14.511  1.00 35.06  ?  283 LYS A N     1 
ATOM   2191 C  CA    . LYS A 1 283 ? -48.537 -58.895 15.535  1.00 39.53  ?  283 LYS A CA    1 
ATOM   2192 C  C     . LYS A 1 283 ? -47.376 -58.350 16.400  1.00 36.95  ?  283 LYS A C     1 
ATOM   2193 O  O     . LYS A 1 283 ? -47.407 -58.530 17.607  1.00 39.96  ?  283 LYS A O     1 
ATOM   2194 C  CB    . LYS A 1 283 ? -48.152 -60.217 14.871  1.00 41.76  ?  283 LYS A CB    1 
ATOM   2195 C  CG    . LYS A 1 283 ? -49.368 -61.017 14.420  1.00 47.51  ?  283 LYS A CG    1 
ATOM   2196 C  CD    . LYS A 1 283 ? -49.086 -62.273 13.614  1.00 53.55  ?  283 LYS A CD    1 
ATOM   2197 C  CE    . LYS A 1 283 ? -50.383 -62.815 13.048  1.00 62.89  ?  283 LYS A CE    1 
ATOM   2198 N  NZ    . LYS A 1 283 ? -50.134 -63.928 12.112  1.00 73.56  ?  283 LYS A NZ    1 
ATOM   2199 N  N     . ILE A 1 284 ? -46.408 -57.666 15.793  1.00 38.87  ?  284 ILE A N     1 
ATOM   2200 C  CA    . ILE A 1 284 ? -45.280 -57.015 16.502  1.00 31.62  ?  284 ILE A CA    1 
ATOM   2201 C  C     . ILE A 1 284 ? -45.863 -55.927 17.396  1.00 32.88  ?  284 ILE A C     1 
ATOM   2202 O  O     . ILE A 1 284 ? -45.474 -55.885 18.580  1.00 32.09  ?  284 ILE A O     1 
ATOM   2203 C  CB    . ILE A 1 284 ? -44.235 -56.476 15.515  1.00 32.37  ?  284 ILE A CB    1 
ATOM   2204 C  CG1   . ILE A 1 284 ? -43.681 -57.600 14.631  1.00 34.14  ?  284 ILE A CG1   1 
ATOM   2205 C  CG2   . ILE A 1 284 ? -43.109 -55.761 16.263  1.00 34.00  ?  284 ILE A CG2   1 
ATOM   2206 C  CD1   . ILE A 1 284 ? -42.776 -57.154 13.512  1.00 32.22  ?  284 ILE A CD1   1 
ATOM   2207 N  N     . LYS A 1 285 ? -46.753 -55.080 16.864  1.00 32.13  ?  285 LYS A N     1 
ATOM   2208 C  CA    . LYS A 1 285 ? -47.318 -53.929 17.610  1.00 31.54  ?  285 LYS A CA    1 
ATOM   2209 C  C     . LYS A 1 285 ? -48.125 -54.429 18.809  1.00 36.48  ?  285 LYS A C     1 
ATOM   2210 O  O     . LYS A 1 285 ? -47.988 -53.853 19.900  1.00 37.09  ?  285 LYS A O     1 
ATOM   2211 C  CB    . LYS A 1 285 ? -48.185 -53.085 16.686  1.00 34.44  ?  285 LYS A CB    1 
ATOM   2212 C  CG    . LYS A 1 285 ? -48.840 -51.901 17.371  1.00 35.82  ?  285 LYS A CG    1 
ATOM   2213 C  CD    . LYS A 1 285 ? -49.637 -51.035 16.449  1.00 40.87  ?  285 LYS A CD    1 
ATOM   2214 C  CE    . LYS A 1 285 ? -50.208 -49.827 17.152  1.00 42.20  ?  285 LYS A CE    1 
ATOM   2215 N  NZ    . LYS A 1 285 ? -51.383 -49.293 16.438  1.00 50.90  ?  285 LYS A NZ    1 
ATOM   2216 N  N     . LYS A 1 286 ? -48.937 -55.471 18.605  1.00 40.34  ?  286 LYS A N     1 
ATOM   2217 C  CA    . LYS A 1 286 ? -49.784 -56.035 19.677  1.00 45.43  ?  286 LYS A CA    1 
ATOM   2218 C  C     . LYS A 1 286 ? -48.870 -56.535 20.796  1.00 38.69  ?  286 LYS A C     1 
ATOM   2219 O  O     . LYS A 1 286 ? -49.109 -56.173 21.961  1.00 33.59  ?  286 LYS A O     1 
ATOM   2220 C  CB    . LYS A 1 286 ? -50.677 -57.158 19.139  1.00 55.78  ?  286 LYS A CB    1 
ATOM   2221 C  CG    . LYS A 1 286 ? -51.588 -57.784 20.181  1.00 58.21  ?  286 LYS A CG    1 
ATOM   2222 C  CD    . LYS A 1 286 ? -52.466 -58.881 19.655  1.00 72.74  ?  286 LYS A CD    1 
ATOM   2223 C  CE    . LYS A 1 286 ? -53.687 -59.040 20.546  1.00 83.48  ?  286 LYS A CE    1 
ATOM   2224 N  NZ    . LYS A 1 286 ? -54.403 -60.296 20.260  1.00 85.60  ?  286 LYS A NZ    1 
ATOM   2225 N  N     . ALA A 1 287 ? -47.858 -57.334 20.430  1.00 33.48  ?  287 ALA A N     1 
ATOM   2226 C  CA    . ALA A 1 287 ? -46.914 -57.977 21.363  1.00 33.04  ?  287 ALA A CA    1 
ATOM   2227 C  C     . ALA A 1 287 ? -46.109 -56.909 22.124  1.00 37.62  ?  287 ALA A C     1 
ATOM   2228 O  O     . ALA A 1 287 ? -45.750 -57.195 23.300  1.00 38.03  ?  287 ALA A O     1 
ATOM   2229 C  CB    . ALA A 1 287 ? -46.005 -58.917 20.608  1.00 34.34  ?  287 ALA A CB    1 
ATOM   2230 N  N     . CYS A 1 288 ? -45.806 -55.764 21.491  1.00 33.04  ?  288 CYS A N     1 
ATOM   2231 C  CA    . CYS A 1 288 ? -45.116 -54.622 22.142  1.00 37.25  ?  288 CYS A CA    1 
ATOM   2232 C  C     . CYS A 1 288 ? -46.027 -54.036 23.210  1.00 36.27  ?  288 CYS A C     1 
ATOM   2233 O  O     . CYS A 1 288 ? -45.498 -53.688 24.288  1.00 41.76  ?  288 CYS A O     1 
ATOM   2234 C  CB    . CYS A 1 288 ? -44.742 -53.500 21.171  1.00 40.39  ?  288 CYS A CB    1 
ATOM   2235 S  SG    . CYS A 1 288 ? -43.258 -53.828 20.189  1.00 42.03  ?  288 CYS A SG    1 
ATOM   2236 N  N     . GLY A 1 289 ? -47.321 -53.889 22.895  1.00 37.36  ?  289 GLY A N     1 
ATOM   2237 C  CA    . GLY A 1 289 ? -48.374 -53.435 23.835  1.00 37.79  ?  289 GLY A CA    1 
ATOM   2238 C  C     . GLY A 1 289 ? -48.353 -54.231 25.133  1.00 35.77  ?  289 GLY A C     1 
ATOM   2239 O  O     . GLY A 1 289 ? -48.478 -53.610 26.186  1.00 36.91  ?  289 GLY A O     1 
ATOM   2240 N  N     . ASN A 1 290 ? -48.119 -55.550 25.064  1.00 35.06  ?  290 ASN A N     1 
ATOM   2241 C  CA    . ASN A 1 290 ? -48.047 -56.446 26.257  1.00 38.93  ?  290 ASN A CA    1 
ATOM   2242 C  C     . ASN A 1 290 ? -46.890 -56.096 27.213  1.00 40.45  ?  290 ASN A C     1 
ATOM   2243 O  O     . ASN A 1 290 ? -47.022 -56.437 28.410  1.00 52.38  ?  290 ASN A O     1 
ATOM   2244 C  CB    . ASN A 1 290 ? -47.965 -57.930 25.906  1.00 37.24  ?  290 ASN A CB    1 
ATOM   2245 C  CG    . ASN A 1 290 ? -49.210 -58.433 25.191  1.00 42.66  ?  290 ASN A CG    1 
ATOM   2246 O  OD1   . ASN A 1 290 ? -50.303 -57.844 25.305  1.00 44.23  ?  290 ASN A OD1   1 
ATOM   2247 N  ND2   . ASN A 1 290 ? -49.052 -59.504 24.412  1.00 37.48  ?  290 ASN A ND2   1 
ATOM   2248 N  N     . PHE A 1 291 ? -45.812 -55.457 26.740  1.00 38.29  ?  291 PHE A N     1 
ATOM   2249 C  CA    . PHE A 1 291 ? -44.661 -54.989 27.574  1.00 33.89  ?  291 PHE A CA    1 
ATOM   2250 C  C     . PHE A 1 291 ? -44.792 -53.498 27.955  1.00 37.98  ?  291 PHE A C     1 
ATOM   2251 O  O     . PHE A 1 291 ? -43.912 -52.990 28.657  1.00 39.76  ?  291 PHE A O     1 
ATOM   2252 C  CB    . PHE A 1 291 ? -43.358 -55.297 26.856  1.00 33.92  ?  291 PHE A CB    1 
ATOM   2253 C  CG    . PHE A 1 291 ? -43.098 -56.779 26.697  1.00 34.90  ?  291 PHE A CG    1 
ATOM   2254 C  CD1   . PHE A 1 291 ? -42.721 -57.542 27.774  1.00 34.83  ?  291 PHE A CD1   1 
ATOM   2255 C  CD2   . PHE A 1 291 ? -43.201 -57.401 25.469  1.00 36.71  ?  291 PHE A CD2   1 
ATOM   2256 C  CE1   . PHE A 1 291 ? -42.515 -58.903 27.644  1.00 40.44  ?  291 PHE A CE1   1 
ATOM   2257 C  CE2   . PHE A 1 291 ? -42.939 -58.753 25.326  1.00 39.60  ?  291 PHE A CE2   1 
ATOM   2258 C  CZ    . PHE A 1 291 ? -42.644 -59.514 26.420  1.00 38.52  ?  291 PHE A CZ    1 
ATOM   2259 N  N     . GLY A 1 292 ? -45.874 -52.824 27.531  1.00 38.38  ?  292 GLY A N     1 
ATOM   2260 C  CA    . GLY A 1 292 ? -46.150 -51.394 27.761  1.00 34.07  ?  292 GLY A CA    1 
ATOM   2261 C  C     . GLY A 1 292 ? -45.241 -50.482 26.951  1.00 39.31  ?  292 GLY A C     1 
ATOM   2262 O  O     . GLY A 1 292 ? -44.971 -49.362 27.421  1.00 34.07  ?  292 GLY A O     1 
ATOM   2263 N  N     . ILE A 1 293 ? -44.764 -50.931 25.779  1.00 38.01  ?  293 ILE A N     1 
ATOM   2264 C  CA    . ILE A 1 293 ? -43.823 -50.157 24.907  1.00 32.27  ?  293 ILE A CA    1 
ATOM   2265 C  C     . ILE A 1 293 ? -44.636 -49.649 23.719  1.00 35.73  ?  293 ILE A C     1 
ATOM   2266 O  O     . ILE A 1 293 ? -45.251 -50.439 22.983  1.00 34.28  ?  293 ILE A O     1 
ATOM   2267 C  CB    . ILE A 1 293 ? -42.640 -51.029 24.463  1.00 37.04  ?  293 ILE A CB    1 
ATOM   2268 C  CG1   . ILE A 1 293 ? -41.848 -51.571 25.652  1.00 34.43  ?  293 ILE A CG1   1 
ATOM   2269 C  CG2   . ILE A 1 293 ? -41.720 -50.285 23.484  1.00 36.63  ?  293 ILE A CG2   1 
ATOM   2270 C  CD1   . ILE A 1 293 ? -40.931 -52.717 25.253  1.00 36.27  ?  293 ILE A CD1   1 
ATOM   2271 N  N     . PRO A 1 294 ? -44.742 -48.309 23.551  1.00 34.90  ?  294 PRO A N     1 
ATOM   2272 C  CA    . PRO A 1 294 ? -45.400 -47.733 22.387  1.00 35.54  ?  294 PRO A CA    1 
ATOM   2273 C  C     . PRO A 1 294 ? -44.707 -48.263 21.114  1.00 38.01  ?  294 PRO A C     1 
ATOM   2274 O  O     . PRO A 1 294 ? -43.488 -48.420 21.111  1.00 37.72  ?  294 PRO A O     1 
ATOM   2275 C  CB    . PRO A 1 294 ? -45.171 -46.212 22.523  1.00 37.54  ?  294 PRO A CB    1 
ATOM   2276 C  CG    . PRO A 1 294 ? -44.715 -45.976 23.968  1.00 35.28  ?  294 PRO A CG    1 
ATOM   2277 C  CD    . PRO A 1 294 ? -44.183 -47.294 24.462  1.00 36.51  ?  294 PRO A CD    1 
ATOM   2278 N  N     . CYS A 1 295 ? -45.478 -48.497 20.054  1.00 38.09  ?  295 CYS A N     1 
ATOM   2279 C  CA    . CYS A 1 295 ? -45.020 -49.095 18.784  1.00 37.61  ?  295 CYS A CA    1 
ATOM   2280 C  C     . CYS A 1 295 ? -45.721 -48.397 17.622  1.00 39.54  ?  295 CYS A C     1 
ATOM   2281 O  O     . CYS A 1 295 ? -46.915 -48.462 17.570  1.00 41.45  ?  295 CYS A O     1 
ATOM   2282 C  CB    . CYS A 1 295 ? -45.322 -50.582 18.760  1.00 41.34  ?  295 CYS A CB    1 
ATOM   2283 S  SG    . CYS A 1 295 ? -44.680 -51.452 17.302  1.00 44.57  ?  295 CYS A SG    1 
ATOM   2284 N  N     . GLU A 1 296 ? -44.951 -47.764 16.739  1.00 39.30  ?  296 GLU A N     1 
ATOM   2285 C  CA    . GLU A 1 296 ? -45.437 -47.078 15.528  1.00 43.76  ?  296 GLU A CA    1 
ATOM   2286 C  C     . GLU A 1 296 ? -45.144 -47.917 14.284  1.00 38.05  ?  296 GLU A C     1 
ATOM   2287 O  O     . GLU A 1 296 ? -44.045 -48.483 14.229  1.00 36.48  ?  296 GLU A O     1 
ATOM   2288 C  CB    . GLU A 1 296 ? -44.765 -45.712 15.463  1.00 47.06  ?  296 GLU A CB    1 
ATOM   2289 C  CG    . GLU A 1 296 ? -45.189 -44.856 16.612  1.00 53.28  ?  296 GLU A CG    1 
ATOM   2290 C  CD    . GLU A 1 296 ? -44.665 -43.455 16.526  1.00 59.47  ?  296 GLU A CD    1 
ATOM   2291 O  OE1   . GLU A 1 296 ? -44.293 -42.922 17.599  1.00 69.11  ?  296 GLU A OE1   1 
ATOM   2292 O  OE2   . GLU A 1 296 ? -44.660 -42.911 15.386  1.00 55.40  ?  296 GLU A OE2   1 
ATOM   2293 N  N     . LEU A 1 297 ? -46.090 -47.948 13.347  1.00 32.59  ?  297 LEU A N     1 
ATOM   2294 C  CA    . LEU A 1 297 ? -45.939 -48.525 11.989  1.00 33.93  ?  297 LEU A CA    1 
ATOM   2295 C  C     . LEU A 1 297 ? -45.681 -47.399 10.973  1.00 30.09  ?  297 LEU A C     1 
ATOM   2296 O  O     . LEU A 1 297 ? -46.303 -46.310 11.076  1.00 27.95  ?  297 LEU A O     1 
ATOM   2297 C  CB    . LEU A 1 297 ? -47.194 -49.328 11.627  1.00 37.83  ?  297 LEU A CB    1 
ATOM   2298 C  CG    . LEU A 1 297 ? -47.649 -50.357 12.655  1.00 38.69  ?  297 LEU A CG    1 
ATOM   2299 C  CD1   . LEU A 1 297 ? -48.924 -51.059 12.209  1.00 41.59  ?  297 LEU A CD1   1 
ATOM   2300 C  CD2   . LEU A 1 297 ? -46.558 -51.358 12.958  1.00 38.00  ?  297 LEU A CD2   1 
ATOM   2301 N  N     . ARG A 1 298 ? -44.766 -47.638 10.041  1.00 28.08  ?  298 ARG A N     1 
ATOM   2302 C  CA    . ARG A 1 298 ? -44.408 -46.695 8.968   1.00 26.62  ?  298 ARG A CA    1 
ATOM   2303 C  C     . ARG A 1 298 ? -44.163 -47.526 7.711   1.00 30.00  ?  298 ARG A C     1 
ATOM   2304 O  O     . ARG A 1 298 ? -43.714 -48.688 7.831   1.00 30.78  ?  298 ARG A O     1 
ATOM   2305 C  CB    . ARG A 1 298 ? -43.193 -45.853 9.345   1.00 27.59  ?  298 ARG A CB    1 
ATOM   2306 C  CG    . ARG A 1 298 ? -43.353 -45.006 10.596  1.00 27.46  ?  298 ARG A CG    1 
ATOM   2307 C  CD    . ARG A 1 298 ? -44.492 -43.991 10.498  1.00 29.37  ?  298 ARG A CD    1 
ATOM   2308 N  NE    . ARG A 1 298 ? -44.239 -43.033 9.439   1.00 34.80  ?  298 ARG A NE    1 
ATOM   2309 C  CZ    . ARG A 1 298 ? -43.550 -41.895 9.556   1.00 38.92  ?  298 ARG A CZ    1 
ATOM   2310 N  NH1   . ARG A 1 298 ? -43.079 -41.514 10.735  1.00 33.89  ?  298 ARG A NH1   1 
ATOM   2311 N  NH2   . ARG A 1 298 ? -43.340 -41.150 8.478   1.00 39.46  ?  298 ARG A NH2   1 
ATOM   2312 N  N     . VAL A 1 299 ? -44.471 -46.968 6.549   1.00 30.89  ?  299 VAL A N     1 
ATOM   2313 C  CA    . VAL A 1 299 ? -44.294 -47.667 5.248   1.00 31.75  ?  299 VAL A CA    1 
ATOM   2314 C  C     . VAL A 1 299 ? -43.166 -46.950 4.537   1.00 31.16  ?  299 VAL A C     1 
ATOM   2315 O  O     . VAL A 1 299 ? -43.326 -45.740 4.346   1.00 30.12  ?  299 VAL A O     1 
ATOM   2316 C  CB    . VAL A 1 299 ? -45.577 -47.666 4.386   1.00 36.69  ?  299 VAL A CB    1 
ATOM   2317 C  CG1   . VAL A 1 299 ? -45.342 -48.336 3.039   1.00 37.41  ?  299 VAL A CG1   1 
ATOM   2318 C  CG2   . VAL A 1 299 ? -46.762 -48.328 5.091   1.00 35.05  ?  299 VAL A CG2   1 
ATOM   2319 N  N     . THR A 1 300 ? -42.103 -47.681 4.173   1.00 27.87  ?  300 THR A N     1 
ATOM   2320 C  CA    . THR A 1 300 ? -40.969 -47.133 3.397   1.00 29.81  ?  300 THR A CA    1 
ATOM   2321 C  C     . THR A 1 300 ? -40.224 -48.286 2.732   1.00 32.00  ?  300 THR A C     1 
ATOM   2322 O  O     . THR A 1 300 ? -40.069 -49.324 3.370   1.00 35.58  ?  300 THR A O     1 
ATOM   2323 C  CB    . THR A 1 300 ? -40.048 -46.307 4.307   1.00 34.36  ?  300 THR A CB    1 
ATOM   2324 O  OG1   . THR A 1 300 ? -39.025 -45.770 3.472   1.00 44.82  ?  300 THR A OG1   1 
ATOM   2325 C  CG2   . THR A 1 300 ? -39.411 -47.122 5.408   1.00 29.58  ?  300 THR A CG2   1 
ATOM   2326 N  N     . SER A 1 301 ? -39.740 -48.097 1.505   1.00 36.67  ?  301 SER A N     1 
ATOM   2327 C  CA    . SER A 1 301 ? -38.956 -49.111 0.757   1.00 36.55  ?  301 SER A CA    1 
ATOM   2328 C  C     . SER A 1 301 ? -37.523 -48.625 0.614   1.00 37.49  ?  301 SER A C     1 
ATOM   2329 O  O     . SER A 1 301 ? -37.357 -47.453 0.199   1.00 34.51  ?  301 SER A O     1 
ATOM   2330 C  CB    . SER A 1 301 ? -39.577 -49.413 -0.576  1.00 40.47  ?  301 SER A CB    1 
ATOM   2331 O  OG    . SER A 1 301 ? -38.660 -50.148 -1.386  1.00 47.00  ?  301 SER A OG    1 
ATOM   2332 N  N     . ALA A 1 302 ? -36.541 -49.477 0.929   1.00 35.98  ?  302 ALA A N     1 
ATOM   2333 C  CA    . ALA A 1 302 ? -35.115 -49.111 0.730   1.00 41.04  ?  302 ALA A CA    1 
ATOM   2334 C  C     . ALA A 1 302 ? -34.845 -49.059 -0.770  1.00 35.95  ?  302 ALA A C     1 
ATOM   2335 O  O     . ALA A 1 302 ? -34.048 -48.238 -1.219  1.00 36.78  ?  302 ALA A O     1 
ATOM   2336 C  CB    . ALA A 1 302 ? -34.180 -50.094 1.401   1.00 45.18  ?  302 ALA A CB    1 
ATOM   2337 N  N     . HIS A 1 303 ? -35.514 -49.924 -1.516  1.00 37.18  ?  303 HIS A N     1 
ATOM   2338 C  CA    . HIS A 1 303 ? -35.267 -50.140 -2.965  1.00 37.23  ?  303 HIS A CA    1 
ATOM   2339 C  C     . HIS A 1 303 ? -35.869 -48.969 -3.730  1.00 40.63  ?  303 HIS A C     1 
ATOM   2340 O  O     . HIS A 1 303 ? -35.192 -48.439 -4.591  1.00 39.88  ?  303 HIS A O     1 
ATOM   2341 C  CB    . HIS A 1 303 ? -35.817 -51.507 -3.406  1.00 42.08  ?  303 HIS A CB    1 
ATOM   2342 C  CG    . HIS A 1 303 ? -35.216 -52.682 -2.683  1.00 42.82  ?  303 HIS A CG    1 
ATOM   2343 N  ND1   . HIS A 1 303 ? -33.882 -52.711 -2.293  1.00 41.26  ?  303 HIS A ND1   1 
ATOM   2344 C  CD2   . HIS A 1 303 ? -35.749 -53.867 -2.298  1.00 40.64  ?  303 HIS A CD2   1 
ATOM   2345 C  CE1   . HIS A 1 303 ? -33.633 -53.883 -1.709  1.00 43.46  ?  303 HIS A CE1   1 
ATOM   2346 N  NE2   . HIS A 1 303 ? -34.764 -54.615 -1.721  1.00 40.88  ?  303 HIS A NE2   1 
ATOM   2347 N  N     . LYS A 1 304 ? -37.075 -48.532 -3.370  1.00 44.50  ?  304 LYS A N     1 
ATOM   2348 C  CA    . LYS A 1 304 ? -37.893 -47.644 -4.235  1.00 47.91  ?  304 LYS A CA    1 
ATOM   2349 C  C     . LYS A 1 304 ? -37.957 -46.235 -3.651  1.00 45.33  ?  304 LYS A C     1 
ATOM   2350 O  O     . LYS A 1 304 ? -38.380 -45.340 -4.360  1.00 65.62  ?  304 LYS A O     1 
ATOM   2351 C  CB    . LYS A 1 304 ? -39.283 -48.262 -4.435  1.00 51.05  ?  304 LYS A CB    1 
ATOM   2352 C  CG    . LYS A 1 304 ? -39.227 -49.677 -5.027  1.00 60.03  ?  304 LYS A CG    1 
ATOM   2353 C  CD    . LYS A 1 304 ? -40.541 -50.300 -5.462  1.00 63.79  ?  304 LYS A CD    1 
ATOM   2354 C  CE    . LYS A 1 304 ? -41.419 -50.706 -4.297  1.00 68.33  ?  304 LYS A CE    1 
ATOM   2355 N  NZ    . LYS A 1 304 ? -42.258 -51.865 -4.663  1.00 72.53  ?  304 LYS A NZ    1 
ATOM   2356 N  N     . GLY A 1 305 ? -37.589 -46.040 -2.396  1.00 48.50  ?  305 GLY A N     1 
ATOM   2357 C  CA    . GLY A 1 305 ? -37.613 -44.708 -1.748  1.00 46.14  ?  305 GLY A CA    1 
ATOM   2358 C  C     . GLY A 1 305 ? -36.564 -44.596 -0.639  1.00 42.14  ?  305 GLY A C     1 
ATOM   2359 O  O     . GLY A 1 305 ? -36.912 -44.300 0.502   1.00 42.11  ?  305 GLY A O     1 
ATOM   2360 N  N     . PRO A 1 306 ? -35.269 -44.842 -0.944  1.00 40.73  ?  306 PRO A N     1 
ATOM   2361 C  CA    . PRO A 1 306 ? -34.211 -44.816 0.063   1.00 38.12  ?  306 PRO A CA    1 
ATOM   2362 C  C     . PRO A 1 306 ? -34.046 -43.427 0.685   1.00 33.98  ?  306 PRO A C     1 
ATOM   2363 O  O     . PRO A 1 306 ? -33.746 -43.351 1.859   1.00 40.59  ?  306 PRO A O     1 
ATOM   2364 C  CB    . PRO A 1 306 ? -32.942 -45.256 -0.676  1.00 37.19  ?  306 PRO A CB    1 
ATOM   2365 C  CG    . PRO A 1 306 ? -33.253 -44.977 -2.136  1.00 42.79  ?  306 PRO A CG    1 
ATOM   2366 C  CD    . PRO A 1 306 ? -34.752 -45.130 -2.295  1.00 40.32  ?  306 PRO A CD    1 
ATOM   2367 N  N     . ASP A 1 307 ? -34.252 -42.380 -0.094  1.00 38.80  ?  307 ASP A N     1 
ATOM   2368 C  CA    . ASP A 1 307 ? -34.261 -40.956 0.368   1.00 42.70  ?  307 ASP A CA    1 
ATOM   2369 C  C     . ASP A 1 307 ? -35.289 -40.811 1.507   1.00 38.27  ?  307 ASP A C     1 
ATOM   2370 O  O     . ASP A 1 307 ? -34.939 -40.237 2.552   1.00 40.22  ?  307 ASP A O     1 
ATOM   2371 C  CB    . ASP A 1 307 ? -34.526 -40.000 -0.807  1.00 45.51  ?  307 ASP A CB    1 
ATOM   2372 C  CG    . ASP A 1 307 ? -35.844 -40.259 -1.551  1.00 53.08  ?  307 ASP A CG    1 
ATOM   2373 O  OD1   . ASP A 1 307 ? -36.171 -41.468 -1.859  1.00 43.80  ?  307 ASP A OD1   1 
ATOM   2374 O  OD2   . ASP A 1 307 ? -36.564 -39.258 -1.814  1.00 57.89  ?  307 ASP A OD2   1 
ATOM   2375 N  N     . GLU A 1 308 ? -36.475 -41.383 1.343   1.00 31.97  ?  308 GLU A N     1 
ATOM   2376 C  CA    . GLU A 1 308 ? -37.601 -41.272 2.297   1.00 33.42  ?  308 GLU A CA    1 
ATOM   2377 C  C     . GLU A 1 308 ? -37.301 -42.133 3.528   1.00 36.81  ?  308 GLU A C     1 
ATOM   2378 O  O     . GLU A 1 308 ? -37.632 -41.681 4.642   1.00 34.32  ?  308 GLU A O     1 
ATOM   2379 C  CB    . GLU A 1 308 ? -38.905 -41.699 1.642   1.00 33.70  ?  308 GLU A CB    1 
ATOM   2380 C  CG    . GLU A 1 308 ? -40.139 -41.474 2.512   1.00 40.22  ?  308 GLU A CG    1 
ATOM   2381 C  CD    . GLU A 1 308 ? -40.383 -40.041 3.001   1.00 47.54  ?  308 GLU A CD    1 
ATOM   2382 O  OE1   . GLU A 1 308 ? -39.608 -39.122 2.622   1.00 52.08  ?  308 GLU A OE1   1 
ATOM   2383 O  OE2   . GLU A 1 308 ? -41.353 -39.835 3.795   1.00 53.35  ?  308 GLU A OE2   1 
ATOM   2384 N  N     . THR A 1 309 ? -36.707 -43.327 3.352   1.00 32.81  ?  309 THR A N     1 
ATOM   2385 C  CA    . THR A 1 309 ? -36.286 -44.211 4.473   1.00 31.46  ?  309 THR A CA    1 
ATOM   2386 C  C     . THR A 1 309 ? -35.376 -43.423 5.431   1.00 29.49  ?  309 THR A C     1 
ATOM   2387 O  O     . THR A 1 309 ? -35.624 -43.452 6.618   1.00 27.81  ?  309 THR A O     1 
ATOM   2388 C  CB    . THR A 1 309 ? -35.561 -45.442 3.916   1.00 34.65  ?  309 THR A CB    1 
ATOM   2389 O  OG1   . THR A 1 309 ? -36.437 -46.019 2.957   1.00 33.82  ?  309 THR A OG1   1 
ATOM   2390 C  CG2   . THR A 1 309 ? -35.168 -46.473 4.961   1.00 35.10  ?  309 THR A CG2   1 
ATOM   2391 N  N     . LEU A 1 310 ? -34.347 -42.755 4.906   1.00 30.02  ?  310 LEU A N     1 
ATOM   2392 C  CA    . LEU A 1 310 ? -33.384 -41.960 5.708   1.00 33.24  ?  310 LEU A CA    1 
ATOM   2393 C  C     . LEU A 1 310 ? -34.059 -40.759 6.400   1.00 34.04  ?  310 LEU A C     1 
ATOM   2394 O  O     . LEU A 1 310 ? -33.657 -40.491 7.547   1.00 35.09  ?  310 LEU A O     1 
ATOM   2395 C  CB    . LEU A 1 310 ? -32.271 -41.455 4.798   1.00 37.91  ?  310 LEU A CB    1 
ATOM   2396 C  CG    . LEU A 1 310 ? -31.441 -42.526 4.115   1.00 40.15  ?  310 LEU A CG    1 
ATOM   2397 C  CD1   . LEU A 1 310 ? -30.397 -41.843 3.238   1.00 46.67  ?  310 LEU A CD1   1 
ATOM   2398 C  CD2   . LEU A 1 310 ? -30.809 -43.467 5.116   1.00 39.69  ?  310 LEU A CD2   1 
ATOM   2399 N  N     . ARG A 1 311 ? -35.004 -40.068 5.742   1.00 30.86  ?  311 ARG A N     1 
ATOM   2400 C  CA    . ARG A 1 311 ? -35.744 -38.924 6.330   1.00 35.37  ?  311 ARG A CA    1 
ATOM   2401 C  C     . ARG A 1 311 ? -36.625 -39.425 7.507   1.00 39.65  ?  311 ARG A C     1 
ATOM   2402 O  O     . ARG A 1 311 ? -36.622 -38.765 8.597   1.00 31.10  ?  311 ARG A O     1 
ATOM   2403 C  CB    . ARG A 1 311 ? -36.541 -38.166 5.263   1.00 39.41  ?  311 ARG A CB    1 
ATOM   2404 C  CG    . ARG A 1 311 ? -36.892 -36.730 5.663   1.00 42.40  ?  311 ARG A CG    1 
ATOM   2405 C  CD    . ARG A 1 311 ? -38.039 -36.097 4.855   1.00 43.56  ?  311 ARG A CD    1 
ATOM   2406 N  NE    . ARG A 1 311 ? -39.245 -36.928 4.863   1.00 41.08  ?  311 ARG A NE    1 
ATOM   2407 C  CZ    . ARG A 1 311 ? -40.074 -37.098 5.918   1.00 45.44  ?  311 ARG A CZ    1 
ATOM   2408 N  NH1   . ARG A 1 311 ? -39.865 -36.430 7.045   1.00 44.46  ?  311 ARG A NH1   1 
ATOM   2409 N  NH2   . ARG A 1 311 ? -41.114 -37.932 5.829   1.00 42.61  ?  311 ARG A NH2   1 
ATOM   2410 N  N     . ILE A 1 312 ? -37.295 -40.579 7.342   1.00 33.30  ?  312 ILE A N     1 
ATOM   2411 C  CA    . ILE A 1 312 ? -38.143 -41.187 8.410   1.00 33.29  ?  312 ILE A CA    1 
ATOM   2412 C  C     . ILE A 1 312 ? -37.238 -41.591 9.592   1.00 33.57  ?  312 ILE A C     1 
ATOM   2413 O  O     . ILE A 1 312 ? -37.584 -41.315 10.742  1.00 27.72  ?  312 ILE A O     1 
ATOM   2414 C  CB    . ILE A 1 312 ? -38.998 -42.343 7.864   1.00 31.06  ?  312 ILE A CB    1 
ATOM   2415 C  CG1   . ILE A 1 312 ? -40.019 -41.804 6.864   1.00 35.29  ?  312 ILE A CG1   1 
ATOM   2416 C  CG2   . ILE A 1 312 ? -39.700 -43.088 8.991   1.00 32.40  ?  312 ILE A CG2   1 
ATOM   2417 C  CD1   . ILE A 1 312 ? -40.696 -42.859 6.015   1.00 40.53  ?  312 ILE A CD1   1 
ATOM   2418 N  N     . LYS A 1 313 ? -36.115 -42.220 9.291   1.00 30.65  ?  313 LYS A N     1 
ATOM   2419 C  CA    . LYS A 1 313 ? -35.123 -42.635 10.283  1.00 30.23  ?  313 LYS A CA    1 
ATOM   2420 C  C     . LYS A 1 313 ? -34.777 -41.394 11.094  1.00 30.75  ?  313 LYS A C     1 
ATOM   2421 O  O     . LYS A 1 313 ? -34.831 -41.486 12.333  1.00 30.46  ?  313 LYS A O     1 
ATOM   2422 C  CB    . LYS A 1 313 ? -33.908 -43.267 9.600   1.00 32.31  ?  313 LYS A CB    1 
ATOM   2423 C  CG    . LYS A 1 313 ? -32.652 -43.366 10.474  1.00 36.64  ?  313 LYS A CG    1 
ATOM   2424 C  CD    . LYS A 1 313 ? -31.398 -43.662 9.683   1.00 42.61  ?  313 LYS A CD    1 
ATOM   2425 C  CE    . LYS A 1 313 ? -30.860 -42.456 8.913   1.00 44.34  ?  313 LYS A CE    1 
ATOM   2426 N  NZ    . LYS A 1 313 ? -30.100 -41.501 9.774   1.00 38.79  ?  313 LYS A NZ    1 
ATOM   2427 N  N     . ALA A 1 314 ? -34.468 -40.279 10.421  1.00 32.06  ?  314 ALA A N     1 
ATOM   2428 C  CA    . ALA A 1 314 ? -34.024 -39.013 11.060  1.00 34.60  ?  314 ALA A CA    1 
ATOM   2429 C  C     . ALA A 1 314 ? -35.081 -38.469 12.037  1.00 33.07  ?  314 ALA A C     1 
ATOM   2430 O  O     . ALA A 1 314 ? -34.673 -37.892 13.028  1.00 31.06  ?  314 ALA A O     1 
ATOM   2431 C  CB    . ALA A 1 314 ? -33.687 -37.968 10.019  1.00 33.46  ?  314 ALA A CB    1 
ATOM   2432 N  N     . GLU A 1 315 ? -36.378 -38.641 11.735  1.00 36.00  ?  315 GLU A N     1 
ATOM   2433 C  CA    . GLU A 1 315 ? -37.497 -38.177 12.575  1.00 36.05  ?  315 GLU A CA    1 
ATOM   2434 C  C     . GLU A 1 315 ? -37.394 -38.851 13.942  1.00 34.94  ?  315 GLU A C     1 
ATOM   2435 O  O     . GLU A 1 315 ? -37.701 -38.183 14.948  1.00 34.99  ?  315 GLU A O     1 
ATOM   2436 C  CB    . GLU A 1 315 ? -38.863 -38.497 11.968  1.00 42.20  ?  315 GLU A CB    1 
ATOM   2437 C  CG    . GLU A 1 315 ? -39.227 -37.661 10.736  1.00 48.52  ?  315 GLU A CG    1 
ATOM   2438 C  CD    . GLU A 1 315 ? -40.655 -37.889 10.222  1.00 49.96  ?  315 GLU A CD    1 
ATOM   2439 O  OE1   . GLU A 1 315 ? -41.312 -38.881 10.646  1.00 46.83  ?  315 GLU A OE1   1 
ATOM   2440 O  OE2   . GLU A 1 315 ? -41.119 -37.064 9.394   1.00 52.02  ?  315 GLU A OE2   1 
ATOM   2441 N  N     . TYR A 1 316 ? -37.024 -40.130 13.976  1.00 30.20  ?  316 TYR A N     1 
ATOM   2442 C  CA    . TYR A 1 316 ? -37.031 -40.952 15.214  1.00 31.30  ?  316 TYR A CA    1 
ATOM   2443 C  C     . TYR A 1 316 ? -35.679 -40.859 15.941  1.00 29.87  ?  316 TYR A C     1 
ATOM   2444 O  O     . TYR A 1 316 ? -35.603 -40.995 17.150  1.00 30.92  ?  316 TYR A O     1 
ATOM   2445 C  CB    . TYR A 1 316 ? -37.416 -42.388 14.871  1.00 31.16  ?  316 TYR A CB    1 
ATOM   2446 C  CG    . TYR A 1 316 ? -38.845 -42.531 14.448  1.00 31.47  ?  316 TYR A CG    1 
ATOM   2447 C  CD1   . TYR A 1 316 ? -39.875 -42.271 15.332  1.00 36.38  ?  316 TYR A CD1   1 
ATOM   2448 C  CD2   . TYR A 1 316 ? -39.175 -42.913 13.174  1.00 33.21  ?  316 TYR A CD2   1 
ATOM   2449 C  CE1   . TYR A 1 316 ? -41.202 -42.354 14.955  1.00 33.29  ?  316 TYR A CE1   1 
ATOM   2450 C  CE2   . TYR A 1 316 ? -40.494 -43.037 12.788  1.00 37.75  ?  316 TYR A CE2   1 
ATOM   2451 C  CZ    . TYR A 1 316 ? -41.509 -42.756 13.683  1.00 34.37  ?  316 TYR A CZ    1 
ATOM   2452 O  OH    . TYR A 1 316 ? -42.808 -42.938 13.315  1.00 35.57  ?  316 TYR A OH    1 
ATOM   2453 N  N     . GLU A 1 317 ? -34.609 -40.661 15.199  1.00 33.02  ?  317 GLU A N     1 
ATOM   2454 C  CA    . GLU A 1 317 ? -33.265 -40.403 15.762  1.00 35.54  ?  317 GLU A CA    1 
ATOM   2455 C  C     . GLU A 1 317 ? -33.214 -39.025 16.458  1.00 36.99  ?  317 GLU A C     1 
ATOM   2456 O  O     . GLU A 1 317 ? -32.400 -38.878 17.400  1.00 42.05  ?  317 GLU A O     1 
ATOM   2457 C  CB    . GLU A 1 317 ? -32.226 -40.402 14.651  1.00 34.52  ?  317 GLU A CB    1 
ATOM   2458 C  CG    . GLU A 1 317 ? -31.781 -41.759 14.195  1.00 34.51  ?  317 GLU A CG    1 
ATOM   2459 C  CD    . GLU A 1 317 ? -30.812 -41.655 13.022  1.00 40.95  ?  317 GLU A CD    1 
ATOM   2460 O  OE1   . GLU A 1 317 ? -30.924 -40.659 12.235  1.00 34.06  ?  317 GLU A OE1   1 
ATOM   2461 O  OE2   . GLU A 1 317 ? -29.933 -42.552 12.897  1.00 46.04  ?  317 GLU A OE2   1 
ATOM   2462 N  N     . GLY A 1 318 ? -34.074 -38.081 16.059  1.00 35.71  ?  318 GLY A N     1 
ATOM   2463 C  CA    . GLY A 1 318 ? -33.871 -36.645 16.314  1.00 34.24  ?  318 GLY A CA    1 
ATOM   2464 C  C     . GLY A 1 318 ? -34.672 -36.086 17.468  1.00 31.31  ?  318 GLY A C     1 
ATOM   2465 O  O     . GLY A 1 318 ? -34.428 -34.922 17.780  1.00 34.09  ?  318 GLY A O     1 
ATOM   2466 N  N     . ASP A 1 319 ? -35.572 -36.846 18.110  1.00 37.34  ?  319 ASP A N     1 
ATOM   2467 C  CA    . ASP A 1 319 ? -36.495 -36.291 19.150  1.00 36.67  ?  319 ASP A CA    1 
ATOM   2468 C  C     . ASP A 1 319 ? -36.132 -36.783 20.554  1.00 41.91  ?  319 ASP A C     1 
ATOM   2469 O  O     . ASP A 1 319 ? -36.929 -36.537 21.472  1.00 44.81  ?  319 ASP A O     1 
ATOM   2470 C  CB    . ASP A 1 319 ? -37.962 -36.553 18.816  1.00 40.03  ?  319 ASP A CB    1 
ATOM   2471 C  CG    . ASP A 1 319 ? -38.411 -38.009 18.856  1.00 45.77  ?  319 ASP A CG    1 
ATOM   2472 O  OD1   . ASP A 1 319 ? -37.551 -38.876 18.999  1.00 47.33  ?  319 ASP A OD1   1 
ATOM   2473 O  OD2   . ASP A 1 319 ? -39.632 -38.256 18.783  1.00 42.97  ?  319 ASP A OD2   1 
ATOM   2474 N  N     . GLY A 1 320 ? -34.983 -37.454 20.732  1.00 43.59  ?  320 GLY A N     1 
ATOM   2475 C  CA    . GLY A 1 320 ? -34.440 -37.764 22.072  1.00 41.14  ?  320 GLY A CA    1 
ATOM   2476 C  C     . GLY A 1 320 ? -35.126 -38.938 22.752  1.00 38.87  ?  320 GLY A C     1 
ATOM   2477 O  O     . GLY A 1 320 ? -34.860 -39.156 23.939  1.00 39.41  ?  320 GLY A O     1 
ATOM   2478 N  N     . ILE A 1 321 ? -35.949 -39.709 22.042  1.00 36.72  ?  321 ILE A N     1 
ATOM   2479 C  CA    . ILE A 1 321 ? -36.603 -40.928 22.615  1.00 34.92  ?  321 ILE A CA    1 
ATOM   2480 C  C     . ILE A 1 321 ? -35.863 -42.187 22.147  1.00 39.26  ?  321 ILE A C     1 
ATOM   2481 O  O     . ILE A 1 321 ? -35.796 -42.464 20.948  1.00 36.05  ?  321 ILE A O     1 
ATOM   2482 C  CB    . ILE A 1 321 ? -38.089 -40.949 22.252  1.00 32.52  ?  321 ILE A CB    1 
ATOM   2483 C  CG1   . ILE A 1 321 ? -38.836 -39.796 22.932  1.00 34.65  ?  321 ILE A CG1   1 
ATOM   2484 C  CG2   . ILE A 1 321 ? -38.687 -42.283 22.612  1.00 32.13  ?  321 ILE A CG2   1 
ATOM   2485 C  CD1   . ILE A 1 321 ? -40.294 -39.658 22.509  1.00 34.80  ?  321 ILE A CD1   1 
ATOM   2486 N  N     . PRO A 1 322 ? -35.273 -42.973 23.079  1.00 35.17  ?  322 PRO A N     1 
ATOM   2487 C  CA    . PRO A 1 322 ? -34.591 -44.221 22.749  1.00 39.32  ?  322 PRO A CA    1 
ATOM   2488 C  C     . PRO A 1 322 ? -35.496 -45.156 21.933  1.00 34.48  ?  322 PRO A C     1 
ATOM   2489 O  O     . PRO A 1 322 ? -36.602 -45.465 22.398  1.00 30.06  ?  322 PRO A O     1 
ATOM   2490 C  CB    . PRO A 1 322 ? -34.291 -44.874 24.139  1.00 37.73  ?  322 PRO A CB    1 
ATOM   2491 C  CG    . PRO A 1 322 ? -34.209 -43.715 25.078  1.00 36.79  ?  322 PRO A CG    1 
ATOM   2492 C  CD    . PRO A 1 322 ? -35.221 -42.720 24.520  1.00 36.49  ?  322 PRO A CD    1 
ATOM   2493 N  N     . THR A 1 323 ? -34.997 -45.585 20.778  1.00 30.06  ?  323 THR A N     1 
ATOM   2494 C  CA    . THR A 1 323 ? -35.793 -46.272 19.739  1.00 29.65  ?  323 THR A CA    1 
ATOM   2495 C  C     . THR A 1 323 ? -35.117 -47.570 19.288  1.00 28.31  ?  323 THR A C     1 
ATOM   2496 O  O     . THR A 1 323 ? -33.896 -47.546 18.989  1.00 30.67  ?  323 THR A O     1 
ATOM   2497 C  CB    . THR A 1 323 ? -36.062 -45.326 18.567  1.00 30.81  ?  323 THR A CB    1 
ATOM   2498 O  OG1   . THR A 1 323 ? -36.814 -44.227 19.080  1.00 31.90  ?  323 THR A OG1   1 
ATOM   2499 C  CG2   . THR A 1 323 ? -36.858 -45.989 17.467  1.00 33.73  ?  323 THR A CG2   1 
ATOM   2500 N  N     . VAL A 1 324 ? -35.901 -48.642 19.162  1.00 26.60  ?  324 VAL A N     1 
ATOM   2501 C  CA    . VAL A 1 324 ? -35.481 -49.850 18.408  1.00 27.96  ?  324 VAL A CA    1 
ATOM   2502 C  C     . VAL A 1 324 ? -36.299 -49.914 17.109  1.00 28.81  ?  324 VAL A C     1 
ATOM   2503 O  O     . VAL A 1 324 ? -37.507 -49.886 17.200  1.00 34.27  ?  324 VAL A O     1 
ATOM   2504 C  CB    . VAL A 1 324 ? -35.644 -51.121 19.254  1.00 28.41  ?  324 VAL A CB    1 
ATOM   2505 C  CG1   . VAL A 1 324 ? -35.373 -52.353 18.410  1.00 28.62  ?  324 VAL A CG1   1 
ATOM   2506 C  CG2   . VAL A 1 324 ? -34.763 -51.117 20.501  1.00 26.82  ?  324 VAL A CG2   1 
ATOM   2507 N  N     . PHE A 1 325 ? -35.631 -49.972 15.960  1.00 28.54  ?  325 PHE A N     1 
ATOM   2508 C  CA    . PHE A 1 325 ? -36.232 -50.134 14.616  1.00 27.53  ?  325 PHE A CA    1 
ATOM   2509 C  C     . PHE A 1 325 ? -36.381 -51.626 14.326  1.00 28.95  ?  325 PHE A C     1 
ATOM   2510 O  O     . PHE A 1 325 ? -35.441 -52.402 14.558  1.00 33.17  ?  325 PHE A O     1 
ATOM   2511 C  CB    . PHE A 1 325 ? -35.358 -49.489 13.543  1.00 26.48  ?  325 PHE A CB    1 
ATOM   2512 C  CG    . PHE A 1 325 ? -35.250 -47.985 13.612  1.00 25.10  ?  325 PHE A CG    1 
ATOM   2513 C  CD1   . PHE A 1 325 ? -36.314 -47.175 13.277  1.00 26.53  ?  325 PHE A CD1   1 
ATOM   2514 C  CD2   . PHE A 1 325 ? -34.071 -47.380 13.989  1.00 25.91  ?  325 PHE A CD2   1 
ATOM   2515 C  CE1   . PHE A 1 325 ? -36.216 -45.792 13.390  1.00 26.49  ?  325 PHE A CE1   1 
ATOM   2516 C  CE2   . PHE A 1 325 ? -33.965 -46.000 14.105  1.00 27.00  ?  325 PHE A CE2   1 
ATOM   2517 C  CZ    . PHE A 1 325 ? -35.039 -45.207 13.789  1.00 26.24  ?  325 PHE A CZ    1 
ATOM   2518 N  N     . VAL A 1 326 ? -37.544 -52.032 13.847  1.00 27.94  ?  326 VAL A N     1 
ATOM   2519 C  CA    . VAL A 1 326 ? -37.789 -53.431 13.408  1.00 29.30  ?  326 VAL A CA    1 
ATOM   2520 C  C     . VAL A 1 326 ? -38.126 -53.372 11.918  1.00 31.10  ?  326 VAL A C     1 
ATOM   2521 O  O     . VAL A 1 326 ? -39.110 -52.693 11.555  1.00 30.66  ?  326 VAL A O     1 
ATOM   2522 C  CB    . VAL A 1 326 ? -38.905 -54.095 14.230  1.00 31.98  ?  326 VAL A CB    1 
ATOM   2523 C  CG1   . VAL A 1 326 ? -39.226 -55.493 13.681  1.00 33.06  ?  326 VAL A CG1   1 
ATOM   2524 C  CG2   . VAL A 1 326 ? -38.556 -54.135 15.724  1.00 28.57  ?  326 VAL A CG2   1 
ATOM   2525 N  N     . ALA A 1 327 ? -37.264 -53.957 11.078  1.00 30.72  ?  327 ALA A N     1 
ATOM   2526 C  CA    . ALA A 1 327 ? -37.393 -53.894 9.603   1.00 27.65  ?  327 ALA A CA    1 
ATOM   2527 C  C     . ALA A 1 327 ? -38.135 -55.145 9.160   1.00 29.29  ?  327 ALA A C     1 
ATOM   2528 O  O     . ALA A 1 327 ? -37.661 -56.292 9.455   1.00 27.45  ?  327 ALA A O     1 
ATOM   2529 C  CB    . ALA A 1 327 ? -36.055 -53.786 8.947   1.00 28.93  ?  327 ALA A CB    1 
ATOM   2530 N  N     . VAL A 1 328 ? -39.267 -54.927 8.504   1.00 29.77  ?  328 VAL A N     1 
ATOM   2531 C  CA    . VAL A 1 328 ? -40.109 -56.008 7.917   1.00 30.88  ?  328 VAL A CA    1 
ATOM   2532 C  C     . VAL A 1 328 ? -40.077 -55.866 6.399   1.00 28.55  ?  328 VAL A C     1 
ATOM   2533 O  O     . VAL A 1 328 ? -40.766 -54.982 5.881   1.00 29.00  ?  328 VAL A O     1 
ATOM   2534 C  CB    . VAL A 1 328 ? -41.527 -55.950 8.508   1.00 29.34  ?  328 VAL A CB    1 
ATOM   2535 C  CG1   . VAL A 1 328 ? -42.455 -56.937 7.838   1.00 32.61  ?  328 VAL A CG1   1 
ATOM   2536 C  CG2   . VAL A 1 328 ? -41.509 -56.170 10.006  1.00 26.38  ?  328 VAL A CG2   1 
ATOM   2537 N  N     . ALA A 1 329 ? -39.253 -56.661 5.731   1.00 29.43  ?  329 ALA A N     1 
ATOM   2538 C  CA    . ALA A 1 329 ? -39.114 -56.647 4.244   1.00 31.71  ?  329 ALA A CA    1 
ATOM   2539 C  C     . ALA A 1 329 ? -39.128 -58.081 3.743   1.00 38.80  ?  329 ALA A C     1 
ATOM   2540 O  O     . ALA A 1 329 ? -38.229 -58.860 4.157   1.00 45.25  ?  329 ALA A O     1 
ATOM   2541 C  CB    . ALA A 1 329 ? -37.853 -55.952 3.779   1.00 34.69  ?  329 ALA A CB    1 
ATOM   2542 N  N     . GLY A 1 330 ? -40.113 -58.406 2.905   1.00 40.81  ?  330 GLY A N     1 
ATOM   2543 C  CA    . GLY A 1 330 ? -40.210 -59.705 2.216   1.00 45.01  ?  330 GLY A CA    1 
ATOM   2544 C  C     . GLY A 1 330 ? -39.150 -59.814 1.128   1.00 42.19  ?  330 GLY A C     1 
ATOM   2545 O  O     . GLY A 1 330 ? -38.554 -58.760 0.743   1.00 36.31  ?  330 GLY A O     1 
ATOM   2546 N  N     . ARG A 1 331 ? -38.885 -61.045 0.688   1.00 45.27  ?  331 ARG A N     1 
ATOM   2547 C  CA    . ARG A 1 331 ? -37.922 -61.337 -0.402  1.00 51.61  ?  331 ARG A CA    1 
ATOM   2548 C  C     . ARG A 1 331 ? -36.564 -60.740 -0.011  1.00 46.63  ?  331 ARG A C     1 
ATOM   2549 O  O     . ARG A 1 331 ? -36.207 -60.869 1.158   1.00 56.44  ?  331 ARG A O     1 
ATOM   2550 C  CB    . ARG A 1 331 ? -38.525 -60.791 -1.699  1.00 57.41  ?  331 ARG A CB    1 
ATOM   2551 C  CG    . ARG A 1 331 ? -40.005 -61.110 -1.863  1.00 60.19  ?  331 ARG A CG    1 
ATOM   2552 C  CD    . ARG A 1 331 ? -40.558 -60.634 -3.179  1.00 59.04  ?  331 ARG A CD    1 
ATOM   2553 N  NE    . ARG A 1 331 ? -41.772 -61.374 -3.442  1.00 69.37  ?  331 ARG A NE    1 
ATOM   2554 C  CZ    . ARG A 1 331 ? -42.481 -61.275 -4.553  1.00 74.67  ?  331 ARG A CZ    1 
ATOM   2555 N  NH1   . ARG A 1 331 ? -42.101 -60.462 -5.523  1.00 63.03  ?  331 ARG A NH1   1 
ATOM   2556 N  NH2   . ARG A 1 331 ? -43.579 -61.996 -4.674  1.00 89.08  ?  331 ARG A NH2   1 
ATOM   2557 N  N     . SER A 1 332 ? -35.850 -60.097 -0.935  1.00 44.38  ?  332 SER A N     1 
ATOM   2558 C  CA    . SER A 1 332 ? -34.488 -59.552 -0.707  1.00 45.50  ?  332 SER A CA    1 
ATOM   2559 C  C     . SER A 1 332 ? -34.605 -58.332 0.215   1.00 43.48  ?  332 SER A C     1 
ATOM   2560 O  O     . SER A 1 332 ? -34.999 -57.241 -0.245  1.00 47.73  ?  332 SER A O     1 
ATOM   2561 C  CB    . SER A 1 332 ? -33.763 -59.280 -2.006  1.00 40.50  ?  332 SER A CB    1 
ATOM   2562 O  OG    . SER A 1 332 ? -32.505 -58.649 -1.805  1.00 34.67  ?  332 SER A OG    1 
ATOM   2563 N  N     . ASN A 1 333 ? -34.318 -58.557 1.491   1.00 41.25  ?  333 ASN A N     1 
ATOM   2564 C  CA    . ASN A 1 333 ? -34.395 -57.540 2.574   1.00 48.20  ?  333 ASN A CA    1 
ATOM   2565 C  C     . ASN A 1 333 ? -33.207 -56.581 2.416   1.00 44.46  ?  333 ASN A C     1 
ATOM   2566 O  O     . ASN A 1 333 ? -32.090 -56.984 2.792   1.00 47.89  ?  333 ASN A O     1 
ATOM   2567 C  CB    . ASN A 1 333 ? -34.454 -58.227 3.950   1.00 47.73  ?  333 ASN A CB    1 
ATOM   2568 C  CG    . ASN A 1 333 ? -34.393 -57.282 5.133   1.00 43.38  ?  333 ASN A CG    1 
ATOM   2569 O  OD1   . ASN A 1 333 ? -34.499 -56.073 4.975   1.00 43.66  ?  333 ASN A OD1   1 
ATOM   2570 N  ND2   . ASN A 1 333 ? -34.176 -57.823 6.314   1.00 36.00  ?  333 ASN A ND2   1 
ATOM   2571 N  N     . GLY A 1 334 ? -33.438 -55.381 1.865   1.00 45.03  ?  334 GLY A N     1 
ATOM   2572 C  CA    . GLY A 1 334 ? -32.469 -54.255 1.866   1.00 39.01  ?  334 GLY A CA    1 
ATOM   2573 C  C     . GLY A 1 334 ? -32.775 -53.224 2.944   1.00 36.90  ?  334 GLY A C     1 
ATOM   2574 O  O     . GLY A 1 334 ? -31.897 -52.415 3.256   1.00 42.26  ?  334 GLY A O     1 
ATOM   2575 N  N     . LEU A 1 335 ? -33.973 -53.253 3.527   1.00 35.37  ?  335 LEU A N     1 
ATOM   2576 C  CA    . LEU A 1 335 ? -34.468 -52.243 4.500   1.00 34.41  ?  335 LEU A CA    1 
ATOM   2577 C  C     . LEU A 1 335 ? -33.738 -52.388 5.839   1.00 34.99  ?  335 LEU A C     1 
ATOM   2578 O  O     . LEU A 1 335 ? -33.328 -51.361 6.387   1.00 32.52  ?  335 LEU A O     1 
ATOM   2579 C  CB    . LEU A 1 335 ? -35.972 -52.410 4.678   1.00 35.30  ?  335 LEU A CB    1 
ATOM   2580 C  CG    . LEU A 1 335 ? -36.638 -51.402 5.602   1.00 38.76  ?  335 LEU A CG    1 
ATOM   2581 C  CD1   . LEU A 1 335 ? -36.407 -49.978 5.125   1.00 37.96  ?  335 LEU A CD1   1 
ATOM   2582 C  CD2   . LEU A 1 335 ? -38.137 -51.690 5.730   1.00 38.17  ?  335 LEU A CD2   1 
ATOM   2583 N  N     . GLY A 1 336 ? -33.531 -53.621 6.312   1.00 31.94  ?  336 GLY A N     1 
ATOM   2584 C  CA    . GLY A 1 336 ? -32.759 -53.879 7.535   1.00 33.90  ?  336 GLY A CA    1 
ATOM   2585 C  C     . GLY A 1 336 ? -31.326 -53.387 7.397   1.00 33.78  ?  336 GLY A C     1 
ATOM   2586 O  O     . GLY A 1 336 ? -30.858 -52.541 8.153   1.00 31.19  ?  336 GLY A O     1 
ATOM   2587 N  N     . PRO A 1 337 ? -30.580 -53.951 6.441   1.00 31.55  ?  337 PRO A N     1 
ATOM   2588 C  CA    . PRO A 1 337 ? -29.243 -53.485 6.112   1.00 33.72  ?  337 PRO A CA    1 
ATOM   2589 C  C     . PRO A 1 337 ? -29.054 -51.972 5.931   1.00 33.01  ?  337 PRO A C     1 
ATOM   2590 O  O     . PRO A 1 337 ? -28.207 -51.433 6.602   1.00 36.52  ?  337 PRO A O     1 
ATOM   2591 C  CB    . PRO A 1 337 ? -29.011 -54.204 4.779   1.00 36.54  ?  337 PRO A CB    1 
ATOM   2592 C  CG    . PRO A 1 337 ? -29.690 -55.529 4.984   1.00 41.84  ?  337 PRO A CG    1 
ATOM   2593 C  CD    . PRO A 1 337 ? -30.976 -55.146 5.688   1.00 38.68  ?  337 PRO A CD    1 
ATOM   2594 N  N     . VAL A 1 338 ? -29.798 -51.323 5.037   1.00 33.88  ?  338 VAL A N     1 
ATOM   2595 C  CA    . VAL A 1 338 ? -29.677 -49.852 4.821   1.00 34.48  ?  338 VAL A CA    1 
ATOM   2596 C  C     . VAL A 1 338 ? -29.915 -49.135 6.167   1.00 33.54  ?  338 VAL A C     1 
ATOM   2597 O  O     . VAL A 1 338 ? -29.082 -48.262 6.512   1.00 33.14  ?  338 VAL A O     1 
ATOM   2598 C  CB    . VAL A 1 338 ? -30.572 -49.327 3.682   1.00 36.57  ?  338 VAL A CB    1 
ATOM   2599 C  CG1   . VAL A 1 338 ? -32.007 -49.514 3.985   1.00 47.24  ?  338 VAL A CG1   1 
ATOM   2600 C  CG2   . VAL A 1 338 ? -30.397 -47.842 3.426   1.00 42.88  ?  338 VAL A CG2   1 
ATOM   2601 N  N     . MET A 1 339 ? -30.973 -49.479 6.916   1.00 29.24  ?  339 MET A N     1 
ATOM   2602 C  CA    . MET A 1 339 ? -31.281 -48.809 8.199   1.00 30.90  ?  339 MET A CA    1 
ATOM   2603 C  C     . MET A 1 339 ? -30.088 -49.040 9.136   1.00 34.09  ?  339 MET A C     1 
ATOM   2604 O  O     . MET A 1 339 ? -29.539 -48.071 9.733   1.00 34.27  ?  339 MET A O     1 
ATOM   2605 C  CB    . MET A 1 339 ? -32.545 -49.374 8.843   1.00 33.31  ?  339 MET A CB    1 
ATOM   2606 C  CG    . MET A 1 339 ? -33.850 -48.772 8.348   1.00 35.62  ?  339 MET A CG    1 
ATOM   2607 S  SD    . MET A 1 339 ? -33.929 -46.985 8.629   1.00 40.18  ?  339 MET A SD    1 
ATOM   2608 C  CE    . MET A 1 339 ? -33.935 -46.947 10.417  1.00 39.88  ?  339 MET A CE    1 
ATOM   2609 N  N     . SER A 1 340 ? -29.644 -50.289 9.215   1.00 30.09  ?  340 SER A N     1 
ATOM   2610 C  CA    . SER A 1 340 ? -28.554 -50.719 10.118  1.00 29.48  ?  340 SER A CA    1 
ATOM   2611 C  C     . SER A 1 340 ? -27.284 -49.903 9.824   1.00 28.99  ?  340 SER A C     1 
ATOM   2612 O  O     . SER A 1 340 ? -26.603 -49.513 10.776  1.00 37.87  ?  340 SER A O     1 
ATOM   2613 C  CB    . SER A 1 340 ? -28.346 -52.183 9.975   1.00 29.97  ?  340 SER A CB    1 
ATOM   2614 O  OG    . SER A 1 340 ? -27.345 -52.616 10.817  1.00 39.27  ?  340 SER A OG    1 
ATOM   2615 N  N     . GLY A 1 341 ? -27.007 -49.627 8.553   1.00 26.38  ?  341 GLY A N     1 
ATOM   2616 C  CA    . GLY A 1 341 ? -25.798 -48.922 8.129   1.00 28.19  ?  341 GLY A CA    1 
ATOM   2617 C  C     . GLY A 1 341 ? -25.852 -47.437 8.410   1.00 29.55  ?  341 GLY A C     1 
ATOM   2618 O  O     . GLY A 1 341 ? -24.782 -46.819 8.342   1.00 36.30  ?  341 GLY A O     1 
ATOM   2619 N  N     . ASN A 1 342 ? -27.029 -46.879 8.728   1.00 31.10  ?  342 ASN A N     1 
ATOM   2620 C  CA    . ASN A 1 342 ? -27.202 -45.401 8.801   1.00 31.25  ?  342 ASN A CA    1 
ATOM   2621 C  C     . ASN A 1 342 ? -27.766 -44.923 10.129  1.00 29.64  ?  342 ASN A C     1 
ATOM   2622 O  O     . ASN A 1 342 ? -28.086 -43.763 10.197  1.00 31.85  ?  342 ASN A O     1 
ATOM   2623 C  CB    . ASN A 1 342 ? -28.046 -44.908 7.627   1.00 35.19  ?  342 ASN A CB    1 
ATOM   2624 C  CG    . ASN A 1 342 ? -27.325 -45.122 6.314   1.00 34.98  ?  342 ASN A CG    1 
ATOM   2625 O  OD1   . ASN A 1 342 ? -26.505 -44.266 5.951   1.00 32.00  ?  342 ASN A OD1   1 
ATOM   2626 N  ND2   . ASN A 1 342 ? -27.602 -46.260 5.655   1.00 26.87  ?  342 ASN A ND2   1 
ATOM   2627 N  N     . THR A 1 343 ? -27.880 -45.780 11.145  1.00 32.10  ?  343 THR A N     1 
ATOM   2628 C  CA    . THR A 1 343 ? -28.301 -45.384 12.517  1.00 26.27  ?  343 THR A CA    1 
ATOM   2629 C  C     . THR A 1 343 ? -27.383 -46.043 13.542  1.00 27.25  ?  343 THR A C     1 
ATOM   2630 O  O     . THR A 1 343 ? -26.862 -47.153 13.289  1.00 28.70  ?  343 THR A O     1 
ATOM   2631 C  CB    . THR A 1 343 ? -29.780 -45.673 12.782  1.00 30.31  ?  343 THR A CB    1 
ATOM   2632 O  OG1   . THR A 1 343 ? -30.120 -45.081 14.030  1.00 33.86  ?  343 THR A OG1   1 
ATOM   2633 C  CG2   . THR A 1 343 ? -30.144 -47.140 12.826  1.00 28.14  ?  343 THR A CG2   1 
ATOM   2634 N  N     . ALA A 1 344 ? -27.172 -45.353 14.652  1.00 27.62  ?  344 ALA A N     1 
ATOM   2635 C  CA    . ALA A 1 344 ? -26.482 -45.891 15.840  1.00 29.22  ?  344 ALA A CA    1 
ATOM   2636 C  C     . ALA A 1 344 ? -27.467 -46.669 16.710  1.00 26.62  ?  344 ALA A C     1 
ATOM   2637 O  O     . ALA A 1 344 ? -27.002 -47.450 17.559  1.00 27.90  ?  344 ALA A O     1 
ATOM   2638 C  CB    . ALA A 1 344 ? -25.807 -44.774 16.591  1.00 31.13  ?  344 ALA A CB    1 
ATOM   2639 N  N     . TYR A 1 345 ? -28.773 -46.536 16.479  1.00 27.47  ?  345 TYR A N     1 
ATOM   2640 C  CA    . TYR A 1 345 ? -29.789 -47.306 17.256  1.00 30.51  ?  345 TYR A CA    1 
ATOM   2641 C  C     . TYR A 1 345 ? -29.824 -48.747 16.752  1.00 28.46  ?  345 TYR A C     1 
ATOM   2642 O  O     . TYR A 1 345 ? -29.493 -49.027 15.607  1.00 29.67  ?  345 TYR A O     1 
ATOM   2643 C  CB    . TYR A 1 345 ? -31.179 -46.675 17.154  1.00 32.05  ?  345 TYR A CB    1 
ATOM   2644 C  CG    . TYR A 1 345 ? -31.381 -45.395 17.928  1.00 32.27  ?  345 TYR A CG    1 
ATOM   2645 C  CD1   . TYR A 1 345 ? -30.557 -45.030 18.982  1.00 32.32  ?  345 TYR A CD1   1 
ATOM   2646 C  CD2   . TYR A 1 345 ? -32.449 -44.574 17.640  1.00 33.65  ?  345 TYR A CD2   1 
ATOM   2647 C  CE1   . TYR A 1 345 ? -30.763 -43.867 19.704  1.00 31.91  ?  345 TYR A CE1   1 
ATOM   2648 C  CE2   . TYR A 1 345 ? -32.681 -43.412 18.368  1.00 36.91  ?  345 TYR A CE2   1 
ATOM   2649 C  CZ    . TYR A 1 345 ? -31.833 -43.048 19.397  1.00 33.64  ?  345 TYR A CZ    1 
ATOM   2650 O  OH    . TYR A 1 345 ? -32.073 -41.894 20.086  1.00 34.78  ?  345 TYR A OH    1 
ATOM   2651 N  N     . PRO A 1 346 ? -30.280 -49.705 17.560  1.00 25.28  ?  346 PRO A N     1 
ATOM   2652 C  CA    . PRO A 1 346 ? -30.367 -51.084 17.104  1.00 28.65  ?  346 PRO A CA    1 
ATOM   2653 C  C     . PRO A 1 346 ? -31.420 -51.277 16.006  1.00 30.30  ?  346 PRO A C     1 
ATOM   2654 O  O     . PRO A 1 346 ? -32.451 -50.621 16.071  1.00 27.35  ?  346 PRO A O     1 
ATOM   2655 C  CB    . PRO A 1 346 ? -30.841 -51.854 18.339  1.00 31.44  ?  346 PRO A CB    1 
ATOM   2656 C  CG    . PRO A 1 346 ? -30.672 -50.891 19.509  1.00 25.95  ?  346 PRO A CG    1 
ATOM   2657 C  CD    . PRO A 1 346 ? -30.830 -49.522 18.902  1.00 27.65  ?  346 PRO A CD    1 
ATOM   2658 N  N     . VAL A 1 347 ? -31.134 -52.173 15.050  1.00 30.71  ?  347 VAL A N     1 
ATOM   2659 C  CA    . VAL A 1 347 ? -32.106 -52.622 14.012  1.00 28.05  ?  347 VAL A CA    1 
ATOM   2660 C  C     . VAL A 1 347 ? -32.274 -54.134 14.095  1.00 27.16  ?  347 VAL A C     1 
ATOM   2661 O  O     . VAL A 1 347 ? -31.264 -54.875 14.177  1.00 31.48  ?  347 VAL A O     1 
ATOM   2662 C  CB    . VAL A 1 347 ? -31.654 -52.190 12.613  1.00 29.38  ?  347 VAL A CB    1 
ATOM   2663 C  CG1   . VAL A 1 347 ? -32.681 -52.614 11.569  1.00 29.37  ?  347 VAL A CG1   1 
ATOM   2664 C  CG2   . VAL A 1 347 ? -31.433 -50.681 12.552  1.00 29.98  ?  347 VAL A CG2   1 
ATOM   2665 N  N     . ILE A 1 348 ? -33.517 -54.583 14.074  1.00 28.75  ?  348 ILE A N     1 
ATOM   2666 C  CA    . ILE A 1 348 ? -33.893 -56.035 14.067  1.00 31.27  ?  348 ILE A CA    1 
ATOM   2667 C  C     . ILE A 1 348 ? -34.623 -56.271 12.740  1.00 30.60  ?  348 ILE A C     1 
ATOM   2668 O  O     . ILE A 1 348 ? -35.604 -55.542 12.463  1.00 30.73  ?  348 ILE A O     1 
ATOM   2669 C  CB    . ILE A 1 348 ? -34.804 -56.391 15.255  1.00 32.37  ?  348 ILE A CB    1 
ATOM   2670 C  CG1   . ILE A 1 348 ? -34.157 -56.066 16.604  1.00 32.99  ?  348 ILE A CG1   1 
ATOM   2671 C  CG2   . ILE A 1 348 ? -35.217 -57.845 15.164  1.00 34.50  ?  348 ILE A CG2   1 
ATOM   2672 C  CD1   . ILE A 1 348 ? -35.139 -56.069 17.774  1.00 32.56  ?  348 ILE A CD1   1 
ATOM   2673 N  N     . SER A 1 349 ? -34.125 -57.185 11.921  1.00 27.30  ?  349 SER A N     1 
ATOM   2674 C  CA    . SER A 1 349 ? -34.886 -57.691 10.757  1.00 34.26  ?  349 SER A CA    1 
ATOM   2675 C  C     . SER A 1 349 ? -35.835 -58.778 11.278  1.00 33.95  ?  349 SER A C     1 
ATOM   2676 O  O     . SER A 1 349 ? -35.360 -59.735 11.901  1.00 34.50  ?  349 SER A O     1 
ATOM   2677 C  CB    . SER A 1 349 ? -33.989 -58.190 9.633   1.00 34.78  ?  349 SER A CB    1 
ATOM   2678 O  OG    . SER A 1 349 ? -33.360 -57.092 8.979   1.00 31.80  ?  349 SER A OG    1 
ATOM   2679 N  N     . CYS A 1 350 ? -37.133 -58.589 11.075  1.00 34.86  ?  350 CYS A N     1 
ATOM   2680 C  CA    . CYS A 1 350 ? -38.153 -59.641 11.289  1.00 35.24  ?  350 CYS A CA    1 
ATOM   2681 C  C     . CYS A 1 350 ? -38.878 -59.858 9.968   1.00 30.25  ?  350 CYS A C     1 
ATOM   2682 O  O     . CYS A 1 350 ? -39.949 -59.309 9.737   1.00 29.96  ?  350 CYS A O     1 
ATOM   2683 C  CB    . CYS A 1 350 ? -39.102 -59.271 12.417  1.00 35.29  ?  350 CYS A CB    1 
ATOM   2684 S  SG    . CYS A 1 350 ? -40.275 -60.610 12.731  1.00 38.49  ?  350 CYS A SG    1 
ATOM   2685 N  N     . PRO A 1 351 ? -38.274 -60.632 9.049   1.00 29.95  ?  351 PRO A N     1 
ATOM   2686 C  CA    . PRO A 1 351 ? -38.844 -60.830 7.719   1.00 34.71  ?  351 PRO A CA    1 
ATOM   2687 C  C     . PRO A 1 351 ? -40.071 -61.742 7.760   1.00 39.36  ?  351 PRO A C     1 
ATOM   2688 O  O     . PRO A 1 351 ? -40.111 -62.706 8.530   1.00 38.80  ?  351 PRO A O     1 
ATOM   2689 C  CB    . PRO A 1 351 ? -37.694 -61.477 6.942   1.00 33.92  ?  351 PRO A CB    1 
ATOM   2690 C  CG    . PRO A 1 351 ? -36.905 -62.214 8.005   1.00 32.78  ?  351 PRO A CG    1 
ATOM   2691 C  CD    . PRO A 1 351 ? -37.006 -61.354 9.235   1.00 31.40  ?  351 PRO A CD    1 
ATOM   2692 N  N     . PRO A 1 352 ? -41.122 -61.444 6.957   1.00 43.88  ?  352 PRO A N     1 
ATOM   2693 C  CA    . PRO A 1 352 ? -42.331 -62.270 6.913   1.00 41.61  ?  352 PRO A CA    1 
ATOM   2694 C  C     . PRO A 1 352 ? -42.129 -63.505 6.023   1.00 39.50  ?  352 PRO A C     1 
ATOM   2695 O  O     . PRO A 1 352 ? -42.766 -63.567 4.995   1.00 47.94  ?  352 PRO A O     1 
ATOM   2696 C  CB    . PRO A 1 352 ? -43.349 -61.289 6.321   1.00 43.89  ?  352 PRO A CB    1 
ATOM   2697 C  CG    . PRO A 1 352 ? -42.525 -60.505 5.315   1.00 46.28  ?  352 PRO A CG    1 
ATOM   2698 C  CD    . PRO A 1 352 ? -41.192 -60.311 6.011   1.00 48.66  ?  352 PRO A CD    1 
ATOM   2699 N  N     . LEU A 1 353 ? -41.283 -64.444 6.472   1.00 40.05  ?  353 LEU A N     1 
ATOM   2700 C  CA    . LEU A 1 353 ? -40.969 -65.716 5.775   1.00 41.76  ?  353 LEU A CA    1 
ATOM   2701 C  C     . LEU A 1 353 ? -42.206 -66.613 5.776   1.00 48.67  ?  353 LEU A C     1 
ATOM   2702 O  O     . LEU A 1 353 ? -42.863 -66.721 6.860   1.00 49.70  ?  353 LEU A O     1 
ATOM   2703 C  CB    . LEU A 1 353 ? -39.837 -66.432 6.511   1.00 40.45  ?  353 LEU A CB    1 
ATOM   2704 C  CG    . LEU A 1 353 ? -38.549 -65.641 6.706   1.00 43.30  ?  353 LEU A CG    1 
ATOM   2705 C  CD1   . LEU A 1 353 ? -37.504 -66.537 7.371   1.00 42.21  ?  353 LEU A CD1   1 
ATOM   2706 C  CD2   . LEU A 1 353 ? -38.038 -65.081 5.362   1.00 42.71  ?  353 LEU A CD2   1 
ATOM   2707 N  N     . THR A 1 354 ? -42.499 -67.231 4.627   1.00 46.09  ?  354 THR A N     1 
ATOM   2708 C  CA    . THR A 1 354 ? -43.438 -68.384 4.504   1.00 44.57  ?  354 THR A CA    1 
ATOM   2709 C  C     . THR A 1 354 ? -42.611 -69.594 4.049   1.00 42.78  ?  354 THR A C     1 
ATOM   2710 O  O     . THR A 1 354 ? -41.452 -69.423 3.616   1.00 31.75  ?  354 THR A O     1 
ATOM   2711 C  CB    . THR A 1 354 ? -44.627 -68.020 3.603   1.00 45.57  ?  354 THR A CB    1 
ATOM   2712 O  OG1   . THR A 1 354 ? -44.182 -68.129 2.252   1.00 46.62  ?  354 THR A OG1   1 
ATOM   2713 C  CG2   . THR A 1 354 ? -45.196 -66.638 3.869   1.00 42.64  ?  354 THR A CG2   1 
ATOM   2714 N  N     . PRO A 1 355 ? -43.141 -70.843 4.154   1.00 38.98  ?  355 PRO A N     1 
ATOM   2715 C  CA    . PRO A 1 355 ? -42.409 -72.036 3.707   1.00 47.08  ?  355 PRO A CA    1 
ATOM   2716 C  C     . PRO A 1 355 ? -42.073 -72.117 2.200   1.00 45.90  ?  355 PRO A C     1 
ATOM   2717 O  O     . PRO A 1 355 ? -41.253 -72.926 1.806   1.00 42.81  ?  355 PRO A O     1 
ATOM   2718 C  CB    . PRO A 1 355 ? -43.353 -73.207 4.089   1.00 49.71  ?  355 PRO A CB    1 
ATOM   2719 C  CG    . PRO A 1 355 ? -44.200 -72.621 5.205   1.00 46.73  ?  355 PRO A CG    1 
ATOM   2720 C  CD    . PRO A 1 355 ? -44.436 -71.194 4.757   1.00 41.80  ?  355 PRO A CD    1 
ATOM   2721 N  N     . ASP A 1 356 ? -42.684 -71.268 1.379   1.00 47.61  ?  356 ASP A N     1 
ATOM   2722 C  CA    . ASP A 1 356 ? -42.517 -71.303 -0.097  1.00 51.33  ?  356 ASP A CA    1 
ATOM   2723 C  C     . ASP A 1 356 ? -41.064 -70.931 -0.450  1.00 42.21  ?  356 ASP A C     1 
ATOM   2724 O  O     . ASP A 1 356 ? -40.414 -71.699 -1.164  1.00 36.08  ?  356 ASP A O     1 
ATOM   2725 C  CB    . ASP A 1 356 ? -43.597 -70.435 -0.768  1.00 50.69  ?  356 ASP A CB    1 
ATOM   2726 C  CG    . ASP A 1 356 ? -44.987 -71.080 -0.824  1.00 55.27  ?  356 ASP A CG    1 
ATOM   2727 O  OD1   . ASP A 1 356 ? -45.119 -72.332 -0.617  1.00 49.54  ?  356 ASP A OD1   1 
ATOM   2728 O  OD2   . ASP A 1 356 ? -45.948 -70.331 -1.081  1.00 60.83  ?  356 ASP A OD2   1 
ATOM   2729 N  N     . TRP A 1 357 ? -40.601 -69.761 -0.005  1.00 39.08  ?  357 TRP A N     1 
ATOM   2730 C  CA    . TRP A 1 357 ? -39.287 -69.169 -0.387  1.00 37.28  ?  357 TRP A CA    1 
ATOM   2731 C  C     . TRP A 1 357 ? -38.481 -68.696 0.843   1.00 38.59  ?  357 TRP A C     1 
ATOM   2732 O  O     . TRP A 1 357 ? -37.460 -68.034 0.650   1.00 37.26  ?  357 TRP A O     1 
ATOM   2733 C  CB    . TRP A 1 357 ? -39.536 -68.026 -1.362  1.00 38.00  ?  357 TRP A CB    1 
ATOM   2734 C  CG    . TRP A 1 357 ? -40.218 -68.458 -2.626  1.00 43.33  ?  357 TRP A CG    1 
ATOM   2735 C  CD1   . TRP A 1 357 ? -41.525 -68.247 -2.965  1.00 50.48  ?  357 TRP A CD1   1 
ATOM   2736 C  CD2   . TRP A 1 357 ? -39.625 -69.149 -3.744  1.00 44.19  ?  357 TRP A CD2   1 
ATOM   2737 N  NE1   . TRP A 1 357 ? -41.798 -68.777 -4.200  1.00 52.60  ?  357 TRP A NE1   1 
ATOM   2738 C  CE2   . TRP A 1 357 ? -40.646 -69.323 -4.709  1.00 53.71  ?  357 TRP A CE2   1 
ATOM   2739 C  CE3   . TRP A 1 357 ? -38.336 -69.613 -4.030  1.00 44.31  ?  357 TRP A CE3   1 
ATOM   2740 C  CZ2   . TRP A 1 357 ? -40.414 -69.956 -5.931  1.00 46.69  ?  357 TRP A CZ2   1 
ATOM   2741 C  CZ3   . TRP A 1 357 ? -38.110 -70.254 -5.225  1.00 48.61  ?  357 TRP A CZ3   1 
ATOM   2742 C  CH2   . TRP A 1 357 ? -39.139 -70.421 -6.158  1.00 51.75  ?  357 TRP A CH2   1 
ATOM   2743 N  N     . GLY A 1 358 ? -38.924 -69.017 2.067   1.00 37.46  ?  358 GLY A N     1 
ATOM   2744 C  CA    . GLY A 1 358 ? -38.355 -68.485 3.321   1.00 37.27  ?  358 GLY A CA    1 
ATOM   2745 C  C     . GLY A 1 358 ? -36.930 -68.955 3.535   1.00 36.78  ?  358 GLY A C     1 
ATOM   2746 O  O     . GLY A 1 358 ? -36.104 -68.132 3.974   1.00 35.46  ?  358 GLY A O     1 
ATOM   2747 N  N     . VAL A 1 359 ? -36.641 -70.214 3.204   1.00 35.73  ?  359 VAL A N     1 
ATOM   2748 C  CA    . VAL A 1 359 ? -35.265 -70.796 3.251   1.00 41.15  ?  359 VAL A CA    1 
ATOM   2749 C  C     . VAL A 1 359 ? -34.319 -69.943 2.373   1.00 45.97  ?  359 VAL A C     1 
ATOM   2750 O  O     . VAL A 1 359 ? -33.124 -69.830 2.712   1.00 49.73  ?  359 VAL A O     1 
ATOM   2751 C  CB    . VAL A 1 359 ? -35.260 -72.279 2.813   1.00 41.49  ?  359 VAL A CB    1 
ATOM   2752 C  CG1   . VAL A 1 359 ? -33.850 -72.833 2.714   1.00 39.65  ?  359 VAL A CG1   1 
ATOM   2753 C  CG2   . VAL A 1 359 ? -36.130 -73.161 3.709   1.00 45.89  ?  359 VAL A CG2   1 
ATOM   2754 N  N     . GLN A 1 360 ? -34.803 -69.384 1.268   1.00 41.48  ?  360 GLN A N     1 
ATOM   2755 C  CA    . GLN A 1 360 ? -33.969 -68.603 0.302   1.00 46.84  ?  360 GLN A CA    1 
ATOM   2756 C  C     . GLN A 1 360 ? -33.858 -67.131 0.756   1.00 42.05  ?  360 GLN A C     1 
ATOM   2757 O  O     . GLN A 1 360 ? -32.733 -66.599 0.762   1.00 40.95  ?  360 GLN A O     1 
ATOM   2758 C  CB    . GLN A 1 360 ? -34.529 -68.708 -1.127  1.00 43.21  ?  360 GLN A CB    1 
ATOM   2759 C  CG    . GLN A 1 360 ? -34.303 -70.087 -1.747  1.00 45.42  ?  360 GLN A CG    1 
ATOM   2760 C  CD    . GLN A 1 360 ? -35.192 -71.189 -1.194  1.00 42.00  ?  360 GLN A CD    1 
ATOM   2761 O  OE1   . GLN A 1 360 ? -36.401 -71.015 -1.055  1.00 38.59  ?  360 GLN A OE1   1 
ATOM   2762 N  NE2   . GLN A 1 360 ? -34.595 -72.343 -0.897  1.00 33.60  ?  360 GLN A NE2   1 
ATOM   2763 N  N     . ASP A 1 361 ? -34.972 -66.541 1.201   1.00 39.11  ?  361 ASP A N     1 
ATOM   2764 C  CA    . ASP A 1 361 ? -35.102 -65.100 1.537   1.00 40.82  ?  361 ASP A CA    1 
ATOM   2765 C  C     . ASP A 1 361 ? -34.324 -64.718 2.803   1.00 37.86  ?  361 ASP A C     1 
ATOM   2766 O  O     . ASP A 1 361 ? -33.802 -63.580 2.817   1.00 40.72  ?  361 ASP A O     1 
ATOM   2767 C  CB    . ASP A 1 361 ? -36.577 -64.729 1.685   1.00 47.86  ?  361 ASP A CB    1 
ATOM   2768 C  CG    . ASP A 1 361 ? -37.342 -64.688 0.368   1.00 49.24  ?  361 ASP A CG    1 
ATOM   2769 O  OD1   . ASP A 1 361 ? -36.683 -64.525 -0.718  1.00 52.19  ?  361 ASP A OD1   1 
ATOM   2770 O  OD2   . ASP A 1 361 ? -38.576 -64.793 0.436   1.00 49.59  ?  361 ASP A OD2   1 
ATOM   2771 N  N     . VAL A 1 362 ? -34.249 -65.613 3.799   1.00 32.15  ?  362 VAL A N     1 
ATOM   2772 C  CA    . VAL A 1 362 ? -33.667 -65.364 5.158   1.00 33.84  ?  362 VAL A CA    1 
ATOM   2773 C  C     . VAL A 1 362 ? -32.194 -64.931 5.049   1.00 35.39  ?  362 VAL A C     1 
ATOM   2774 O  O     . VAL A 1 362 ? -31.765 -64.111 5.874   1.00 35.21  ?  362 VAL A O     1 
ATOM   2775 C  CB    . VAL A 1 362 ? -33.793 -66.588 6.081   1.00 32.27  ?  362 VAL A CB    1 
ATOM   2776 C  CG1   . VAL A 1 362 ? -32.823 -67.701 5.693   1.00 33.31  ?  362 VAL A CG1   1 
ATOM   2777 C  CG2   . VAL A 1 362 ? -33.615 -66.200 7.536   1.00 32.43  ?  362 VAL A CG2   1 
ATOM   2778 N  N     . TRP A 1 363 ? -31.450 -65.444 4.069   1.00 34.62  ?  363 TRP A N     1 
ATOM   2779 C  CA    . TRP A 1 363 ? -29.999 -65.172 3.924   1.00 34.21  ?  363 TRP A CA    1 
ATOM   2780 C  C     . TRP A 1 363 ? -29.737 -63.678 3.612   1.00 32.46  ?  363 TRP A C     1 
ATOM   2781 O  O     . TRP A 1 363 ? -28.671 -63.177 3.972   1.00 32.62  ?  363 TRP A O     1 
ATOM   2782 C  CB    . TRP A 1 363 ? -29.369 -66.148 2.931   1.00 34.25  ?  363 TRP A CB    1 
ATOM   2783 C  CG    . TRP A 1 363 ? -29.329 -67.542 3.489   1.00 38.85  ?  363 TRP A CG    1 
ATOM   2784 C  CD1   . TRP A 1 363 ? -30.199 -68.573 3.251   1.00 36.38  ?  363 TRP A CD1   1 
ATOM   2785 C  CD2   . TRP A 1 363 ? -28.392 -68.041 4.467   1.00 42.03  ?  363 TRP A CD2   1 
ATOM   2786 N  NE1   . TRP A 1 363 ? -29.853 -69.682 3.982   1.00 36.11  ?  363 TRP A NE1   1 
ATOM   2787 C  CE2   . TRP A 1 363 ? -28.749 -69.388 4.734   1.00 37.14  ?  363 TRP A CE2   1 
ATOM   2788 C  CE3   . TRP A 1 363 ? -27.263 -67.490 5.090   1.00 38.49  ?  363 TRP A CE3   1 
ATOM   2789 C  CZ2   . TRP A 1 363 ? -28.025 -70.179 5.610   1.00 35.01  ?  363 TRP A CZ2   1 
ATOM   2790 C  CZ3   . TRP A 1 363 ? -26.537 -68.283 5.949   1.00 38.24  ?  363 TRP A CZ3   1 
ATOM   2791 C  CH2   . TRP A 1 363 ? -26.921 -69.604 6.200   1.00 40.20  ?  363 TRP A CH2   1 
ATOM   2792 N  N     . SER A 1 364 ? -30.676 -62.953 3.032   1.00 31.26  ?  364 SER A N     1 
ATOM   2793 C  CA    . SER A 1 364 ? -30.518 -61.504 2.753   1.00 32.24  ?  364 SER A CA    1 
ATOM   2794 C  C     . SER A 1 364 ? -30.566 -60.690 4.054   1.00 35.71  ?  364 SER A C     1 
ATOM   2795 O  O     . SER A 1 364 ? -30.128 -59.545 4.023   1.00 37.37  ?  364 SER A O     1 
ATOM   2796 C  CB    . SER A 1 364 ? -31.587 -61.025 1.766   1.00 34.14  ?  364 SER A CB    1 
ATOM   2797 O  OG    . SER A 1 364 ? -32.894 -61.115 2.336   1.00 34.02  ?  364 SER A OG    1 
ATOM   2798 N  N     . SER A 1 365 ? -31.129 -61.243 5.141   1.00 38.80  ?  365 SER A N     1 
ATOM   2799 C  CA    . SER A 1 365 ? -31.105 -60.664 6.519   1.00 40.37  ?  365 SER A CA    1 
ATOM   2800 C  C     . SER A 1 365 ? -29.823 -61.057 7.274   1.00 37.87  ?  365 SER A C     1 
ATOM   2801 O  O     . SER A 1 365 ? -29.365 -60.234 8.092   1.00 43.25  ?  365 SER A O     1 
ATOM   2802 C  CB    . SER A 1 365 ? -32.342 -61.068 7.309   1.00 35.88  ?  365 SER A CB    1 
ATOM   2803 O  OG    . SER A 1 365 ? -33.514 -60.581 6.670   1.00 34.19  ?  365 SER A OG    1 
ATOM   2804 N  N     . LEU A 1 366 ? -29.295 -62.257 7.005   1.00 38.37  ?  366 LEU A N     1 
ATOM   2805 C  CA    . LEU A 1 366 ? -28.231 -62.939 7.797   1.00 37.95  ?  366 LEU A CA    1 
ATOM   2806 C  C     . LEU A 1 366 ? -26.811 -62.612 7.324   1.00 42.54  ?  366 LEU A C     1 
ATOM   2807 O  O     . LEU A 1 366 ? -25.943 -62.505 8.195   1.00 44.10  ?  366 LEU A O     1 
ATOM   2808 C  CB    . LEU A 1 366 ? -28.422 -64.445 7.709   1.00 39.74  ?  366 LEU A CB    1 
ATOM   2809 C  CG    . LEU A 1 366 ? -29.633 -64.988 8.466   1.00 44.18  ?  366 LEU A CG    1 
ATOM   2810 C  CD1   . LEU A 1 366 ? -29.788 -66.475 8.151   1.00 41.76  ?  366 LEU A CD1   1 
ATOM   2811 C  CD2   . LEU A 1 366 ? -29.513 -64.706 9.973   1.00 41.90  ?  366 LEU A CD2   1 
ATOM   2812 N  N     . ARG A 1 367 ? -26.545 -62.568 6.014   1.00 46.11  ?  367 ARG A N     1 
ATOM   2813 C  CA    . ARG A 1 367 ? -25.153 -62.441 5.496   1.00 47.02  ?  367 ARG A CA    1 
ATOM   2814 C  C     . ARG A 1 367 ? -24.978 -61.010 4.994   1.00 41.98  ?  367 ARG A C     1 
ATOM   2815 O  O     . ARG A 1 367 ? -25.457 -60.720 3.901   1.00 41.04  ?  367 ARG A O     1 
ATOM   2816 C  CB    . ARG A 1 367 ? -24.835 -63.518 4.449   1.00 45.42  ?  367 ARG A CB    1 
ATOM   2817 C  CG    . ARG A 1 367 ? -24.303 -64.803 5.052   1.00 41.49  ?  367 ARG A CG    1 
ATOM   2818 C  CD    . ARG A 1 367 ? -23.987 -65.867 4.023   1.00 44.29  ?  367 ARG A CD    1 
ATOM   2819 N  NE    . ARG A 1 367 ? -23.045 -65.413 3.003   1.00 48.61  ?  367 ARG A NE    1 
ATOM   2820 C  CZ    . ARG A 1 367 ? -21.734 -65.207 3.190   1.00 52.32  ?  367 ARG A CZ    1 
ATOM   2821 N  NH1   . ARG A 1 367 ? -21.174 -65.431 4.372   1.00 57.48  ?  367 ARG A NH1   1 
ATOM   2822 N  NH2   . ARG A 1 367 ? -20.973 -64.825 2.179   1.00 48.84  ?  367 ARG A NH2   1 
ATOM   2823 N  N     . LEU A 1 368 ? -24.339 -60.174 5.806   1.00 39.87  ?  368 LEU A N     1 
ATOM   2824 C  CA    . LEU A 1 368 ? -24.258 -58.706 5.613   1.00 50.96  ?  368 LEU A CA    1 
ATOM   2825 C  C     . LEU A 1 368 ? -22.799 -58.289 5.423   1.00 46.22  ?  368 LEU A C     1 
ATOM   2826 O  O     . LEU A 1 368 ? -21.897 -58.979 5.870   1.00 48.67  ?  368 LEU A O     1 
ATOM   2827 C  CB    . LEU A 1 368 ? -24.909 -58.021 6.828   1.00 53.02  ?  368 LEU A CB    1 
ATOM   2828 C  CG    . LEU A 1 368 ? -26.320 -58.499 7.184   1.00 50.52  ?  368 LEU A CG    1 
ATOM   2829 C  CD1   . LEU A 1 368 ? -26.915 -57.654 8.285   1.00 47.90  ?  368 LEU A CD1   1 
ATOM   2830 C  CD2   . LEU A 1 368 ? -27.242 -58.451 5.973   1.00 54.11  ?  368 LEU A CD2   1 
ATOM   2831 N  N     . PRO A 1 369 ? -22.511 -57.180 4.702   1.00 48.49  ?  369 PRO A N     1 
ATOM   2832 C  CA    . PRO A 1 369 ? -21.148 -56.657 4.639   1.00 48.42  ?  369 PRO A CA    1 
ATOM   2833 C  C     . PRO A 1 369 ? -20.670 -56.259 6.031   1.00 49.70  ?  369 PRO A C     1 
ATOM   2834 O  O     . PRO A 1 369 ? -21.524 -56.064 6.896   1.00 49.83  ?  369 PRO A O     1 
ATOM   2835 C  CB    . PRO A 1 369 ? -21.200 -55.431 3.724   1.00 53.19  ?  369 PRO A CB    1 
ATOM   2836 C  CG    . PRO A 1 369 ? -22.667 -55.170 3.507   1.00 58.02  ?  369 PRO A CG    1 
ATOM   2837 C  CD    . PRO A 1 369 ? -23.431 -56.450 3.819   1.00 50.74  ?  369 PRO A CD    1 
ATOM   2838 N  N     . SER A 1 370 ? -19.347 -56.183 6.216   1.00 46.76  ?  370 SER A N     1 
ATOM   2839 C  CA    . SER A 1 370 ? -18.723 -55.798 7.508   1.00 51.85  ?  370 SER A CA    1 
ATOM   2840 C  C     . SER A 1 370 ? -19.196 -54.387 7.870   1.00 46.20  ?  370 SER A C     1 
ATOM   2841 O  O     . SER A 1 370 ? -19.544 -53.636 6.945   1.00 51.11  ?  370 SER A O     1 
ATOM   2842 C  CB    . SER A 1 370 ? -17.229 -55.904 7.451   1.00 54.92  ?  370 SER A CB    1 
ATOM   2843 O  OG    . SER A 1 370 ? -16.712 -54.847 6.661   1.00 62.61  ?  370 SER A OG    1 
ATOM   2844 N  N     . GLY A 1 371 ? -19.261 -54.060 9.157   1.00 42.95  ?  371 GLY A N     1 
ATOM   2845 C  CA    . GLY A 1 371 ? -19.646 -52.712 9.622   1.00 47.29  ?  371 GLY A CA    1 
ATOM   2846 C  C     . GLY A 1 371 ? -21.144 -52.544 9.824   1.00 44.79  ?  371 GLY A C     1 
ATOM   2847 O  O     . GLY A 1 371 ? -21.576 -51.375 9.981   1.00 55.59  ?  371 GLY A O     1 
ATOM   2848 N  N     . LEU A 1 372 ? -21.904 -53.643 9.808   1.00 43.95  ?  372 LEU A N     1 
ATOM   2849 C  CA    . LEU A 1 372 ? -23.387 -53.701 10.024  1.00 49.41  ?  372 LEU A CA    1 
ATOM   2850 C  C     . LEU A 1 372 ? -23.688 -54.635 11.216  1.00 55.16  ?  372 LEU A C     1 
ATOM   2851 O  O     . LEU A 1 372 ? -23.210 -55.822 11.237  1.00 52.25  ?  372 LEU A O     1 
ATOM   2852 C  CB    . LEU A 1 372 ? -24.070 -54.220 8.756   1.00 50.81  ?  372 LEU A CB    1 
ATOM   2853 C  CG    . LEU A 1 372 ? -24.572 -53.174 7.769   1.00 51.36  ?  372 LEU A CG    1 
ATOM   2854 C  CD1   . LEU A 1 372 ? -23.479 -52.252 7.304   1.00 51.74  ?  372 LEU A CD1   1 
ATOM   2855 C  CD2   . LEU A 1 372 ? -25.186 -53.854 6.566   1.00 54.25  ?  372 LEU A CD2   1 
ATOM   2856 N  N     . GLY A 1 373 ? -24.418 -54.120 12.207  1.00 48.80  ?  373 GLY A N     1 
ATOM   2857 C  CA    . GLY A 1 373 ? -24.788 -54.856 13.429  1.00 47.07  ?  373 GLY A CA    1 
ATOM   2858 C  C     . GLY A 1 373 ? -26.143 -55.527 13.312  1.00 45.87  ?  373 GLY A C     1 
ATOM   2859 O  O     . GLY A 1 373 ? -26.488 -56.285 14.219  1.00 61.31  ?  373 GLY A O     1 
ATOM   2860 N  N     . CYS A 1 374 ? -26.889 -55.274 12.242  1.00 43.51  ?  374 CYS A N     1 
ATOM   2861 C  CA    . CYS A 1 374 ? -28.289 -55.717 12.054  1.00 47.02  ?  374 CYS A CA    1 
ATOM   2862 C  C     . CYS A 1 374 ? -28.438 -57.160 12.564  1.00 44.27  ?  374 CYS A C     1 
ATOM   2863 O  O     . CYS A 1 374 ? -27.650 -58.040 12.088  1.00 48.18  ?  374 CYS A O     1 
ATOM   2864 C  CB    . CYS A 1 374 ? -28.673 -55.611 10.580  1.00 60.99  ?  374 CYS A CB    1 
ATOM   2865 S  SG    . CYS A 1 374 ? -30.441 -55.872 10.267  1.00 77.35  ?  374 CYS A SG    1 
ATOM   2866 N  N     . SER A 1 375 ? -29.354 -57.386 13.523  1.00 38.20  ?  375 SER A N     1 
ATOM   2867 C  CA    . SER A 1 375 ? -29.717 -58.727 14.070  1.00 39.21  ?  375 SER A CA    1 
ATOM   2868 C  C     . SER A 1 375 ? -30.958 -59.323 13.355  1.00 36.12  ?  375 SER A C     1 
ATOM   2869 O  O     . SER A 1 375 ? -31.733 -58.558 12.756  1.00 34.21  ?  375 SER A O     1 
ATOM   2870 C  CB    . SER A 1 375 ? -29.909 -58.658 15.567  1.00 39.93  ?  375 SER A CB    1 
ATOM   2871 O  OG    . SER A 1 375 ? -31.172 -58.092 15.890  1.00 47.54  ?  375 SER A OG    1 
ATOM   2872 N  N     . THR A 1 376 ? -31.197 -60.629 13.488  1.00 33.29  ?  376 THR A N     1 
ATOM   2873 C  CA    . THR A 1 376 ? -32.377 -61.317 12.908  1.00 36.14  ?  376 THR A CA    1 
ATOM   2874 C  C     . THR A 1 376 ? -33.172 -62.068 13.976  1.00 35.00  ?  376 THR A C     1 
ATOM   2875 O  O     . THR A 1 376 ? -32.585 -62.792 14.780  1.00 32.10  ?  376 THR A O     1 
ATOM   2876 C  CB    . THR A 1 376 ? -31.992 -62.239 11.758  1.00 38.91  ?  376 THR A CB    1 
ATOM   2877 O  OG1   . THR A 1 376 ? -31.161 -61.478 10.886  1.00 47.15  ?  376 THR A OG1   1 
ATOM   2878 C  CG2   . THR A 1 376 ? -33.186 -62.771 11.007  1.00 41.91  ?  376 THR A CG2   1 
ATOM   2879 N  N     . VAL A 1 377 ? -34.486 -61.859 13.967  1.00 36.73  ?  377 VAL A N     1 
ATOM   2880 C  CA    . VAL A 1 377 ? -35.456 -62.619 14.794  1.00 35.40  ?  377 VAL A CA    1 
ATOM   2881 C  C     . VAL A 1 377 ? -36.638 -62.960 13.889  1.00 36.80  ?  377 VAL A C     1 
ATOM   2882 O  O     . VAL A 1 377 ? -37.323 -62.021 13.438  1.00 34.50  ?  377 VAL A O     1 
ATOM   2883 C  CB    . VAL A 1 377 ? -35.886 -61.784 16.008  1.00 36.20  ?  377 VAL A CB    1 
ATOM   2884 C  CG1   . VAL A 1 377 ? -36.735 -62.595 16.986  1.00 39.46  ?  377 VAL A CG1   1 
ATOM   2885 C  CG2   . VAL A 1 377 ? -34.693 -61.198 16.736  1.00 40.72  ?  377 VAL A CG2   1 
ATOM   2886 N  N     . LEU A 1 378 ? -36.877 -64.244 13.665  1.00 36.80  ?  378 LEU A N     1 
ATOM   2887 C  CA    . LEU A 1 378 ? -37.924 -64.724 12.723  1.00 40.20  ?  378 LEU A CA    1 
ATOM   2888 C  C     . LEU A 1 378 ? -39.330 -64.569 13.316  1.00 41.51  ?  378 LEU A C     1 
ATOM   2889 O  O     . LEU A 1 378 ? -40.244 -64.200 12.541  1.00 44.60  ?  378 LEU A O     1 
ATOM   2890 C  CB    . LEU A 1 378 ? -37.630 -66.179 12.356  1.00 38.31  ?  378 LEU A CB    1 
ATOM   2891 C  CG    . LEU A 1 378 ? -36.277 -66.390 11.677  1.00 40.49  ?  378 LEU A CG    1 
ATOM   2892 C  CD1   . LEU A 1 378 ? -36.200 -67.810 11.128  1.00 44.24  ?  378 LEU A CD1   1 
ATOM   2893 C  CD2   . LEU A 1 378 ? -35.999 -65.351 10.596  1.00 35.92  ?  378 LEU A CD2   1 
ATOM   2894 N  N     . SER A 1 379 ? -39.520 -64.811 14.614  1.00 37.46  ?  379 SER A N     1 
ATOM   2895 C  CA    . SER A 1 379 ? -40.868 -64.711 15.240  1.00 39.34  ?  379 SER A CA    1 
ATOM   2896 C  C     . SER A 1 379 ? -41.218 -63.221 15.380  1.00 38.36  ?  379 SER A C     1 
ATOM   2897 O  O     . SER A 1 379 ? -40.412 -62.407 15.825  1.00 33.41  ?  379 SER A O     1 
ATOM   2898 C  CB    . SER A 1 379 ? -40.921 -65.427 16.577  1.00 39.70  ?  379 SER A CB    1 
ATOM   2899 O  OG    . SER A 1 379 ? -42.158 -65.238 17.213  1.00 45.76  ?  379 SER A OG    1 
ATOM   2900 N  N     . PRO A 1 380 ? -42.420 -62.791 14.973  1.00 37.96  ?  380 PRO A N     1 
ATOM   2901 C  CA    . PRO A 1 380 ? -42.844 -61.417 15.224  1.00 37.77  ?  380 PRO A CA    1 
ATOM   2902 C  C     . PRO A 1 380 ? -43.094 -61.130 16.721  1.00 36.70  ?  380 PRO A C     1 
ATOM   2903 O  O     . PRO A 1 380 ? -42.676 -60.092 17.167  1.00 37.28  ?  380 PRO A O     1 
ATOM   2904 C  CB    . PRO A 1 380 ? -44.118 -61.251 14.365  1.00 38.35  ?  380 PRO A CB    1 
ATOM   2905 C  CG    . PRO A 1 380 ? -44.587 -62.673 14.055  1.00 39.51  ?  380 PRO A CG    1 
ATOM   2906 C  CD    . PRO A 1 380 ? -43.397 -63.594 14.218  1.00 40.16  ?  380 PRO A CD    1 
ATOM   2907 N  N     . GLU A 1 381 ? -43.744 -62.022 17.470  1.00 34.97  ?  381 GLU A N     1 
ATOM   2908 C  CA    . GLU A 1 381 ? -43.827 -61.917 18.956  1.00 38.39  ?  381 GLU A CA    1 
ATOM   2909 C  C     . GLU A 1 381 ? -42.399 -61.905 19.540  1.00 35.58  ?  381 GLU A C     1 
ATOM   2910 O  O     . GLU A 1 381 ? -42.110 -61.084 20.416  1.00 40.68  ?  381 GLU A O     1 
ATOM   2911 C  CB    . GLU A 1 381 ? -44.610 -63.075 19.583  1.00 43.32  ?  381 GLU A CB    1 
ATOM   2912 C  CG    . GLU A 1 381 ? -46.098 -63.098 19.235  1.00 52.22  ?  381 GLU A CG    1 
ATOM   2913 C  CD    . GLU A 1 381 ? -46.450 -63.605 17.838  1.00 58.82  ?  381 GLU A CD    1 
ATOM   2914 O  OE1   . GLU A 1 381 ? -45.567 -64.242 17.183  1.00 55.98  ?  381 GLU A OE1   1 
ATOM   2915 O  OE2   . GLU A 1 381 ? -47.599 -63.323 17.373  1.00 60.31  ?  381 GLU A OE2   1 
ATOM   2916 N  N     . GLY A 1 382 ? -41.518 -62.760 19.032  1.00 31.77  ?  382 GLY A N     1 
ATOM   2917 C  CA    . GLY A 1 382 ? -40.093 -62.784 19.414  1.00 33.48  ?  382 GLY A CA    1 
ATOM   2918 C  C     . GLY A 1 382 ? -39.366 -61.443 19.230  1.00 34.31  ?  382 GLY A C     1 
ATOM   2919 O  O     . GLY A 1 382 ? -38.497 -61.093 20.060  1.00 37.75  ?  382 GLY A O     1 
ATOM   2920 N  N     . SER A 1 383 ? -39.647 -60.709 18.168  1.00 31.55  ?  383 SER A N     1 
ATOM   2921 C  CA    . SER A 1 383 ? -38.917 -59.457 17.857  1.00 32.73  ?  383 SER A CA    1 
ATOM   2922 C  C     . SER A 1 383 ? -39.363 -58.407 18.867  1.00 29.01  ?  383 SER A C     1 
ATOM   2923 O  O     . SER A 1 383 ? -38.505 -57.621 19.341  1.00 28.84  ?  383 SER A O     1 
ATOM   2924 C  CB    . SER A 1 383 ? -39.077 -59.042 16.407  1.00 32.18  ?  383 SER A CB    1 
ATOM   2925 O  OG    . SER A 1 383 ? -40.403 -58.640 16.105  1.00 36.20  ?  383 SER A OG    1 
ATOM   2926 N  N     . ALA A 1 384 ? -40.621 -58.479 19.291  1.00 28.93  ?  384 ALA A N     1 
ATOM   2927 C  CA    . ALA A 1 384 ? -41.153 -57.558 20.330  1.00 32.42  ?  384 ALA A CA    1 
ATOM   2928 C  C     . ALA A 1 384 ? -40.445 -57.876 21.647  1.00 31.20  ?  384 ALA A C     1 
ATOM   2929 O  O     . ALA A 1 384 ? -39.911 -56.963 22.304  1.00 33.32  ?  384 ALA A O     1 
ATOM   2930 C  CB    . ALA A 1 384 ? -42.655 -57.671 20.472  1.00 30.95  ?  384 ALA A CB    1 
ATOM   2931 N  N     . GLN A 1 385 ? -40.398 -59.148 21.991  1.00 28.49  ?  385 GLN A N     1 
ATOM   2932 C  CA    . GLN A 1 385 ? -39.746 -59.605 23.234  1.00 32.19  ?  385 GLN A CA    1 
ATOM   2933 C  C     . GLN A 1 385 ? -38.273 -59.182 23.245  1.00 33.30  ?  385 GLN A C     1 
ATOM   2934 O  O     . GLN A 1 385 ? -37.751 -58.766 24.324  1.00 28.48  ?  385 GLN A O     1 
ATOM   2935 C  CB    . GLN A 1 385 ? -39.896 -61.115 23.354  1.00 37.21  ?  385 GLN A CB    1 
ATOM   2936 C  CG    . GLN A 1 385 ? -39.325 -61.686 24.634  1.00 36.05  ?  385 GLN A CG    1 
ATOM   2937 C  CD    . GLN A 1 385 ? -39.734 -63.124 24.831  1.00 40.31  ?  385 GLN A CD    1 
ATOM   2938 O  OE1   . GLN A 1 385 ? -40.333 -63.771 23.978  1.00 47.03  ?  385 GLN A OE1   1 
ATOM   2939 N  NE2   . GLN A 1 385 ? -39.391 -63.651 25.984  1.00 42.11  ?  385 GLN A NE2   1 
ATOM   2940 N  N     . PHE A 1 386 ? -37.597 -59.293 22.113  1.00 26.51  ?  386 PHE A N     1 
ATOM   2941 C  CA    . PHE A 1 386 ? -36.174 -58.931 22.054  1.00 28.62  ?  386 PHE A CA    1 
ATOM   2942 C  C     . PHE A 1 386 ? -36.063 -57.420 22.254  1.00 30.19  ?  386 PHE A C     1 
ATOM   2943 O  O     . PHE A 1 386 ? -35.186 -56.966 23.026  1.00 29.63  ?  386 PHE A O     1 
ATOM   2944 C  CB    . PHE A 1 386 ? -35.531 -59.360 20.731  1.00 33.15  ?  386 PHE A CB    1 
ATOM   2945 C  CG    . PHE A 1 386 ? -34.039 -59.235 20.785  1.00 33.14  ?  386 PHE A CG    1 
ATOM   2946 C  CD1   . PHE A 1 386 ? -33.305 -60.064 21.630  1.00 31.59  ?  386 PHE A CD1   1 
ATOM   2947 C  CD2   . PHE A 1 386 ? -33.380 -58.257 20.068  1.00 37.79  ?  386 PHE A CD2   1 
ATOM   2948 C  CE1   . PHE A 1 386 ? -31.926 -59.975 21.704  1.00 28.86  ?  386 PHE A CE1   1 
ATOM   2949 C  CE2   . PHE A 1 386 ? -32.003 -58.145 20.179  1.00 39.44  ?  386 PHE A CE2   1 
ATOM   2950 C  CZ    . PHE A 1 386 ? -31.287 -58.973 21.033  1.00 34.14  ?  386 PHE A CZ    1 
ATOM   2951 N  N     . ALA A 1 387 ? -36.938 -56.660 21.603  1.00 28.25  ?  387 ALA A N     1 
ATOM   2952 C  CA    . ALA A 1 387 ? -36.994 -55.181 21.764  1.00 30.79  ?  387 ALA A CA    1 
ATOM   2953 C  C     . ALA A 1 387 ? -37.231 -54.862 23.249  1.00 28.48  ?  387 ALA A C     1 
ATOM   2954 O  O     . ALA A 1 387 ? -36.600 -53.929 23.768  1.00 27.70  ?  387 ALA A O     1 
ATOM   2955 C  CB    . ALA A 1 387 ? -38.056 -54.582 20.859  1.00 30.02  ?  387 ALA A CB    1 
ATOM   2956 N  N     . ALA A 1 388 ? -38.097 -55.616 23.919  1.00 27.27  ?  388 ALA A N     1 
ATOM   2957 C  CA    . ALA A 1 388 ? -38.411 -55.426 25.370  1.00 28.12  ?  388 ALA A CA    1 
ATOM   2958 C  C     . ALA A 1 388 ? -37.165 -55.713 26.219  1.00 28.06  ?  388 ALA A C     1 
ATOM   2959 O  O     . ALA A 1 388 ? -36.855 -54.915 27.116  1.00 23.07  ?  388 ALA A O     1 
ATOM   2960 C  CB    . ALA A 1 388 ? -39.545 -56.332 25.784  1.00 26.59  ?  388 ALA A CB    1 
ATOM   2961 N  N     . GLN A 1 389 ? -36.459 -56.803 25.899  1.00 27.01  ?  389 GLN A N     1 
ATOM   2962 C  CA    . GLN A 1 389 ? -35.250 -57.230 26.627  1.00 26.44  ?  389 GLN A CA    1 
ATOM   2963 C  C     . GLN A 1 389 ? -34.226 -56.097 26.522  1.00 27.89  ?  389 GLN A C     1 
ATOM   2964 O  O     . GLN A 1 389 ? -33.568 -55.817 27.548  1.00 32.73  ?  389 GLN A O     1 
ATOM   2965 C  CB    . GLN A 1 389 ? -34.739 -58.560 26.072  1.00 29.51  ?  389 GLN A CB    1 
ATOM   2966 C  CG    . GLN A 1 389 ? -35.512 -59.767 26.538  1.00 33.39  ?  389 GLN A CG    1 
ATOM   2967 C  CD    . GLN A 1 389 ? -35.276 -61.018 25.713  1.00 37.63  ?  389 GLN A CD    1 
ATOM   2968 O  OE1   . GLN A 1 389 ? -34.503 -61.045 24.738  1.00 34.63  ?  389 GLN A OE1   1 
ATOM   2969 N  NE2   . GLN A 1 389 ? -36.025 -62.059 26.059  1.00 33.17  ?  389 GLN A NE2   1 
ATOM   2970 N  N     . ILE A 1 390 ? -34.098 -55.464 25.350  1.00 24.00  ?  390 ILE A N     1 
ATOM   2971 C  CA    . ILE A 1 390 ? -33.188 -54.301 25.151  1.00 25.01  ?  390 ILE A CA    1 
ATOM   2972 C  C     . ILE A 1 390 ? -33.621 -53.180 26.096  1.00 27.44  ?  390 ILE A C     1 
ATOM   2973 O  O     . ILE A 1 390 ? -32.732 -52.603 26.788  1.00 31.44  ?  390 ILE A O     1 
ATOM   2974 C  CB    . ILE A 1 390 ? -33.158 -53.837 23.680  1.00 24.67  ?  390 ILE A CB    1 
ATOM   2975 C  CG1   . ILE A 1 390 ? -32.440 -54.865 22.812  1.00 25.44  ?  390 ILE A CG1   1 
ATOM   2976 C  CG2   . ILE A 1 390 ? -32.528 -52.463 23.561  1.00 25.47  ?  390 ILE A CG2   1 
ATOM   2977 C  CD1   . ILE A 1 390 ? -32.592 -54.695 21.356  1.00 26.70  ?  390 ILE A CD1   1 
ATOM   2978 N  N     . PHE A 1 391 ? -34.907 -52.850 26.142  1.00 25.25  ?  391 PHE A N     1 
ATOM   2979 C  CA    . PHE A 1 391 ? -35.357 -51.704 26.970  1.00 28.50  ?  391 PHE A CA    1 
ATOM   2980 C  C     . PHE A 1 391 ? -35.320 -52.089 28.450  1.00 28.61  ?  391 PHE A C     1 
ATOM   2981 O  O     . PHE A 1 391 ? -35.209 -51.198 29.315  1.00 28.43  ?  391 PHE A O     1 
ATOM   2982 C  CB    . PHE A 1 391 ? -36.725 -51.229 26.531  1.00 25.13  ?  391 PHE A CB    1 
ATOM   2983 C  CG    . PHE A 1 391 ? -36.683 -50.497 25.233  1.00 25.88  ?  391 PHE A CG    1 
ATOM   2984 C  CD1   . PHE A 1 391 ? -35.908 -49.367 25.093  1.00 30.75  ?  391 PHE A CD1   1 
ATOM   2985 C  CD2   . PHE A 1 391 ? -37.434 -50.912 24.147  1.00 28.57  ?  391 PHE A CD2   1 
ATOM   2986 C  CE1   . PHE A 1 391 ? -35.864 -48.675 23.881  1.00 28.50  ?  391 PHE A CE1   1 
ATOM   2987 C  CE2   . PHE A 1 391 ? -37.407 -50.204 22.953  1.00 27.51  ?  391 PHE A CE2   1 
ATOM   2988 C  CZ    . PHE A 1 391 ? -36.612 -49.104 22.816  1.00 26.37  ?  391 PHE A CZ    1 
ATOM   2989 N  N     . GLY A 1 392 ? -35.386 -53.384 28.737  1.00 29.08  ?  392 GLY A N     1 
ATOM   2990 C  CA    . GLY A 1 392 ? -35.343 -53.894 30.118  1.00 29.84  ?  392 GLY A CA    1 
ATOM   2991 C  C     . GLY A 1 392 ? -34.019 -53.554 30.804  1.00 25.93  ?  392 GLY A C     1 
ATOM   2992 O  O     . GLY A 1 392 ? -33.978 -53.537 32.006  1.00 26.16  ?  392 GLY A O     1 
ATOM   2993 N  N     . LEU A 1 393 ? -32.953 -53.320 30.055  1.00 26.63  ?  393 LEU A N     1 
ATOM   2994 C  CA    . LEU A 1 393 ? -31.651 -52.914 30.627  1.00 27.51  ?  393 LEU A CA    1 
ATOM   2995 C  C     . LEU A 1 393 ? -31.756 -51.544 31.297  1.00 31.98  ?  393 LEU A C     1 
ATOM   2996 O  O     . LEU A 1 393 ? -30.935 -51.284 32.162  1.00 37.39  ?  393 LEU A O     1 
ATOM   2997 C  CB    . LEU A 1 393 ? -30.579 -52.903 29.544  1.00 28.57  ?  393 LEU A CB    1 
ATOM   2998 C  CG    . LEU A 1 393 ? -30.206 -54.269 28.997  1.00 31.71  ?  393 LEU A CG    1 
ATOM   2999 C  CD1   . LEU A 1 393 ? -29.191 -54.114 27.882  1.00 32.89  ?  393 LEU A CD1   1 
ATOM   3000 C  CD2   . LEU A 1 393 ? -29.679 -55.213 30.081  1.00 29.31  ?  393 LEU A CD2   1 
ATOM   3001 N  N     . SER A 1 394 ? -32.719 -50.713 30.907  1.00 36.02  ?  394 SER A N     1 
ATOM   3002 C  CA    . SER A 1 394 ? -32.905 -49.314 31.382  1.00 37.47  ?  394 SER A CA    1 
ATOM   3003 C  C     . SER A 1 394 ? -34.228 -49.136 32.123  1.00 36.63  ?  394 SER A C     1 
ATOM   3004 O  O     . SER A 1 394 ? -34.349 -48.131 32.790  1.00 41.43  ?  394 SER A O     1 
ATOM   3005 C  CB    . SER A 1 394 ? -32.871 -48.354 30.217  1.00 36.73  ?  394 SER A CB    1 
ATOM   3006 O  OG    . SER A 1 394 ? -31.764 -48.692 29.424  1.00 45.78  ?  394 SER A OG    1 
ATOM   3007 N  N     . ASN A 1 395 ? -35.219 -49.999 31.900  1.00 33.94  ?  395 ASN A N     1 
ATOM   3008 C  CA    . ASN A 1 395 ? -36.607 -49.777 32.383  1.00 35.49  ?  395 ASN A CA    1 
ATOM   3009 C  C     . ASN A 1 395 ? -37.007 -50.958 33.258  1.00 32.35  ?  395 ASN A C     1 
ATOM   3010 O  O     . ASN A 1 395 ? -37.238 -52.026 32.716  1.00 32.87  ?  395 ASN A O     1 
ATOM   3011 C  CB    . ASN A 1 395 ? -37.591 -49.565 31.210  1.00 34.50  ?  395 ASN A CB    1 
ATOM   3012 C  CG    . ASN A 1 395 ? -38.940 -49.048 31.653  1.00 32.03  ?  395 ASN A CG    1 
ATOM   3013 O  OD1   . ASN A 1 395 ? -39.580 -49.665 32.492  1.00 27.72  ?  395 ASN A OD1   1 
ATOM   3014 N  ND2   . ASN A 1 395 ? -39.364 -47.902 31.140  1.00 33.23  ?  395 ASN A ND2   1 
ATOM   3015 N  N     . HIS A 1 396 ? -37.086 -50.728 34.562  1.00 33.61  ?  396 HIS A N     1 
ATOM   3016 C  CA    . HIS A 1 396 ? -37.453 -51.762 35.557  1.00 31.90  ?  396 HIS A CA    1 
ATOM   3017 C  C     . HIS A 1 396 ? -38.867 -52.294 35.315  1.00 30.22  ?  396 HIS A C     1 
ATOM   3018 O  O     . HIS A 1 396 ? -39.070 -53.441 35.584  1.00 30.53  ?  396 HIS A O     1 
ATOM   3019 C  CB    . HIS A 1 396 ? -37.187 -51.257 36.982  1.00 32.62  ?  396 HIS A CB    1 
ATOM   3020 C  CG    . HIS A 1 396 ? -38.248 -50.378 37.536  1.00 31.55  ?  396 HIS A CG    1 
ATOM   3021 N  ND1   . HIS A 1 396 ? -38.275 -49.035 37.311  1.00 32.54  ?  396 HIS A ND1   1 
ATOM   3022 C  CD2   . HIS A 1 396 ? -39.322 -50.652 38.289  1.00 32.90  ?  396 HIS A CD2   1 
ATOM   3023 C  CE1   . HIS A 1 396 ? -39.316 -48.526 37.898  1.00 34.06  ?  396 HIS A CE1   1 
ATOM   3024 N  NE2   . HIS A 1 396 ? -39.959 -49.488 38.508  1.00 33.01  ?  396 HIS A NE2   1 
ATOM   3025 N  N     . LEU A 1 397 ? -39.780 -51.477 34.803  1.00 26.46  ?  397 LEU A N     1 
ATOM   3026 C  CA    . LEU A 1 397 ? -41.176 -51.923 34.541  1.00 29.59  ?  397 LEU A CA    1 
ATOM   3027 C  C     . LEU A 1 397 ? -41.175 -52.958 33.420  1.00 28.90  ?  397 LEU A C     1 
ATOM   3028 O  O     . LEU A 1 397 ? -41.827 -54.013 33.599  1.00 26.10  ?  397 LEU A O     1 
ATOM   3029 C  CB    . LEU A 1 397 ? -42.081 -50.723 34.221  1.00 29.10  ?  397 LEU A CB    1 
ATOM   3030 C  CG    . LEU A 1 397 ? -42.182 -49.719 35.370  1.00 34.26  ?  397 LEU A CG    1 
ATOM   3031 C  CD1   . LEU A 1 397 ? -42.980 -48.488 34.927  1.00 34.21  ?  397 LEU A CD1   1 
ATOM   3032 C  CD2   . LEU A 1 397 ? -42.803 -50.378 36.603  1.00 32.40  ?  397 LEU A CD2   1 
ATOM   3033 N  N     . VAL A 1 398 ? -40.455 -52.682 32.319  1.00 26.86  ?  398 VAL A N     1 
ATOM   3034 C  CA    . VAL A 1 398 ? -40.371 -53.628 31.178  1.00 24.42  ?  398 VAL A CA    1 
ATOM   3035 C  C     . VAL A 1 398 ? -39.646 -54.878 31.686  1.00 26.03  ?  398 VAL A C     1 
ATOM   3036 O  O     . VAL A 1 398 ? -40.118 -56.011 31.437  1.00 24.26  ?  398 VAL A O     1 
ATOM   3037 C  CB    . VAL A 1 398 ? -39.631 -53.003 29.988  1.00 25.34  ?  398 VAL A CB    1 
ATOM   3038 C  CG1   . VAL A 1 398 ? -39.355 -54.037 28.899  1.00 26.54  ?  398 VAL A CG1   1 
ATOM   3039 C  CG2   . VAL A 1 398 ? -40.379 -51.813 29.425  1.00 25.55  ?  398 VAL A CG2   1 
ATOM   3040 N  N     . TRP A 1 399 ? -38.527 -54.684 32.390  1.00 23.41  ?  399 TRP A N     1 
ATOM   3041 C  CA    . TRP A 1 399 ? -37.728 -55.811 32.911  1.00 25.01  ?  399 TRP A CA    1 
ATOM   3042 C  C     . TRP A 1 399 ? -38.677 -56.752 33.671  1.00 25.66  ?  399 TRP A C     1 
ATOM   3043 O  O     . TRP A 1 399 ? -38.646 -57.963 33.456  1.00 27.51  ?  399 TRP A O     1 
ATOM   3044 C  CB    . TRP A 1 399 ? -36.585 -55.304 33.781  1.00 27.06  ?  399 TRP A CB    1 
ATOM   3045 C  CG    . TRP A 1 399 ? -35.659 -56.410 34.165  1.00 28.94  ?  399 TRP A CG    1 
ATOM   3046 C  CD1   . TRP A 1 399 ? -34.622 -56.882 33.428  1.00 27.15  ?  399 TRP A CD1   1 
ATOM   3047 C  CD2   . TRP A 1 399 ? -35.764 -57.281 35.301  1.00 26.62  ?  399 TRP A CD2   1 
ATOM   3048 N  NE1   . TRP A 1 399 ? -34.054 -57.957 34.041  1.00 25.54  ?  399 TRP A NE1   1 
ATOM   3049 C  CE2   . TRP A 1 399 ? -34.731 -58.234 35.189  1.00 26.43  ?  399 TRP A CE2   1 
ATOM   3050 C  CE3   . TRP A 1 399 ? -36.635 -57.376 36.378  1.00 28.63  ?  399 TRP A CE3   1 
ATOM   3051 C  CZ2   . TRP A 1 399 ? -34.501 -59.224 36.143  1.00 29.64  ?  399 TRP A CZ2   1 
ATOM   3052 C  CZ3   . TRP A 1 399 ? -36.415 -58.356 37.332  1.00 31.47  ?  399 TRP A CZ3   1 
ATOM   3053 C  CH2   . TRP A 1 399 ? -35.368 -59.278 37.212  1.00 29.93  ?  399 TRP A CH2   1 
ATOM   3054 N  N     . SER A 1 400 ? -39.501 -56.187 34.552  1.00 27.07  ?  400 SER A N     1 
ATOM   3055 C  CA    . SER A 1 400 ? -40.371 -56.928 35.504  1.00 26.09  ?  400 SER A CA    1 
ATOM   3056 C  C     . SER A 1 400 ? -41.419 -57.740 34.745  1.00 24.60  ?  400 SER A C     1 
ATOM   3057 O  O     . SER A 1 400 ? -41.699 -58.858 35.156  1.00 23.03  ?  400 SER A O     1 
ATOM   3058 C  CB    . SER A 1 400 ? -40.988 -55.983 36.483  1.00 26.48  ?  400 SER A CB    1 
ATOM   3059 O  OG    . SER A 1 400 ? -39.964 -55.319 37.204  1.00 27.13  ?  400 SER A OG    1 
ATOM   3060 N  N     . LYS A 1 401 ? -41.932 -57.208 33.631  1.00 27.11  ?  401 LYS A N     1 
ATOM   3061 C  CA    . LYS A 1 401 ? -42.895 -57.961 32.801  1.00 28.09  ?  401 LYS A CA    1 
ATOM   3062 C  C     . LYS A 1 401 ? -42.184 -59.150 32.191  1.00 27.64  ?  401 LYS A C     1 
ATOM   3063 O  O     . LYS A 1 401 ? -42.818 -60.235 32.147  1.00 31.01  ?  401 LYS A O     1 
ATOM   3064 C  CB    . LYS A 1 401 ? -43.581 -57.106 31.758  1.00 27.27  ?  401 LYS A CB    1 
ATOM   3065 C  CG    . LYS A 1 401 ? -44.440 -55.986 32.319  1.00 28.51  ?  401 LYS A CG    1 
ATOM   3066 C  CD    . LYS A 1 401 ? -45.449 -55.447 31.316  1.00 32.92  ?  401 LYS A CD    1 
ATOM   3067 C  CE    . LYS A 1 401 ? -45.754 -53.972 31.417  1.00 31.32  ?  401 LYS A CE    1 
ATOM   3068 N  NZ    . LYS A 1 401 ? -46.056 -53.572 32.785  1.00 36.70  ?  401 LYS A NZ    1 
ATOM   3069 N  N     . LEU A 1 402 ? -40.927 -58.977 31.790  1.00 28.88  ?  402 LEU A N     1 
ATOM   3070 C  CA    . LEU A 1 402 ? -40.144 -60.087 31.168  1.00 26.52  ?  402 LEU A CA    1 
ATOM   3071 C  C     . LEU A 1 402 ? -39.912 -61.146 32.236  1.00 29.00  ?  402 LEU A C     1 
ATOM   3072 O  O     . LEU A 1 402 ? -40.137 -62.335 31.949  1.00 26.82  ?  402 LEU A O     1 
ATOM   3073 C  CB    . LEU A 1 402 ? -38.807 -59.584 30.624  1.00 24.09  ?  402 LEU A CB    1 
ATOM   3074 C  CG    . LEU A 1 402 ? -38.911 -58.682 29.421  1.00 28.76  ?  402 LEU A CG    1 
ATOM   3075 C  CD1   . LEU A 1 402 ? -37.635 -57.838 29.281  1.00 30.67  ?  402 LEU A CD1   1 
ATOM   3076 C  CD2   . LEU A 1 402 ? -39.190 -59.493 28.157  1.00 26.97  ?  402 LEU A CD2   1 
ATOM   3077 N  N     . ARG A 1 403 ? -39.486 -60.692 33.445  1.00 32.14  ?  403 ARG A N     1 
ATOM   3078 C  CA    . ARG A 1 403 ? -39.177 -61.583 34.589  1.00 27.11  ?  403 ARG A CA    1 
ATOM   3079 C  C     . ARG A 1 403 ? -40.418 -62.392 34.997  1.00 27.36  ?  403 ARG A C     1 
ATOM   3080 O  O     . ARG A 1 403 ? -40.280 -63.601 35.247  1.00 24.42  ?  403 ARG A O     1 
ATOM   3081 C  CB    . ARG A 1 403 ? -38.625 -60.811 35.781  1.00 27.83  ?  403 ARG A CB    1 
ATOM   3082 C  CG    . ARG A 1 403 ? -38.109 -61.730 36.880  1.00 25.20  ?  403 ARG A CG    1 
ATOM   3083 C  CD    . ARG A 1 403 ? -37.034 -62.679 36.367  1.00 24.22  ?  403 ARG A CD    1 
ATOM   3084 N  NE    . ARG A 1 403 ? -36.688 -63.643 37.373  1.00 25.12  ?  403 ARG A NE    1 
ATOM   3085 C  CZ    . ARG A 1 403 ? -37.289 -64.810 37.574  1.00 26.28  ?  403 ARG A CZ    1 
ATOM   3086 N  NH1   . ARG A 1 403 ? -38.256 -65.232 36.792  1.00 26.73  ?  403 ARG A NH1   1 
ATOM   3087 N  NH2   . ARG A 1 403 ? -36.885 -65.582 38.556  1.00 29.03  ?  403 ARG A NH2   1 
ATOM   3088 N  N     . ALA A 1 404 ? -41.563 -61.747 35.108  1.00 24.14  ?  404 ALA A N     1 
ATOM   3089 C  CA    . ALA A 1 404 ? -42.798 -62.412 35.548  1.00 31.44  ?  404 ALA A CA    1 
ATOM   3090 C  C     . ALA A 1 404 ? -43.255 -63.387 34.442  1.00 30.69  ?  404 ALA A C     1 
ATOM   3091 O  O     . ALA A 1 404 ? -43.792 -64.459 34.739  1.00 32.70  ?  404 ALA A O     1 
ATOM   3092 C  CB    . ALA A 1 404 ? -43.849 -61.361 35.869  1.00 31.84  ?  404 ALA A CB    1 
ATOM   3093 N  N     . SER A 1 405 ? -43.034 -63.027 33.197  1.00 30.66  ?  405 SER A N     1 
ATOM   3094 C  CA    . SER A 1 405 ? -43.396 -63.892 32.042  1.00 33.26  ?  405 SER A CA    1 
ATOM   3095 C  C     . SER A 1 405 ? -42.548 -65.192 32.034  1.00 31.45  ?  405 SER A C     1 
ATOM   3096 O  O     . SER A 1 405 ? -43.074 -66.279 31.664  1.00 30.32  ?  405 SER A O     1 
ATOM   3097 C  CB    . SER A 1 405 ? -43.283 -63.137 30.749  1.00 34.35  ?  405 SER A CB    1 
ATOM   3098 O  OG    . SER A 1 405 ? -43.658 -64.015 29.693  1.00 41.29  ?  405 SER A OG    1 
ATOM   3099 N  N     . ILE A 1 406 ? -41.276 -65.121 32.418  1.00 29.56  ?  406 ILE A N     1 
ATOM   3100 C  CA    . ILE A 1 406 ? -40.434 -66.340 32.567  1.00 27.25  ?  406 ILE A CA    1 
ATOM   3101 C  C     . ILE A 1 406 ? -41.078 -67.204 33.642  1.00 30.93  ?  406 ILE A C     1 
ATOM   3102 O  O     . ILE A 1 406 ? -41.239 -68.429 33.400  1.00 31.74  ?  406 ILE A O     1 
ATOM   3103 C  CB    . ILE A 1 406 ? -38.995 -65.974 32.886  1.00 32.31  ?  406 ILE A CB    1 
ATOM   3104 C  CG1   . ILE A 1 406 ? -38.308 -65.341 31.667  1.00 35.56  ?  406 ILE A CG1   1 
ATOM   3105 C  CG2   . ILE A 1 406 ? -38.231 -67.184 33.403  1.00 38.29  ?  406 ILE A CG2   1 
ATOM   3106 C  CD1   . ILE A 1 406 ? -36.970 -64.644 31.990  1.00 37.61  ?  406 ILE A CD1   1 
ATOM   3107 N  N     . LEU A 1 407 ? -41.535 -66.609 34.746  1.00 26.90  ?  407 LEU A N     1 
ATOM   3108 C  CA    . LEU A 1 407 ? -42.166 -67.396 35.831  1.00 28.34  ?  407 LEU A CA    1 
ATOM   3109 C  C     . LEU A 1 407 ? -43.458 -68.043 35.304  1.00 26.49  ?  407 LEU A C     1 
ATOM   3110 O  O     . LEU A 1 407 ? -43.623 -69.261 35.438  1.00 27.92  ?  407 LEU A O     1 
ATOM   3111 C  CB    . LEU A 1 407 ? -42.439 -66.481 37.031  1.00 32.01  ?  407 LEU A CB    1 
ATOM   3112 C  CG    . LEU A 1 407 ? -43.265 -67.120 38.155  1.00 30.81  ?  407 LEU A CG    1 
ATOM   3113 C  CD1   . LEU A 1 407 ? -42.463 -68.230 38.789  1.00 28.92  ?  407 LEU A CD1   1 
ATOM   3114 C  CD2   . LEU A 1 407 ? -43.705 -66.082 39.187  1.00 31.70  ?  407 LEU A CD2   1 
ATOM   3115 N  N     . ASN A 1 408 ? -44.355 -67.250 34.747  1.00 24.15  ?  408 ASN A N     1 
ATOM   3116 C  CA    . ASN A 1 408 ? -45.715 -67.669 34.367  1.00 25.76  ?  408 ASN A CA    1 
ATOM   3117 C  C     . ASN A 1 408 ? -45.597 -68.788 33.336  1.00 25.59  ?  408 ASN A C     1 
ATOM   3118 O  O     . ASN A 1 408 ? -46.319 -69.767 33.436  1.00 29.62  ?  408 ASN A O     1 
ATOM   3119 C  CB    . ASN A 1 408 ? -46.543 -66.442 33.942  1.00 27.89  ?  408 ASN A CB    1 
ATOM   3120 C  CG    . ASN A 1 408 ? -46.996 -65.592 35.122  1.00 29.46  ?  408 ASN A CG    1 
ATOM   3121 O  OD1   . ASN A 1 408 ? -47.210 -66.119 36.203  1.00 33.33  ?  408 ASN A OD1   1 
ATOM   3122 N  ND2   . ASN A 1 408 ? -47.152 -64.295 34.945  1.00 23.71  ?  408 ASN A ND2   1 
ATOM   3123 N  N     . THR A 1 409 ? -44.713 -68.658 32.361  1.00 26.38  ?  409 THR A N     1 
ATOM   3124 C  CA    . THR A 1 409 ? -44.482 -69.696 31.329  1.00 28.97  ?  409 THR A CA    1 
ATOM   3125 C  C     . THR A 1 409 ? -44.005 -70.992 31.991  1.00 26.71  ?  409 THR A C     1 
ATOM   3126 O  O     . THR A 1 409 ? -44.382 -72.072 31.565  1.00 31.08  ?  409 THR A O     1 
ATOM   3127 C  CB    . THR A 1 409 ? -43.471 -69.188 30.295  1.00 30.34  ?  409 THR A CB    1 
ATOM   3128 O  OG1   . THR A 1 409 ? -44.080 -68.067 29.667  1.00 29.93  ?  409 THR A OG1   1 
ATOM   3129 C  CG2   . THR A 1 409 ? -43.106 -70.200 29.239  1.00 29.80  ?  409 THR A CG2   1 
ATOM   3130 N  N     . TRP A 1 410 ? -43.112 -70.892 32.955  1.00 30.09  ?  410 TRP A N     1 
ATOM   3131 C  CA    . TRP A 1 410 ? -42.566 -72.056 33.689  1.00 30.49  ?  410 TRP A CA    1 
ATOM   3132 C  C     . TRP A 1 410 ? -43.718 -72.698 34.476  1.00 29.18  ?  410 TRP A C     1 
ATOM   3133 O  O     . TRP A 1 410 ? -43.878 -73.925 34.430  1.00 24.60  ?  410 TRP A O     1 
ATOM   3134 C  CB    . TRP A 1 410 ? -41.419 -71.607 34.597  1.00 35.27  ?  410 TRP A CB    1 
ATOM   3135 C  CG    . TRP A 1 410 ? -40.783 -72.733 35.344  1.00 35.08  ?  410 TRP A CG    1 
ATOM   3136 C  CD1   . TRP A 1 410 ? -39.787 -73.551 34.910  1.00 34.26  ?  410 TRP A CD1   1 
ATOM   3137 C  CD2   . TRP A 1 410 ? -41.147 -73.193 36.646  1.00 36.89  ?  410 TRP A CD2   1 
ATOM   3138 N  NE1   . TRP A 1 410 ? -39.497 -74.478 35.863  1.00 42.36  ?  410 TRP A NE1   1 
ATOM   3139 C  CE2   . TRP A 1 410 ? -40.316 -74.293 36.937  1.00 38.80  ?  410 TRP A CE2   1 
ATOM   3140 C  CE3   . TRP A 1 410 ? -42.090 -72.783 37.592  1.00 39.74  ?  410 TRP A CE3   1 
ATOM   3141 C  CZ2   . TRP A 1 410 ? -40.382 -74.975 38.149  1.00 38.98  ?  410 TRP A CZ2   1 
ATOM   3142 C  CZ3   . TRP A 1 410 ? -42.167 -73.463 38.789  1.00 39.27  ?  410 TRP A CZ3   1 
ATOM   3143 C  CH2   . TRP A 1 410 ? -41.324 -74.548 39.059  1.00 40.83  ?  410 TRP A CH2   1 
ATOM   3144 N  N     . ILE A 1 411 ? -44.526 -71.879 35.141  1.00 27.70  ?  411 ILE A N     1 
ATOM   3145 C  CA    . ILE A 1 411 ? -45.707 -72.386 35.888  1.00 30.69  ?  411 ILE A CA    1 
ATOM   3146 C  C     . ILE A 1 411 ? -46.626 -73.165 34.937  1.00 33.57  ?  411 ILE A C     1 
ATOM   3147 O  O     . ILE A 1 411 ? -47.046 -74.296 35.332  1.00 29.81  ?  411 ILE A O     1 
ATOM   3148 C  CB    . ILE A 1 411 ? -46.418 -71.255 36.631  1.00 31.53  ?  411 ILE A CB    1 
ATOM   3149 C  CG1   . ILE A 1 411 ? -45.580 -70.800 37.835  1.00 33.65  ?  411 ILE A CG1   1 
ATOM   3150 C  CG2   . ILE A 1 411 ? -47.821 -71.694 37.031  1.00 35.74  ?  411 ILE A CG2   1 
ATOM   3151 C  CD1   . ILE A 1 411 ? -46.104 -69.579 38.548  1.00 33.47  ?  411 ILE A CD1   1 
ATOM   3152 N  N     . SER A 1 412 ? -46.918 -72.612 33.749  1.00 31.29  ?  412 SER A N     1 
ATOM   3153 C  CA    . SER A 1 412 ? -47.762 -73.258 32.709  1.00 33.10  ?  412 SER A CA    1 
ATOM   3154 C  C     . SER A 1 412 ? -47.248 -74.658 32.339  1.00 34.12  ?  412 SER A C     1 
ATOM   3155 O  O     . SER A 1 412 ? -48.085 -75.607 32.197  1.00 35.73  ?  412 SER A O     1 
ATOM   3156 C  CB    . SER A 1 412 ? -47.848 -72.444 31.481  1.00 34.32  ?  412 SER A CB    1 
ATOM   3157 O  OG    . SER A 1 412 ? -48.817 -71.436 31.654  1.00 42.52  ?  412 SER A OG    1 
ATOM   3158 N  N     . LEU A 1 413 ? -45.937 -74.801 32.180  1.00 29.85  ?  413 LEU A N     1 
ATOM   3159 C  CA    . LEU A 1 413 ? -45.338 -76.138 31.862  1.00 35.05  ?  413 LEU A CA    1 
ATOM   3160 C  C     . LEU A 1 413 ? -45.586 -77.122 33.009  1.00 33.34  ?  413 LEU A C     1 
ATOM   3161 O  O     . LEU A 1 413 ? -46.038 -78.231 32.708  1.00 33.62  ?  413 LEU A O     1 
ATOM   3162 C  CB    . LEU A 1 413 ? -43.842 -76.020 31.561  1.00 34.04  ?  413 LEU A CB    1 
ATOM   3163 C  CG    . LEU A 1 413 ? -43.508 -75.380 30.219  1.00 39.04  ?  413 LEU A CG    1 
ATOM   3164 C  CD1   . LEU A 1 413 ? -42.097 -74.775 30.216  1.00 41.49  ?  413 LEU A CD1   1 
ATOM   3165 C  CD2   . LEU A 1 413 ? -43.714 -76.391 29.097  1.00 39.56  ?  413 LEU A CD2   1 
ATOM   3166 N  N     . LYS A 1 414 ? -45.278 -76.734 34.251  1.00 30.01  ?  414 LYS A N     1 
ATOM   3167 C  CA    . LYS A 1 414 ? -45.573 -77.559 35.452  1.00 34.63  ?  414 LYS A CA    1 
ATOM   3168 C  C     . LYS A 1 414 ? -47.051 -78.000 35.459  1.00 33.82  ?  414 LYS A C     1 
ATOM   3169 O  O     . LYS A 1 414 ? -47.293 -79.152 35.750  1.00 35.61  ?  414 LYS A O     1 
ATOM   3170 C  CB    . LYS A 1 414 ? -45.282 -76.791 36.750  1.00 37.54  ?  414 LYS A CB    1 
ATOM   3171 C  CG    . LYS A 1 414 ? -43.827 -76.388 37.002  1.00 39.04  ?  414 LYS A CG    1 
ATOM   3172 C  CD    . LYS A 1 414 ? -42.934 -77.511 37.473  1.00 43.11  ?  414 LYS A CD    1 
ATOM   3173 C  CE    . LYS A 1 414 ? -43.424 -78.169 38.750  1.00 43.51  ?  414 LYS A CE    1 
ATOM   3174 N  NZ    . LYS A 1 414 ? -42.440 -79.175 39.223  1.00 46.87  ?  414 LYS A NZ    1 
ATOM   3175 N  N     . GLN A 1 415 ? -48.003 -77.106 35.163  1.00 38.02  ?  415 GLN A N     1 
ATOM   3176 C  CA    . GLN A 1 415 ? -49.475 -77.382 35.180  1.00 39.08  ?  415 GLN A CA    1 
ATOM   3177 C  C     . GLN A 1 415 ? -49.831 -78.360 34.046  1.00 36.63  ?  415 GLN A C     1 
ATOM   3178 O  O     . GLN A 1 415 ? -50.582 -79.307 34.297  1.00 36.77  ?  415 GLN A O     1 
ATOM   3179 C  CB    . GLN A 1 415 ? -50.338 -76.104 35.086  1.00 41.61  ?  415 GLN A CB    1 
ATOM   3180 C  CG    . GLN A 1 415 ? -50.172 -75.118 36.259  1.00 46.35  ?  415 GLN A CG    1 
ATOM   3181 C  CD    . GLN A 1 415 ? -50.660 -75.568 37.624  1.00 57.53  ?  415 GLN A CD    1 
ATOM   3182 O  OE1   . GLN A 1 415 ? -50.971 -76.747 37.903  1.00 55.01  ?  415 GLN A OE1   1 
ATOM   3183 N  NE2   . GLN A 1 415 ? -50.755 -74.583 38.501  1.00 56.02  ?  415 GLN A NE2   1 
ATOM   3184 N  N     . ALA A 1 416 ? -49.310 -78.165 32.832  1.00 39.70  ?  416 ALA A N     1 
ATOM   3185 C  CA    . ALA A 1 416 ? -49.547 -79.096 31.692  1.00 38.03  ?  416 ALA A CA    1 
ATOM   3186 C  C     . ALA A 1 416 ? -48.926 -80.466 31.990  1.00 38.08  ?  416 ALA A C     1 
ATOM   3187 O  O     . ALA A 1 416 ? -49.544 -81.469 31.622  1.00 41.70  ?  416 ALA A O     1 
ATOM   3188 C  CB    . ALA A 1 416 ? -49.005 -78.549 30.413  1.00 38.87  ?  416 ALA A CB    1 
ATOM   3189 N  N     . ASP A 1 417 ? -47.766 -80.522 32.652  1.00 35.37  ?  417 ASP A N     1 
ATOM   3190 C  CA    . ASP A 1 417 ? -47.130 -81.822 32.991  1.00 37.11  ?  417 ASP A CA    1 
ATOM   3191 C  C     . ASP A 1 417 ? -48.016 -82.528 34.023  1.00 40.45  ?  417 ASP A C     1 
ATOM   3192 O  O     . ASP A 1 417 ? -48.226 -83.736 33.888  1.00 38.49  ?  417 ASP A O     1 
ATOM   3193 C  CB    . ASP A 1 417 ? -45.696 -81.673 33.484  1.00 33.55  ?  417 ASP A CB    1 
ATOM   3194 C  CG    . ASP A 1 417 ? -45.015 -83.003 33.828  1.00 34.70  ?  417 ASP A CG    1 
ATOM   3195 O  OD1   . ASP A 1 417 ? -45.037 -83.927 32.967  1.00 38.03  ?  417 ASP A OD1   1 
ATOM   3196 O  OD2   . ASP A 1 417 ? -44.448 -83.111 34.961  1.00 32.56  ?  417 ASP A OD2   1 
ATOM   3197 N  N     . LYS A 1 418 ? -48.512 -81.782 35.009  1.00 40.67  ?  418 LYS A N     1 
ATOM   3198 C  CA    . LYS A 1 418 ? -49.383 -82.321 36.073  1.00 45.92  ?  418 LYS A CA    1 
ATOM   3199 C  C     . LYS A 1 418 ? -50.636 -82.922 35.427  1.00 42.09  ?  418 LYS A C     1 
ATOM   3200 O  O     . LYS A 1 418 ? -51.023 -84.035 35.829  1.00 43.66  ?  418 LYS A O     1 
ATOM   3201 C  CB    . LYS A 1 418 ? -49.694 -81.237 37.110  1.00 45.19  ?  418 LYS A CB    1 
ATOM   3202 C  CG    . LYS A 1 418 ? -50.447 -81.714 38.334  1.00 47.57  ?  418 LYS A CG    1 
ATOM   3203 C  CD    . LYS A 1 418 ? -51.221 -80.577 38.991  1.00 58.78  ?  418 LYS A CD    1 
ATOM   3204 C  CE    . LYS A 1 418 ? -52.012 -81.006 40.210  1.00 63.66  ?  418 LYS A CE    1 
ATOM   3205 N  NZ    . LYS A 1 418 ? -51.218 -80.836 41.442  1.00 58.27  ?  418 LYS A NZ    1 
ATOM   3206 N  N     . LYS A 1 419 ? -51.218 -82.247 34.445  1.00 41.00  ?  419 LYS A N     1 
ATOM   3207 C  CA    . LYS A 1 419 ? -52.455 -82.705 33.756  1.00 42.94  ?  419 LYS A CA    1 
ATOM   3208 C  C     . LYS A 1 419 ? -52.181 -84.032 33.048  1.00 44.79  ?  419 LYS A C     1 
ATOM   3209 O  O     . LYS A 1 419 ? -52.896 -85.016 33.335  1.00 51.08  ?  419 LYS A O     1 
ATOM   3210 C  CB    . LYS A 1 419 ? -52.997 -81.667 32.770  1.00 46.49  ?  419 LYS A CB    1 
ATOM   3211 C  CG    . LYS A 1 419 ? -54.509 -81.717 32.570  1.00 63.41  ?  419 LYS A CG    1 
ATOM   3212 C  CD    . LYS A 1 419 ? -55.086 -80.643 31.628  1.00 76.31  ?  419 LYS A CD    1 
ATOM   3213 C  CE    . LYS A 1 419 ? -55.538 -81.193 30.279  1.00 83.08  ?  419 LYS A CE    1 
ATOM   3214 N  NZ    . LYS A 1 419 ? -56.128 -80.158 29.392  1.00 77.08  ?  419 LYS A NZ    1 
ATOM   3215 N  N     . ILE A 1 420 ? -51.186 -84.064 32.162  1.00 46.04  ?  420 ILE A N     1 
ATOM   3216 C  CA    . ILE A 1 420 ? -50.873 -85.242 31.300  1.00 45.14  ?  420 ILE A CA    1 
ATOM   3217 C  C     . ILE A 1 420 ? -50.405 -86.433 32.156  1.00 42.01  ?  420 ILE A C     1 
ATOM   3218 O  O     . ILE A 1 420 ? -50.682 -87.553 31.751  1.00 43.93  ?  420 ILE A O     1 
ATOM   3219 C  CB    . ILE A 1 420 ? -49.834 -84.841 30.246  1.00 49.66  ?  420 ILE A CB    1 
ATOM   3220 C  CG1   . ILE A 1 420 ? -49.878 -85.747 29.030  1.00 57.58  ?  420 ILE A CG1   1 
ATOM   3221 C  CG2   . ILE A 1 420 ? -48.454 -84.836 30.852  1.00 57.51  ?  420 ILE A CG2   1 
ATOM   3222 C  CD1   . ILE A 1 420 ? -49.427 -85.050 27.780  1.00 65.70  ?  420 ILE A CD1   1 
ATOM   3223 N  N     . ARG A 1 421 ? -49.827 -86.169 33.319  1.00 41.17  ?  421 ARG A N     1 
ATOM   3224 C  CA    . ARG A 1 421 ? -49.378 -87.211 34.269  1.00 47.60  ?  421 ARG A CA    1 
ATOM   3225 C  C     . ARG A 1 421 ? -50.585 -87.998 34.796  1.00 51.75  ?  421 ARG A C     1 
ATOM   3226 O  O     . ARG A 1 421 ? -50.430 -89.162 35.076  1.00 54.89  ?  421 ARG A O     1 
ATOM   3227 C  CB    . ARG A 1 421 ? -48.685 -86.520 35.438  1.00 48.79  ?  421 ARG A CB    1 
ATOM   3228 C  CG    . ARG A 1 421 ? -47.328 -87.081 35.804  1.00 49.21  ?  421 ARG A CG    1 
ATOM   3229 C  CD    . ARG A 1 421 ? -46.539 -86.046 36.565  1.00 55.29  ?  421 ARG A CD    1 
ATOM   3230 N  NE    . ARG A 1 421 ? -47.204 -85.388 37.674  1.00 53.84  ?  421 ARG A NE    1 
ATOM   3231 C  CZ    . ARG A 1 421 ? -46.965 -84.145 38.040  1.00 44.74  ?  421 ARG A CZ    1 
ATOM   3232 N  NH1   . ARG A 1 421 ? -46.096 -83.421 37.373  1.00 42.27  ?  421 ARG A NH1   1 
ATOM   3233 N  NH2   . ARG A 1 421 ? -47.597 -83.621 39.063  1.00 41.82  ?  421 ARG A NH2   1 
ATOM   3234 N  N     . GLU A 1 422 ? -51.732 -87.351 34.968  1.00 68.81  ?  422 GLU A N     1 
ATOM   3235 C  CA    . GLU A 1 422 ? -52.985 -88.007 35.453  1.00 82.34  ?  422 GLU A CA    1 
ATOM   3236 C  C     . GLU A 1 422 ? -53.515 -88.964 34.366  1.00 89.50  ?  422 GLU A C     1 
ATOM   3237 O  O     . GLU A 1 422 ? -53.994 -90.062 34.727  1.00 89.31  ?  422 GLU A O     1 
ATOM   3238 C  CB    . GLU A 1 422 ? -53.955 -86.943 35.965  1.00 93.75  ?  422 GLU A CB    1 
ATOM   3239 C  CG    . GLU A 1 422 ? -53.420 -86.313 37.255  1.00 107.15 ?  422 GLU A CG    1 
ATOM   3240 C  CD    . GLU A 1 422 ? -54.127 -85.087 37.821  1.00 112.36 ?  422 GLU A CD    1 
ATOM   3241 O  OE1   . GLU A 1 422 ? -55.191 -84.708 37.263  1.00 96.27  ?  422 GLU A OE1   1 
ATOM   3242 O  OE2   . GLU A 1 422 ? -53.584 -84.494 38.810  1.00 84.58  ?  422 GLU A OE2   1 
ATOM   3243 N  N     . CYS A 1 423 ? -53.339 -88.621 33.085  1.00 84.42  ?  423 CYS A N     1 
ATOM   3244 C  CA    . CYS A 1 423 ? -53.619 -89.490 31.906  1.00 87.06  ?  423 CYS A CA    1 
ATOM   3245 C  C     . CYS A 1 423 ? -52.482 -90.500 31.667  1.00 86.57  ?  423 CYS A C     1 
ATOM   3246 O  O     . CYS A 1 423 ? -52.233 -90.806 30.476  1.00 88.96  ?  423 CYS A O     1 
ATOM   3247 C  CB    . CYS A 1 423 ? -53.793 -88.661 30.631  1.00 99.42  ?  423 CYS A CB    1 
ATOM   3248 S  SG    . CYS A 1 423 ? -54.877 -87.212 30.790  1.00 88.62  ?  423 CYS A SG    1 
ATOM   3249 N  N     . ASN A 1 424 ? -51.795 -90.908 32.735  1.00 85.66  ?  424 ASN A N     1 
ATOM   3250 C  CA    . ASN A 1 424 ? -50.689 -91.899 32.679  1.00 85.82  ?  424 ASN A CA    1 
ATOM   3251 C  C     . ASN A 1 424 ? -51.060 -93.047 33.616  1.00 98.86  ?  424 ASN A C     1 
ATOM   3252 O  O     . ASN A 1 424 ? -50.150 -93.724 34.102  1.00 101.78 ?  424 ASN A O     1 
ATOM   3253 C  CB    . ASN A 1 424 ? -49.382 -91.349 33.248  1.00 84.79  ?  424 ASN A CB    1 
ATOM   3254 C  CG    . ASN A 1 424 ? -48.402 -90.775 32.245  1.00 81.41  ?  424 ASN A CG    1 
ATOM   3255 O  OD1   . ASN A 1 424 ? -48.611 -90.835 31.039  1.00 64.92  ?  424 ASN A OD1   1 
ATOM   3256 N  ND2   . ASN A 1 424 ? -47.323 -90.207 32.750  1.00 55.73  ?  424 ASN A ND2   1 
ATOM   3257 N  N     . LEU A 1 425 ? -52.352 -93.200 33.898  1.00 114.02 ?  425 LEU A N     1 
ATOM   3258 C  CA    . LEU A 1 425 ? -52.875 -94.271 34.784  1.00 108.20 ?  425 LEU A CA    1 
ATOM   3259 C  C     . LEU A 1 425 ? -54.148 -94.864 34.169  1.00 102.10 ?  425 LEU A C     1 
ATOM   3260 O  O     . LEU A 1 425 ? -54.438 -94.537 33.004  1.00 76.76  ?  425 LEU A O     1 
ATOM   3261 C  CB    . LEU A 1 425 ? -53.171 -93.660 36.153  1.00 96.40  ?  425 LEU A CB    1 
ATOM   3262 C  CG    . LEU A 1 425 ? -51.967 -93.087 36.888  1.00 93.28  ?  425 LEU A CG    1 
ATOM   3263 C  CD1   . LEU A 1 425 ? -52.405 -92.312 38.112  1.00 99.37  ?  425 LEU A CD1   1 
ATOM   3264 C  CD2   . LEU A 1 425 ? -51.016 -94.193 37.290  1.00 82.54  ?  425 LEU A CD2   1 
ATOM   3265 N  N     . LEU B 1 7   ? 8.948   -26.602 28.015  1.00 83.71  ?  7   LEU B N     1 
ATOM   3266 C  CA    . LEU B 1 7   ? 8.191   -26.337 26.738  1.00 86.67  ?  7   LEU B CA    1 
ATOM   3267 C  C     . LEU B 1 7   ? 8.852   -25.161 25.992  1.00 75.13  ?  7   LEU B C     1 
ATOM   3268 O  O     . LEU B 1 7   ? 8.840   -24.022 26.529  1.00 68.25  ?  7   LEU B O     1 
ATOM   3269 C  CB    . LEU B 1 7   ? 6.713   -26.060 27.068  1.00 88.71  ?  7   LEU B CB    1 
ATOM   3270 C  CG    . LEU B 1 7   ? 5.733   -26.043 25.883  1.00 80.44  ?  7   LEU B CG    1 
ATOM   3271 C  CD1   . LEU B 1 7   ? 5.396   -27.459 25.393  1.00 66.14  ?  7   LEU B CD1   1 
ATOM   3272 C  CD2   . LEU B 1 7   ? 4.459   -25.269 26.241  1.00 71.10  ?  7   LEU B CD2   1 
ATOM   3273 N  N     . ASN B 1 8   ? 9.370   -25.421 24.786  1.00 63.65  ?  8   ASN B N     1 
ATOM   3274 C  CA    . ASN B 1 8   ? 10.129  -24.432 23.983  1.00 71.85  ?  8   ASN B CA    1 
ATOM   3275 C  C     . ASN B 1 8   ? 9.157   -23.674 23.058  1.00 66.63  ?  8   ASN B C     1 
ATOM   3276 O  O     . ASN B 1 8   ? 8.861   -24.186 21.947  1.00 73.93  ?  8   ASN B O     1 
ATOM   3277 C  CB    . ASN B 1 8   ? 11.304  -25.111 23.264  1.00 80.72  ?  8   ASN B CB    1 
ATOM   3278 C  CG    . ASN B 1 8   ? 12.435  -24.155 22.905  1.00 84.16  ?  8   ASN B CG    1 
ATOM   3279 O  OD1   . ASN B 1 8   ? 12.564  -23.085 23.501  1.00 92.09  ?  8   ASN B OD1   1 
ATOM   3280 N  ND2   . ASN B 1 8   ? 13.277  -24.525 21.949  1.00 64.01  ?  8   ASN B ND2   1 
ATOM   3281 N  N     . ILE B 1 9   ? 8.706   -22.493 23.495  1.00 62.67  ?  9   ILE B N     1 
ATOM   3282 C  CA    . ILE B 1 9   ? 7.801   -21.579 22.732  1.00 68.42  ?  9   ILE B CA    1 
ATOM   3283 C  C     . ILE B 1 9   ? 8.645   -20.877 21.679  1.00 58.30  ?  9   ILE B C     1 
ATOM   3284 O  O     . ILE B 1 9   ? 9.713   -20.432 22.032  1.00 66.40  ?  9   ILE B O     1 
ATOM   3285 C  CB    . ILE B 1 9   ? 7.102   -20.543 23.649  1.00 77.87  ?  9   ILE B CB    1 
ATOM   3286 C  CG1   . ILE B 1 9   ? 6.467   -21.173 24.896  1.00 79.87  ?  9   ILE B CG1   1 
ATOM   3287 C  CG2   . ILE B 1 9   ? 6.094   -19.720 22.855  1.00 78.31  ?  9   ILE B CG2   1 
ATOM   3288 C  CD1   . ILE B 1 9   ? 5.650   -22.411 24.632  1.00 72.87  ?  9   ILE B CD1   1 
ATOM   3289 N  N     . GLY B 1 10  ? 8.142   -20.793 20.450  1.00 63.75  ?  10  GLY B N     1 
ATOM   3290 C  CA    . GLY B 1 10  ? 8.759   -20.140 19.280  1.00 61.46  ?  10  GLY B CA    1 
ATOM   3291 C  C     . GLY B 1 10  ? 8.168   -18.767 19.051  1.00 58.20  ?  10  GLY B C     1 
ATOM   3292 O  O     . GLY B 1 10  ? 7.833   -18.092 20.073  1.00 55.99  ?  10  GLY B O     1 
ATOM   3293 N  N     . LYS B 1 11  ? 8.048   -18.375 17.781  1.00 54.07  ?  11  LYS B N     1 
ATOM   3294 C  CA    . LYS B 1 11  ? 7.493   -17.051 17.378  1.00 64.70  ?  11  LYS B CA    1 
ATOM   3295 C  C     . LYS B 1 11  ? 5.952   -17.088 17.340  1.00 59.90  ?  11  LYS B C     1 
ATOM   3296 O  O     . LYS B 1 11  ? 5.355   -18.174 17.046  1.00 52.71  ?  11  LYS B O     1 
ATOM   3297 C  CB    . LYS B 1 11  ? 8.049   -16.651 16.006  1.00 67.33  ?  11  LYS B CB    1 
ATOM   3298 C  CG    . LYS B 1 11  ? 7.627   -17.552 14.850  1.00 77.93  ?  11  LYS B CG    1 
ATOM   3299 C  CD    . LYS B 1 11  ? 8.140   -17.099 13.486  1.00 91.29  ?  11  LYS B CD    1 
ATOM   3300 C  CE    . LYS B 1 11  ? 7.563   -17.907 12.340  1.00 93.96  ?  11  LYS B CE    1 
ATOM   3301 N  NZ    . LYS B 1 11  ? 8.237   -17.606 11.057  1.00 90.11  ?  11  LYS B NZ    1 
ATOM   3302 N  N     . LYS B 1 12  ? 5.338   -15.931 17.594  1.00 57.36  ?  12  LYS B N     1 
ATOM   3303 C  CA    . LYS B 1 12  ? 3.877   -15.714 17.463  1.00 57.24  ?  12  LYS B CA    1 
ATOM   3304 C  C     . LYS B 1 12  ? 3.526   -15.742 15.980  1.00 55.82  ?  12  LYS B C     1 
ATOM   3305 O  O     . LYS B 1 12  ? 4.029   -14.868 15.279  1.00 73.27  ?  12  LYS B O     1 
ATOM   3306 C  CB    . LYS B 1 12  ? 3.468   -14.400 18.129  1.00 56.15  ?  12  LYS B CB    1 
ATOM   3307 C  CG    . LYS B 1 12  ? 1.972   -14.235 18.369  1.00 61.73  ?  12  LYS B CG    1 
ATOM   3308 C  CD    . LYS B 1 12  ? 1.628   -13.292 19.491  1.00 71.37  ?  12  LYS B CD    1 
ATOM   3309 C  CE    . LYS B 1 12  ? 1.916   -11.835 19.175  1.00 71.97  ?  12  LYS B CE    1 
ATOM   3310 N  NZ    . LYS B 1 12  ? 1.521   -10.966 20.310  1.00 82.14  ?  12  LYS B NZ    1 
ATOM   3311 N  N     . LEU B 1 13  ? 2.736   -16.722 15.529  1.00 55.10  ?  13  LEU B N     1 
ATOM   3312 C  CA    . LEU B 1 13  ? 2.365   -16.903 14.095  1.00 55.52  ?  13  LEU B CA    1 
ATOM   3313 C  C     . LEU B 1 13  ? 1.195   -15.986 13.721  1.00 59.04  ?  13  LEU B C     1 
ATOM   3314 O  O     . LEU B 1 13  ? 1.303   -15.293 12.724  1.00 61.24  ?  13  LEU B O     1 
ATOM   3315 C  CB    . LEU B 1 13  ? 1.999   -18.363 13.834  1.00 53.41  ?  13  LEU B CB    1 
ATOM   3316 C  CG    . LEU B 1 13  ? 3.148   -19.358 13.933  1.00 57.47  ?  13  LEU B CG    1 
ATOM   3317 C  CD1   . LEU B 1 13  ? 2.731   -20.703 13.346  1.00 54.57  ?  13  LEU B CD1   1 
ATOM   3318 C  CD2   . LEU B 1 13  ? 4.400   -18.853 13.213  1.00 61.62  ?  13  LEU B CD2   1 
ATOM   3319 N  N     . TYR B 1 14  ? 0.101   -16.034 14.477  1.00 64.21  ?  14  TYR B N     1 
ATOM   3320 C  CA    . TYR B 1 14  ? -1.124  -15.217 14.270  1.00 63.42  ?  14  TYR B CA    1 
ATOM   3321 C  C     . TYR B 1 14  ? -1.648  -14.805 15.642  1.00 63.30  ?  14  TYR B C     1 
ATOM   3322 O  O     . TYR B 1 14  ? -1.314  -15.472 16.667  1.00 51.95  ?  14  TYR B O     1 
ATOM   3323 C  CB    . TYR B 1 14  ? -2.261  -15.957 13.545  1.00 70.17  ?  14  TYR B CB    1 
ATOM   3324 C  CG    . TYR B 1 14  ? -1.924  -17.221 12.784  1.00 76.28  ?  14  TYR B CG    1 
ATOM   3325 C  CD1   . TYR B 1 14  ? -1.161  -17.205 11.619  1.00 82.57  ?  14  TYR B CD1   1 
ATOM   3326 C  CD2   . TYR B 1 14  ? -2.459  -18.444 13.169  1.00 73.19  ?  14  TYR B CD2   1 
ATOM   3327 C  CE1   . TYR B 1 14  ? -0.904  -18.362 10.892  1.00 81.15  ?  14  TYR B CE1   1 
ATOM   3328 C  CE2   . TYR B 1 14  ? -2.211  -19.617 12.458  1.00 72.95  ?  14  TYR B CE2   1 
ATOM   3329 C  CZ    . TYR B 1 14  ? -1.426  -19.576 11.316  1.00 84.65  ?  14  TYR B CZ    1 
ATOM   3330 O  OH    . TYR B 1 14  ? -1.160  -20.734 10.639  1.00 83.18  ?  14  TYR B OH    1 
ATOM   3331 N  N     . GLU B 1 15  ? -2.468  -13.763 15.647  1.00 54.37  ?  15  GLU B N     1 
ATOM   3332 C  CA    . GLU B 1 15  ? -3.187  -13.270 16.841  1.00 52.22  ?  15  GLU B CA    1 
ATOM   3333 C  C     . GLU B 1 15  ? -4.565  -12.781 16.369  1.00 59.64  ?  15  GLU B C     1 
ATOM   3334 O  O     . GLU B 1 15  ? -4.628  -12.038 15.388  1.00 54.97  ?  15  GLU B O     1 
ATOM   3335 C  CB    . GLU B 1 15  ? -2.368  -12.175 17.521  1.00 55.96  ?  15  GLU B CB    1 
ATOM   3336 C  CG    . GLU B 1 15  ? -3.176  -11.270 18.427  1.00 69.65  ?  15  GLU B CG    1 
ATOM   3337 C  CD    . GLU B 1 15  ? -2.443  -10.814 19.675  1.00 72.90  ?  15  GLU B CD    1 
ATOM   3338 O  OE1   . GLU B 1 15  ? -1.196  -10.819 19.630  1.00 72.43  ?  15  GLU B OE1   1 
ATOM   3339 O  OE2   . GLU B 1 15  ? -3.127  -10.483 20.685  1.00 70.15  ?  15  GLU B OE2   1 
ATOM   3340 N  N     . GLY B 1 16  ? -5.642  -13.208 17.022  1.00 54.32  ?  16  GLY B N     1 
ATOM   3341 C  CA    . GLY B 1 16  ? -6.998  -12.753 16.681  1.00 53.26  ?  16  GLY B CA    1 
ATOM   3342 C  C     . GLY B 1 16  ? -7.649  -12.142 17.909  1.00 57.52  ?  16  GLY B C     1 
ATOM   3343 O  O     . GLY B 1 16  ? -6.913  -11.807 18.855  1.00 46.57  ?  16  GLY B O     1 
ATOM   3344 N  N     . LYS B 1 17  ? -8.980  -12.066 17.899  1.00 53.37  ?  17  LYS B N     1 
ATOM   3345 C  CA    . LYS B 1 17  ? -9.779  -11.407 18.956  1.00 54.83  ?  17  LYS B CA    1 
ATOM   3346 C  C     . LYS B 1 17  ? -9.608  -12.147 20.289  1.00 49.16  ?  17  LYS B C     1 
ATOM   3347 O  O     . LYS B 1 17  ? -9.700  -11.476 21.336  1.00 53.25  ?  17  LYS B O     1 
ATOM   3348 C  CB    . LYS B 1 17  ? -11.258 -11.349 18.554  1.00 59.23  ?  17  LYS B CB    1 
ATOM   3349 C  CG    . LYS B 1 17  ? -11.680 -10.113 17.770  1.00 69.85  ?  17  LYS B CG    1 
ATOM   3350 C  CD    . LYS B 1 17  ? -13.014 -10.322 17.030  1.00 74.04  ?  17  LYS B CD    1 
ATOM   3351 C  CE    . LYS B 1 17  ? -12.855 -11.106 15.742  1.00 80.16  ?  17  LYS B CE    1 
ATOM   3352 N  NZ    . LYS B 1 17  ? -13.894 -12.152 15.596  1.00 79.36  ?  17  LYS B NZ    1 
ATOM   3353 N  N     . THR B 1 18  ? -9.432  -13.461 20.278  1.00 45.98  ?  18  THR B N     1 
ATOM   3354 C  CA    . THR B 1 18  ? -9.488  -14.233 21.546  1.00 47.89  ?  18  THR B CA    1 
ATOM   3355 C  C     . THR B 1 18  ? -8.351  -15.228 21.710  1.00 42.83  ?  18  THR B C     1 
ATOM   3356 O  O     . THR B 1 18  ? -8.298  -15.799 22.786  1.00 44.30  ?  18  THR B O     1 
ATOM   3357 C  CB    . THR B 1 18  ? -10.782 -15.049 21.660  1.00 51.17  ?  18  THR B CB    1 
ATOM   3358 O  OG1   . THR B 1 18  ? -10.821 -15.992 20.588  1.00 47.13  ?  18  THR B OG1   1 
ATOM   3359 C  CG2   . THR B 1 18  ? -12.036 -14.197 21.636  1.00 51.81  ?  18  THR B CG2   1 
ATOM   3360 N  N     . LYS B 1 19  ? -7.493  -15.427 20.715  1.00 41.01  ?  19  LYS B N     1 
ATOM   3361 C  CA    . LYS B 1 19  ? -6.461  -16.486 20.800  1.00 39.57  ?  19  LYS B CA    1 
ATOM   3362 C  C     . LYS B 1 19  ? -5.163  -16.071 20.098  1.00 42.66  ?  19  LYS B C     1 
ATOM   3363 O  O     . LYS B 1 19  ? -5.228  -15.425 19.063  1.00 41.13  ?  19  LYS B O     1 
ATOM   3364 C  CB    . LYS B 1 19  ? -6.995  -17.682 20.040  1.00 41.06  ?  19  LYS B CB    1 
ATOM   3365 C  CG    . LYS B 1 19  ? -7.032  -18.979 20.800  1.00 53.49  ?  19  LYS B CG    1 
ATOM   3366 C  CD    . LYS B 1 19  ? -7.896  -20.027 20.121  1.00 59.84  ?  19  LYS B CD    1 
ATOM   3367 C  CE    . LYS B 1 19  ? -8.119  -19.781 18.649  1.00 58.18  ?  19  LYS B CE    1 
ATOM   3368 N  NZ    . LYS B 1 19  ? -9.565  -19.689 18.349  1.00 59.07  ?  19  LYS B NZ    1 
ATOM   3369 N  N     . GLU B 1 20  ? -4.026  -16.478 20.642  1.00 42.28  ?  20  GLU B N     1 
ATOM   3370 C  CA    . GLU B 1 20  ? -2.700  -16.277 20.028  1.00 42.23  ?  20  GLU B CA    1 
ATOM   3371 C  C     . GLU B 1 20  ? -2.167  -17.652 19.689  1.00 37.73  ?  20  GLU B C     1 
ATOM   3372 O  O     . GLU B 1 20  ? -2.311  -18.530 20.513  1.00 41.05  ?  20  GLU B O     1 
ATOM   3373 C  CB    . GLU B 1 20  ? -1.730  -15.589 20.992  1.00 48.83  ?  20  GLU B CB    1 
ATOM   3374 C  CG    . GLU B 1 20  ? -2.003  -14.117 21.205  1.00 59.25  ?  20  GLU B CG    1 
ATOM   3375 C  CD    . GLU B 1 20  ? -1.397  -13.518 22.480  1.00 68.53  ?  20  GLU B CD    1 
ATOM   3376 O  OE1   . GLU B 1 20  ? -1.223  -14.247 23.495  1.00 65.40  ?  20  GLU B OE1   1 
ATOM   3377 O  OE2   . GLU B 1 20  ? -1.095  -12.308 22.473  1.00 70.47  ?  20  GLU B OE2   1 
ATOM   3378 N  N     . VAL B 1 21  ? -1.580  -17.810 18.515  1.00 38.35  ?  21  VAL B N     1 
ATOM   3379 C  CA    . VAL B 1 21  ? -1.012  -19.104 18.042  1.00 40.56  ?  21  VAL B CA    1 
ATOM   3380 C  C     . VAL B 1 21  ? 0.505   -18.968 17.949  1.00 40.91  ?  21  VAL B C     1 
ATOM   3381 O  O     . VAL B 1 21  ? 0.960   -18.052 17.256  1.00 43.43  ?  21  VAL B O     1 
ATOM   3382 C  CB    . VAL B 1 21  ? -1.626  -19.509 16.694  1.00 43.56  ?  21  VAL B CB    1 
ATOM   3383 C  CG1   . VAL B 1 21  ? -1.012  -20.781 16.154  1.00 42.92  ?  21  VAL B CG1   1 
ATOM   3384 C  CG2   . VAL B 1 21  ? -3.135  -19.651 16.805  1.00 50.07  ?  21  VAL B CG2   1 
ATOM   3385 N  N     . TYR B 1 22  ? 1.237   -19.868 18.601  1.00 39.55  ?  22  TYR B N     1 
ATOM   3386 C  CA    . TYR B 1 22  ? 2.716   -19.882 18.716  1.00 41.92  ?  22  TYR B CA    1 
ATOM   3387 C  C     . TYR B 1 22  ? 3.231   -21.178 18.105  1.00 41.28  ?  22  TYR B C     1 
ATOM   3388 O  O     . TYR B 1 22  ? 2.604   -22.234 18.291  1.00 36.41  ?  22  TYR B O     1 
ATOM   3389 C  CB    . TYR B 1 22  ? 3.185   -19.782 20.183  1.00 44.01  ?  22  TYR B CB    1 
ATOM   3390 C  CG    . TYR B 1 22  ? 2.865   -18.480 20.877  1.00 40.79  ?  22  TYR B CG    1 
ATOM   3391 C  CD1   . TYR B 1 22  ? 1.660   -18.314 21.553  1.00 42.71  ?  22  TYR B CD1   1 
ATOM   3392 C  CD2   . TYR B 1 22  ? 3.747   -17.401 20.848  1.00 42.46  ?  22  TYR B CD2   1 
ATOM   3393 C  CE1   . TYR B 1 22  ? 1.332   -17.118 22.181  1.00 46.05  ?  22  TYR B CE1   1 
ATOM   3394 C  CE2   . TYR B 1 22  ? 3.432   -16.194 21.468  1.00 44.49  ?  22  TYR B CE2   1 
ATOM   3395 C  CZ    . TYR B 1 22  ? 2.223   -16.052 22.138  1.00 46.26  ?  22  TYR B CZ    1 
ATOM   3396 O  OH    . TYR B 1 22  ? 1.883   -14.900 22.770  1.00 44.86  ?  22  TYR B OH    1 
ATOM   3397 N  N     . GLU B 1 23  ? 4.377   -21.091 17.431  1.00 48.25  ?  23  GLU B N     1 
ATOM   3398 C  CA    . GLU B 1 23  ? 5.122   -22.275 16.939  1.00 51.81  ?  23  GLU B CA    1 
ATOM   3399 C  C     . GLU B 1 23  ? 5.812   -22.930 18.148  1.00 52.24  ?  23  GLU B C     1 
ATOM   3400 O  O     . GLU B 1 23  ? 6.062   -22.235 19.148  1.00 43.71  ?  23  GLU B O     1 
ATOM   3401 C  CB    . GLU B 1 23  ? 6.034   -21.819 15.799  1.00 61.18  ?  23  GLU B CB    1 
ATOM   3402 C  CG    . GLU B 1 23  ? 7.352   -22.558 15.694  1.00 75.32  ?  23  GLU B CG    1 
ATOM   3403 C  CD    . GLU B 1 23  ? 8.336   -21.912 14.723  1.00 77.86  ?  23  GLU B CD    1 
ATOM   3404 O  OE1   . GLU B 1 23  ? 8.226   -20.673 14.501  1.00 80.12  ?  23  GLU B OE1   1 
ATOM   3405 O  OE2   . GLU B 1 23  ? 9.186   -22.656 14.177  1.00 70.55  ?  23  GLU B OE2   1 
ATOM   3406 N  N     . LEU B 1 24  ? 5.998   -24.248 18.097  1.00 55.67  ?  24  LEU B N     1 
ATOM   3407 C  CA    . LEU B 1 24  ? 6.696   -25.063 19.132  1.00 50.03  ?  24  LEU B CA    1 
ATOM   3408 C  C     . LEU B 1 24  ? 7.964   -25.631 18.484  1.00 55.31  ?  24  LEU B C     1 
ATOM   3409 O  O     . LEU B 1 24  ? 7.845   -26.475 17.575  1.00 47.11  ?  24  LEU B O     1 
ATOM   3410 C  CB    . LEU B 1 24  ? 5.788   -26.187 19.646  1.00 46.07  ?  24  LEU B CB    1 
ATOM   3411 C  CG    . LEU B 1 24  ? 4.498   -25.759 20.355  1.00 48.60  ?  24  LEU B CG    1 
ATOM   3412 C  CD1   . LEU B 1 24  ? 3.607   -26.956 20.646  1.00 50.38  ?  24  LEU B CD1   1 
ATOM   3413 C  CD2   . LEU B 1 24  ? 4.791   -25.036 21.648  1.00 54.43  ?  24  LEU B CD2   1 
ATOM   3414 N  N     . LEU B 1 25  ? 9.136   -25.191 18.950  1.00 65.92  ?  25  LEU B N     1 
ATOM   3415 C  CA    . LEU B 1 25  ? 10.422  -25.361 18.217  1.00 64.71  ?  25  LEU B CA    1 
ATOM   3416 C  C     . LEU B 1 25  ? 10.852  -26.830 18.277  1.00 59.79  ?  25  LEU B C     1 
ATOM   3417 O  O     . LEU B 1 25  ? 11.424  -27.300 17.290  1.00 55.65  ?  25  LEU B O     1 
ATOM   3418 C  CB    . LEU B 1 25  ? 11.468  -24.407 18.807  1.00 71.91  ?  25  LEU B CB    1 
ATOM   3419 C  CG    . LEU B 1 25  ? 11.116  -22.915 18.709  1.00 79.58  ?  25  LEU B CG    1 
ATOM   3420 C  CD1   . LEU B 1 25  ? 11.956  -22.085 19.671  1.00 74.43  ?  25  LEU B CD1   1 
ATOM   3421 C  CD2   . LEU B 1 25  ? 11.236  -22.380 17.274  1.00 79.40  ?  25  LEU B CD2   1 
ATOM   3422 N  N     . ASP B 1 26  ? 10.506  -27.549 19.343  1.00 59.72  ?  26  ASP B N     1 
ATOM   3423 C  CA    . ASP B 1 26  ? 10.851  -28.997 19.490  1.00 75.86  ?  26  ASP B CA    1 
ATOM   3424 C  C     . ASP B 1 26  ? 9.766   -29.922 18.904  1.00 67.86  ?  26  ASP B C     1 
ATOM   3425 O  O     . ASP B 1 26  ? 10.000  -31.131 18.902  1.00 58.79  ?  26  ASP B O     1 
ATOM   3426 C  CB    . ASP B 1 26  ? 11.108  -29.364 20.961  1.00 90.77  ?  26  ASP B CB    1 
ATOM   3427 C  CG    . ASP B 1 26  ? 12.397  -28.755 21.507  1.00 95.03  ?  26  ASP B CG    1 
ATOM   3428 O  OD1   . ASP B 1 26  ? 13.363  -28.649 20.707  1.00 72.17  ?  26  ASP B OD1   1 
ATOM   3429 O  OD2   . ASP B 1 26  ? 12.419  -28.370 22.718  1.00 85.54  ?  26  ASP B OD2   1 
ATOM   3430 N  N     . SER B 1 27  ? 8.642   -29.394 18.407  1.00 65.68  ?  27  SER B N     1 
ATOM   3431 C  CA    . SER B 1 27  ? 7.419   -30.178 18.051  1.00 61.12  ?  27  SER B CA    1 
ATOM   3432 C  C     . SER B 1 27  ? 6.998   -29.888 16.612  1.00 60.13  ?  27  SER B C     1 
ATOM   3433 O  O     . SER B 1 27  ? 6.254   -28.946 16.355  1.00 57.24  ?  27  SER B O     1 
ATOM   3434 C  CB    . SER B 1 27  ? 6.264   -29.876 18.991  1.00 58.73  ?  27  SER B CB    1 
ATOM   3435 O  OG    . SER B 1 27  ? 6.279   -30.680 20.139  1.00 50.80  ?  27  SER B OG    1 
ATOM   3436 N  N     . PRO B 1 28  ? 7.449   -30.679 15.619  1.00 63.93  ?  28  PRO B N     1 
ATOM   3437 C  CA    . PRO B 1 28  ? 7.204   -30.304 14.230  1.00 67.16  ?  28  PRO B CA    1 
ATOM   3438 C  C     . PRO B 1 28  ? 5.705   -30.481 13.914  1.00 57.07  ?  28  PRO B C     1 
ATOM   3439 O  O     . PRO B 1 28  ? 5.095   -31.478 14.292  1.00 48.68  ?  28  PRO B O     1 
ATOM   3440 C  CB    . PRO B 1 28  ? 8.145   -31.239 13.446  1.00 70.85  ?  28  PRO B CB    1 
ATOM   3441 C  CG    . PRO B 1 28  ? 8.325   -32.466 14.356  1.00 68.10  ?  28  PRO B CG    1 
ATOM   3442 C  CD    . PRO B 1 28  ? 8.173   -31.957 15.772  1.00 66.55  ?  28  PRO B CD    1 
ATOM   3443 N  N     . GLY B 1 29  ? 5.129   -29.485 13.258  1.00 50.04  ?  29  GLY B N     1 
ATOM   3444 C  CA    . GLY B 1 29  ? 3.730   -29.550 12.800  1.00 51.90  ?  29  GLY B CA    1 
ATOM   3445 C  C     . GLY B 1 29  ? 2.712   -29.432 13.925  1.00 46.03  ?  29  GLY B C     1 
ATOM   3446 O  O     . GLY B 1 29  ? 1.566   -29.779 13.677  1.00 42.23  ?  29  GLY B O     1 
ATOM   3447 N  N     . LYS B 1 30  ? 3.111   -28.926 15.090  1.00 39.22  ?  30  LYS B N     1 
ATOM   3448 C  CA    . LYS B 1 30  ? 2.218   -28.648 16.242  1.00 38.69  ?  30  LYS B CA    1 
ATOM   3449 C  C     . LYS B 1 30  ? 2.352   -27.184 16.665  1.00 36.51  ?  30  LYS B C     1 
ATOM   3450 O  O     . LYS B 1 30  ? 3.401   -26.595 16.433  1.00 38.03  ?  30  LYS B O     1 
ATOM   3451 C  CB    . LYS B 1 30  ? 2.526   -29.593 17.397  1.00 39.18  ?  30  LYS B CB    1 
ATOM   3452 C  CG    . LYS B 1 30  ? 1.992   -31.002 17.198  1.00 45.78  ?  30  LYS B CG    1 
ATOM   3453 C  CD    . LYS B 1 30  ? 2.415   -31.930 18.299  1.00 48.12  ?  30  LYS B CD    1 
ATOM   3454 C  CE    . LYS B 1 30  ? 1.559   -33.168 18.399  1.00 51.78  ?  30  LYS B CE    1 
ATOM   3455 N  NZ    . LYS B 1 30  ? 1.844   -34.080 17.266  1.00 57.19  ?  30  LYS B NZ    1 
ATOM   3456 N  N     . VAL B 1 31  ? 1.294   -26.618 17.240  1.00 34.94  ?  31  VAL B N     1 
ATOM   3457 C  CA    . VAL B 1 31  ? 1.265   -25.206 17.709  1.00 31.23  ?  31  VAL B CA    1 
ATOM   3458 C  C     . VAL B 1 31  ? 0.576   -25.149 19.063  1.00 34.60  ?  31  VAL B C     1 
ATOM   3459 O  O     . VAL B 1 31  ? -0.147  -26.102 19.419  1.00 34.08  ?  31  VAL B O     1 
ATOM   3460 C  CB    . VAL B 1 31  ? 0.591   -24.280 16.694  1.00 33.15  ?  31  VAL B CB    1 
ATOM   3461 C  CG1   . VAL B 1 31  ? 1.440   -24.193 15.413  1.00 34.41  ?  31  VAL B CG1   1 
ATOM   3462 C  CG2   . VAL B 1 31  ? -0.831  -24.697 16.391  1.00 33.78  ?  31  VAL B CG2   1 
ATOM   3463 N  N     . LEU B 1 32  ? 0.801   -24.041 19.766  1.00 39.45  ?  32  LEU B N     1 
ATOM   3464 C  CA    . LEU B 1 32  ? 0.168   -23.697 21.056  1.00 37.15  ?  32  LEU B CA    1 
ATOM   3465 C  C     . LEU B 1 32  ? -0.843  -22.579 20.817  1.00 38.46  ?  32  LEU B C     1 
ATOM   3466 O  O     . LEU B 1 32  ? -0.443  -21.501 20.329  1.00 33.05  ?  32  LEU B O     1 
ATOM   3467 C  CB    . LEU B 1 32  ? 1.242   -23.277 22.056  1.00 37.56  ?  32  LEU B CB    1 
ATOM   3468 C  CG    . LEU B 1 32  ? 0.705   -22.805 23.397  1.00 39.36  ?  32  LEU B CG    1 
ATOM   3469 C  CD1   . LEU B 1 32  ? 0.504   -23.994 24.305  1.00 42.52  ?  32  LEU B CD1   1 
ATOM   3470 C  CD2   . LEU B 1 32  ? 1.634   -21.783 24.041  1.00 41.63  ?  32  LEU B CD2   1 
ATOM   3471 N  N     . LEU B 1 33  ? -2.102  -22.837 21.190  1.00 40.02  ?  33  LEU B N     1 
ATOM   3472 C  CA    . LEU B 1 33  ? -3.201  -21.856 21.112  1.00 38.38  ?  33  LEU B CA    1 
ATOM   3473 C  C     . LEU B 1 33  ? -3.482  -21.340 22.513  1.00 38.71  ?  33  LEU B C     1 
ATOM   3474 O  O     . LEU B 1 33  ? -4.061  -22.094 23.319  1.00 44.66  ?  33  LEU B O     1 
ATOM   3475 C  CB    . LEU B 1 33  ? -4.425  -22.506 20.453  1.00 46.98  ?  33  LEU B CB    1 
ATOM   3476 C  CG    . LEU B 1 33  ? -4.202  -22.848 18.974  1.00 46.88  ?  33  LEU B CG    1 
ATOM   3477 C  CD1   . LEU B 1 33  ? -3.670  -24.259 18.872  1.00 46.96  ?  33  LEU B CD1   1 
ATOM   3478 C  CD2   . LEU B 1 33  ? -5.439  -22.641 18.139  1.00 49.21  ?  33  LEU B CD2   1 
ATOM   3479 N  N     . GLN B 1 34  ? -3.045  -20.103 22.759  1.00 35.88  ?  34  GLN B N     1 
ATOM   3480 C  CA    . GLN B 1 34  ? -3.192  -19.353 24.021  1.00 34.58  ?  34  GLN B CA    1 
ATOM   3481 C  C     . GLN B 1 34  ? -4.458  -18.505 23.938  1.00 32.03  ?  34  GLN B C     1 
ATOM   3482 O  O     . GLN B 1 34  ? -4.521  -17.643 23.082  1.00 33.50  ?  34  GLN B O     1 
ATOM   3483 C  CB    . GLN B 1 34  ? -1.943  -18.480 24.221  1.00 36.94  ?  34  GLN B CB    1 
ATOM   3484 C  CG    . GLN B 1 34  ? -1.953  -17.608 25.474  1.00 36.54  ?  34  GLN B CG    1 
ATOM   3485 C  CD    . GLN B 1 34  ? -1.956  -18.412 26.747  1.00 35.05  ?  34  GLN B CD    1 
ATOM   3486 O  OE1   . GLN B 1 34  ? -2.916  -18.395 27.516  1.00 45.18  ?  34  GLN B OE1   1 
ATOM   3487 N  NE2   . GLN B 1 34  ? -0.880  -19.136 26.973  1.00 33.05  ?  34  GLN B NE2   1 
ATOM   3488 N  N     . SER B 1 35  ? -5.411  -18.749 24.828  1.00 37.54  ?  35  SER B N     1 
ATOM   3489 C  CA    . SER B 1 35  ? -6.694  -18.011 24.934  1.00 35.60  ?  35  SER B CA    1 
ATOM   3490 C  C     . SER B 1 35  ? -6.429  -16.714 25.701  1.00 38.63  ?  35  SER B C     1 
ATOM   3491 O  O     . SER B 1 35  ? -5.471  -16.701 26.548  1.00 41.55  ?  35  SER B O     1 
ATOM   3492 C  CB    . SER B 1 35  ? -7.745  -18.848 25.601  1.00 37.29  ?  35  SER B CB    1 
ATOM   3493 O  OG    . SER B 1 35  ? -8.256  -19.815 24.703  1.00 40.40  ?  35  SER B OG    1 
ATOM   3494 N  N     . LYS B 1 36  ? -7.194  -15.665 25.399  1.00 37.91  ?  36  LYS B N     1 
ATOM   3495 C  CA    . LYS B 1 36  ? -7.098  -14.312 26.011  1.00 41.12  ?  36  LYS B CA    1 
ATOM   3496 C  C     . LYS B 1 36  ? -8.388  -14.026 26.766  1.00 41.07  ?  36  LYS B C     1 
ATOM   3497 O  O     . LYS B 1 36  ? -9.395  -14.625 26.397  1.00 38.75  ?  36  LYS B O     1 
ATOM   3498 C  CB    . LYS B 1 36  ? -6.871  -13.272 24.925  1.00 45.90  ?  36  LYS B CB    1 
ATOM   3499 C  CG    . LYS B 1 36  ? -5.555  -13.415 24.174  1.00 51.93  ?  36  LYS B CG    1 
ATOM   3500 C  CD    . LYS B 1 36  ? -5.605  -12.890 22.759  1.00 53.13  ?  36  LYS B CD    1 
ATOM   3501 C  CE    . LYS B 1 36  ? -6.029  -11.442 22.672  1.00 56.73  ?  36  LYS B CE    1 
ATOM   3502 N  NZ    . LYS B 1 36  ? -5.834  -10.908 21.309  1.00 59.04  ?  36  LYS B NZ    1 
ATOM   3503 N  N     . ASP B 1 37  ? -8.338  -13.184 27.802  1.00 45.25  ?  37  ASP B N     1 
ATOM   3504 C  CA    . ASP B 1 37  ? -9.515  -12.846 28.657  1.00 49.19  ?  37  ASP B CA    1 
ATOM   3505 C  C     . ASP B 1 37  ? -10.374 -11.796 27.950  1.00 43.52  ?  37  ASP B C     1 
ATOM   3506 O  O     . ASP B 1 37  ? -10.649 -10.746 28.548  1.00 48.07  ?  37  ASP B O     1 
ATOM   3507 C  CB    . ASP B 1 37  ? -9.089  -12.379 30.050  1.00 52.32  ?  37  ASP B CB    1 
ATOM   3508 C  CG    . ASP B 1 37  ? -8.679  -13.494 30.989  1.00 60.45  ?  37  ASP B CG    1 
ATOM   3509 O  OD1   . ASP B 1 37  ? -9.293  -14.603 30.915  1.00 62.39  ?  37  ASP B OD1   1 
ATOM   3510 O  OD2   . ASP B 1 37  ? -7.772  -13.231 31.805  1.00 60.24  ?  37  ASP B OD2   1 
ATOM   3511 N  N     . GLN B 1 38  ? -10.792 -12.098 26.734  1.00 43.21  ?  38  GLN B N     1 
ATOM   3512 C  CA    . GLN B 1 38  ? -11.566 -11.161 25.892  1.00 49.41  ?  38  GLN B CA    1 
ATOM   3513 C  C     . GLN B 1 38  ? -12.842 -11.833 25.413  1.00 49.26  ?  38  GLN B C     1 
ATOM   3514 O  O     . GLN B 1 38  ? -12.784 -12.966 24.938  1.00 53.15  ?  38  GLN B O     1 
ATOM   3515 C  CB    . GLN B 1 38  ? -10.791 -10.782 24.643  1.00 52.16  ?  38  GLN B CB    1 
ATOM   3516 C  CG    . GLN B 1 38  ? -9.633  -9.856  24.918  1.00 60.10  ?  38  GLN B CG    1 
ATOM   3517 C  CD    . GLN B 1 38  ? -10.152 -8.465  25.149  1.00 68.52  ?  38  GLN B CD    1 
ATOM   3518 O  OE1   . GLN B 1 38  ? -10.876 -7.908  24.321  1.00 70.09  ?  38  GLN B OE1   1 
ATOM   3519 N  NE2   . GLN B 1 38  ? -9.789  -7.899  26.287  1.00 66.71  ?  38  GLN B NE2   1 
ATOM   3520 N  N     . ILE B 1 39  ? -13.952 -11.124 25.527  1.00 47.95  ?  39  ILE B N     1 
ATOM   3521 C  CA    . ILE B 1 39  ? -15.243 -11.557 24.935  1.00 49.82  ?  39  ILE B CA    1 
ATOM   3522 C  C     . ILE B 1 39  ? -15.637 -10.486 23.918  1.00 53.35  ?  39  ILE B C     1 
ATOM   3523 O  O     . ILE B 1 39  ? -15.365 -9.323  24.171  1.00 51.71  ?  39  ILE B O     1 
ATOM   3524 C  CB    . ILE B 1 39  ? -16.304 -11.790 26.025  1.00 49.60  ?  39  ILE B CB    1 
ATOM   3525 C  CG1   . ILE B 1 39  ? -17.465 -12.626 25.488  1.00 54.00  ?  39  ILE B CG1   1 
ATOM   3526 C  CG2   . ILE B 1 39  ? -16.781 -10.472 26.628  1.00 53.23  ?  39  ILE B CG2   1 
ATOM   3527 C  CD1   . ILE B 1 39  ? -18.409 -13.093 26.583  1.00 54.73  ?  39  ILE B CD1   1 
ATOM   3528 N  N     . THR B 1 40  ? -16.204 -10.877 22.782  1.00 55.36  ?  40  THR B N     1 
ATOM   3529 C  CA    . THR B 1 40  ? -16.602 -9.950  21.695  1.00 54.68  ?  40  THR B CA    1 
ATOM   3530 C  C     . THR B 1 40  ? -17.946 -10.422 21.135  1.00 58.81  ?  40  THR B C     1 
ATOM   3531 O  O     . THR B 1 40  ? -18.308 -11.574 21.415  1.00 54.63  ?  40  THR B O     1 
ATOM   3532 C  CB    . THR B 1 40  ? -15.515 -9.875  20.619  1.00 56.78  ?  40  THR B CB    1 
ATOM   3533 O  OG1   . THR B 1 40  ? -15.476 -11.125 19.937  1.00 63.22  ?  40  THR B OG1   1 
ATOM   3534 C  CG2   . THR B 1 40  ? -14.145 -9.591  21.188  1.00 57.30  ?  40  THR B CG2   1 
ATOM   3535 N  N     . ALA B 1 41  ? -18.651 -9.552  20.402  1.00 57.51  ?  41  ALA B N     1 
ATOM   3536 C  CA    . ALA B 1 41  ? -19.876 -9.880  19.640  1.00 54.81  ?  41  ALA B CA    1 
ATOM   3537 C  C     . ALA B 1 41  ? -19.935 -9.045  18.357  1.00 54.96  ?  41  ALA B C     1 
ATOM   3538 O  O     . ALA B 1 41  ? -19.483 -7.875  18.388  1.00 61.83  ?  41  ALA B O     1 
ATOM   3539 C  CB    . ALA B 1 41  ? -21.091 -9.682  20.514  1.00 56.04  ?  41  ALA B CB    1 
ATOM   3540 N  N     . GLY B 1 42  ? -20.507 -9.636  17.298  1.00 70.69  ?  42  GLY B N     1 
ATOM   3541 C  CA    . GLY B 1 42  ? -20.800 -8.986  16.004  1.00 74.84  ?  42  GLY B CA    1 
ATOM   3542 C  C     . GLY B 1 42  ? -19.523 -8.546  15.300  1.00 86.25  ?  42  GLY B C     1 
ATOM   3543 O  O     . GLY B 1 42  ? -18.424 -9.084  15.616  1.00 74.27  ?  42  GLY B O     1 
ATOM   3544 N  N     . ASN B 1 43  ? -19.649 -7.569  14.403  1.00 98.62  ?  43  ASN B N     1 
ATOM   3545 C  CA    . ASN B 1 43  ? -18.515 -7.003  13.633  1.00 108.01 ?  43  ASN B CA    1 
ATOM   3546 C  C     . ASN B 1 43  ? -18.052 -5.701  14.287  1.00 110.78 ?  43  ASN B C     1 
ATOM   3547 O  O     . ASN B 1 43  ? -16.937 -5.287  13.960  1.00 102.86 ?  43  ASN B O     1 
ATOM   3548 C  CB    . ASN B 1 43  ? -18.907 -6.811  12.171  1.00 124.83 ?  43  ASN B CB    1 
ATOM   3549 C  CG    . ASN B 1 43  ? -19.100 -8.116  11.422  1.00 141.63 ?  43  ASN B CG    1 
ATOM   3550 O  OD1   . ASN B 1 43  ? -19.743 -8.136  10.373  1.00 144.47 ?  43  ASN B OD1   1 
ATOM   3551 N  ND2   . ASN B 1 43  ? -18.534 -9.206  11.926  1.00 143.23 ?  43  ASN B ND2   1 
ATOM   3552 N  N     . ALA B 1 44  ? -18.823 -5.185  15.258  1.00 126.40 ?  44  ALA B N     1 
ATOM   3553 C  CA    . ALA B 1 44  ? -18.749 -3.809  15.804  1.00 119.86 ?  44  ALA B CA    1 
ATOM   3554 C  C     . ALA B 1 44  ? -18.035 -3.795  17.171  1.00 112.26 ?  44  ALA B C     1 
ATOM   3555 O  O     . ALA B 1 44  ? -17.245 -4.740  17.470  1.00 79.59  ?  44  ALA B O     1 
ATOM   3556 C  CB    . ALA B 1 44  ? -20.152 -3.235  15.871  1.00 109.08 ?  44  ALA B CB    1 
ATOM   3557 N  N     . ALA B 1 45  ? -18.345 -2.774  17.982  1.00 114.14 ?  45  ALA B N     1 
ATOM   3558 C  CA    . ALA B 1 45  ? -17.542 -2.288  19.132  1.00 106.78 ?  45  ALA B CA    1 
ATOM   3559 C  C     . ALA B 1 45  ? -17.842 -3.084  20.406  1.00 97.25  ?  45  ALA B C     1 
ATOM   3560 O  O     . ALA B 1 45  ? -17.287 -2.705  21.479  1.00 93.34  ?  45  ALA B O     1 
ATOM   3561 C  CB    . ALA B 1 45  ? -17.807 -0.813  19.352  1.00 100.58 ?  45  ALA B CB    1 
ATOM   3562 N  N     . ARG B 1 46  ? -18.653 -4.147  20.314  1.00 79.38  ?  46  ARG B N     1 
ATOM   3563 C  CA    . ARG B 1 46  ? -18.924 -5.029  21.477  1.00 77.14  ?  46  ARG B CA    1 
ATOM   3564 C  C     . ARG B 1 46  ? -17.661 -5.864  21.753  1.00 74.46  ?  46  ARG B C     1 
ATOM   3565 O  O     . ARG B 1 46  ? -17.435 -6.886  21.075  1.00 67.92  ?  46  ARG B O     1 
ATOM   3566 C  CB    . ARG B 1 46  ? -20.187 -5.867  21.271  1.00 69.36  ?  46  ARG B CB    1 
ATOM   3567 C  CG    . ARG B 1 46  ? -20.748 -6.423  22.574  1.00 72.18  ?  46  ARG B CG    1 
ATOM   3568 C  CD    . ARG B 1 46  ? -22.248 -6.682  22.543  1.00 69.93  ?  46  ARG B CD    1 
ATOM   3569 N  NE    . ARG B 1 46  ? -23.007 -5.497  22.912  1.00 64.38  ?  46  ARG B NE    1 
ATOM   3570 C  CZ    . ARG B 1 46  ? -24.231 -5.500  23.409  1.00 60.60  ?  46  ARG B CZ    1 
ATOM   3571 N  NH1   . ARG B 1 46  ? -24.862 -6.644  23.617  1.00 65.30  ?  46  ARG B NH1   1 
ATOM   3572 N  NH2   . ARG B 1 46  ? -24.821 -4.353  23.705  1.00 61.00  ?  46  ARG B NH2   1 
ATOM   3573 N  N     . LYS B 1 47  ? -16.845 -5.384  22.685  1.00 71.01  ?  47  LYS B N     1 
ATOM   3574 C  CA    . LYS B 1 47  ? -15.584 -6.015  23.147  1.00 74.23  ?  47  LYS B CA    1 
ATOM   3575 C  C     . LYS B 1 47  ? -15.460 -5.692  24.641  1.00 74.49  ?  47  LYS B C     1 
ATOM   3576 O  O     . LYS B 1 47  ? -15.852 -4.588  25.055  1.00 74.38  ?  47  LYS B O     1 
ATOM   3577 C  CB    . LYS B 1 47  ? -14.369 -5.523  22.349  1.00 73.93  ?  47  LYS B CB    1 
ATOM   3578 C  CG    . LYS B 1 47  ? -14.086 -4.043  22.533  1.00 92.22  ?  47  LYS B CG    1 
ATOM   3579 C  CD    . LYS B 1 47  ? -12.829 -3.519  21.903  1.00 101.99 ?  47  LYS B CD    1 
ATOM   3580 C  CE    . LYS B 1 47  ? -12.501 -2.131  22.435  1.00 100.25 ?  47  LYS B CE    1 
ATOM   3581 N  NZ    . LYS B 1 47  ? -11.835 -1.288  21.415  1.00 108.79 ?  47  LYS B NZ    1 
ATOM   3582 N  N     . ASN B 1 48  ? -14.960 -6.641  25.423  1.00 72.01  ?  48  ASN B N     1 
ATOM   3583 C  CA    . ASN B 1 48  ? -14.814 -6.488  26.889  1.00 62.51  ?  48  ASN B CA    1 
ATOM   3584 C  C     . ASN B 1 48  ? -13.700 -7.392  27.378  1.00 56.66  ?  48  ASN B C     1 
ATOM   3585 O  O     . ASN B 1 48  ? -13.578 -8.513  26.893  1.00 52.21  ?  48  ASN B O     1 
ATOM   3586 C  CB    . ASN B 1 48  ? -16.104 -6.799  27.649  1.00 59.45  ?  48  ASN B CB    1 
ATOM   3587 C  CG    . ASN B 1 48  ? -17.106 -5.677  27.539  1.00 65.00  ?  48  ASN B CG    1 
ATOM   3588 O  OD1   . ASN B 1 48  ? -18.079 -5.788  26.783  1.00 59.44  ?  48  ASN B OD1   1 
ATOM   3589 N  ND2   . ASN B 1 48  ? -16.854 -4.601  28.280  1.00 60.15  ?  48  ASN B ND2   1 
ATOM   3590 N  N     . HIS B 1 49  ? -12.992 -6.894  28.365  1.00 58.54  ?  49  HIS B N     1 
ATOM   3591 C  CA    . HIS B 1 49  ? -12.103 -7.736  29.175  1.00 54.61  ?  49  HIS B CA    1 
ATOM   3592 C  C     . HIS B 1 49  ? -13.029 -8.461  30.147  1.00 52.55  ?  49  HIS B C     1 
ATOM   3593 O  O     . HIS B 1 49  ? -13.984 -7.844  30.630  1.00 54.22  ?  49  HIS B O     1 
ATOM   3594 C  CB    . HIS B 1 49  ? -11.050 -6.882  29.854  1.00 49.49  ?  49  HIS B CB    1 
ATOM   3595 C  CG    . HIS B 1 49  ? -10.149 -7.697  30.687  1.00 53.98  ?  49  HIS B CG    1 
ATOM   3596 N  ND1   . HIS B 1 49  ? -10.374 -7.855  32.043  1.00 61.31  ?  49  HIS B ND1   1 
ATOM   3597 C  CD2   . HIS B 1 49  ? -9.082  -8.457  30.350  1.00 57.07  ?  49  HIS B CD2   1 
ATOM   3598 C  CE1   . HIS B 1 49  ? -9.450  -8.664  32.524  1.00 71.17  ?  49  HIS B CE1   1 
ATOM   3599 N  NE2   . HIS B 1 49  ? -8.641  -9.049  31.502  1.00 63.07  ?  49  HIS B NE2   1 
ATOM   3600 N  N     . LEU B 1 50  ? -12.793 -9.742  30.355  1.00 46.67  ?  50  LEU B N     1 
ATOM   3601 C  CA    . LEU B 1 50  ? -13.577 -10.587 31.281  1.00 50.72  ?  50  LEU B CA    1 
ATOM   3602 C  C     . LEU B 1 50  ? -12.603 -11.582 31.911  1.00 56.03  ?  50  LEU B C     1 
ATOM   3603 O  O     . LEU B 1 50  ? -12.050 -12.421 31.171  1.00 51.84  ?  50  LEU B O     1 
ATOM   3604 C  CB    . LEU B 1 50  ? -14.692 -11.284 30.500  1.00 50.53  ?  50  LEU B CB    1 
ATOM   3605 C  CG    . LEU B 1 50  ? -15.709 -12.021 31.356  1.00 58.72  ?  50  LEU B CG    1 
ATOM   3606 C  CD1   . LEU B 1 50  ? -16.460 -11.032 32.222  1.00 71.02  ?  50  LEU B CD1   1 
ATOM   3607 C  CD2   . LEU B 1 50  ? -16.666 -12.825 30.491  1.00 63.88  ?  50  LEU B CD2   1 
ATOM   3608 N  N     . GLU B 1 51  ? -12.340 -11.444 33.211  1.00 59.72  ?  51  GLU B N     1 
ATOM   3609 C  CA    . GLU B 1 51  ? -11.290 -12.250 33.877  1.00 63.66  ?  51  GLU B CA    1 
ATOM   3610 C  C     . GLU B 1 51  ? -11.813 -13.687 34.037  1.00 53.11  ?  51  GLU B C     1 
ATOM   3611 O  O     . GLU B 1 51  ? -12.959 -13.859 34.497  1.00 50.95  ?  51  GLU B O     1 
ATOM   3612 C  CB    . GLU B 1 51  ? -10.855 -11.604 35.188  1.00 71.97  ?  51  GLU B CB    1 
ATOM   3613 C  CG    . GLU B 1 51  ? -9.565  -12.214 35.707  1.00 76.57  ?  51  GLU B CG    1 
ATOM   3614 C  CD    . GLU B 1 51  ? -8.721  -11.285 36.551  1.00 87.25  ?  51  GLU B CD    1 
ATOM   3615 O  OE1   . GLU B 1 51  ? -7.892  -11.811 37.376  1.00 68.42  ?  51  GLU B OE1   1 
ATOM   3616 O  OE2   . GLU B 1 51  ? -8.900  -10.042 36.385  1.00 89.82  ?  51  GLU B OE2   1 
ATOM   3617 N  N     . GLY B 1 52  ? -11.003 -14.676 33.627  1.00 52.08  ?  52  GLY B N     1 
ATOM   3618 C  CA    . GLY B 1 52  ? -11.326 -16.112 33.715  1.00 51.36  ?  52  GLY B CA    1 
ATOM   3619 C  C     . GLY B 1 52  ? -11.979 -16.653 32.449  1.00 48.54  ?  52  GLY B C     1 
ATOM   3620 O  O     . GLY B 1 52  ? -12.150 -17.888 32.348  1.00 46.10  ?  52  GLY B O     1 
ATOM   3621 N  N     . LYS B 1 53  ? -12.317 -15.795 31.492  1.00 40.28  ?  53  LYS B N     1 
ATOM   3622 C  CA    . LYS B 1 53  ? -12.879 -16.233 30.183  1.00 42.19  ?  53  LYS B CA    1 
ATOM   3623 C  C     . LYS B 1 53  ? -11.873 -17.148 29.468  1.00 39.82  ?  53  LYS B C     1 
ATOM   3624 O  O     . LYS B 1 53  ? -12.283 -18.216 28.966  1.00 43.41  ?  53  LYS B O     1 
ATOM   3625 C  CB    . LYS B 1 53  ? -13.293 -15.008 29.381  1.00 41.19  ?  53  LYS B CB    1 
ATOM   3626 C  CG    . LYS B 1 53  ? -13.525 -15.231 27.911  1.00 47.86  ?  53  LYS B CG    1 
ATOM   3627 C  CD    . LYS B 1 53  ? -14.762 -15.968 27.536  1.00 54.39  ?  53  LYS B CD    1 
ATOM   3628 C  CE    . LYS B 1 53  ? -15.095 -15.792 26.061  1.00 60.40  ?  53  LYS B CE    1 
ATOM   3629 N  NZ    . LYS B 1 53  ? -13.884 -15.766 25.185  1.00 59.53  ?  53  LYS B NZ    1 
ATOM   3630 N  N     . ALA B 1 54  ? -10.595 -16.774 29.436  1.00 38.87  ?  54  ALA B N     1 
ATOM   3631 C  CA    . ALA B 1 54  ? -9.524  -17.567 28.787  1.00 39.22  ?  54  ALA B CA    1 
ATOM   3632 C  C     . ALA B 1 54  ? -9.516  -19.004 29.328  1.00 37.20  ?  54  ALA B C     1 
ATOM   3633 O  O     . ALA B 1 54  ? -9.372  -19.929 28.506  1.00 36.81  ?  54  ALA B O     1 
ATOM   3634 C  CB    . ALA B 1 54  ? -8.188  -16.919 29.006  1.00 41.92  ?  54  ALA B CB    1 
ATOM   3635 N  N     . ALA B 1 55  ? -9.647  -19.167 30.657  1.00 33.91  ?  55  ALA B N     1 
ATOM   3636 C  CA    . ALA B 1 55  ? -9.607  -20.470 31.365  1.00 35.87  ?  55  ALA B CA    1 
ATOM   3637 C  C     . ALA B 1 55  ? -10.876 -21.297 31.069  1.00 37.53  ?  55  ALA B C     1 
ATOM   3638 O  O     . ALA B 1 55  ? -10.792 -22.518 30.947  1.00 30.04  ?  55  ALA B O     1 
ATOM   3639 C  CB    . ALA B 1 55  ? -9.454  -20.231 32.827  1.00 36.03  ?  55  ALA B CB    1 
ATOM   3640 N  N     . ILE B 1 56  ? -12.011 -20.612 30.973  1.00 37.60  ?  56  ILE B N     1 
ATOM   3641 C  CA    . ILE B 1 56  ? -13.327 -21.211 30.665  1.00 40.10  ?  56  ILE B CA    1 
ATOM   3642 C  C     . ILE B 1 56  ? -13.352 -21.687 29.212  1.00 33.93  ?  56  ILE B C     1 
ATOM   3643 O  O     . ILE B 1 56  ? -13.718 -22.849 29.018  1.00 36.53  ?  56  ILE B O     1 
ATOM   3644 C  CB    . ILE B 1 56  ? -14.451 -20.213 31.000  1.00 44.81  ?  56  ILE B CB    1 
ATOM   3645 C  CG1   . ILE B 1 56  ? -14.609 -20.076 32.513  1.00 41.66  ?  56  ILE B CG1   1 
ATOM   3646 C  CG2   . ILE B 1 56  ? -15.758 -20.616 30.341  1.00 42.38  ?  56  ILE B CG2   1 
ATOM   3647 C  CD1   . ILE B 1 56  ? -15.417 -18.849 32.952  1.00 46.38  ?  56  ILE B CD1   1 
ATOM   3648 N  N     . SER B 1 57  ? -12.980 -20.852 28.243  1.00 36.50  ?  57  SER B N     1 
ATOM   3649 C  CA    . SER B 1 57  ? -12.884 -21.241 26.794  1.00 37.66  ?  57  SER B CA    1 
ATOM   3650 C  C     . SER B 1 57  ? -11.952 -22.447 26.612  1.00 37.24  ?  57  SER B C     1 
ATOM   3651 O  O     . SER B 1 57  ? -12.322 -23.423 25.936  1.00 37.43  ?  57  SER B O     1 
ATOM   3652 C  CB    . SER B 1 57  ? -12.440 -20.116 25.923  1.00 41.08  ?  57  SER B CB    1 
ATOM   3653 O  OG    . SER B 1 57  ? -13.465 -19.124 25.859  1.00 53.48  ?  57  SER B OG    1 
ATOM   3654 N  N     . ASN B 1 58  ? -10.782 -22.387 27.231  1.00 35.67  ?  58  ASN B N     1 
ATOM   3655 C  CA    . ASN B 1 58  ? -9.759  -23.449 27.110  1.00 33.35  ?  58  ASN B CA    1 
ATOM   3656 C  C     . ASN B 1 58  ? -10.301 -24.752 27.698  1.00 28.76  ?  58  ASN B C     1 
ATOM   3657 O  O     . ASN B 1 58  ? -10.069 -25.797 27.100  1.00 26.97  ?  58  ASN B O     1 
ATOM   3658 C  CB    . ASN B 1 58  ? -8.455  -23.031 27.774  1.00 31.98  ?  58  ASN B CB    1 
ATOM   3659 C  CG    . ASN B 1 58  ? -7.308  -23.883 27.319  1.00 31.05  ?  58  ASN B CG    1 
ATOM   3660 O  OD1   . ASN B 1 58  ? -7.034  -23.917 26.119  1.00 30.46  ?  58  ASN B OD1   1 
ATOM   3661 N  ND2   . ASN B 1 58  ? -6.672  -24.575 28.265  1.00 32.38  ?  58  ASN B ND2   1 
ATOM   3662 N  N     . LYS B 1 59  ? -10.961 -24.676 28.844  1.00 27.22  ?  59  LYS B N     1 
ATOM   3663 C  CA    . LYS B 1 59  ? -11.490 -25.855 29.550  1.00 28.07  ?  59  LYS B CA    1 
ATOM   3664 C  C     . LYS B 1 59  ? -12.601 -26.507 28.719  1.00 27.43  ?  59  LYS B C     1 
ATOM   3665 O  O     . LYS B 1 59  ? -12.537 -27.717 28.519  1.00 27.85  ?  59  LYS B O     1 
ATOM   3666 C  CB    . LYS B 1 59  ? -12.037 -25.513 30.932  1.00 32.37  ?  59  LYS B CB    1 
ATOM   3667 C  CG    . LYS B 1 59  ? -12.658 -26.709 31.630  1.00 31.95  ?  59  LYS B CG    1 
ATOM   3668 C  CD    . LYS B 1 59  ? -13.152 -26.404 32.973  1.00 39.68  ?  59  LYS B CD    1 
ATOM   3669 C  CE    . LYS B 1 59  ? -13.532 -27.674 33.710  1.00 46.02  ?  59  LYS B CE    1 
ATOM   3670 N  NZ    . LYS B 1 59  ? -14.166 -27.355 35.007  1.00 43.82  ?  59  LYS B NZ    1 
ATOM   3671 N  N     . ILE B 1 60  ? -13.533 -25.726 28.201  1.00 26.98  ?  60  ILE B N     1 
ATOM   3672 C  CA    . ILE B 1 60  ? -14.652 -26.231 27.352  1.00 26.22  ?  60  ILE B CA    1 
ATOM   3673 C  C     . ILE B 1 60  ? -14.100 -26.903 26.090  1.00 27.43  ?  60  ILE B C     1 
ATOM   3674 O  O     . ILE B 1 60  ? -14.410 -28.099 25.855  1.00 29.65  ?  60  ILE B O     1 
ATOM   3675 C  CB    . ILE B 1 60  ? -15.654 -25.116 27.047  1.00 27.89  ?  60  ILE B CB    1 
ATOM   3676 C  CG1   . ILE B 1 60  ? -16.342 -24.649 28.342  1.00 30.61  ?  60  ILE B CG1   1 
ATOM   3677 C  CG2   . ILE B 1 60  ? -16.668 -25.607 26.034  1.00 28.42  ?  60  ILE B CG2   1 
ATOM   3678 C  CD1   . ILE B 1 60  ? -17.167 -23.425 28.154  1.00 30.60  ?  60  ILE B CD1   1 
ATOM   3679 N  N     . THR B 1 61  ? -13.281 -26.220 25.304  1.00 29.05  ?  61  THR B N     1 
ATOM   3680 C  CA    . THR B 1 61  ? -12.749 -26.796 24.041  1.00 30.39  ?  61  THR B CA    1 
ATOM   3681 C  C     . THR B 1 61  ? -11.902 -28.038 24.318  1.00 33.69  ?  61  THR B C     1 
ATOM   3682 O  O     . THR B 1 61  ? -11.910 -28.969 23.482  1.00 31.93  ?  61  THR B O     1 
ATOM   3683 C  CB    . THR B 1 61  ? -12.009 -25.767 23.205  1.00 33.16  ?  61  THR B CB    1 
ATOM   3684 O  OG1   . THR B 1 61  ? -11.980 -26.290 21.877  1.00 34.01  ?  61  THR B OG1   1 
ATOM   3685 C  CG2   . THR B 1 61  ? -10.645 -25.468 23.748  1.00 35.13  ?  61  THR B CG2   1 
ATOM   3686 N  N     . SER B 1 62  ? -11.196 -28.062 25.442  1.00 31.49  ?  62  SER B N     1 
ATOM   3687 C  CA    . SER B 1 62  ? -10.290 -29.176 25.796  1.00 29.88  ?  62  SER B CA    1 
ATOM   3688 C  C     . SER B 1 62  ? -11.134 -30.408 26.135  1.00 31.75  ?  62  SER B C     1 
ATOM   3689 O  O     . SER B 1 62  ? -10.802 -31.484 25.626  1.00 32.16  ?  62  SER B O     1 
ATOM   3690 C  CB    . SER B 1 62  ? -9.346  -28.781 26.905  1.00 31.97  ?  62  SER B CB    1 
ATOM   3691 O  OG    . SER B 1 62  ? -8.366  -27.871 26.403  1.00 33.64  ?  62  SER B OG    1 
ATOM   3692 N  N     . CYS B 1 63  ? -12.193 -30.241 26.939  1.00 30.24  ?  63  CYS B N     1 
ATOM   3693 C  CA    . CYS B 1 63  ? -13.183 -31.307 27.248  1.00 30.95  ?  63  CYS B CA    1 
ATOM   3694 C  C     . CYS B 1 63  ? -13.923 -31.725 25.963  1.00 32.63  ?  63  CYS B C     1 
ATOM   3695 O  O     . CYS B 1 63  ? -13.996 -32.934 25.700  1.00 29.58  ?  63  CYS B O     1 
ATOM   3696 C  CB    . CYS B 1 63  ? -14.197 -30.852 28.299  1.00 34.07  ?  63  CYS B CB    1 
ATOM   3697 S  SG    . CYS B 1 63  ? -13.477 -30.659 29.963  1.00 38.59  ?  63  CYS B SG    1 
ATOM   3698 N  N     . ILE B 1 64  ? -14.456 -30.777 25.187  1.00 29.32  ?  64  ILE B N     1 
ATOM   3699 C  CA    . ILE B 1 64  ? -15.263 -31.137 23.994  1.00 31.85  ?  64  ILE B CA    1 
ATOM   3700 C  C     . ILE B 1 64  ? -14.348 -31.846 22.973  1.00 30.98  ?  64  ILE B C     1 
ATOM   3701 O  O     . ILE B 1 64  ? -14.783 -32.842 22.402  1.00 30.09  ?  64  ILE B O     1 
ATOM   3702 C  CB    . ILE B 1 64  ? -15.952 -29.890 23.397  1.00 33.52  ?  64  ILE B CB    1 
ATOM   3703 C  CG1   . ILE B 1 64  ? -17.006 -29.317 24.332  1.00 31.07  ?  64  ILE B CG1   1 
ATOM   3704 C  CG2   . ILE B 1 64  ? -16.540 -30.179 22.025  1.00 35.37  ?  64  ILE B CG2   1 
ATOM   3705 C  CD1   . ILE B 1 64  ? -18.098 -30.286 24.696  1.00 32.33  ?  64  ILE B CD1   1 
ATOM   3706 N  N     . PHE B 1 65  ? -13.119 -31.385 22.762  1.00 28.61  ?  65  PHE B N     1 
ATOM   3707 C  CA    . PHE B 1 65  ? -12.227 -32.009 21.756  1.00 30.21  ?  65  PHE B CA    1 
ATOM   3708 C  C     . PHE B 1 65  ? -11.824 -33.410 22.213  1.00 29.51  ?  65  PHE B C     1 
ATOM   3709 O  O     . PHE B 1 65  ? -11.745 -34.302 21.373  1.00 33.26  ?  65  PHE B O     1 
ATOM   3710 C  CB    . PHE B 1 65  ? -10.998 -31.151 21.474  1.00 30.22  ?  65  PHE B CB    1 
ATOM   3711 C  CG    . PHE B 1 65  ? -11.192 -30.033 20.473  1.00 29.80  ?  65  PHE B CG    1 
ATOM   3712 C  CD1   . PHE B 1 65  ? -12.340 -29.942 19.705  1.00 31.76  ?  65  PHE B CD1   1 
ATOM   3713 C  CD2   . PHE B 1 65  ? -10.211 -29.064 20.315  1.00 28.95  ?  65  PHE B CD2   1 
ATOM   3714 C  CE1   . PHE B 1 65  ? -12.509 -28.910 18.802  1.00 31.09  ?  65  PHE B CE1   1 
ATOM   3715 C  CE2   . PHE B 1 65  ? -10.380 -28.031 19.415  1.00 35.60  ?  65  PHE B CE2   1 
ATOM   3716 C  CZ    . PHE B 1 65  ? -11.528 -27.959 18.658  1.00 35.05  ?  65  PHE B CZ    1 
ATOM   3717 N  N     . GLN B 1 66  ? -11.614 -33.613 23.505  1.00 28.44  ?  66  GLN B N     1 
ATOM   3718 C  CA    . GLN B 1 66  ? -11.244 -34.947 24.027  1.00 32.13  ?  66  GLN B CA    1 
ATOM   3719 C  C     . GLN B 1 66  ? -12.425 -35.899 23.819  1.00 31.92  ?  66  GLN B C     1 
ATOM   3720 O  O     . GLN B 1 66  ? -12.193 -37.059 23.508  1.00 29.87  ?  66  GLN B O     1 
ATOM   3721 C  CB    . GLN B 1 66  ? -10.842 -34.866 25.500  1.00 34.07  ?  66  GLN B CB    1 
ATOM   3722 C  CG    . GLN B 1 66  ? -10.293 -36.162 26.092  1.00 40.89  ?  66  GLN B CG    1 
ATOM   3723 C  CD    . GLN B 1 66  ? -10.006 -36.035 27.583  1.00 43.06  ?  66  GLN B CD    1 
ATOM   3724 O  OE1   . GLN B 1 66  ? -10.602 -36.735 28.381  1.00 38.59  ?  66  GLN B OE1   1 
ATOM   3725 N  NE2   . GLN B 1 66  ? -9.122  -35.116 27.979  1.00 37.56  ?  66  GLN B NE2   1 
ATOM   3726 N  N     . LEU B 1 67  ? -13.645 -35.420 24.061  1.00 30.27  ?  67  LEU B N     1 
ATOM   3727 C  CA    . LEU B 1 67  ? -14.888 -36.196 23.904  1.00 31.82  ?  67  LEU B CA    1 
ATOM   3728 C  C     . LEU B 1 67  ? -15.014 -36.622 22.433  1.00 33.37  ?  67  LEU B C     1 
ATOM   3729 O  O     . LEU B 1 67  ? -15.231 -37.803 22.159  1.00 32.18  ?  67  LEU B O     1 
ATOM   3730 C  CB    . LEU B 1 67  ? -16.059 -35.294 24.303  1.00 36.57  ?  67  LEU B CB    1 
ATOM   3731 C  CG    . LEU B 1 67  ? -17.452 -35.850 24.026  1.00 39.50  ?  67  LEU B CG    1 
ATOM   3732 C  CD1   . LEU B 1 67  ? -17.754 -37.014 24.951  1.00 42.03  ?  67  LEU B CD1   1 
ATOM   3733 C  CD2   . LEU B 1 67  ? -18.493 -34.764 24.184  1.00 43.52  ?  67  LEU B CD2   1 
ATOM   3734 N  N     . LEU B 1 68  ? -14.901 -35.671 21.513  1.00 30.99  ?  68  LEU B N     1 
ATOM   3735 C  CA    . LEU B 1 68  ? -15.039 -35.934 20.065  1.00 30.08  ?  68  LEU B CA    1 
ATOM   3736 C  C     . LEU B 1 68  ? -13.912 -36.858 19.633  1.00 27.52  ?  68  LEU B C     1 
ATOM   3737 O  O     . LEU B 1 68  ? -14.189 -37.769 18.841  1.00 30.06  ?  68  LEU B O     1 
ATOM   3738 C  CB    . LEU B 1 68  ? -15.057 -34.608 19.296  1.00 28.26  ?  68  LEU B CB    1 
ATOM   3739 C  CG    . LEU B 1 68  ? -16.322 -33.760 19.485  1.00 28.04  ?  68  LEU B CG    1 
ATOM   3740 C  CD1   . LEU B 1 68  ? -16.231 -32.405 18.833  1.00 28.42  ?  68  LEU B CD1   1 
ATOM   3741 C  CD2   . LEU B 1 68  ? -17.531 -34.463 18.907  1.00 30.65  ?  68  LEU B CD2   1 
ATOM   3742 N  N     . GLN B 1 69  ? -12.721 -36.679 20.169  1.00 26.08  ?  69  GLN B N     1 
ATOM   3743 C  CA    . GLN B 1 69  ? -11.537 -37.481 19.761  1.00 30.67  ?  69  GLN B CA    1 
ATOM   3744 C  C     . GLN B 1 69  ? -11.700 -38.934 20.231  1.00 29.71  ?  69  GLN B C     1 
ATOM   3745 O  O     . GLN B 1 69  ? -11.373 -39.826 19.441  1.00 33.88  ?  69  GLN B O     1 
ATOM   3746 C  CB    . GLN B 1 69  ? -10.233 -36.868 20.284  1.00 32.00  ?  69  GLN B CB    1 
ATOM   3747 C  CG    . GLN B 1 69  ? -9.059  -37.006 19.344  1.00 35.68  ?  69  GLN B CG    1 
ATOM   3748 C  CD    . GLN B 1 69  ? -7.898  -36.080 19.654  1.00 40.17  ?  69  GLN B CD    1 
ATOM   3749 O  OE1   . GLN B 1 69  ? -7.505  -35.914 20.806  1.00 34.06  ?  69  GLN B OE1   1 
ATOM   3750 N  NE2   . GLN B 1 69  ? -7.301  -35.507 18.605  1.00 35.42  ?  69  GLN B NE2   1 
ATOM   3751 N  N     . GLU B 1 70  ? -12.212 -39.161 21.439  1.00 30.56  ?  70  GLU B N     1 
ATOM   3752 C  CA    . GLU B 1 70  ? -12.370 -40.506 22.049  1.00 36.87  ?  70  GLU B CA    1 
ATOM   3753 C  C     . GLU B 1 70  ? -13.535 -41.246 21.390  1.00 32.54  ?  70  GLU B C     1 
ATOM   3754 O  O     . GLU B 1 70  ? -13.510 -42.443 21.360  1.00 32.56  ?  70  GLU B O     1 
ATOM   3755 C  CB    . GLU B 1 70  ? -12.467 -40.404 23.572  1.00 50.98  ?  70  GLU B CB    1 
ATOM   3756 C  CG    . GLU B 1 70  ? -11.122 -40.015 24.219  1.00 62.94  ?  70  GLU B CG    1 
ATOM   3757 C  CD    . GLU B 1 70  ? -11.068 -39.924 25.758  1.00 73.26  ?  70  GLU B CD    1 
ATOM   3758 O  OE1   . GLU B 1 70  ? -12.120 -39.637 26.423  1.00 69.04  ?  70  GLU B OE1   1 
ATOM   3759 O  OE2   . GLU B 1 70  ? -9.959  -40.123 26.319  1.00 75.09  ?  70  GLU B OE2   1 
ATOM   3760 N  N     . ALA B 1 71  ? -14.505 -40.537 20.833  1.00 35.97  ?  71  ALA B N     1 
ATOM   3761 C  CA    . ALA B 1 71  ? -15.566 -41.103 19.957  1.00 32.00  ?  71  ALA B CA    1 
ATOM   3762 C  C     . ALA B 1 71  ? -14.986 -41.553 18.608  1.00 27.94  ?  71  ALA B C     1 
ATOM   3763 O  O     . ALA B 1 71  ? -15.556 -42.470 18.021  1.00 31.78  ?  71  ALA B O     1 
ATOM   3764 C  CB    . ALA B 1 71  ? -16.688 -40.104 19.738  1.00 30.43  ?  71  ALA B CB    1 
ATOM   3765 N  N     . GLY B 1 72  ? -13.979 -40.864 18.076  1.00 27.85  ?  72  GLY B N     1 
ATOM   3766 C  CA    . GLY B 1 72  ? -13.314 -41.231 16.804  1.00 27.75  ?  72  GLY B CA    1 
ATOM   3767 C  C     . GLY B 1 72  ? -13.411 -40.137 15.750  1.00 28.38  ?  72  GLY B C     1 
ATOM   3768 O  O     . GLY B 1 72  ? -13.008 -40.411 14.616  1.00 33.65  ?  72  GLY B O     1 
ATOM   3769 N  N     . ILE B 1 73  ? -13.963 -38.960 16.085  1.00 26.55  ?  73  ILE B N     1 
ATOM   3770 C  CA    . ILE B 1 73  ? -13.964 -37.769 15.176  1.00 26.57  ?  73  ILE B CA    1 
ATOM   3771 C  C     . ILE B 1 73  ? -12.530 -37.249 15.019  1.00 27.06  ?  73  ILE B C     1 
ATOM   3772 O  O     . ILE B 1 73  ? -11.872 -37.023 16.055  1.00 28.06  ?  73  ILE B O     1 
ATOM   3773 C  CB    . ILE B 1 73  ? -14.890 -36.657 15.708  1.00 23.85  ?  73  ILE B CB    1 
ATOM   3774 C  CG1   . ILE B 1 73  ? -16.335 -37.107 15.862  1.00 23.34  ?  73  ILE B CG1   1 
ATOM   3775 C  CG2   . ILE B 1 73  ? -14.754 -35.411 14.855  1.00 21.78  ?  73  ILE B CG2   1 
ATOM   3776 C  CD1   . ILE B 1 73  ? -17.000 -37.525 14.582  1.00 25.37  ?  73  ILE B CD1   1 
ATOM   3777 N  N     . LYS B 1 74  ? -12.085 -37.028 13.791  1.00 28.12  ?  74  LYS B N     1 
ATOM   3778 C  CA    . LYS B 1 74  ? -10.709 -36.559 13.516  1.00 35.48  ?  74  LYS B CA    1 
ATOM   3779 C  C     . LYS B 1 74  ? -10.611 -35.085 13.889  1.00 32.47  ?  74  LYS B C     1 
ATOM   3780 O  O     . LYS B 1 74  ? -11.345 -34.272 13.284  1.00 36.24  ?  74  LYS B O     1 
ATOM   3781 C  CB    . LYS B 1 74  ? -10.319 -36.807 12.059  1.00 41.21  ?  74  LYS B CB    1 
ATOM   3782 C  CG    . LYS B 1 74  ? -10.294 -38.279 11.683  1.00 51.77  ?  74  LYS B CG    1 
ATOM   3783 C  CD    . LYS B 1 74  ? -9.154  -39.061 12.280  1.00 58.54  ?  74  LYS B CD    1 
ATOM   3784 C  CE    . LYS B 1 74  ? -9.048  -40.438 11.639  1.00 75.66  ?  74  LYS B CE    1 
ATOM   3785 N  NZ    . LYS B 1 74  ? -7.939  -41.209 12.253  1.00 88.60  ?  74  LYS B NZ    1 
ATOM   3786 N  N     . THR B 1 75  ? -9.743  -34.743 14.843  1.00 29.94  ?  75  THR B N     1 
ATOM   3787 C  CA    . THR B 1 75  ? -9.771  -33.413 15.496  1.00 31.35  ?  75  THR B CA    1 
ATOM   3788 C  C     . THR B 1 75  ? -8.352  -32.890 15.689  1.00 30.33  ?  75  THR B C     1 
ATOM   3789 O  O     . THR B 1 75  ? -7.533  -33.655 16.169  1.00 28.25  ?  75  THR B O     1 
ATOM   3790 C  CB    . THR B 1 75  ? -10.455 -33.519 16.861  1.00 34.89  ?  75  THR B CB    1 
ATOM   3791 O  OG1   . THR B 1 75  ? -11.711 -34.177 16.692  1.00 38.58  ?  75  THR B OG1   1 
ATOM   3792 C  CG2   . THR B 1 75  ? -10.694 -32.167 17.493  1.00 37.17  ?  75  THR B CG2   1 
ATOM   3793 N  N     . ALA B 1 76  ? -8.127  -31.604 15.435  1.00 27.89  ?  76  ALA B N     1 
ATOM   3794 C  CA    . ALA B 1 76  ? -6.849  -30.915 15.711  1.00 25.04  ?  76  ALA B CA    1 
ATOM   3795 C  C     . ALA B 1 76  ? -6.794  -30.577 17.206  1.00 30.34  ?  76  ALA B C     1 
ATOM   3796 O  O     . ALA B 1 76  ? -7.089  -29.419 17.630  1.00 32.26  ?  76  ALA B O     1 
ATOM   3797 C  CB    . ALA B 1 76  ? -6.710  -29.680 14.861  1.00 25.33  ?  76  ALA B CB    1 
ATOM   3798 N  N     . PHE B 1 77  ? -6.452  -31.587 18.000  1.00 29.70  ?  77  PHE B N     1 
ATOM   3799 C  CA    . PHE B 1 77  ? -6.210  -31.454 19.446  1.00 33.85  ?  77  PHE B CA    1 
ATOM   3800 C  C     . PHE B 1 77  ? -5.189  -32.489 19.872  1.00 29.88  ?  77  PHE B C     1 
ATOM   3801 O  O     . PHE B 1 77  ? -5.421  -33.643 19.569  1.00 27.33  ?  77  PHE B O     1 
ATOM   3802 C  CB    . PHE B 1 77  ? -7.530  -31.638 20.207  1.00 38.77  ?  77  PHE B CB    1 
ATOM   3803 C  CG    . PHE B 1 77  ? -7.406  -31.533 21.708  1.00 31.29  ?  77  PHE B CG    1 
ATOM   3804 C  CD1   . PHE B 1 77  ? -7.223  -30.310 22.327  1.00 29.36  ?  77  PHE B CD1   1 
ATOM   3805 C  CD2   . PHE B 1 77  ? -7.482  -32.670 22.487  1.00 32.39  ?  77  PHE B CD2   1 
ATOM   3806 C  CE1   . PHE B 1 77  ? -7.132  -30.230 23.706  1.00 31.13  ?  77  PHE B CE1   1 
ATOM   3807 C  CE2   . PHE B 1 77  ? -7.402  -32.583 23.871  1.00 31.10  ?  77  PHE B CE2   1 
ATOM   3808 C  CZ    . PHE B 1 77  ? -7.215  -31.365 24.477  1.00 30.08  ?  77  PHE B CZ    1 
ATOM   3809 N  N     . THR B 1 78  ? -4.148  -32.075 20.591  1.00 32.52  ?  78  THR B N     1 
ATOM   3810 C  CA    . THR B 1 78  ? -3.123  -33.004 21.156  1.00 35.18  ?  78  THR B CA    1 
ATOM   3811 C  C     . THR B 1 78  ? -3.406  -33.164 22.650  1.00 32.85  ?  78  THR B C     1 
ATOM   3812 O  O     . THR B 1 78  ? -3.788  -34.237 23.051  1.00 32.59  ?  78  THR B O     1 
ATOM   3813 C  CB    . THR B 1 78  ? -1.702  -32.500 20.876  1.00 39.04  ?  78  THR B CB    1 
ATOM   3814 O  OG1   . THR B 1 78  ? -1.649  -32.093 19.502  1.00 34.24  ?  78  THR B OG1   1 
ATOM   3815 C  CG2   . THR B 1 78  ? -0.661  -33.565 21.179  1.00 38.39  ?  78  THR B CG2   1 
ATOM   3816 N  N     . ARG B 1 79  ? -3.308  -32.087 23.406  1.00 33.71  ?  79  ARG B N     1 
ATOM   3817 C  CA    . ARG B 1 79  ? -3.512  -32.088 24.872  1.00 37.61  ?  79  ARG B CA    1 
ATOM   3818 C  C     . ARG B 1 79  ? -3.709  -30.665 25.400  1.00 33.31  ?  79  ARG B C     1 
ATOM   3819 O  O     . ARG B 1 79  ? -3.283  -29.685 24.764  1.00 31.00  ?  79  ARG B O     1 
ATOM   3820 C  CB    . ARG B 1 79  ? -2.331  -32.746 25.602  1.00 39.82  ?  79  ARG B CB    1 
ATOM   3821 C  CG    . ARG B 1 79  ? -1.010  -31.994 25.537  1.00 43.66  ?  79  ARG B CG    1 
ATOM   3822 C  CD    . ARG B 1 79  ? 0.100   -32.751 26.261  1.00 52.97  ?  79  ARG B CD    1 
ATOM   3823 N  NE    . ARG B 1 79  ? 1.388   -32.048 26.245  1.00 62.51  ?  79  ARG B NE    1 
ATOM   3824 C  CZ    . ARG B 1 79  ? 1.722   -30.999 27.015  1.00 59.63  ?  79  ARG B CZ    1 
ATOM   3825 N  NH1   . ARG B 1 79  ? 0.871   -30.490 27.885  1.00 59.67  ?  79  ARG B NH1   1 
ATOM   3826 N  NH2   . ARG B 1 79  ? 2.902   -30.421 26.885  1.00 59.45  ?  79  ARG B NH2   1 
ATOM   3827 N  N     . LYS B 1 80  ? -4.305  -30.584 26.581  1.00 37.04  ?  80  LYS B N     1 
ATOM   3828 C  CA    . LYS B 1 80  ? -4.412  -29.327 27.367  1.00 36.78  ?  80  LYS B CA    1 
ATOM   3829 C  C     . LYS B 1 80  ? -2.997  -28.956 27.818  1.00 37.51  ?  80  LYS B C     1 
ATOM   3830 O  O     . LYS B 1 80  ? -2.190  -29.869 28.080  1.00 35.29  ?  80  LYS B O     1 
ATOM   3831 C  CB    . LYS B 1 80  ? -5.382  -29.518 28.539  1.00 33.85  ?  80  LYS B CB    1 
ATOM   3832 C  CG    . LYS B 1 80  ? -6.003  -28.237 29.041  1.00 34.29  ?  80  LYS B CG    1 
ATOM   3833 C  CD    . LYS B 1 80  ? -6.864  -28.447 30.256  1.00 38.58  ?  80  LYS B CD    1 
ATOM   3834 C  CE    . LYS B 1 80  ? -7.834  -27.317 30.517  1.00 39.36  ?  80  LYS B CE    1 
ATOM   3835 N  NZ    . LYS B 1 80  ? -7.995  -27.134 31.975  1.00 43.39  ?  80  LYS B NZ    1 
ATOM   3836 N  N     . CYS B 1 81  ? -2.725  -27.672 27.939  1.00 35.03  ?  81  CYS B N     1 
ATOM   3837 C  CA    . CYS B 1 81  ? -1.405  -27.173 28.348  1.00 37.46  ?  81  CYS B CA    1 
ATOM   3838 C  C     . CYS B 1 81  ? -1.584  -26.042 29.355  1.00 37.98  ?  81  CYS B C     1 
ATOM   3839 O  O     . CYS B 1 81  ? -1.431  -24.854 28.967  1.00 38.64  ?  81  CYS B O     1 
ATOM   3840 C  CB    . CYS B 1 81  ? -0.642  -26.716 27.124  1.00 42.79  ?  81  CYS B CB    1 
ATOM   3841 S  SG    . CYS B 1 81  ? 1.054   -26.286 27.552  1.00 57.19  ?  81  CYS B SG    1 
ATOM   3842 N  N     . GLY B 1 82  ? -1.988  -26.412 30.578  1.00 42.61  ?  82  GLY B N     1 
ATOM   3843 C  CA    . GLY B 1 82  ? -2.297  -25.459 31.665  1.00 40.28  ?  82  GLY B CA    1 
ATOM   3844 C  C     . GLY B 1 82  ? -3.705  -24.886 31.540  1.00 37.93  ?  82  GLY B C     1 
ATOM   3845 O  O     . GLY B 1 82  ? -4.449  -25.351 30.669  1.00 36.35  ?  82  GLY B O     1 
ATOM   3846 N  N     . GLU B 1 83  ? -4.053  -23.940 32.404  1.00 35.65  ?  83  GLU B N     1 
ATOM   3847 C  CA    . GLU B 1 83  ? -5.404  -23.363 32.528  1.00 42.01  ?  83  GLU B CA    1 
ATOM   3848 C  C     . GLU B 1 83  ? -5.863  -22.728 31.200  1.00 40.88  ?  83  GLU B C     1 
ATOM   3849 O  O     . GLU B 1 83  ? -7.098  -22.812 30.923  1.00 37.40  ?  83  GLU B O     1 
ATOM   3850 C  CB    . GLU B 1 83  ? -5.486  -22.309 33.642  1.00 52.37  ?  83  GLU B CB    1 
ATOM   3851 C  CG    . GLU B 1 83  ? -5.494  -22.862 35.078  1.00 68.37  ?  83  GLU B CG    1 
ATOM   3852 C  CD    . GLU B 1 83  ? -6.740  -23.630 35.518  1.00 73.08  ?  83  GLU B CD    1 
ATOM   3853 O  OE1   . GLU B 1 83  ? -7.553  -23.999 34.652  1.00 80.19  ?  83  GLU B OE1   1 
ATOM   3854 O  OE2   . GLU B 1 83  ? -6.898  -23.904 36.725  1.00 54.43  ?  83  GLU B OE2   1 
ATOM   3855 N  N     . THR B 1 84  ? -4.982  -22.097 30.403  1.00 35.24  ?  84  THR B N     1 
ATOM   3856 C  CA    . THR B 1 84  ? -5.445  -21.148 29.353  1.00 36.50  ?  84  THR B CA    1 
ATOM   3857 C  C     . THR B 1 84  ? -4.912  -21.472 27.950  1.00 35.91  ?  84  THR B C     1 
ATOM   3858 O  O     . THR B 1 84  ? -5.144  -20.647 27.040  1.00 41.56  ?  84  THR B O     1 
ATOM   3859 C  CB    . THR B 1 84  ? -5.153  -19.696 29.757  1.00 33.67  ?  84  THR B CB    1 
ATOM   3860 O  OG1   . THR B 1 84  ? -3.752  -19.503 29.778  1.00 31.94  ?  84  THR B OG1   1 
ATOM   3861 C  CG2   . THR B 1 84  ? -5.753  -19.323 31.095  1.00 33.53  ?  84  THR B CG2   1 
ATOM   3862 N  N     . ALA B 1 85  ? -4.266  -22.611 27.741  1.00 30.65  ?  85  ALA B N     1 
ATOM   3863 C  CA    . ALA B 1 85  ? -3.797  -22.981 26.394  1.00 30.01  ?  85  ALA B CA    1 
ATOM   3864 C  C     . ALA B 1 85  ? -4.013  -24.468 26.123  1.00 31.97  ?  85  ALA B C     1 
ATOM   3865 O  O     . ALA B 1 85  ? -4.343  -25.235 27.055  1.00 29.78  ?  85  ALA B O     1 
ATOM   3866 C  CB    . ALA B 1 85  ? -2.351  -22.610 26.232  1.00 28.48  ?  85  ALA B CB    1 
ATOM   3867 N  N     . PHE B 1 86  ? -3.781  -24.841 24.863  1.00 32.10  ?  86  PHE B N     1 
ATOM   3868 C  CA    . PHE B 1 86  ? -3.802  -26.257 24.414  1.00 31.62  ?  86  PHE B CA    1 
ATOM   3869 C  C     . PHE B 1 86  ? -2.847  -26.391 23.242  1.00 29.75  ?  86  PHE B C     1 
ATOM   3870 O  O     . PHE B 1 86  ? -2.541  -25.404 22.629  1.00 34.46  ?  86  PHE B O     1 
ATOM   3871 C  CB    . PHE B 1 86  ? -5.234  -26.776 24.226  1.00 28.32  ?  86  PHE B CB    1 
ATOM   3872 C  CG    . PHE B 1 86  ? -5.953  -26.395 22.961  1.00 25.72  ?  86  PHE B CG    1 
ATOM   3873 C  CD1   . PHE B 1 86  ? -5.827  -27.154 21.830  1.00 26.23  ?  86  PHE B CD1   1 
ATOM   3874 C  CD2   . PHE B 1 86  ? -6.801  -25.297 22.926  1.00 26.05  ?  86  PHE B CD2   1 
ATOM   3875 C  CE1   . PHE B 1 86  ? -6.510  -26.804 20.669  1.00 28.12  ?  86  PHE B CE1   1 
ATOM   3876 C  CE2   . PHE B 1 86  ? -7.474  -24.938 21.774  1.00 26.19  ?  86  PHE B CE2   1 
ATOM   3877 C  CZ    . PHE B 1 86  ? -7.313  -25.686 20.637  1.00 26.38  ?  86  PHE B CZ    1 
ATOM   3878 N  N     . ILE B 1 87  ? -2.302  -27.585 23.065  1.00 32.41  ?  87  ILE B N     1 
ATOM   3879 C  CA    . ILE B 1 87  ? -1.415  -27.964 21.936  1.00 34.81  ?  87  ILE B CA    1 
ATOM   3880 C  C     . ILE B 1 87  ? -2.321  -28.563 20.864  1.00 33.27  ?  87  ILE B C     1 
ATOM   3881 O  O     . ILE B 1 87  ? -3.161  -29.444 21.203  1.00 31.00  ?  87  ILE B O     1 
ATOM   3882 C  CB    . ILE B 1 87  ? -0.346  -29.000 22.354  1.00 37.43  ?  87  ILE B CB    1 
ATOM   3883 C  CG1   . ILE B 1 87  ? 0.361   -28.662 23.656  1.00 41.01  ?  87  ILE B CG1   1 
ATOM   3884 C  CG2   . ILE B 1 87  ? 0.669   -29.196 21.239  1.00 40.38  ?  87  ILE B CG2   1 
ATOM   3885 C  CD1   . ILE B 1 87  ? 1.245   -27.486 23.557  1.00 48.37  ?  87  ILE B CD1   1 
ATOM   3886 N  N     . ALA B 1 88  ? -2.089  -28.207 19.611  1.00 29.67  ?  88  ALA B N     1 
ATOM   3887 C  CA    . ALA B 1 88  ? -2.868  -28.789 18.493  1.00 29.95  ?  88  ALA B CA    1 
ATOM   3888 C  C     . ALA B 1 88  ? -1.944  -29.018 17.313  1.00 32.09  ?  88  ALA B C     1 
ATOM   3889 O  O     . ALA B 1 88  ? -0.937  -28.328 17.170  1.00 30.55  ?  88  ALA B O     1 
ATOM   3890 C  CB    . ALA B 1 88  ? -4.008  -27.860 18.124  1.00 31.23  ?  88  ALA B CB    1 
ATOM   3891 N  N     . PRO B 1 89  ? -2.292  -29.964 16.420  1.00 29.07  ?  89  PRO B N     1 
ATOM   3892 C  CA    . PRO B 1 89  ? -1.695  -30.011 15.100  1.00 29.85  ?  89  PRO B CA    1 
ATOM   3893 C  C     . PRO B 1 89  ? -2.018  -28.695 14.393  1.00 34.18  ?  89  PRO B C     1 
ATOM   3894 O  O     . PRO B 1 89  ? -3.143  -28.192 14.506  1.00 30.79  ?  89  PRO B O     1 
ATOM   3895 C  CB    . PRO B 1 89  ? -2.382  -31.188 14.400  1.00 33.05  ?  89  PRO B CB    1 
ATOM   3896 C  CG    . PRO B 1 89  ? -2.959  -32.024 15.536  1.00 32.01  ?  89  PRO B CG    1 
ATOM   3897 C  CD    . PRO B 1 89  ? -3.271  -31.030 16.638  1.00 31.58  ?  89  PRO B CD    1 
ATOM   3898 N  N     . GLN B 1 90  ? -0.997  -28.134 13.744  1.00 38.00  ?  90  GLN B N     1 
ATOM   3899 C  CA    . GLN B 1 90  ? -1.098  -26.908 12.926  1.00 34.92  ?  90  GLN B CA    1 
ATOM   3900 C  C     . GLN B 1 90  ? -1.945  -27.253 11.691  1.00 34.16  ?  90  GLN B C     1 
ATOM   3901 O  O     . GLN B 1 90  ? -1.714  -28.273 11.048  1.00 32.43  ?  90  GLN B O     1 
ATOM   3902 C  CB    . GLN B 1 90  ? 0.303   -26.432 12.559  1.00 37.68  ?  90  GLN B CB    1 
ATOM   3903 C  CG    . GLN B 1 90  ? 0.304   -25.216 11.626  1.00 42.74  ?  90  GLN B CG    1 
ATOM   3904 C  CD    . GLN B 1 90  ? 1.682   -24.641 11.417  1.00 42.24  ?  90  GLN B CD    1 
ATOM   3905 O  OE1   . GLN B 1 90  ? 2.701   -25.326 11.546  1.00 38.31  ?  90  GLN B OE1   1 
ATOM   3906 N  NE2   . GLN B 1 90  ? 1.693   -23.352 11.142  1.00 40.42  ?  90  GLN B NE2   1 
ATOM   3907 N  N     . CYS B 1 91  ? -2.908  -26.410 11.390  1.00 32.58  ?  91  CYS B N     1 
ATOM   3908 C  CA    . CYS B 1 91  ? -3.819  -26.553 10.250  1.00 34.25  ?  91  CYS B CA    1 
ATOM   3909 C  C     . CYS B 1 91  ? -3.778  -25.283 9.394   1.00 35.15  ?  91  CYS B C     1 
ATOM   3910 O  O     . CYS B 1 91  ? -3.505  -24.216 9.931   1.00 34.89  ?  91  CYS B O     1 
ATOM   3911 C  CB    . CYS B 1 91  ? -5.229  -26.842 10.748  1.00 35.73  ?  91  CYS B CB    1 
ATOM   3912 S  SG    . CYS B 1 91  ? -5.330  -28.450 11.591  1.00 40.08  ?  91  CYS B SG    1 
ATOM   3913 N  N     . GLU B 1 92  ? -3.944  -25.444 8.087   1.00 37.67  ?  92  GLU B N     1 
ATOM   3914 C  CA    . GLU B 1 92  ? -4.370  -24.365 7.171   1.00 47.63  ?  92  GLU B CA    1 
ATOM   3915 C  C     . GLU B 1 92  ? -5.893  -24.330 7.240   1.00 40.96  ?  92  GLU B C     1 
ATOM   3916 O  O     . GLU B 1 92  ? -6.540  -25.269 6.742   1.00 36.87  ?  92  GLU B O     1 
ATOM   3917 C  CB    . GLU B 1 92  ? -3.860  -24.583 5.741   1.00 54.89  ?  92  GLU B CB    1 
ATOM   3918 C  CG    . GLU B 1 92  ? -2.368  -24.339 5.587   1.00 69.07  ?  92  GLU B CG    1 
ATOM   3919 C  CD    . GLU B 1 92  ? -1.950  -22.872 5.552   1.00 73.73  ?  92  GLU B CD    1 
ATOM   3920 O  OE1   . GLU B 1 92  ? -1.010  -22.508 6.322   1.00 70.11  ?  92  GLU B OE1   1 
ATOM   3921 O  OE2   . GLU B 1 92  ? -2.565  -22.099 4.756   1.00 69.67  ?  92  GLU B OE2   1 
ATOM   3922 N  N     . MET B 1 93  ? -6.426  -23.289 7.850   1.00 38.84  ?  93  MET B N     1 
ATOM   3923 C  CA    . MET B 1 93  ? -7.866  -23.182 8.132   1.00 39.29  ?  93  MET B CA    1 
ATOM   3924 C  C     . MET B 1 93  ? -8.627  -22.900 6.827   1.00 40.97  ?  93  MET B C     1 
ATOM   3925 O  O     . MET B 1 93  ? -8.159  -22.078 6.023   1.00 41.30  ?  93  MET B O     1 
ATOM   3926 C  CB    . MET B 1 93  ? -8.088  -22.085 9.168   1.00 37.60  ?  93  MET B CB    1 
ATOM   3927 C  CG    . MET B 1 93  ? -7.453  -22.464 10.506  1.00 42.46  ?  93  MET B CG    1 
ATOM   3928 S  SD    . MET B 1 93  ? -8.101  -24.035 11.203  1.00 39.58  ?  93  MET B SD    1 
ATOM   3929 C  CE    . MET B 1 93  ? -9.811  -23.565 11.452  1.00 47.49  ?  93  MET B CE    1 
ATOM   3930 N  N     . ILE B 1 94  ? -9.735  -23.618 6.618   1.00 35.11  ?  94  ILE B N     1 
ATOM   3931 C  CA    . ILE B 1 94  ? -10.732 -23.367 5.537   1.00 35.02  ?  94  ILE B CA    1 
ATOM   3932 C  C     . ILE B 1 94  ? -11.663 -22.259 6.005   1.00 34.36  ?  94  ILE B C     1 
ATOM   3933 O  O     . ILE B 1 94  ? -12.211 -22.302 7.104   1.00 33.33  ?  94  ILE B O     1 
ATOM   3934 C  CB    . ILE B 1 94  ? -11.434 -24.689 5.204   1.00 35.85  ?  94  ILE B CB    1 
ATOM   3935 C  CG1   . ILE B 1 94  ? -10.398 -25.705 4.699   1.00 35.70  ?  94  ILE B CG1   1 
ATOM   3936 C  CG2   . ILE B 1 94  ? -12.520 -24.454 4.201   1.00 38.60  ?  94  ILE B CG2   1 
ATOM   3937 C  CD1   . ILE B 1 94  ? -10.792 -27.132 4.840   1.00 37.73  ?  94  ILE B CD1   1 
ATOM   3938 N  N     . PRO B 1 95  ? -11.779 -21.142 5.267   1.00 37.77  ?  95  PRO B N     1 
ATOM   3939 C  CA    . PRO B 1 95  ? -12.412 -19.932 5.806   1.00 36.56  ?  95  PRO B CA    1 
ATOM   3940 C  C     . PRO B 1 95  ? -13.933 -19.985 5.578   1.00 32.74  ?  95  PRO B C     1 
ATOM   3941 O  O     . PRO B 1 95  ? -14.505 -19.141 4.934   1.00 31.54  ?  95  PRO B O     1 
ATOM   3942 C  CB    . PRO B 1 95  ? -11.657 -18.854 5.018   1.00 37.41  ?  95  PRO B CB    1 
ATOM   3943 C  CG    . PRO B 1 95  ? -11.576 -19.472 3.657   1.00 34.41  ?  95  PRO B CG    1 
ATOM   3944 C  CD    . PRO B 1 95  ? -11.291 -20.940 3.913   1.00 33.87  ?  95  PRO B CD    1 
ATOM   3945 N  N     . ILE B 1 96  ? -14.543 -21.017 6.148   1.00 32.77  ?  96  ILE B N     1 
ATOM   3946 C  CA    . ILE B 1 96  ? -16.008 -21.283 6.133   1.00 29.92  ?  96  ILE B CA    1 
ATOM   3947 C  C     . ILE B 1 96  ? -16.446 -21.563 7.564   1.00 27.47  ?  96  ILE B C     1 
ATOM   3948 O  O     . ILE B 1 96  ? -15.712 -22.332 8.267   1.00 24.05  ?  96  ILE B O     1 
ATOM   3949 C  CB    . ILE B 1 96  ? -16.329 -22.474 5.217   1.00 32.67  ?  96  ILE B CB    1 
ATOM   3950 C  CG1   . ILE B 1 96  ? -15.918 -22.214 3.760   1.00 35.16  ?  96  ILE B CG1   1 
ATOM   3951 C  CG2   . ILE B 1 96  ? -17.793 -22.851 5.369   1.00 35.16  ?  96  ILE B CG2   1 
ATOM   3952 C  CD1   . ILE B 1 96  ? -16.733 -21.107 3.095   1.00 36.12  ?  96  ILE B CD1   1 
ATOM   3953 N  N     . GLU B 1 97  ? -17.575 -20.971 7.958   1.00 26.41  ?  97  GLU B N     1 
ATOM   3954 C  CA    . GLU B 1 97  ? -18.306 -21.321 9.197   1.00 30.04  ?  97  GLU B CA    1 
ATOM   3955 C  C     . GLU B 1 97  ? -19.394 -22.318 8.819   1.00 30.71  ?  97  GLU B C     1 
ATOM   3956 O  O     . GLU B 1 97  ? -20.261 -21.991 8.021   1.00 40.69  ?  97  GLU B O     1 
ATOM   3957 C  CB    . GLU B 1 97  ? -18.834 -20.074 9.897   1.00 36.06  ?  97  GLU B CB    1 
ATOM   3958 C  CG    . GLU B 1 97  ? -17.734 -19.182 10.454  1.00 40.12  ?  97  GLU B CG    1 
ATOM   3959 C  CD    . GLU B 1 97  ? -18.184 -17.894 11.116  1.00 44.33  ?  97  GLU B CD    1 
ATOM   3960 O  OE1   . GLU B 1 97  ? -17.298 -17.145 11.581  1.00 50.49  ?  97  GLU B OE1   1 
ATOM   3961 O  OE2   . GLU B 1 97  ? -19.407 -17.614 11.140  1.00 53.92  ?  97  GLU B OE2   1 
ATOM   3962 N  N     . TRP B 1 98  ? -19.297 -23.525 9.350   1.00 31.11  ?  98  TRP B N     1 
ATOM   3963 C  CA    . TRP B 1 98  ? -20.246 -24.648 9.199   1.00 25.16  ?  98  TRP B CA    1 
ATOM   3964 C  C     . TRP B 1 98  ? -21.189 -24.598 10.394  1.00 26.04  ?  98  TRP B C     1 
ATOM   3965 O  O     . TRP B 1 98  ? -20.747 -24.755 11.530  1.00 27.73  ?  98  TRP B O     1 
ATOM   3966 C  CB    . TRP B 1 98  ? -19.497 -25.986 9.110   1.00 29.76  ?  98  TRP B CB    1 
ATOM   3967 C  CG    . TRP B 1 98  ? -18.578 -26.075 7.934   1.00 31.37  ?  98  TRP B CG    1 
ATOM   3968 C  CD1   . TRP B 1 98  ? -17.307 -25.588 7.836   1.00 33.11  ?  98  TRP B CD1   1 
ATOM   3969 C  CD2   . TRP B 1 98  ? -18.885 -26.622 6.647   1.00 34.33  ?  98  TRP B CD2   1 
ATOM   3970 N  NE1   . TRP B 1 98  ? -16.809 -25.805 6.588   1.00 32.44  ?  98  TRP B NE1   1 
ATOM   3971 C  CE2   . TRP B 1 98  ? -17.747 -26.440 5.833   1.00 29.07  ?  98  TRP B CE2   1 
ATOM   3972 C  CE3   . TRP B 1 98  ? -20.023 -27.230 6.098   1.00 37.87  ?  98  TRP B CE3   1 
ATOM   3973 C  CZ2   . TRP B 1 98  ? -17.693 -26.872 4.518   1.00 30.00  ?  98  TRP B CZ2   1 
ATOM   3974 C  CZ3   . TRP B 1 98  ? -19.969 -27.661 4.789   1.00 38.62  ?  98  TRP B CZ3   1 
ATOM   3975 C  CH2   . TRP B 1 98  ? -18.816 -27.488 4.012   1.00 34.52  ?  98  TRP B CH2   1 
ATOM   3976 N  N     . VAL B 1 99  ? -22.458 -24.334 10.137  1.00 28.82  ?  99  VAL B N     1 
ATOM   3977 C  CA    . VAL B 1 99  ? -23.512 -24.282 11.169  1.00 25.71  ?  99  VAL B CA    1 
ATOM   3978 C  C     . VAL B 1 99  ? -24.400 -25.511 11.023  1.00 25.03  ?  99  VAL B C     1 
ATOM   3979 O  O     . VAL B 1 99  ? -24.725 -25.907 9.897   1.00 29.46  ?  99  VAL B O     1 
ATOM   3980 C  CB    . VAL B 1 99  ? -24.295 -22.972 11.035  1.00 26.72  ?  99  VAL B CB    1 
ATOM   3981 C  CG1   . VAL B 1 99  ? -25.492 -22.950 11.981  1.00 27.54  ?  99  VAL B CG1   1 
ATOM   3982 C  CG2   . VAL B 1 99  ? -23.381 -21.764 11.262  1.00 24.95  ?  99  VAL B CG2   1 
ATOM   3983 N  N     . CYS B 1 100 ? -24.797 -26.074 12.143  1.00 26.30  ?  100 CYS B N     1 
ATOM   3984 C  CA    . CYS B 1 100 ? -25.806 -27.152 12.224  1.00 28.70  ?  100 CYS B CA    1 
ATOM   3985 C  C     . CYS B 1 100 ? -26.931 -26.704 13.173  1.00 30.18  ?  100 CYS B C     1 
ATOM   3986 O  O     . CYS B 1 100 ? -26.595 -26.207 14.293  1.00 28.65  ?  100 CYS B O     1 
ATOM   3987 C  CB    . CYS B 1 100 ? -25.199 -28.452 12.726  1.00 29.67  ?  100 CYS B CB    1 
ATOM   3988 S  SG    . CYS B 1 100 ? -26.213 -29.882 12.263  1.00 34.48  ?  100 CYS B SG    1 
ATOM   3989 N  N     . ARG B 1 101 ? -28.193 -26.896 12.761  1.00 25.19  ?  101 ARG B N     1 
ATOM   3990 C  CA    . ARG B 1 101 ? -29.392 -26.487 13.539  1.00 26.74  ?  101 ARG B CA    1 
ATOM   3991 C  C     . ARG B 1 101 ? -30.256 -27.717 13.831  1.00 26.06  ?  101 ARG B C     1 
ATOM   3992 O  O     . ARG B 1 101 ? -30.542 -28.469 12.896  1.00 26.16  ?  101 ARG B O     1 
ATOM   3993 C  CB    . ARG B 1 101 ? -30.173 -25.422 12.775  1.00 25.59  ?  101 ARG B CB    1 
ATOM   3994 C  CG    . ARG B 1 101 ? -29.377 -24.140 12.516  1.00 27.70  ?  101 ARG B CG    1 
ATOM   3995 C  CD    . ARG B 1 101 ? -30.163 -23.103 11.704  1.00 25.69  ?  101 ARG B CD    1 
ATOM   3996 N  NE    . ARG B 1 101 ? -29.260 -22.144 11.094  1.00 28.85  ?  101 ARG B NE    1 
ATOM   3997 C  CZ    . ARG B 1 101 ? -28.772 -21.047 11.711  1.00 29.19  ?  101 ARG B CZ    1 
ATOM   3998 N  NH1   . ARG B 1 101 ? -29.134 -20.749 12.950  1.00 31.31  ?  101 ARG B NH1   1 
ATOM   3999 N  NH2   . ARG B 1 101 ? -27.892 -20.268 11.099  1.00 28.52  ?  101 ARG B NH2   1 
ATOM   4000 N  N     . ARG B 1 102 ? -30.671 -27.905 15.086  1.00 26.79  ?  102 ARG B N     1 
ATOM   4001 C  CA    . ARG B 1 102 ? -31.822 -28.768 15.461  1.00 23.50  ?  102 ARG B CA    1 
ATOM   4002 C  C     . ARG B 1 102 ? -33.075 -27.901 15.509  1.00 25.33  ?  102 ARG B C     1 
ATOM   4003 O  O     . ARG B 1 102 ? -34.142 -28.415 15.109  1.00 22.95  ?  102 ARG B O     1 
ATOM   4004 C  CB    . ARG B 1 102 ? -31.637 -29.454 16.800  1.00 23.26  ?  102 ARG B CB    1 
ATOM   4005 C  CG    . ARG B 1 102 ? -32.851 -30.279 17.221  1.00 25.67  ?  102 ARG B CG    1 
ATOM   4006 C  CD    . ARG B 1 102 ? -33.107 -31.404 16.236  1.00 25.73  ?  102 ARG B CD    1 
ATOM   4007 N  NE    . ARG B 1 102 ? -32.138 -32.496 16.427  1.00 26.11  ?  102 ARG B NE    1 
ATOM   4008 C  CZ    . ARG B 1 102 ? -31.998 -33.559 15.682  1.00 24.46  ?  102 ARG B CZ    1 
ATOM   4009 N  NH1   . ARG B 1 102 ? -32.686 -33.704 14.568  1.00 28.54  ?  102 ARG B NH1   1 
ATOM   4010 N  NH2   . ARG B 1 102 ? -31.093 -34.467 16.014  1.00 32.08  ?  102 ARG B NH2   1 
ATOM   4011 N  N     . ILE B 1 103 ? -32.947 -26.643 15.946  1.00 27.09  ?  103 ILE B N     1 
ATOM   4012 C  CA    . ILE B 1 103 ? -34.121 -25.731 16.171  1.00 33.26  ?  103 ILE B CA    1 
ATOM   4013 C  C     . ILE B 1 103 ? -33.894 -24.438 15.387  1.00 33.39  ?  103 ILE B C     1 
ATOM   4014 O  O     . ILE B 1 103 ? -32.808 -23.848 15.488  1.00 34.56  ?  103 ILE B O     1 
ATOM   4015 C  CB    . ILE B 1 103 ? -34.353 -25.480 17.692  1.00 36.51  ?  103 ILE B CB    1 
ATOM   4016 C  CG1   . ILE B 1 103 ? -34.741 -26.766 18.433  1.00 36.19  ?  103 ILE B CG1   1 
ATOM   4017 C  CG2   . ILE B 1 103 ? -35.389 -24.424 17.953  1.00 34.37  ?  103 ILE B CG2   1 
ATOM   4018 C  CD1   . ILE B 1 103 ? -34.582 -26.688 19.925  1.00 38.76  ?  103 ILE B CD1   1 
ATOM   4019 N  N     . ALA B 1 104 ? -34.911 -24.004 14.667  1.00 30.30  ?  104 ALA B N     1 
ATOM   4020 C  CA    . ALA B 1 104 ? -34.904 -22.730 13.932  1.00 33.26  ?  104 ALA B CA    1 
ATOM   4021 C  C     . ALA B 1 104 ? -34.896 -21.566 14.934  1.00 30.67  ?  104 ALA B C     1 
ATOM   4022 O  O     . ALA B 1 104 ? -35.827 -21.455 15.713  1.00 37.52  ?  104 ALA B O     1 
ATOM   4023 C  CB    . ALA B 1 104 ? -36.083 -22.692 12.997  1.00 31.65  ?  104 ALA B CB    1 
ATOM   4024 N  N     . THR B 1 105 ? -33.845 -20.756 14.916  1.00 34.32  ?  105 THR B N     1 
ATOM   4025 C  CA    . THR B 1 105 ? -33.705 -19.479 15.667  1.00 34.03  ?  105 THR B CA    1 
ATOM   4026 C  C     . THR B 1 105 ? -32.652 -18.616 14.971  1.00 28.92  ?  105 THR B C     1 
ATOM   4027 O  O     . THR B 1 105 ? -32.170 -19.019 13.945  1.00 33.54  ?  105 THR B O     1 
ATOM   4028 C  CB    . THR B 1 105 ? -33.400 -19.718 17.161  1.00 39.84  ?  105 THR B CB    1 
ATOM   4029 O  OG1   . THR B 1 105 ? -33.491 -18.437 17.800  1.00 38.37  ?  105 THR B OG1   1 
ATOM   4030 C  CG2   . THR B 1 105 ? -32.053 -20.376 17.424  1.00 38.40  ?  105 THR B CG2   1 
ATOM   4031 N  N     . GLY B 1 106 ? -32.333 -17.451 15.528  1.00 32.89  ?  106 GLY B N     1 
ATOM   4032 C  CA    . GLY B 1 106 ? -31.272 -16.553 15.054  1.00 30.34  ?  106 GLY B CA    1 
ATOM   4033 C  C     . GLY B 1 106 ? -31.413 -16.239 13.574  1.00 36.26  ?  106 GLY B C     1 
ATOM   4034 O  O     . GLY B 1 106 ? -32.495 -15.798 13.159  1.00 37.79  ?  106 GLY B O     1 
ATOM   4035 N  N     . SER B 1 107 ? -30.343 -16.423 12.792  1.00 34.00  ?  107 SER B N     1 
ATOM   4036 C  CA    . SER B 1 107 ? -30.273 -15.933 11.391  1.00 34.25  ?  107 SER B CA    1 
ATOM   4037 C  C     . SER B 1 107 ? -31.186 -16.809 10.520  1.00 36.79  ?  107 SER B C     1 
ATOM   4038 O  O     . SER B 1 107 ? -31.604 -16.344 9.443   1.00 33.07  ?  107 SER B O     1 
ATOM   4039 C  CB    . SER B 1 107 ? -28.858 -15.891 10.856  1.00 33.81  ?  107 SER B CB    1 
ATOM   4040 O  OG    . SER B 1 107 ? -28.314 -17.205 10.666  1.00 32.54  ?  107 SER B OG    1 
ATOM   4041 N  N     . PHE B 1 108 ? -31.527 -18.025 10.951  1.00 33.21  ?  108 PHE B N     1 
ATOM   4042 C  CA    . PHE B 1 108 ? -32.409 -18.868 10.120  1.00 29.57  ?  108 PHE B CA    1 
ATOM   4043 C  C     . PHE B 1 108 ? -33.759 -18.191 9.960   1.00 28.05  ?  108 PHE B C     1 
ATOM   4044 O  O     . PHE B 1 108 ? -34.245 -18.206 8.838   1.00 33.18  ?  108 PHE B O     1 
ATOM   4045 C  CB    . PHE B 1 108 ? -32.544 -20.285 10.637  1.00 31.16  ?  108 PHE B CB    1 
ATOM   4046 C  CG    . PHE B 1 108 ? -33.267 -21.149 9.648   1.00 29.03  ?  108 PHE B CG    1 
ATOM   4047 C  CD1   . PHE B 1 108 ? -32.559 -21.767 8.646   1.00 32.79  ?  108 PHE B CD1   1 
ATOM   4048 C  CD2   . PHE B 1 108 ? -34.644 -21.253 9.669   1.00 28.14  ?  108 PHE B CD2   1 
ATOM   4049 C  CE1   . PHE B 1 108 ? -33.195 -22.544 7.685   1.00 34.88  ?  108 PHE B CE1   1 
ATOM   4050 C  CE2   . PHE B 1 108 ? -35.288 -22.012 8.710   1.00 32.69  ?  108 PHE B CE2   1 
ATOM   4051 C  CZ    . PHE B 1 108 ? -34.560 -22.659 7.716   1.00 35.16  ?  108 PHE B CZ    1 
ATOM   4052 N  N     . LEU B 1 109 ? -34.306 -17.614 11.015  1.00 31.97  ?  109 LEU B N     1 
ATOM   4053 C  CA    . LEU B 1 109 ? -35.590 -16.857 10.990  1.00 37.06  ?  109 LEU B CA    1 
ATOM   4054 C  C     . LEU B 1 109 ? -35.478 -15.599 10.121  1.00 36.28  ?  109 LEU B C     1 
ATOM   4055 O  O     . LEU B 1 109 ? -36.414 -15.328 9.382   1.00 40.31  ?  109 LEU B O     1 
ATOM   4056 C  CB    . LEU B 1 109 ? -36.018 -16.465 12.404  1.00 36.79  ?  109 LEU B CB    1 
ATOM   4057 C  CG    . LEU B 1 109 ? -36.132 -17.609 13.403  1.00 42.50  ?  109 LEU B CG    1 
ATOM   4058 C  CD1   . LEU B 1 109 ? -36.600 -17.089 14.776  1.00 41.18  ?  109 LEU B CD1   1 
ATOM   4059 C  CD2   . LEU B 1 109 ? -37.042 -18.733 12.868  1.00 42.87  ?  109 LEU B CD2   1 
ATOM   4060 N  N     . LYS B 1 110 ? -34.396 -14.846 10.213  1.00 37.28  ?  110 LYS B N     1 
ATOM   4061 C  CA    . LYS B 1 110 ? -34.229 -13.604 9.424   1.00 41.27  ?  110 LYS B CA    1 
ATOM   4062 C  C     . LYS B 1 110 ? -34.186 -13.941 7.922   1.00 39.96  ?  110 LYS B C     1 
ATOM   4063 O  O     . LYS B 1 110 ? -34.854 -13.237 7.158   1.00 41.42  ?  110 LYS B O     1 
ATOM   4064 C  CB    . LYS B 1 110 ? -32.974 -12.840 9.873   1.00 55.35  ?  110 LYS B CB    1 
ATOM   4065 C  CG    . LYS B 1 110 ? -33.222 -11.802 10.961  1.00 77.59  ?  110 LYS B CG    1 
ATOM   4066 C  CD    . LYS B 1 110 ? -32.413 -10.501 10.759  1.00 100.56 ?  110 LYS B CD    1 
ATOM   4067 C  CE    . LYS B 1 110 ? -32.957 -9.313  11.532  1.00 106.20 ?  110 LYS B CE    1 
ATOM   4068 N  NZ    . LYS B 1 110 ? -32.523 -9.332  12.954  1.00 113.25 ?  110 LYS B NZ    1 
ATOM   4069 N  N     . ARG B 1 111 ? -33.439 -14.975 7.520   1.00 35.31  ?  111 ARG B N     1 
ATOM   4070 C  CA    . ARG B 1 111 ? -33.272 -15.407 6.112   1.00 35.86  ?  111 ARG B CA    1 
ATOM   4071 C  C     . ARG B 1 111 ? -34.510 -16.198 5.603   1.00 36.09  ?  111 ARG B C     1 
ATOM   4072 O  O     . ARG B 1 111 ? -34.622 -16.358 4.395   1.00 37.99  ?  111 ARG B O     1 
ATOM   4073 C  CB    . ARG B 1 111 ? -31.986 -16.228 5.978   1.00 33.89  ?  111 ARG B CB    1 
ATOM   4074 C  CG    . ARG B 1 111 ? -30.713 -15.403 5.844   1.00 35.78  ?  111 ARG B CG    1 
ATOM   4075 C  CD    . ARG B 1 111 ? -29.387 -16.101 6.259   1.00 41.26  ?  111 ARG B CD    1 
ATOM   4076 N  NE    . ARG B 1 111 ? -29.520 -17.541 6.116   1.00 44.08  ?  111 ARG B NE    1 
ATOM   4077 C  CZ    . ARG B 1 111 ? -29.462 -18.455 7.075   1.00 40.67  ?  111 ARG B CZ    1 
ATOM   4078 N  NH1   . ARG B 1 111 ? -29.155 -18.157 8.315   1.00 40.31  ?  111 ARG B NH1   1 
ATOM   4079 N  NH2   . ARG B 1 111 ? -29.684 -19.704 6.771   1.00 45.45  ?  111 ARG B NH2   1 
ATOM   4080 N  N     . ASN B 1 112 ? -35.392 -16.696 6.478   1.00 38.51  ?  112 ASN B N     1 
ATOM   4081 C  CA    . ASN B 1 112 ? -36.619 -17.469 6.135   1.00 34.17  ?  112 ASN B CA    1 
ATOM   4082 C  C     . ASN B 1 112 ? -37.850 -16.902 6.860   1.00 36.46  ?  112 ASN B C     1 
ATOM   4083 O  O     . ASN B 1 112 ? -38.466 -17.590 7.699   1.00 33.90  ?  112 ASN B O     1 
ATOM   4084 C  CB    . ASN B 1 112 ? -36.470 -18.935 6.521   1.00 38.04  ?  112 ASN B CB    1 
ATOM   4085 C  CG    . ASN B 1 112 ? -35.337 -19.620 5.790   1.00 41.35  ?  112 ASN B CG    1 
ATOM   4086 O  OD1   . ASN B 1 112 ? -35.568 -20.295 4.785   1.00 42.95  ?  112 ASN B OD1   1 
ATOM   4087 N  ND2   . ASN B 1 112 ? -34.128 -19.477 6.317   1.00 42.02  ?  112 ASN B ND2   1 
ATOM   4088 N  N     . PRO B 1 113 ? -38.252 -15.639 6.580   1.00 38.21  ?  113 PRO B N     1 
ATOM   4089 C  CA    . PRO B 1 113 ? -39.434 -15.044 7.232   1.00 38.88  ?  113 PRO B CA    1 
ATOM   4090 C  C     . PRO B 1 113 ? -40.668 -15.926 6.974   1.00 36.58  ?  113 PRO B C     1 
ATOM   4091 O  O     . PRO B 1 113 ? -40.813 -16.441 5.868   1.00 34.99  ?  113 PRO B O     1 
ATOM   4092 C  CB    . PRO B 1 113 ? -39.597 -13.647 6.588   1.00 36.63  ?  113 PRO B CB    1 
ATOM   4093 C  CG    . PRO B 1 113 ? -38.738 -13.711 5.311   1.00 38.67  ?  113 PRO B CG    1 
ATOM   4094 C  CD    . PRO B 1 113 ? -37.642 -14.731 5.585   1.00 37.73  ?  113 PRO B CD    1 
ATOM   4095 N  N     . GLY B 1 114 ? -41.454 -16.159 8.028   1.00 36.20  ?  114 GLY B N     1 
ATOM   4096 C  CA    . GLY B 1 114 ? -42.615 -17.064 8.020   1.00 33.95  ?  114 GLY B CA    1 
ATOM   4097 C  C     . GLY B 1 114 ? -42.366 -18.284 8.863   1.00 33.77  ?  114 GLY B C     1 
ATOM   4098 O  O     . GLY B 1 114 ? -43.314 -18.810 9.404   1.00 38.37  ?  114 GLY B O     1 
ATOM   4099 N  N     . VAL B 1 115 ? -41.123 -18.736 8.963   1.00 35.11  ?  115 VAL B N     1 
ATOM   4100 C  CA    . VAL B 1 115 ? -40.773 -19.880 9.850   1.00 33.69  ?  115 VAL B CA    1 
ATOM   4101 C  C     . VAL B 1 115 ? -40.793 -19.321 11.257  1.00 32.69  ?  115 VAL B C     1 
ATOM   4102 O  O     . VAL B 1 115 ? -40.285 -18.229 11.417  1.00 29.57  ?  115 VAL B O     1 
ATOM   4103 C  CB    . VAL B 1 115 ? -39.402 -20.498 9.518   1.00 30.68  ?  115 VAL B CB    1 
ATOM   4104 C  CG1   . VAL B 1 115 ? -39.060 -21.653 10.445  1.00 30.14  ?  115 VAL B CG1   1 
ATOM   4105 C  CG2   . VAL B 1 115 ? -39.328 -20.932 8.082   1.00 30.14  ?  115 VAL B CG2   1 
ATOM   4106 N  N     . LYS B 1 116 ? -41.394 -20.051 12.188  1.00 38.31  ?  116 LYS B N     1 
ATOM   4107 C  CA    . LYS B 1 116 ? -41.550 -19.652 13.615  1.00 44.71  ?  116 LYS B CA    1 
ATOM   4108 C  C     . LYS B 1 116 ? -40.369 -20.224 14.398  1.00 42.53  ?  116 LYS B C     1 
ATOM   4109 O  O     . LYS B 1 116 ? -39.942 -21.354 14.081  1.00 40.38  ?  116 LYS B O     1 
ATOM   4110 C  CB    . LYS B 1 116 ? -42.850 -20.210 14.218  1.00 53.81  ?  116 LYS B CB    1 
ATOM   4111 C  CG    . LYS B 1 116 ? -44.157 -19.670 13.658  1.00 61.34  ?  116 LYS B CG    1 
ATOM   4112 C  CD    . LYS B 1 116 ? -44.152 -18.147 13.419  1.00 65.81  ?  116 LYS B CD    1 
ATOM   4113 C  CE    . LYS B 1 116 ? -45.544 -17.588 13.163  1.00 67.05  ?  116 LYS B CE    1 
ATOM   4114 N  NZ    . LYS B 1 116 ? -45.583 -16.817 11.899  1.00 68.02  ?  116 LYS B NZ    1 
ATOM   4115 N  N     . GLU B 1 117 ? -39.871 -19.492 15.393  1.00 41.67  ?  117 GLU B N     1 
ATOM   4116 C  CA    . GLU B 1 117 ? -38.918 -20.035 16.384  1.00 46.07  ?  117 GLU B CA    1 
ATOM   4117 C  C     . GLU B 1 117 ? -39.434 -21.394 16.890  1.00 45.79  ?  117 GLU B C     1 
ATOM   4118 O  O     . GLU B 1 117 ? -40.639 -21.475 17.258  1.00 40.77  ?  117 GLU B O     1 
ATOM   4119 C  CB    . GLU B 1 117 ? -38.744 -19.082 17.561  1.00 50.87  ?  117 GLU B CB    1 
ATOM   4120 C  CG    . GLU B 1 117 ? -37.735 -19.625 18.572  1.00 56.72  ?  117 GLU B CG    1 
ATOM   4121 C  CD    . GLU B 1 117 ? -36.865 -18.579 19.240  1.00 67.38  ?  117 GLU B CD    1 
ATOM   4122 O  OE1   . GLU B 1 117 ? -36.067 -17.910 18.519  1.00 71.10  ?  117 GLU B OE1   1 
ATOM   4123 O  OE2   . GLU B 1 117 ? -37.034 -18.406 20.474  1.00 80.00  ?  117 GLU B OE2   1 
ATOM   4124 N  N     . GLY B 1 118 ? -38.577 -22.430 16.861  1.00 37.41  ?  118 GLY B N     1 
ATOM   4125 C  CA    . GLY B 1 118 ? -38.904 -23.742 17.441  1.00 34.90  ?  118 GLY B CA    1 
ATOM   4126 C  C     . GLY B 1 118 ? -39.169 -24.803 16.408  1.00 33.26  ?  118 GLY B C     1 
ATOM   4127 O  O     . GLY B 1 118 ? -39.296 -25.981 16.809  1.00 40.18  ?  118 GLY B O     1 
ATOM   4128 N  N     . TYR B 1 119 ? -39.265 -24.423 15.130  1.00 32.68  ?  119 TYR B N     1 
ATOM   4129 C  CA    . TYR B 1 119 ? -39.280 -25.363 13.994  1.00 33.78  ?  119 TYR B CA    1 
ATOM   4130 C  C     . TYR B 1 119 ? -38.109 -26.350 14.122  1.00 32.61  ?  119 TYR B C     1 
ATOM   4131 O  O     . TYR B 1 119 ? -36.973 -25.913 14.212  1.00 31.81  ?  119 TYR B O     1 
ATOM   4132 C  CB    . TYR B 1 119 ? -39.254 -24.625 12.662  1.00 38.72  ?  119 TYR B CB    1 
ATOM   4133 C  CG    . TYR B 1 119 ? -39.441 -25.544 11.483  1.00 43.17  ?  119 TYR B CG    1 
ATOM   4134 C  CD1   . TYR B 1 119 ? -38.380 -26.299 10.995  1.00 41.20  ?  119 TYR B CD1   1 
ATOM   4135 C  CD2   . TYR B 1 119 ? -40.666 -25.670 10.858  1.00 49.13  ?  119 TYR B CD2   1 
ATOM   4136 C  CE1   . TYR B 1 119 ? -38.527 -27.149 9.921   1.00 37.30  ?  119 TYR B CE1   1 
ATOM   4137 C  CE2   . TYR B 1 119 ? -40.834 -26.517 9.770   1.00 48.69  ?  119 TYR B CE2   1 
ATOM   4138 C  CZ    . TYR B 1 119 ? -39.757 -27.264 9.314   1.00 45.74  ?  119 TYR B CZ    1 
ATOM   4139 O  OH    . TYR B 1 119 ? -39.861 -28.121 8.273   1.00 47.47  ?  119 TYR B OH    1 
ATOM   4140 N  N     . LYS B 1 120 ? -38.400 -27.656 14.118  1.00 35.53  ?  120 LYS B N     1 
ATOM   4141 C  CA    . LYS B 1 120 ? -37.410 -28.742 14.301  1.00 35.15  ?  120 LYS B CA    1 
ATOM   4142 C  C     . LYS B 1 120 ? -36.964 -29.271 12.939  1.00 37.30  ?  120 LYS B C     1 
ATOM   4143 O  O     . LYS B 1 120 ? -37.829 -29.522 12.078  1.00 42.57  ?  120 LYS B O     1 
ATOM   4144 C  CB    . LYS B 1 120 ? -37.997 -29.885 15.114  1.00 43.37  ?  120 LYS B CB    1 
ATOM   4145 C  CG    . LYS B 1 120 ? -38.379 -29.530 16.537  1.00 51.13  ?  120 LYS B CG    1 
ATOM   4146 C  CD    . LYS B 1 120 ? -37.240 -29.654 17.495  1.00 58.68  ?  120 LYS B CD    1 
ATOM   4147 C  CE    . LYS B 1 120 ? -37.665 -29.462 18.938  1.00 64.64  ?  120 LYS B CE    1 
ATOM   4148 N  NZ    . LYS B 1 120 ? -37.982 -30.768 19.553  1.00 67.65  ?  120 LYS B NZ    1 
ATOM   4149 N  N     . PHE B 1 121 ? -35.659 -29.451 12.772  1.00 32.48  ?  121 PHE B N     1 
ATOM   4150 C  CA    . PHE B 1 121 ? -35.025 -30.014 11.563  1.00 30.38  ?  121 PHE B CA    1 
ATOM   4151 C  C     . PHE B 1 121 ? -34.692 -31.496 11.802  1.00 31.58  ?  121 PHE B C     1 
ATOM   4152 O  O     . PHE B 1 121 ? -33.931 -31.833 12.695  1.00 30.21  ?  121 PHE B O     1 
ATOM   4153 C  CB    . PHE B 1 121 ? -33.762 -29.221 11.225  1.00 32.63  ?  121 PHE B CB    1 
ATOM   4154 C  CG    . PHE B 1 121 ? -33.987 -27.762 10.949  1.00 29.46  ?  121 PHE B CG    1 
ATOM   4155 C  CD1   . PHE B 1 121 ? -34.531 -27.353 9.741   1.00 31.04  ?  121 PHE B CD1   1 
ATOM   4156 C  CD2   . PHE B 1 121 ? -33.640 -26.803 11.871  1.00 28.36  ?  121 PHE B CD2   1 
ATOM   4157 C  CE1   . PHE B 1 121 ? -34.692 -25.999 9.463   1.00 31.87  ?  121 PHE B CE1   1 
ATOM   4158 C  CE2   . PHE B 1 121 ? -33.807 -25.449 11.606  1.00 30.36  ?  121 PHE B CE2   1 
ATOM   4159 C  CZ    . PHE B 1 121 ? -34.318 -25.040 10.397  1.00 31.24  ?  121 PHE B CZ    1 
ATOM   4160 N  N     . TYR B 1 122 ? -35.291 -32.364 10.999  1.00 33.79  ?  122 TYR B N     1 
ATOM   4161 C  CA    . TYR B 1 122 ? -35.016 -33.810 10.918  1.00 37.25  ?  122 TYR B CA    1 
ATOM   4162 C  C     . TYR B 1 122 ? -34.618 -34.153 9.481   1.00 35.99  ?  122 TYR B C     1 
ATOM   4163 O  O     . TYR B 1 122 ? -35.465 -34.133 8.603   1.00 38.75  ?  122 TYR B O     1 
ATOM   4164 C  CB    . TYR B 1 122 ? -36.267 -34.585 11.360  1.00 39.39  ?  122 TYR B CB    1 
ATOM   4165 C  CG    . TYR B 1 122 ? -36.876 -34.201 12.679  1.00 38.60  ?  122 TYR B CG    1 
ATOM   4166 C  CD1   . TYR B 1 122 ? -36.207 -34.478 13.862  1.00 43.37  ?  122 TYR B CD1   1 
ATOM   4167 C  CD2   . TYR B 1 122 ? -38.135 -33.626 12.764  1.00 38.90  ?  122 TYR B CD2   1 
ATOM   4168 C  CE1   . TYR B 1 122 ? -36.752 -34.175 15.106  1.00 41.05  ?  122 TYR B CE1   1 
ATOM   4169 C  CE2   . TYR B 1 122 ? -38.698 -33.327 13.998  1.00 45.80  ?  122 TYR B CE2   1 
ATOM   4170 C  CZ    . TYR B 1 122 ? -38.008 -33.607 15.174  1.00 43.55  ?  122 TYR B CZ    1 
ATOM   4171 O  OH    . TYR B 1 122 ? -38.524 -33.301 16.397  1.00 44.59  ?  122 TYR B OH    1 
ATOM   4172 N  N     . PRO B 1 123 ? -33.331 -34.422 9.140   1.00 40.32  ?  123 PRO B N     1 
ATOM   4173 C  CA    . PRO B 1 123 ? -32.192 -34.374 10.064  1.00 34.42  ?  123 PRO B CA    1 
ATOM   4174 C  C     . PRO B 1 123 ? -31.715 -32.946 10.285  1.00 30.95  ?  123 PRO B C     1 
ATOM   4175 O  O     . PRO B 1 123 ? -32.234 -32.012 9.674   1.00 33.61  ?  123 PRO B O     1 
ATOM   4176 C  CB    . PRO B 1 123 ? -31.111 -35.195 9.333   1.00 34.08  ?  123 PRO B CB    1 
ATOM   4177 C  CG    . PRO B 1 123 ? -31.394 -34.944 7.860   1.00 32.57  ?  123 PRO B CG    1 
ATOM   4178 C  CD    . PRO B 1 123 ? -32.891 -34.749 7.768   1.00 34.66  ?  123 PRO B CD    1 
ATOM   4179 N  N     . PRO B 1 124 ? -30.753 -32.729 11.212  1.00 33.96  ?  124 PRO B N     1 
ATOM   4180 C  CA    . PRO B 1 124 ? -30.263 -31.380 11.494  1.00 30.42  ?  124 PRO B CA    1 
ATOM   4181 C  C     . PRO B 1 124 ? -29.815 -30.688 10.199  1.00 31.19  ?  124 PRO B C     1 
ATOM   4182 O  O     . PRO B 1 124 ? -29.169 -31.319 9.389   1.00 32.78  ?  124 PRO B O     1 
ATOM   4183 C  CB    . PRO B 1 124 ? -29.091 -31.619 12.468  1.00 29.20  ?  124 PRO B CB    1 
ATOM   4184 C  CG    . PRO B 1 124 ? -29.438 -32.923 13.146  1.00 32.00  ?  124 PRO B CG    1 
ATOM   4185 C  CD    . PRO B 1 124 ? -30.139 -33.751 12.097  1.00 31.29  ?  124 PRO B CD    1 
ATOM   4186 N  N     . LYS B 1 125 ? -30.160 -29.410 10.064  1.00 32.03  ?  125 LYS B N     1 
ATOM   4187 C  CA    . LYS B 1 125 ? -29.810 -28.537 8.920   1.00 35.94  ?  125 LYS B CA    1 
ATOM   4188 C  C     . LYS B 1 125 ? -28.341 -28.116 9.025   1.00 34.51  ?  125 LYS B C     1 
ATOM   4189 O  O     . LYS B 1 125 ? -27.957 -27.555 10.052  1.00 35.08  ?  125 LYS B O     1 
ATOM   4190 C  CB    . LYS B 1 125 ? -30.744 -27.321 8.928   1.00 39.68  ?  125 LYS B CB    1 
ATOM   4191 C  CG    . LYS B 1 125 ? -30.467 -26.264 7.868   1.00 46.43  ?  125 LYS B CG    1 
ATOM   4192 C  CD    . LYS B 1 125 ? -30.881 -26.645 6.474   1.00 49.65  ?  125 LYS B CD    1 
ATOM   4193 C  CE    . LYS B 1 125 ? -32.383 -26.625 6.300   1.00 52.26  ?  125 LYS B CE    1 
ATOM   4194 N  NZ    . LYS B 1 125 ? -32.794 -26.855 4.895   1.00 51.83  ?  125 LYS B NZ    1 
ATOM   4195 N  N     . VAL B 1 126 ? -27.577 -28.326 7.957   1.00 33.14  ?  126 VAL B N     1 
ATOM   4196 C  CA    . VAL B 1 126 ? -26.190 -27.809 7.783   1.00 31.86  ?  126 VAL B CA    1 
ATOM   4197 C  C     . VAL B 1 126 ? -26.216 -26.607 6.831   1.00 28.30  ?  126 VAL B C     1 
ATOM   4198 O  O     . VAL B 1 126 ? -26.827 -26.720 5.782   1.00 29.49  ?  126 VAL B O     1 
ATOM   4199 C  CB    . VAL B 1 126 ? -25.277 -28.932 7.266   1.00 32.36  ?  126 VAL B CB    1 
ATOM   4200 C  CG1   . VAL B 1 126 ? -23.840 -28.484 7.124   1.00 33.65  ?  126 VAL B CG1   1 
ATOM   4201 C  CG2   . VAL B 1 126 ? -25.361 -30.139 8.182   1.00 32.14  ?  126 VAL B CG2   1 
ATOM   4202 N  N     . GLU B 1 127 ? -25.540 -25.509 7.196   1.00 30.84  ?  127 GLU B N     1 
ATOM   4203 C  CA    . GLU B 1 127 ? -25.332 -24.305 6.341   1.00 30.22  ?  127 GLU B CA    1 
ATOM   4204 C  C     . GLU B 1 127 ? -23.887 -23.847 6.402   1.00 29.25  ?  127 GLU B C     1 
ATOM   4205 O  O     . GLU B 1 127 ? -23.222 -24.126 7.408   1.00 30.66  ?  127 GLU B O     1 
ATOM   4206 C  CB    . GLU B 1 127 ? -26.213 -23.143 6.789   1.00 34.90  ?  127 GLU B CB    1 
ATOM   4207 C  CG    . GLU B 1 127 ? -27.684 -23.516 6.866   1.00 40.74  ?  127 GLU B CG    1 
ATOM   4208 C  CD    . GLU B 1 127 ? -28.600 -22.412 7.402   1.00 41.86  ?  127 GLU B CD    1 
ATOM   4209 O  OE1   . GLU B 1 127 ? -28.256 -21.704 8.426   1.00 38.16  ?  127 GLU B OE1   1 
ATOM   4210 O  OE2   . GLU B 1 127 ? -29.662 -22.254 6.768   1.00 48.56  ?  127 GLU B OE2   1 
ATOM   4211 N  N     . LEU B 1 128 ? -23.449 -23.176 5.332   1.00 33.35  ?  128 LEU B N     1 
ATOM   4212 C  CA    . LEU B 1 128 ? -22.063 -22.666 5.086   1.00 34.51  ?  128 LEU B CA    1 
ATOM   4213 C  C     . LEU B 1 128 ? -22.128 -21.150 5.121   1.00 33.68  ?  128 LEU B C     1 
ATOM   4214 O  O     . LEU B 1 128 ? -23.008 -20.617 4.435   1.00 37.27  ?  128 LEU B O     1 
ATOM   4215 C  CB    . LEU B 1 128 ? -21.554 -23.041 3.696   1.00 34.19  ?  128 LEU B CB    1 
ATOM   4216 C  CG    . LEU B 1 128 ? -21.248 -24.516 3.462   1.00 45.66  ?  128 LEU B CG    1 
ATOM   4217 C  CD1   . LEU B 1 128 ? -22.505 -25.357 3.308   1.00 47.51  ?  128 LEU B CD1   1 
ATOM   4218 C  CD2   . LEU B 1 128 ? -20.404 -24.695 2.208   1.00 54.66  ?  128 LEU B CD2   1 
ATOM   4219 N  N     . PHE B 1 129 ? -21.193 -20.505 5.817   1.00 31.17  ?  129 PHE B N     1 
ATOM   4220 C  CA    . PHE B 1 129 ? -20.976 -19.039 5.779   1.00 35.99  ?  129 PHE B CA    1 
ATOM   4221 C  C     . PHE B 1 129 ? -19.497 -18.759 5.517   1.00 34.47  ?  129 PHE B C     1 
ATOM   4222 O  O     . PHE B 1 129 ? -18.650 -19.315 6.192   1.00 33.62  ?  129 PHE B O     1 
ATOM   4223 C  CB    . PHE B 1 129 ? -21.476 -18.406 7.077   1.00 40.25  ?  129 PHE B CB    1 
ATOM   4224 C  CG    . PHE B 1 129 ? -22.929 -18.652 7.375   1.00 34.15  ?  129 PHE B CG    1 
ATOM   4225 C  CD1   . PHE B 1 129 ? -23.342 -19.840 7.952   1.00 33.36  ?  129 PHE B CD1   1 
ATOM   4226 C  CD2   . PHE B 1 129 ? -23.884 -17.701 7.060   1.00 37.63  ?  129 PHE B CD2   1 
ATOM   4227 C  CE1   . PHE B 1 129 ? -24.680 -20.072 8.201   1.00 34.45  ?  129 PHE B CE1   1 
ATOM   4228 C  CE2   . PHE B 1 129 ? -25.228 -17.928 7.341   1.00 37.48  ?  129 PHE B CE2   1 
ATOM   4229 C  CZ    . PHE B 1 129 ? -25.623 -19.115 7.902   1.00 34.13  ?  129 PHE B CZ    1 
ATOM   4230 N  N     . PHE B 1 130 ? -19.219 -17.951 4.511   1.00 36.81  ?  130 PHE B N     1 
ATOM   4231 C  CA    . PHE B 1 130 ? -17.863 -17.494 4.139   1.00 42.02  ?  130 PHE B CA    1 
ATOM   4232 C  C     . PHE B 1 130 ? -17.405 -16.455 5.172   1.00 41.89  ?  130 PHE B C     1 
ATOM   4233 O  O     . PHE B 1 130 ? -18.183 -15.536 5.490   1.00 33.09  ?  130 PHE B O     1 
ATOM   4234 C  CB    . PHE B 1 130 ? -17.853 -16.964 2.703   1.00 48.12  ?  130 PHE B CB    1 
ATOM   4235 C  CG    . PHE B 1 130 ? -16.558 -16.305 2.286   1.00 56.41  ?  130 PHE B CG    1 
ATOM   4236 C  CD1   . PHE B 1 130 ? -15.382 -17.041 2.188   1.00 57.15  ?  130 PHE B CD1   1 
ATOM   4237 C  CD2   . PHE B 1 130 ? -16.516 -14.951 1.975   1.00 62.00  ?  130 PHE B CD2   1 
ATOM   4238 C  CE1   . PHE B 1 130 ? -14.202 -16.437 1.787   1.00 56.03  ?  130 PHE B CE1   1 
ATOM   4239 C  CE2   . PHE B 1 130 ? -15.328 -14.346 1.591   1.00 62.73  ?  130 PHE B CE2   1 
ATOM   4240 C  CZ    . PHE B 1 130 ? -14.175 -15.093 1.498   1.00 57.03  ?  130 PHE B CZ    1 
ATOM   4241 N  N     . LYS B 1 131 ? -16.183 -16.622 5.686   1.00 45.36  ?  131 LYS B N     1 
ATOM   4242 C  CA    . LYS B 1 131 ? -15.589 -15.741 6.737   1.00 56.94  ?  131 LYS B CA    1 
ATOM   4243 C  C     . LYS B 1 131 ? -15.090 -14.437 6.100   1.00 64.16  ?  131 LYS B C     1 
ATOM   4244 O  O     . LYS B 1 131 ? -14.152 -14.480 5.256   1.00 61.23  ?  131 LYS B O     1 
ATOM   4245 C  CB    . LYS B 1 131 ? -14.460 -16.467 7.479   1.00 50.72  ?  131 LYS B CB    1 
ATOM   4246 C  CG    . LYS B 1 131 ? -14.935 -17.583 8.405   1.00 47.42  ?  131 LYS B CG    1 
ATOM   4247 C  CD    . LYS B 1 131 ? -13.829 -18.318 9.123   1.00 45.34  ?  131 LYS B CD    1 
ATOM   4248 C  CE    . LYS B 1 131 ? -13.190 -17.468 10.202  1.00 43.23  ?  131 LYS B CE    1 
ATOM   4249 N  NZ    . LYS B 1 131 ? -14.134 -17.219 11.303  1.00 42.50  ?  131 LYS B NZ    1 
ATOM   4250 N  N     . ASP B 1 132 ? -15.709 -13.332 6.504   1.00 82.16  ?  132 ASP B N     1 
ATOM   4251 C  CA    . ASP B 1 132 ? -15.525 -11.958 5.965   1.00 89.91  ?  132 ASP B CA    1 
ATOM   4252 C  C     . ASP B 1 132 ? -16.359 -11.082 6.906   1.00 101.43 ?  132 ASP B C     1 
ATOM   4253 O  O     . ASP B 1 132 ? -17.590 -11.267 6.942   1.00 100.83 ?  132 ASP B O     1 
ATOM   4254 C  CB    . ASP B 1 132 ? -15.916 -11.908 4.483   1.00 87.66  ?  132 ASP B CB    1 
ATOM   4255 C  CG    . ASP B 1 132 ? -15.784 -10.537 3.855   1.00 93.90  ?  132 ASP B CG    1 
ATOM   4256 O  OD1   . ASP B 1 132 ? -15.077 -9.681  4.436   1.00 99.38  ?  132 ASP B OD1   1 
ATOM   4257 O  OD2   . ASP B 1 132 ? -16.387 -10.339 2.791   1.00 85.05  ?  132 ASP B OD2   1 
ATOM   4258 N  N     . ASP B 1 133 ? -15.689 -10.288 7.750   1.00 117.48 ?  133 ASP B N     1 
ATOM   4259 C  CA    . ASP B 1 133 ? -16.303 -9.385  8.767   1.00 117.92 ?  133 ASP B CA    1 
ATOM   4260 C  C     . ASP B 1 133 ? -16.903 -8.187  8.022   1.00 114.73 ?  133 ASP B C     1 
ATOM   4261 O  O     . ASP B 1 133 ? -18.008 -7.755  8.396   1.00 107.23 ?  133 ASP B O     1 
ATOM   4262 C  CB    . ASP B 1 133 ? -15.274 -8.971  9.831   1.00 116.92 ?  133 ASP B CB    1 
ATOM   4263 C  CG    . ASP B 1 133 ? -14.732 -10.128 10.670  1.00 119.17 ?  133 ASP B CG    1 
ATOM   4264 O  OD1   . ASP B 1 133 ? -15.478 -11.128 10.850  1.00 103.43 ?  133 ASP B OD1   1 
ATOM   4265 O  OD2   . ASP B 1 133 ? -13.564 -10.028 11.145  1.00 110.38 ?  133 ASP B OD2   1 
ATOM   4266 N  N     . ALA B 1 134 ? -16.206 -7.712  6.977   1.00 117.33 ?  134 ALA B N     1 
ATOM   4267 C  CA    . ALA B 1 134 ? -16.623 -6.603  6.082   1.00 104.03 ?  134 ALA B CA    1 
ATOM   4268 C  C     . ALA B 1 134 ? -18.102 -6.748  5.660   1.00 104.74 ?  134 ALA B C     1 
ATOM   4269 O  O     . ALA B 1 134 ? -18.801 -5.719  5.688   1.00 105.14 ?  134 ALA B O     1 
ATOM   4270 C  CB    . ALA B 1 134 ? -15.693 -6.521  4.889   1.00 84.62  ?  134 ALA B CB    1 
ATOM   4271 N  N     . ASN B 1 135 ? -18.567 -7.956  5.298   1.00 105.31 ?  135 ASN B N     1 
ATOM   4272 C  CA    . ASN B 1 135 ? -19.939 -8.226  4.750   1.00 97.94  ?  135 ASN B CA    1 
ATOM   4273 C  C     . ASN B 1 135 ? -20.770 -9.119  5.696   1.00 86.02  ?  135 ASN B C     1 
ATOM   4274 O  O     . ASN B 1 135 ? -21.735 -9.761  5.205   1.00 71.34  ?  135 ASN B O     1 
ATOM   4275 C  CB    . ASN B 1 135 ? -19.905 -8.882  3.360   1.00 93.41  ?  135 ASN B CB    1 
ATOM   4276 C  CG    . ASN B 1 135 ? -19.245 -8.037  2.289   1.00 94.71  ?  135 ASN B CG    1 
ATOM   4277 O  OD1   . ASN B 1 135 ? -18.251 -7.357  2.521   1.00 98.87  ?  135 ASN B OD1   1 
ATOM   4278 N  ND2   . ASN B 1 135 ? -19.770 -8.103  1.079   1.00 92.27  ?  135 ASN B ND2   1 
ATOM   4279 N  N     . ASN B 1 136 ? -20.414 -9.174  6.988   1.00 78.86  ?  136 ASN B N     1 
ATOM   4280 C  CA    . ASN B 1 136 ? -21.211 -9.810  8.080   1.00 79.32  ?  136 ASN B CA    1 
ATOM   4281 C  C     . ASN B 1 136 ? -21.393 -11.328 7.838   1.00 72.44  ?  136 ASN B C     1 
ATOM   4282 O  O     . ASN B 1 136 ? -22.393 -11.874 8.332   1.00 64.60  ?  136 ASN B O     1 
ATOM   4283 C  CB    . ASN B 1 136 ? -22.558 -9.092  8.279   1.00 79.50  ?  136 ASN B CB    1 
ATOM   4284 C  CG    . ASN B 1 136 ? -22.932 -8.861  9.743   1.00 91.47  ?  136 ASN B CG    1 
ATOM   4285 O  OD1   . ASN B 1 136 ? -22.343 -8.007  10.431  1.00 77.21  ?  136 ASN B OD1   1 
ATOM   4286 N  ND2   . ASN B 1 136 ? -23.936 -9.586  10.234  1.00 76.95  ?  136 ASN B ND2   1 
ATOM   4287 N  N     . ASP B 1 137 ? -20.436 -11.993 7.162   1.00 64.41  ?  137 ASP B N     1 
ATOM   4288 C  CA    . ASP B 1 137 ? -20.329 -13.476 6.991   1.00 55.40  ?  137 ASP B CA    1 
ATOM   4289 C  C     . ASP B 1 137 ? -21.491 -13.981 6.133   1.00 47.77  ?  137 ASP B C     1 
ATOM   4290 O  O     . ASP B 1 137 ? -22.420 -14.610 6.636   1.00 43.85  ?  137 ASP B O     1 
ATOM   4291 C  CB    . ASP B 1 137 ? -20.282 -14.245 8.320   1.00 56.67  ?  137 ASP B CB    1 
ATOM   4292 C  CG    . ASP B 1 137 ? -18.995 -14.111 9.139   1.00 65.96  ?  137 ASP B CG    1 
ATOM   4293 O  OD1   . ASP B 1 137 ? -17.929 -13.656 8.577   1.00 57.97  ?  137 ASP B OD1   1 
ATOM   4294 O  OD2   . ASP B 1 137 ? -19.059 -14.495 10.362  1.00 58.97  ?  137 ASP B OD2   1 
ATOM   4295 N  N     . PRO B 1 138 ? -21.453 -13.749 4.807   1.00 37.31  ?  138 PRO B N     1 
ATOM   4296 C  CA    . PRO B 1 138 ? -22.548 -14.136 3.934   1.00 37.40  ?  138 PRO B CA    1 
ATOM   4297 C  C     . PRO B 1 138 ? -22.691 -15.653 3.734   1.00 35.61  ?  138 PRO B C     1 
ATOM   4298 O  O     . PRO B 1 138 ? -21.721 -16.352 3.653   1.00 31.43  ?  138 PRO B O     1 
ATOM   4299 C  CB    . PRO B 1 138 ? -22.172 -13.468 2.605   1.00 39.08  ?  138 PRO B CB    1 
ATOM   4300 C  CG    . PRO B 1 138 ? -20.648 -13.462 2.638   1.00 38.60  ?  138 PRO B CG    1 
ATOM   4301 C  CD    . PRO B 1 138 ? -20.341 -13.124 4.073   1.00 38.94  ?  138 PRO B CD    1 
ATOM   4302 N  N     . GLN B 1 139 ? -23.928 -16.121 3.655   1.00 34.77  ?  139 GLN B N     1 
ATOM   4303 C  CA    . GLN B 1 139 ? -24.208 -17.547 3.410   1.00 34.36  ?  139 GLN B CA    1 
ATOM   4304 C  C     . GLN B 1 139 ? -23.666 -17.906 2.025   1.00 32.17  ?  139 GLN B C     1 
ATOM   4305 O  O     . GLN B 1 139 ? -23.886 -17.127 1.079   1.00 35.25  ?  139 GLN B O     1 
ATOM   4306 C  CB    . GLN B 1 139 ? -25.707 -17.855 3.518   1.00 32.97  ?  139 GLN B CB    1 
ATOM   4307 C  CG    . GLN B 1 139 ? -25.987 -19.335 3.269   1.00 36.64  ?  139 GLN B CG    1 
ATOM   4308 C  CD    . GLN B 1 139 ? -27.392 -19.690 3.656   1.00 42.14  ?  139 GLN B CD    1 
ATOM   4309 O  OE1   . GLN B 1 139 ? -28.223 -18.795 3.833   1.00 47.75  ?  139 GLN B OE1   1 
ATOM   4310 N  NE2   . GLN B 1 139 ? -27.676 -20.982 3.725   1.00 32.12  ?  139 GLN B NE2   1 
ATOM   4311 N  N     . TRP B 1 140 ? -22.999 -19.051 1.922   1.00 30.89  ?  140 TRP B N     1 
ATOM   4312 C  CA    . TRP B 1 140 ? -22.545 -19.638 0.645   1.00 31.29  ?  140 TRP B CA    1 
ATOM   4313 C  C     . TRP B 1 140 ? -23.336 -20.913 0.397   1.00 30.16  ?  140 TRP B C     1 
ATOM   4314 O  O     . TRP B 1 140 ? -23.820 -21.515 1.375   1.00 27.59  ?  140 TRP B O     1 
ATOM   4315 C  CB    . TRP B 1 140 ? -21.036 -19.903 0.640   1.00 32.88  ?  140 TRP B CB    1 
ATOM   4316 C  CG    . TRP B 1 140 ? -20.164 -18.778 0.165   1.00 32.42  ?  140 TRP B CG    1 
ATOM   4317 C  CD1   . TRP B 1 140 ? -20.453 -17.447 0.154   1.00 35.91  ?  140 TRP B CD1   1 
ATOM   4318 C  CD2   . TRP B 1 140 ? -18.802 -18.893 -0.275  1.00 34.06  ?  140 TRP B CD2   1 
ATOM   4319 N  NE1   . TRP B 1 140 ? -19.373 -16.726 -0.286  1.00 38.52  ?  140 TRP B NE1   1 
ATOM   4320 C  CE2   . TRP B 1 140 ? -18.346 -17.586 -0.561  1.00 36.06  ?  140 TRP B CE2   1 
ATOM   4321 C  CE3   . TRP B 1 140 ? -17.939 -19.977 -0.490  1.00 35.11  ?  140 TRP B CE3   1 
ATOM   4322 C  CZ2   . TRP B 1 140 ? -17.074 -17.328 -1.063  1.00 38.09  ?  140 TRP B CZ2   1 
ATOM   4323 C  CZ3   . TRP B 1 140 ? -16.688 -19.722 -1.010  1.00 36.95  ?  140 TRP B CZ3   1 
ATOM   4324 C  CH2   . TRP B 1 140 ? -16.254 -18.417 -1.268  1.00 38.50  ?  140 TRP B CH2   1 
ATOM   4325 N  N     . SER B 1 141 ? -23.524 -21.230 -0.875  1.00 29.53  ?  141 SER B N     1 
ATOM   4326 C  CA    . SER B 1 141 ? -24.018 -22.558 -1.320  1.00 34.40  ?  141 SER B CA    1 
ATOM   4327 C  C     . SER B 1 141 ? -22.822 -23.517 -1.411  1.00 30.06  ?  141 SER B C     1 
ATOM   4328 O  O     . SER B 1 141 ? -21.698 -23.018 -1.533  1.00 29.79  ?  141 SER B O     1 
ATOM   4329 C  CB    . SER B 1 141 ? -24.738 -22.404 -2.639  1.00 31.13  ?  141 SER B CB    1 
ATOM   4330 O  OG    . SER B 1 141 ? -23.819 -22.037 -3.654  1.00 32.72  ?  141 SER B OG    1 
ATOM   4331 N  N     . GLU B 1 142 ? -23.058 -24.823 -1.419  1.00 30.63  ?  142 GLU B N     1 
ATOM   4332 C  CA    . GLU B 1 142 ? -21.991 -25.807 -1.744  1.00 38.15  ?  142 GLU B CA    1 
ATOM   4333 C  C     . GLU B 1 142 ? -21.389 -25.446 -3.109  1.00 39.60  ?  142 GLU B C     1 
ATOM   4334 O  O     . GLU B 1 142 ? -20.195 -25.558 -3.265  1.00 39.25  ?  142 GLU B O     1 
ATOM   4335 C  CB    . GLU B 1 142 ? -22.513 -27.246 -1.733  1.00 43.14  ?  142 GLU B CB    1 
ATOM   4336 C  CG    . GLU B 1 142 ? -22.793 -27.792 -0.336  1.00 49.44  ?  142 GLU B CG    1 
ATOM   4337 C  CD    . GLU B 1 142 ? -23.138 -29.276 -0.317  1.00 59.18  ?  142 GLU B CD    1 
ATOM   4338 O  OE1   . GLU B 1 142 ? -23.394 -29.782 -1.435  1.00 58.43  ?  142 GLU B OE1   1 
ATOM   4339 O  OE2   . GLU B 1 142 ? -23.151 -29.925 0.805   1.00 58.05  ?  142 GLU B OE2   1 
ATOM   4340 N  N     . GLU B 1 143 ? -22.205 -25.017 -4.073  1.00 44.47  ?  143 GLU B N     1 
ATOM   4341 C  CA    . GLU B 1 143 ? -21.741 -24.705 -5.460  1.00 44.43  ?  143 GLU B CA    1 
ATOM   4342 C  C     . GLU B 1 143 ? -20.728 -23.542 -5.415  1.00 34.35  ?  143 GLU B C     1 
ATOM   4343 O  O     . GLU B 1 143 ? -19.752 -23.589 -6.148  1.00 31.07  ?  143 GLU B O     1 
ATOM   4344 C  CB    . GLU B 1 143 ? -22.924 -24.415 -6.401  1.00 44.58  ?  143 GLU B CB    1 
ATOM   4345 C  CG    . GLU B 1 143 ? -23.754 -25.660 -6.699  1.00 47.04  ?  143 GLU B CG    1 
ATOM   4346 C  CD    . GLU B 1 143 ? -24.810 -26.035 -5.663  1.00 46.89  ?  143 GLU B CD    1 
ATOM   4347 O  OE1   . GLU B 1 143 ? -24.946 -25.294 -4.687  1.00 47.65  ?  143 GLU B OE1   1 
ATOM   4348 O  OE2   . GLU B 1 143 ? -25.510 -27.052 -5.835  1.00 46.56  ?  143 GLU B OE2   1 
ATOM   4349 N  N     . GLN B 1 144 ? -20.951 -22.545 -4.560  1.00 36.30  ?  144 GLN B N     1 
ATOM   4350 C  CA    . GLN B 1 144 ? -20.021 -21.396 -4.407  1.00 35.00  ?  144 GLN B CA    1 
ATOM   4351 C  C     . GLN B 1 144 ? -18.682 -21.871 -3.842  1.00 34.95  ?  144 GLN B C     1 
ATOM   4352 O  O     . GLN B 1 144 ? -17.646 -21.359 -4.325  1.00 34.41  ?  144 GLN B O     1 
ATOM   4353 C  CB    . GLN B 1 144 ? -20.588 -20.313 -3.497  1.00 32.82  ?  144 GLN B CB    1 
ATOM   4354 C  CG    . GLN B 1 144 ? -21.404 -19.282 -4.285  1.00 33.03  ?  144 GLN B CG    1 
ATOM   4355 C  CD    . GLN B 1 144 ? -22.232 -18.384 -3.394  1.00 31.44  ?  144 GLN B CD    1 
ATOM   4356 O  OE1   . GLN B 1 144 ? -22.968 -18.857 -2.518  1.00 29.39  ?  144 GLN B OE1   1 
ATOM   4357 N  NE2   . GLN B 1 144 ? -22.074 -17.084 -3.602  1.00 29.47  ?  144 GLN B NE2   1 
ATOM   4358 N  N     . LEU B 1 145 ? -18.703 -22.769 -2.852  1.00 36.18  ?  145 LEU B N     1 
ATOM   4359 C  CA    . LEU B 1 145 ? -17.471 -23.270 -2.196  1.00 32.66  ?  145 LEU B CA    1 
ATOM   4360 C  C     . LEU B 1 145 ? -16.686 -24.115 -3.195  1.00 33.56  ?  145 LEU B C     1 
ATOM   4361 O  O     . LEU B 1 145 ? -15.472 -23.958 -3.302  1.00 38.16  ?  145 LEU B O     1 
ATOM   4362 C  CB    . LEU B 1 145 ? -17.829 -24.084 -0.958  1.00 36.20  ?  145 LEU B CB    1 
ATOM   4363 C  CG    . LEU B 1 145 ? -16.644 -24.603 -0.152  1.00 36.07  ?  145 LEU B CG    1 
ATOM   4364 C  CD1   . LEU B 1 145 ? -15.675 -23.462 0.128   1.00 31.87  ?  145 LEU B CD1   1 
ATOM   4365 C  CD2   . LEU B 1 145 ? -17.107 -25.256 1.150   1.00 37.15  ?  145 LEU B CD2   1 
ATOM   4366 N  N     . ILE B 1 146 ? -17.355 -24.965 -3.954  1.00 36.99  ?  146 ILE B N     1 
ATOM   4367 C  CA    . ILE B 1 146 ? -16.670 -25.786 -4.981  1.00 39.17  ?  146 ILE B CA    1 
ATOM   4368 C  C     . ILE B 1 146 ? -16.029 -24.841 -6.028  1.00 42.42  ?  146 ILE B C     1 
ATOM   4369 O  O     . ILE B 1 146 ? -14.840 -25.031 -6.389  1.00 38.46  ?  146 ILE B O     1 
ATOM   4370 C  CB    . ILE B 1 146 ? -17.639 -26.802 -5.579  1.00 39.28  ?  146 ILE B CB    1 
ATOM   4371 C  CG1   . ILE B 1 146 ? -18.109 -27.784 -4.506  1.00 36.11  ?  146 ILE B CG1   1 
ATOM   4372 C  CG2   . ILE B 1 146 ? -16.994 -27.521 -6.764  1.00 40.16  ?  146 ILE B CG2   1 
ATOM   4373 C  CD1   . ILE B 1 146 ? -19.264 -28.722 -4.950  1.00 41.53  ?  146 ILE B CD1   1 
ATOM   4374 N  N     . ALA B 1 147 ? -16.752 -23.828 -6.476  1.00 40.73  ?  147 ALA B N     1 
ATOM   4375 C  CA    . ALA B 1 147 ? -16.295 -22.919 -7.551  1.00 48.26  ?  147 ALA B CA    1 
ATOM   4376 C  C     . ALA B 1 147 ? -15.137 -22.041 -7.064  1.00 45.03  ?  147 ALA B C     1 
ATOM   4377 O  O     . ALA B 1 147 ? -14.413 -21.518 -7.932  1.00 51.39  ?  147 ALA B O     1 
ATOM   4378 C  CB    . ALA B 1 147 ? -17.444 -22.077 -8.067  1.00 50.95  ?  147 ALA B CB    1 
ATOM   4379 N  N     . ALA B 1 148 ? -14.955 -21.872 -5.751  1.00 41.36  ?  148 ALA B N     1 
ATOM   4380 C  CA    . ALA B 1 148 ? -13.861 -21.057 -5.177  1.00 38.80  ?  148 ALA B CA    1 
ATOM   4381 C  C     . ALA B 1 148 ? -12.503 -21.709 -5.475  1.00 39.98  ?  148 ALA B C     1 
ATOM   4382 O  O     . ALA B 1 148 ? -11.510 -20.990 -5.474  1.00 41.82  ?  148 ALA B O     1 
ATOM   4383 C  CB    . ALA B 1 148 ? -14.058 -20.874 -3.692  1.00 42.14  ?  148 ALA B CB    1 
ATOM   4384 N  N     . LYS B 1 149 ? -12.464 -23.023 -5.695  1.00 39.62  ?  149 LYS B N     1 
ATOM   4385 C  CA    . LYS B 1 149 ? -11.222 -23.770 -6.037  1.00 49.66  ?  149 LYS B CA    1 
ATOM   4386 C  C     . LYS B 1 149 ? -10.126 -23.445 -5.003  1.00 47.03  ?  149 LYS B C     1 
ATOM   4387 O  O     . LYS B 1 149 ? -8.974  -23.234 -5.374  1.00 44.16  ?  149 LYS B O     1 
ATOM   4388 C  CB    . LYS B 1 149 ? -10.858 -23.471 -7.492  1.00 52.35  ?  149 LYS B CB    1 
ATOM   4389 C  CG    . LYS B 1 149 ? -11.592 -24.362 -8.484  1.00 55.70  ?  149 LYS B CG    1 
ATOM   4390 C  CD    . LYS B 1 149 ? -11.624 -23.903 -9.924  1.00 65.86  ?  149 LYS B CD    1 
ATOM   4391 C  CE    . LYS B 1 149 ? -12.179 -25.019 -10.808 1.00 79.66  ?  149 LYS B CE    1 
ATOM   4392 N  NZ    . LYS B 1 149 ? -12.612 -24.566 -12.155 1.00 83.06  ?  149 LYS B NZ    1 
ATOM   4393 N  N     . PHE B 1 150 ? -10.512 -23.396 -3.736  1.00 45.11  ?  150 PHE B N     1 
ATOM   4394 C  CA    . PHE B 1 150 ? -9.604  -23.209 -2.582  1.00 41.98  ?  150 PHE B CA    1 
ATOM   4395 C  C     . PHE B 1 150 ? -8.626  -24.376 -2.539  1.00 44.76  ?  150 PHE B C     1 
ATOM   4396 O  O     . PHE B 1 150 ? -9.011  -25.547 -2.787  1.00 31.49  ?  150 PHE B O     1 
ATOM   4397 C  CB    . PHE B 1 150 ? -10.334 -23.186 -1.239  1.00 41.42  ?  150 PHE B CB    1 
ATOM   4398 C  CG    . PHE B 1 150 ? -11.099 -21.926 -0.933  1.00 45.21  ?  150 PHE B CG    1 
ATOM   4399 C  CD1   . PHE B 1 150 ? -10.570 -20.682 -1.231  1.00 44.34  ?  150 PHE B CD1   1 
ATOM   4400 C  CD2   . PHE B 1 150 ? -12.315 -21.987 -0.259  1.00 38.65  ?  150 PHE B CD2   1 
ATOM   4401 C  CE1   . PHE B 1 150 ? -11.265 -19.530 -0.895  1.00 45.74  ?  150 PHE B CE1   1 
ATOM   4402 C  CE2   . PHE B 1 150 ? -13.006 -20.838 0.069   1.00 34.57  ?  150 PHE B CE2   1 
ATOM   4403 C  CZ    . PHE B 1 150 ? -12.482 -19.612 -0.255  1.00 40.38  ?  150 PHE B CZ    1 
ATOM   4404 N  N     . CYS B 1 151 ? -7.380  -24.031 -2.196  1.00 48.59  ?  151 CYS B N     1 
ATOM   4405 C  CA    . CYS B 1 151 ? -6.275  -24.989 -1.994  1.00 48.94  ?  151 CYS B CA    1 
ATOM   4406 C  C     . CYS B 1 151 ? -5.623  -24.656 -0.657  1.00 46.36  ?  151 CYS B C     1 
ATOM   4407 O  O     . CYS B 1 151 ? -5.226  -23.508 -0.455  1.00 49.69  ?  151 CYS B O     1 
ATOM   4408 C  CB    . CYS B 1 151 ? -5.288  -24.913 -3.149  1.00 51.78  ?  151 CYS B CB    1 
ATOM   4409 S  SG    . CYS B 1 151 ? -4.361  -26.453 -3.319  1.00 61.66  ?  151 CYS B SG    1 
ATOM   4410 N  N     . PHE B 1 152 ? -5.560  -25.625 0.243   1.00 44.44  ?  152 PHE B N     1 
ATOM   4411 C  CA    . PHE B 1 152 ? -4.988  -25.440 1.599   1.00 39.90  ?  152 PHE B CA    1 
ATOM   4412 C  C     . PHE B 1 152 ? -4.041  -26.598 1.897   1.00 38.37  ?  152 PHE B C     1 
ATOM   4413 O  O     . PHE B 1 152 ? -4.504  -27.732 1.850   1.00 44.70  ?  152 PHE B O     1 
ATOM   4414 C  CB    . PHE B 1 152 ? -6.103  -25.282 2.622   1.00 39.64  ?  152 PHE B CB    1 
ATOM   4415 C  CG    . PHE B 1 152 ? -6.810  -23.965 2.499   1.00 41.57  ?  152 PHE B CG    1 
ATOM   4416 C  CD1   . PHE B 1 152 ? -6.159  -22.772 2.797   1.00 41.38  ?  152 PHE B CD1   1 
ATOM   4417 C  CD2   . PHE B 1 152 ? -8.131  -23.927 2.095   1.00 41.27  ?  152 PHE B CD2   1 
ATOM   4418 C  CE1   . PHE B 1 152 ? -6.811  -21.551 2.656   1.00 41.50  ?  152 PHE B CE1   1 
ATOM   4419 C  CE2   . PHE B 1 152 ? -8.778  -22.706 1.951   1.00 41.25  ?  152 PHE B CE2   1 
ATOM   4420 C  CZ    . PHE B 1 152 ? -8.117  -21.521 2.229   1.00 40.45  ?  152 PHE B CZ    1 
ATOM   4421 N  N     . ALA B 1 153 ? -2.762  -26.290 2.162   1.00 41.85  ?  153 ALA B N     1 
ATOM   4422 C  CA    . ALA B 1 153 ? -1.699  -27.285 2.410   1.00 38.60  ?  153 ALA B CA    1 
ATOM   4423 C  C     . ALA B 1 153 ? -1.703  -28.310 1.275   1.00 38.50  ?  153 ALA B C     1 
ATOM   4424 O  O     . ALA B 1 153 ? -1.480  -29.515 1.560   1.00 36.20  ?  153 ALA B O     1 
ATOM   4425 C  CB    . ALA B 1 153 ? -1.940  -27.945 3.749   1.00 42.60  ?  153 ALA B CB    1 
ATOM   4426 N  N     . GLY B 1 154 ? -2.035  -27.845 0.060   1.00 36.49  ?  154 GLY B N     1 
ATOM   4427 C  CA    . GLY B 1 154 ? -1.956  -28.646 -1.177  1.00 37.79  ?  154 GLY B CA    1 
ATOM   4428 C  C     . GLY B 1 154 ? -3.199  -29.444 -1.499  1.00 36.63  ?  154 GLY B C     1 
ATOM   4429 O  O     . GLY B 1 154 ? -3.231  -29.972 -2.622  1.00 32.76  ?  154 GLY B O     1 
ATOM   4430 N  N     . LEU B 1 155 ? -4.162  -29.558 -0.571  1.00 34.08  ?  155 LEU B N     1 
ATOM   4431 C  CA    . LEU B 1 155 ? -5.478  -30.213 -0.816  1.00 37.22  ?  155 LEU B CA    1 
ATOM   4432 C  C     . LEU B 1 155 ? -6.471  -29.230 -1.486  1.00 35.73  ?  155 LEU B C     1 
ATOM   4433 O  O     . LEU B 1 155 ? -6.840  -28.227 -0.857  1.00 36.96  ?  155 LEU B O     1 
ATOM   4434 C  CB    . LEU B 1 155 ? -6.028  -30.737 0.516   1.00 37.47  ?  155 LEU B CB    1 
ATOM   4435 C  CG    . LEU B 1 155 ? -7.361  -31.483 0.412   1.00 39.09  ?  155 LEU B CG    1 
ATOM   4436 C  CD1   . LEU B 1 155 ? -7.216  -32.713 -0.478  1.00 38.94  ?  155 LEU B CD1   1 
ATOM   4437 C  CD2   . LEU B 1 155 ? -7.886  -31.871 1.781   1.00 35.99  ?  155 LEU B CD2   1 
ATOM   4438 N  N     . LEU B 1 156 ? -6.827  -29.486 -2.741  1.00 31.54  ?  156 LEU B N     1 
ATOM   4439 C  CA    . LEU B 1 156 ? -7.860  -28.744 -3.500  1.00 37.20  ?  156 LEU B CA    1 
ATOM   4440 C  C     . LEU B 1 156 ? -9.213  -29.074 -2.843  1.00 37.42  ?  156 LEU B C     1 
ATOM   4441 O  O     . LEU B 1 156 ? -9.504  -30.296 -2.652  1.00 40.70  ?  156 LEU B O     1 
ATOM   4442 C  CB    . LEU B 1 156 ? -7.821  -29.173 -4.982  1.00 38.04  ?  156 LEU B CB    1 
ATOM   4443 C  CG    . LEU B 1 156 ? -8.954  -28.606 -5.875  1.00 49.26  ?  156 LEU B CG    1 
ATOM   4444 C  CD1   . LEU B 1 156 ? -8.900  -27.085 -6.001  1.00 44.04  ?  156 LEU B CD1   1 
ATOM   4445 C  CD2   . LEU B 1 156 ? -8.936  -29.206 -7.294  1.00 51.68  ?  156 LEU B CD2   1 
ATOM   4446 N  N     . ILE B 1 157 ? -10.006 -28.065 -2.476  1.00 32.31  ?  157 ILE B N     1 
ATOM   4447 C  CA    . ILE B 1 157 ? -11.321 -28.309 -1.815  1.00 36.05  ?  157 ILE B CA    1 
ATOM   4448 C  C     . ILE B 1 157 ? -12.390 -28.481 -2.903  1.00 34.22  ?  157 ILE B C     1 
ATOM   4449 O  O     . ILE B 1 157 ? -12.907 -27.493 -3.405  1.00 37.03  ?  157 ILE B O     1 
ATOM   4450 C  CB    . ILE B 1 157 ? -11.634 -27.207 -0.782  1.00 33.96  ?  157 ILE B CB    1 
ATOM   4451 C  CG1   . ILE B 1 157 ? -10.520 -27.060 0.253   1.00 32.20  ?  157 ILE B CG1   1 
ATOM   4452 C  CG2   . ILE B 1 157 ? -12.970 -27.439 -0.119  1.00 35.33  ?  157 ILE B CG2   1 
ATOM   4453 C  CD1   . ILE B 1 157 ? -10.215 -28.324 1.032   1.00 36.38  ?  157 ILE B CD1   1 
ATOM   4454 N  N     . GLY B 1 158 ? -12.687 -29.734 -3.218  1.00 36.74  ?  158 GLY B N     1 
ATOM   4455 C  CA    . GLY B 1 158 ? -13.641 -30.143 -4.261  1.00 41.48  ?  158 GLY B CA    1 
ATOM   4456 C  C     . GLY B 1 158 ? -14.907 -30.743 -3.684  1.00 40.08  ?  158 GLY B C     1 
ATOM   4457 O  O     . GLY B 1 158 ? -15.094 -30.711 -2.461  1.00 42.41  ?  158 GLY B O     1 
ATOM   4458 N  N     . GLN B 1 159 ? -15.758 -31.248 -4.564  1.00 41.26  ?  159 GLN B N     1 
ATOM   4459 C  CA    . GLN B 1 159 ? -17.043 -31.896 -4.222  1.00 40.83  ?  159 GLN B CA    1 
ATOM   4460 C  C     . GLN B 1 159 ? -16.779 -32.866 -3.055  1.00 37.01  ?  159 GLN B C     1 
ATOM   4461 O  O     . GLN B 1 159 ? -17.483 -32.751 -2.044  1.00 30.13  ?  159 GLN B O     1 
ATOM   4462 C  CB    . GLN B 1 159 ? -17.657 -32.502 -5.498  1.00 48.01  ?  159 GLN B CB    1 
ATOM   4463 C  CG    . GLN B 1 159 ? -18.354 -33.855 -5.310  1.00 53.80  ?  159 GLN B CG    1 
ATOM   4464 C  CD    . GLN B 1 159 ? -19.557 -33.674 -4.432  1.00 59.30  ?  159 GLN B CD    1 
ATOM   4465 O  OE1   . GLN B 1 159 ? -20.128 -32.578 -4.402  1.00 67.44  ?  159 GLN B OE1   1 
ATOM   4466 N  NE2   . GLN B 1 159 ? -19.901 -34.711 -3.670  1.00 58.37  ?  159 GLN B NE2   1 
ATOM   4467 N  N     . THR B 1 160 ? -15.804 -33.781 -3.172  1.00 34.95  ?  160 THR B N     1 
ATOM   4468 C  CA    . THR B 1 160 ? -15.524 -34.815 -2.138  1.00 32.14  ?  160 THR B CA    1 
ATOM   4469 C  C     . THR B 1 160 ? -15.289 -34.155 -0.768  1.00 32.47  ?  160 THR B C     1 
ATOM   4470 O  O     . THR B 1 160 ? -15.835 -34.649 0.260   1.00 29.38  ?  160 THR B O     1 
ATOM   4471 C  CB    . THR B 1 160 ? -14.329 -35.684 -2.550  1.00 33.52  ?  160 THR B CB    1 
ATOM   4472 O  OG1   . THR B 1 160 ? -14.766 -36.505 -3.634  1.00 30.65  ?  160 THR B OG1   1 
ATOM   4473 C  CG2   . THR B 1 160 ? -13.810 -36.562 -1.436  1.00 31.94  ?  160 THR B CG2   1 
ATOM   4474 N  N     . GLU B 1 161 ? -14.491 -33.088 -0.734  1.00 34.60  ?  161 GLU B N     1 
ATOM   4475 C  CA    . GLU B 1 161 ? -14.014 -32.464 0.526   1.00 30.21  ?  161 GLU B CA    1 
ATOM   4476 C  C     . GLU B 1 161 ? -15.179 -31.729 1.186   1.00 30.03  ?  161 GLU B C     1 
ATOM   4477 O  O     . GLU B 1 161 ? -15.296 -31.760 2.429   1.00 30.74  ?  161 GLU B O     1 
ATOM   4478 C  CB    . GLU B 1 161 ? -12.832 -31.551 0.200   1.00 32.02  ?  161 GLU B CB    1 
ATOM   4479 C  CG    . GLU B 1 161 ? -11.559 -32.332 -0.137  1.00 35.45  ?  161 GLU B CG    1 
ATOM   4480 C  CD    . GLU B 1 161 ? -11.527 -33.036 -1.477  1.00 38.65  ?  161 GLU B CD    1 
ATOM   4481 O  OE1   . GLU B 1 161 ? -12.108 -32.493 -2.492  1.00 35.58  ?  161 GLU B OE1   1 
ATOM   4482 O  OE2   . GLU B 1 161 ? -10.904 -34.113 -1.508  1.00 41.32  ?  161 GLU B OE2   1 
ATOM   4483 N  N     . VAL B 1 162 ? -15.998 -31.071 0.372   1.00 27.38  ?  162 VAL B N     1 
ATOM   4484 C  CA    . VAL B 1 162 ? -17.183 -30.315 0.819   1.00 26.69  ?  162 VAL B CA    1 
ATOM   4485 C  C     . VAL B 1 162 ? -18.222 -31.307 1.357   1.00 28.95  ?  162 VAL B C     1 
ATOM   4486 O  O     . VAL B 1 162 ? -18.813 -31.052 2.414   1.00 26.45  ?  162 VAL B O     1 
ATOM   4487 C  CB    . VAL B 1 162 ? -17.710 -29.491 -0.351  1.00 29.47  ?  162 VAL B CB    1 
ATOM   4488 C  CG1   . VAL B 1 162 ? -19.054 -28.864 -0.031  1.00 32.35  ?  162 VAL B CG1   1 
ATOM   4489 C  CG2   . VAL B 1 162 ? -16.706 -28.392 -0.699  1.00 38.42  ?  162 VAL B CG2   1 
ATOM   4490 N  N     . ASP B 1 163 ? -18.432 -32.407 0.651   1.00 28.18  ?  163 ASP B N     1 
ATOM   4491 C  CA    . ASP B 1 163 ? -19.395 -33.446 1.051   1.00 35.63  ?  163 ASP B CA    1 
ATOM   4492 C  C     . ASP B 1 163 ? -18.922 -34.024 2.399   1.00 40.89  ?  163 ASP B C     1 
ATOM   4493 O  O     . ASP B 1 163 ? -19.758 -34.317 3.238   1.00 41.16  ?  163 ASP B O     1 
ATOM   4494 C  CB    . ASP B 1 163 ? -19.580 -34.460 -0.084  1.00 46.10  ?  163 ASP B CB    1 
ATOM   4495 C  CG    . ASP B 1 163 ? -20.887 -35.251 -0.058  1.00 58.52  ?  163 ASP B CG    1 
ATOM   4496 O  OD1   . ASP B 1 163 ? -21.804 -34.861 0.688   1.00 64.64  ?  163 ASP B OD1   1 
ATOM   4497 O  OD2   . ASP B 1 163 ? -20.980 -36.268 -0.783  1.00 59.77  ?  163 ASP B OD2   1 
ATOM   4498 N  N     . ILE B 1 164 ? -17.615 -34.152 2.608   1.00 38.19  ?  164 ILE B N     1 
ATOM   4499 C  CA    . ILE B 1 164 ? -17.061 -34.675 3.886   1.00 33.68  ?  164 ILE B CA    1 
ATOM   4500 C  C     . ILE B 1 164 ? -17.294 -33.677 5.027   1.00 32.20  ?  164 ILE B C     1 
ATOM   4501 O  O     . ILE B 1 164 ? -17.695 -34.088 6.107   1.00 31.55  ?  164 ILE B O     1 
ATOM   4502 C  CB    . ILE B 1 164 ? -15.587 -35.072 3.723   1.00 31.07  ?  164 ILE B CB    1 
ATOM   4503 C  CG1   . ILE B 1 164 ? -15.486 -36.407 2.976   1.00 33.91  ?  164 ILE B CG1   1 
ATOM   4504 C  CG2   . ILE B 1 164 ? -14.878 -35.148 5.057   1.00 28.66  ?  164 ILE B CG2   1 
ATOM   4505 C  CD1   . ILE B 1 164 ? -14.095 -36.717 2.435   1.00 35.96  ?  164 ILE B CD1   1 
ATOM   4506 N  N     . MET B 1 165 ? -17.007 -32.408 4.827   1.00 30.85  ?  165 MET B N     1 
ATOM   4507 C  CA    . MET B 1 165 ? -17.177 -31.392 5.884   1.00 29.38  ?  165 MET B CA    1 
ATOM   4508 C  C     . MET B 1 165 ? -18.650 -31.261 6.287   1.00 28.40  ?  165 MET B C     1 
ATOM   4509 O  O     . MET B 1 165 ? -18.943 -31.034 7.478   1.00 27.87  ?  165 MET B O     1 
ATOM   4510 C  CB    . MET B 1 165 ? -16.627 -30.054 5.405   1.00 30.08  ?  165 MET B CB    1 
ATOM   4511 C  CG    . MET B 1 165 ? -15.119 -29.986 5.512   1.00 32.33  ?  165 MET B CG    1 
ATOM   4512 S  SD    . MET B 1 165 ? -14.370 -28.755 4.507   1.00 42.33  ?  165 MET B SD    1 
ATOM   4513 C  CE    . MET B 1 165 ? -14.551 -27.346 5.547   1.00 41.00  ?  165 MET B CE    1 
ATOM   4514 N  N     . SER B 1 166 ? -19.536 -31.424 5.334   1.00 27.22  ?  166 SER B N     1 
ATOM   4515 C  CA    . SER B 1 166 ? -20.999 -31.299 5.516   1.00 29.77  ?  166 SER B CA    1 
ATOM   4516 C  C     . SER B 1 166 ? -21.524 -32.462 6.368   1.00 26.81  ?  166 SER B C     1 
ATOM   4517 O  O     . SER B 1 166 ? -22.292 -32.238 7.308   1.00 30.10  ?  166 SER B O     1 
ATOM   4518 C  CB    . SER B 1 166 ? -21.656 -31.238 4.173   1.00 29.86  ?  166 SER B CB    1 
ATOM   4519 O  OG    . SER B 1 166 ? -22.955 -30.725 4.291   1.00 38.31  ?  166 SER B OG    1 
ATOM   4520 N  N     . HIS B 1 167 ? -21.143 -33.675 6.038   1.00 26.43  ?  167 HIS B N     1 
ATOM   4521 C  CA    . HIS B 1 167 ? -21.510 -34.889 6.794   1.00 30.15  ?  167 HIS B CA    1 
ATOM   4522 C  C     . HIS B 1 167 ? -20.875 -34.857 8.184   1.00 29.72  ?  167 HIS B C     1 
ATOM   4523 O  O     . HIS B 1 167 ? -21.538 -35.252 9.139   1.00 29.31  ?  167 HIS B O     1 
ATOM   4524 C  CB    . HIS B 1 167 ? -21.094 -36.135 6.004   1.00 32.28  ?  167 HIS B CB    1 
ATOM   4525 C  CG    . HIS B 1 167 ? -22.103 -36.534 4.991   1.00 36.25  ?  167 HIS B CG    1 
ATOM   4526 N  ND1   . HIS B 1 167 ? -22.339 -35.762 3.879   1.00 40.07  ?  167 HIS B ND1   1 
ATOM   4527 C  CD2   . HIS B 1 167 ? -22.934 -37.600 4.923   1.00 38.68  ?  167 HIS B CD2   1 
ATOM   4528 C  CE1   . HIS B 1 167 ? -23.269 -36.340 3.142   1.00 45.79  ?  167 HIS B CE1   1 
ATOM   4529 N  NE2   . HIS B 1 167 ? -23.648 -37.480 3.766   1.00 41.90  ?  167 HIS B NE2   1 
ATOM   4530 N  N     . ALA B 1 168 ? -19.641 -34.396 8.282   1.00 28.44  ?  168 ALA B N     1 
ATOM   4531 C  CA    . ALA B 1 168 ? -18.891 -34.337 9.548   1.00 29.98  ?  168 ALA B CA    1 
ATOM   4532 C  C     . ALA B 1 168 ? -19.584 -33.330 10.459  1.00 29.18  ?  168 ALA B C     1 
ATOM   4533 O  O     . ALA B 1 168 ? -19.638 -33.587 11.691  1.00 28.33  ?  168 ALA B O     1 
ATOM   4534 C  CB    . ALA B 1 168 ? -17.437 -33.954 9.314   1.00 31.98  ?  168 ALA B CB    1 
ATOM   4535 N  N     . THR B 1 169 ? -20.065 -32.220 9.918   1.00 25.09  ?  169 THR B N     1 
ATOM   4536 C  CA    . THR B 1 169 ? -20.734 -31.167 10.730  1.00 24.98  ?  169 THR B CA    1 
ATOM   4537 C  C     . THR B 1 169 ? -21.982 -31.755 11.414  1.00 27.07  ?  169 THR B C     1 
ATOM   4538 O  O     . THR B 1 169 ? -22.164 -31.578 12.620  1.00 29.09  ?  169 THR B O     1 
ATOM   4539 C  CB    . THR B 1 169 ? -21.101 -29.957 9.878   1.00 24.15  ?  169 THR B CB    1 
ATOM   4540 O  OG1   . THR B 1 169 ? -19.927 -29.403 9.279   1.00 26.60  ?  169 THR B OG1   1 
ATOM   4541 C  CG2   . THR B 1 169 ? -21.793 -28.890 10.681  1.00 28.57  ?  169 THR B CG2   1 
ATOM   4542 N  N     . GLN B 1 170 ? -22.813 -32.469 10.671  1.00 30.63  ?  170 GLN B N     1 
ATOM   4543 C  CA    . GLN B 1 170 ? -24.028 -33.129 11.190  1.00 31.57  ?  170 GLN B CA    1 
ATOM   4544 C  C     . GLN B 1 170 ? -23.632 -34.118 12.300  1.00 31.45  ?  170 GLN B C     1 
ATOM   4545 O  O     . GLN B 1 170 ? -24.249 -34.048 13.376  1.00 29.74  ?  170 GLN B O     1 
ATOM   4546 C  CB    . GLN B 1 170 ? -24.768 -33.805 10.037  1.00 32.85  ?  170 GLN B CB    1 
ATOM   4547 C  CG    . GLN B 1 170 ? -26.229 -34.115 10.332  1.00 36.36  ?  170 GLN B CG    1 
ATOM   4548 C  CD    . GLN B 1 170 ? -26.952 -34.537 9.087   1.00 37.70  ?  170 GLN B CD    1 
ATOM   4549 O  OE1   . GLN B 1 170 ? -26.803 -35.652 8.642   1.00 42.44  ?  170 GLN B OE1   1 
ATOM   4550 N  NE2   . GLN B 1 170 ? -27.673 -33.603 8.477   1.00 41.91  ?  170 GLN B NE2   1 
ATOM   4551 N  N     . ALA B 1 171 ? -22.630 -34.974 12.070  1.00 28.98  ?  171 ALA B N     1 
ATOM   4552 C  CA    . ALA B 1 171 ? -22.214 -36.028 13.033  1.00 29.43  ?  171 ALA B CA    1 
ATOM   4553 C  C     . ALA B 1 171 ? -21.667 -35.389 14.319  1.00 27.43  ?  171 ALA B C     1 
ATOM   4554 O  O     . ALA B 1 171 ? -22.021 -35.819 15.421  1.00 28.36  ?  171 ALA B O     1 
ATOM   4555 C  CB    . ALA B 1 171 ? -21.213 -36.954 12.376  1.00 27.69  ?  171 ALA B CB    1 
ATOM   4556 N  N     . ILE B 1 172 ? -20.836 -34.365 14.183  1.00 27.06  ?  172 ILE B N     1 
ATOM   4557 C  CA    . ILE B 1 172 ? -20.283 -33.629 15.357  1.00 27.86  ?  172 ILE B CA    1 
ATOM   4558 C  C     . ILE B 1 172 ? -21.437 -33.051 16.179  1.00 27.01  ?  172 ILE B C     1 
ATOM   4559 O  O     . ILE B 1 172 ? -21.406 -33.215 17.415  1.00 26.28  ?  172 ILE B O     1 
ATOM   4560 C  CB    . ILE B 1 172 ? -19.265 -32.570 14.887  1.00 26.31  ?  172 ILE B CB    1 
ATOM   4561 C  CG1   . ILE B 1 172 ? -17.985 -33.283 14.457  1.00 29.41  ?  172 ILE B CG1   1 
ATOM   4562 C  CG2   . ILE B 1 172 ? -19.003 -31.505 15.942  1.00 29.36  ?  172 ILE B CG2   1 
ATOM   4563 C  CD1   . ILE B 1 172 ? -17.133 -32.480 13.495  1.00 32.94  ?  172 ILE B CD1   1 
ATOM   4564 N  N     . PHE B 1 173 ? -22.397 -32.400 15.518  1.00 24.92  ?  173 PHE B N     1 
ATOM   4565 C  CA    . PHE B 1 173 ? -23.562 -31.768 16.194  1.00 26.11  ?  173 PHE B CA    1 
ATOM   4566 C  C     . PHE B 1 173 ? -24.370 -32.859 16.941  1.00 25.88  ?  173 PHE B C     1 
ATOM   4567 O  O     . PHE B 1 173 ? -24.714 -32.667 18.143  1.00 24.44  ?  173 PHE B O     1 
ATOM   4568 C  CB    . PHE B 1 173 ? -24.467 -31.028 15.192  1.00 24.11  ?  173 PHE B CB    1 
ATOM   4569 C  CG    . PHE B 1 173 ? -25.724 -30.528 15.835  1.00 23.95  ?  173 PHE B CG    1 
ATOM   4570 C  CD1   . PHE B 1 173 ? -25.730 -29.331 16.519  1.00 25.29  ?  173 PHE B CD1   1 
ATOM   4571 C  CD2   . PHE B 1 173 ? -26.859 -31.322 15.884  1.00 25.77  ?  173 PHE B CD2   1 
ATOM   4572 C  CE1   . PHE B 1 173 ? -26.878 -28.891 17.167  1.00 27.65  ?  173 PHE B CE1   1 
ATOM   4573 C  CE2   . PHE B 1 173 ? -28.004 -30.884 16.533  1.00 28.39  ?  173 PHE B CE2   1 
ATOM   4574 C  CZ    . PHE B 1 173 ? -28.014 -29.663 17.164  1.00 25.31  ?  173 PHE B CZ    1 
ATOM   4575 N  N     . GLU B 1 174 ? -24.669 -33.977 16.277  1.00 24.38  ?  174 GLU B N     1 
ATOM   4576 C  CA    . GLU B 1 174 ? -25.498 -35.064 16.891  1.00 31.09  ?  174 GLU B CA    1 
ATOM   4577 C  C     . GLU B 1 174 ? -24.778 -35.651 18.131  1.00 28.88  ?  174 GLU B C     1 
ATOM   4578 O  O     . GLU B 1 174 ? -25.427 -35.865 19.157  1.00 27.87  ?  174 GLU B O     1 
ATOM   4579 C  CB    . GLU B 1 174 ? -25.820 -36.165 15.891  1.00 33.07  ?  174 GLU B CB    1 
ATOM   4580 C  CG    . GLU B 1 174 ? -26.775 -35.763 14.777  1.00 39.27  ?  174 GLU B CG    1 
ATOM   4581 C  CD    . GLU B 1 174 ? -26.954 -36.874 13.737  1.00 44.42  ?  174 GLU B CD    1 
ATOM   4582 O  OE1   . GLU B 1 174 ? -27.276 -38.067 14.110  1.00 58.17  ?  174 GLU B OE1   1 
ATOM   4583 O  OE2   . GLU B 1 174 ? -26.706 -36.603 12.585  1.00 48.75  ?  174 GLU B OE2   1 
ATOM   4584 N  N     . ILE B 1 175 ? -23.468 -35.832 18.057  1.00 26.67  ?  175 ILE B N     1 
ATOM   4585 C  CA    . ILE B 1 175 ? -22.658 -36.336 19.201  1.00 27.67  ?  175 ILE B CA    1 
ATOM   4586 C  C     . ILE B 1 175 ? -22.730 -35.341 20.361  1.00 26.51  ?  175 ILE B C     1 
ATOM   4587 O  O     . ILE B 1 175 ? -23.008 -35.792 21.493  1.00 28.01  ?  175 ILE B O     1 
ATOM   4588 C  CB    . ILE B 1 175 ? -21.221 -36.642 18.758  1.00 25.85  ?  175 ILE B CB    1 
ATOM   4589 C  CG1   . ILE B 1 175 ? -21.202 -37.890 17.881  1.00 24.36  ?  175 ILE B CG1   1 
ATOM   4590 C  CG2   . ILE B 1 175 ? -20.290 -36.789 19.947  1.00 26.40  ?  175 ILE B CG2   1 
ATOM   4591 C  CD1   . ILE B 1 175 ? -19.907 -38.055 17.104  1.00 26.71  ?  175 ILE B CD1   1 
ATOM   4592 N  N     . LEU B 1 176 ? -22.493 -34.057 20.112  1.00 29.12  ?  176 LEU B N     1 
ATOM   4593 C  CA    . LEU B 1 176 ? -22.554 -33.026 21.192  1.00 27.19  ?  176 LEU B CA    1 
ATOM   4594 C  C     . LEU B 1 176 ? -23.998 -32.909 21.712  1.00 27.11  ?  176 LEU B C     1 
ATOM   4595 O  O     . LEU B 1 176 ? -24.177 -32.761 22.931  1.00 30.55  ?  176 LEU B O     1 
ATOM   4596 C  CB    . LEU B 1 176 ? -22.056 -31.676 20.670  1.00 25.42  ?  176 LEU B CB    1 
ATOM   4597 C  CG    . LEU B 1 176 ? -20.576 -31.593 20.323  1.00 27.02  ?  176 LEU B CG    1 
ATOM   4598 C  CD1   . LEU B 1 176 ? -20.155 -30.150 20.202  1.00 28.54  ?  176 LEU B CD1   1 
ATOM   4599 C  CD2   . LEU B 1 176 ? -19.695 -32.254 21.358  1.00 28.46  ?  176 LEU B CD2   1 
ATOM   4600 N  N     . GLU B 1 177 ? -24.990 -32.990 20.825  1.00 27.45  ?  177 GLU B N     1 
ATOM   4601 C  CA    . GLU B 1 177 ? -26.433 -32.939 21.180  1.00 27.78  ?  177 GLU B CA    1 
ATOM   4602 C  C     . GLU B 1 177 ? -26.735 -34.086 22.149  1.00 27.86  ?  177 GLU B C     1 
ATOM   4603 O  O     . GLU B 1 177 ? -27.325 -33.814 23.233  1.00 25.87  ?  177 GLU B O     1 
ATOM   4604 C  CB    . GLU B 1 177 ? -27.303 -33.036 19.926  1.00 30.40  ?  177 GLU B CB    1 
ATOM   4605 C  CG    . GLU B 1 177 ? -28.794 -32.833 20.158  1.00 30.99  ?  177 GLU B CG    1 
ATOM   4606 C  CD    . GLU B 1 177 ? -29.689 -33.066 18.926  1.00 38.08  ?  177 GLU B CD    1 
ATOM   4607 O  OE1   . GLU B 1 177 ? -29.439 -34.071 18.155  1.00 31.98  ?  177 GLU B OE1   1 
ATOM   4608 O  OE2   . GLU B 1 177 ? -30.657 -32.254 18.727  1.00 31.46  ?  177 GLU B OE2   1 
ATOM   4609 N  N     . LYS B 1 178 ? -26.362 -35.319 21.787  1.00 25.78  ?  178 LYS B N     1 
ATOM   4610 C  CA    . LYS B 1 178 ? -26.614 -36.505 22.634  1.00 27.68  ?  178 LYS B CA    1 
ATOM   4611 C  C     . LYS B 1 178 ? -25.882 -36.348 23.977  1.00 26.90  ?  178 LYS B C     1 
ATOM   4612 O  O     . LYS B 1 178 ? -26.408 -36.795 24.976  1.00 26.35  ?  178 LYS B O     1 
ATOM   4613 C  CB    . LYS B 1 178 ? -26.159 -37.792 21.944  1.00 29.13  ?  178 LYS B CB    1 
ATOM   4614 C  CG    . LYS B 1 178 ? -26.567 -39.059 22.689  1.00 28.37  ?  178 LYS B CG    1 
ATOM   4615 C  CD    . LYS B 1 178 ? -27.998 -39.429 22.484  1.00 33.28  ?  178 LYS B CD    1 
ATOM   4616 C  CE    . LYS B 1 178 ? -28.293 -39.834 21.047  1.00 33.83  ?  178 LYS B CE    1 
ATOM   4617 N  NZ    . LYS B 1 178 ? -29.742 -40.005 20.796  1.00 36.32  ?  178 LYS B NZ    1 
ATOM   4618 N  N     . SER B 1 179 ? -24.707 -35.745 23.980  1.00 28.81  ?  179 SER B N     1 
ATOM   4619 C  CA    . SER B 1 179 ? -23.807 -35.681 25.158  1.00 29.90  ?  179 SER B CA    1 
ATOM   4620 C  C     . SER B 1 179 ? -24.349 -34.691 26.198  1.00 30.84  ?  179 SER B C     1 
ATOM   4621 O  O     . SER B 1 179 ? -24.112 -34.905 27.410  1.00 31.73  ?  179 SER B O     1 
ATOM   4622 C  CB    . SER B 1 179 ? -22.393 -35.366 24.708  1.00 28.44  ?  179 SER B CB    1 
ATOM   4623 O  OG    . SER B 1 179 ? -21.918 -36.375 23.811  1.00 24.57  ?  179 SER B OG    1 
ATOM   4624 N  N     . TRP B 1 180 ? -25.082 -33.659 25.757  1.00 33.33  ?  180 TRP B N     1 
ATOM   4625 C  CA    . TRP B 1 180 ? -25.667 -32.620 26.649  1.00 31.47  ?  180 TRP B CA    1 
ATOM   4626 C  C     . TRP B 1 180 ? -26.995 -33.081 27.253  1.00 32.69  ?  180 TRP B C     1 
ATOM   4627 O  O     . TRP B 1 180 ? -27.397 -32.525 28.287  1.00 34.93  ?  180 TRP B O     1 
ATOM   4628 C  CB    . TRP B 1 180 ? -25.834 -31.306 25.890  1.00 30.94  ?  180 TRP B CB    1 
ATOM   4629 C  CG    . TRP B 1 180 ? -24.619 -30.440 25.907  1.00 27.72  ?  180 TRP B CG    1 
ATOM   4630 C  CD1   . TRP B 1 180 ? -23.839 -30.102 24.851  1.00 27.79  ?  180 TRP B CD1   1 
ATOM   4631 C  CD2   . TRP B 1 180 ? -24.042 -29.810 27.051  1.00 28.68  ?  180 TRP B CD2   1 
ATOM   4632 N  NE1   . TRP B 1 180 ? -22.822 -29.275 25.250  1.00 32.50  ?  180 TRP B NE1   1 
ATOM   4633 C  CE2   . TRP B 1 180 ? -22.913 -29.093 26.603  1.00 29.84  ?  180 TRP B CE2   1 
ATOM   4634 C  CE3   . TRP B 1 180 ? -24.393 -29.752 28.407  1.00 32.40  ?  180 TRP B CE3   1 
ATOM   4635 C  CZ2   . TRP B 1 180 ? -22.107 -28.354 27.463  1.00 32.41  ?  180 TRP B CZ2   1 
ATOM   4636 C  CZ3   . TRP B 1 180 ? -23.592 -29.028 29.265  1.00 29.53  ?  180 TRP B CZ3   1 
ATOM   4637 C  CH2   . TRP B 1 180 ? -22.477 -28.329 28.792  1.00 31.58  ?  180 TRP B CH2   1 
ATOM   4638 N  N     . LEU B 1 181 ? -27.660 -34.045 26.624  1.00 38.11  ?  181 LEU B N     1 
ATOM   4639 C  CA    . LEU B 1 181 ? -29.036 -34.496 26.960  1.00 38.34  ?  181 LEU B CA    1 
ATOM   4640 C  C     . LEU B 1 181 ? -29.104 -34.917 28.420  1.00 35.76  ?  181 LEU B C     1 
ATOM   4641 O  O     . LEU B 1 181 ? -29.995 -34.466 29.124  1.00 41.26  ?  181 LEU B O     1 
ATOM   4642 C  CB    . LEU B 1 181 ? -29.447 -35.637 26.019  1.00 41.69  ?  181 LEU B CB    1 
ATOM   4643 C  CG    . LEU B 1 181 ? -30.920 -35.690 25.648  1.00 48.30  ?  181 LEU B CG    1 
ATOM   4644 C  CD1   . LEU B 1 181 ? -31.398 -34.374 25.050  1.00 50.26  ?  181 LEU B CD1   1 
ATOM   4645 C  CD2   . LEU B 1 181 ? -31.165 -36.831 24.681  1.00 55.71  ?  181 LEU B CD2   1 
ATOM   4646 N  N     . PRO B 1 182 ? -28.201 -35.789 28.926  1.00 37.76  ?  182 PRO B N     1 
ATOM   4647 C  CA    . PRO B 1 182 ? -28.248 -36.228 30.323  1.00 38.63  ?  182 PRO B CA    1 
ATOM   4648 C  C     . PRO B 1 182 ? -28.147 -35.102 31.354  1.00 37.97  ?  182 PRO B C     1 
ATOM   4649 O  O     . PRO B 1 182 ? -28.457 -35.386 32.478  1.00 42.85  ?  182 PRO B O     1 
ATOM   4650 C  CB    . PRO B 1 182 ? -27.013 -37.146 30.500  1.00 38.92  ?  182 PRO B CB    1 
ATOM   4651 C  CG    . PRO B 1 182 ? -26.639 -37.558 29.070  1.00 39.81  ?  182 PRO B CG    1 
ATOM   4652 C  CD    . PRO B 1 182 ? -27.054 -36.378 28.211  1.00 38.65  ?  182 PRO B CD    1 
ATOM   4653 N  N     . GLN B 1 183 ? -27.690 -33.914 30.964  1.00 39.27  ?  183 GLN B N     1 
ATOM   4654 C  CA    . GLN B 1 183 ? -27.622 -32.712 31.830  1.00 43.71  ?  183 GLN B CA    1 
ATOM   4655 C  C     . GLN B 1 183 ? -28.915 -31.893 31.714  1.00 46.61  ?  183 GLN B C     1 
ATOM   4656 O  O     . GLN B 1 183 ? -28.926 -30.759 32.251  1.00 40.43  ?  183 GLN B O     1 
ATOM   4657 C  CB    . GLN B 1 183 ? -26.478 -31.770 31.430  1.00 52.55  ?  183 GLN B CB    1 
ATOM   4658 C  CG    . GLN B 1 183 ? -25.125 -32.445 31.278  1.00 56.03  ?  183 GLN B CG    1 
ATOM   4659 C  CD    . GLN B 1 183 ? -24.672 -32.970 32.601  1.00 53.73  ?  183 GLN B CD    1 
ATOM   4660 O  OE1   . GLN B 1 183 ? -24.482 -32.204 33.537  1.00 70.60  ?  183 GLN B OE1   1 
ATOM   4661 N  NE2   . GLN B 1 183 ? -24.529 -34.278 32.683  1.00 49.90  ?  183 GLN B NE2   1 
ATOM   4662 N  N     . ASN B 1 184 ? -29.929 -32.423 31.024  1.00 44.46  ?  184 ASN B N     1 
ATOM   4663 C  CA    . ASN B 1 184 ? -31.195 -31.728 30.669  1.00 52.66  ?  184 ASN B CA    1 
ATOM   4664 C  C     . ASN B 1 184 ? -30.907 -30.376 30.011  1.00 49.37  ?  184 ASN B C     1 
ATOM   4665 O  O     . ASN B 1 184 ? -31.621 -29.410 30.339  1.00 49.58  ?  184 ASN B O     1 
ATOM   4666 C  CB    . ASN B 1 184 ? -32.157 -31.632 31.856  1.00 61.07  ?  184 ASN B CB    1 
ATOM   4667 C  CG    . ASN B 1 184 ? -33.219 -32.711 31.760  1.00 71.67  ?  184 ASN B CG    1 
ATOM   4668 O  OD1   . ASN B 1 184 ? -34.203 -32.549 31.034  1.00 64.85  ?  184 ASN B OD1   1 
ATOM   4669 N  ND2   . ASN B 1 184 ? -32.984 -33.848 32.407  1.00 66.50  ?  184 ASN B ND2   1 
ATOM   4670 N  N     . CYS B 1 185 ? -29.941 -30.343 29.078  1.00 42.85  ?  185 CYS B N     1 
ATOM   4671 C  CA    . CYS B 1 185 ? -29.664 -29.182 28.196  1.00 40.88  ?  185 CYS B CA    1 
ATOM   4672 C  C     . CYS B 1 185 ? -29.941 -29.540 26.733  1.00 35.93  ?  185 CYS B C     1 
ATOM   4673 O  O     . CYS B 1 185 ? -29.486 -30.591 26.264  1.00 37.47  ?  185 CYS B O     1 
ATOM   4674 C  CB    . CYS B 1 185 ? -28.230 -28.701 28.323  1.00 40.95  ?  185 CYS B CB    1 
ATOM   4675 S  SG    . CYS B 1 185 ? -27.830 -28.134 29.987  1.00 51.20  ?  185 CYS B SG    1 
ATOM   4676 N  N     . THR B 1 186 ? -30.653 -28.663 26.044  1.00 32.40  ?  186 THR B N     1 
ATOM   4677 C  CA    . THR B 1 186 ? -30.941 -28.771 24.597  1.00 34.10  ?  186 THR B CA    1 
ATOM   4678 C  C     . THR B 1 186 ? -29.845 -28.019 23.847  1.00 36.88  ?  186 THR B C     1 
ATOM   4679 O  O     . THR B 1 186 ? -29.743 -26.764 24.016  1.00 35.92  ?  186 THR B O     1 
ATOM   4680 C  CB    . THR B 1 186 ? -32.301 -28.164 24.256  1.00 33.40  ?  186 THR B CB    1 
ATOM   4681 O  OG1   . THR B 1 186 ? -33.289 -28.824 25.054  1.00 32.25  ?  186 THR B OG1   1 
ATOM   4682 C  CG2   . THR B 1 186 ? -32.611 -28.207 22.771  1.00 34.42  ?  186 THR B CG2   1 
ATOM   4683 N  N     . LEU B 1 187 ? -29.041 -28.748 23.067  1.00 36.07  ?  187 LEU B N     1 
ATOM   4684 C  CA    . LEU B 1 187 ? -28.128 -28.123 22.077  1.00 33.93  ?  187 LEU B CA    1 
ATOM   4685 C  C     . LEU B 1 187 ? -28.985 -27.714 20.868  1.00 30.06  ?  187 LEU B C     1 
ATOM   4686 O  O     . LEU B 1 187 ? -29.547 -28.582 20.185  1.00 32.12  ?  187 LEU B O     1 
ATOM   4687 C  CB    . LEU B 1 187 ? -26.989 -29.096 21.740  1.00 32.53  ?  187 LEU B CB    1 
ATOM   4688 C  CG    . LEU B 1 187 ? -25.841 -28.491 20.928  1.00 34.93  ?  187 LEU B CG    1 
ATOM   4689 C  CD1   . LEU B 1 187 ? -25.042 -27.449 21.694  1.00 33.75  ?  187 LEU B CD1   1 
ATOM   4690 C  CD2   . LEU B 1 187 ? -24.909 -29.569 20.448  1.00 36.01  ?  187 LEU B CD2   1 
ATOM   4691 N  N     . VAL B 1 188 ? -29.146 -26.415 20.675  1.00 27.27  ?  188 VAL B N     1 
ATOM   4692 C  CA    . VAL B 1 188 ? -30.064 -25.813 19.681  1.00 29.39  ?  188 VAL B CA    1 
ATOM   4693 C  C     . VAL B 1 188 ? -29.380 -25.818 18.304  1.00 32.67  ?  188 VAL B C     1 
ATOM   4694 O  O     . VAL B 1 188 ? -30.012 -26.244 17.307  1.00 29.67  ?  188 VAL B O     1 
ATOM   4695 C  CB    . VAL B 1 188 ? -30.410 -24.389 20.132  1.00 30.84  ?  188 VAL B CB    1 
ATOM   4696 C  CG1   . VAL B 1 188 ? -31.110 -23.588 19.057  1.00 33.51  ?  188 VAL B CG1   1 
ATOM   4697 C  CG2   . VAL B 1 188 ? -31.211 -24.411 21.401  1.00 35.73  ?  188 VAL B CG2   1 
ATOM   4698 N  N     . ASP B 1 189 ? -28.155 -25.292 18.260  1.00 28.98  ?  189 ASP B N     1 
ATOM   4699 C  CA    . ASP B 1 189 ? -27.349 -25.148 17.033  1.00 31.35  ?  189 ASP B CA    1 
ATOM   4700 C  C     . ASP B 1 189 ? -25.891 -24.921 17.437  1.00 30.98  ?  189 ASP B C     1 
ATOM   4701 O  O     . ASP B 1 189 ? -25.630 -24.867 18.625  1.00 27.77  ?  189 ASP B O     1 
ATOM   4702 C  CB    . ASP B 1 189 ? -27.898 -24.020 16.168  1.00 28.26  ?  189 ASP B CB    1 
ATOM   4703 C  CG    . ASP B 1 189 ? -27.975 -22.692 16.878  1.00 29.86  ?  189 ASP B CG    1 
ATOM   4704 O  OD1   . ASP B 1 189 ? -27.201 -22.484 17.826  1.00 29.68  ?  189 ASP B OD1   1 
ATOM   4705 O  OD2   . ASP B 1 189 ? -28.820 -21.871 16.468  1.00 32.83  ?  189 ASP B OD2   1 
ATOM   4706 N  N     . MET B 1 190 ? -24.992 -24.821 16.468  1.00 29.19  ?  190 MET B N     1 
ATOM   4707 C  CA    . MET B 1 190 ? -23.563 -24.616 16.731  1.00 30.55  ?  190 MET B CA    1 
ATOM   4708 C  C     . MET B 1 190 ? -22.833 -24.230 15.460  1.00 32.46  ?  190 MET B C     1 
ATOM   4709 O  O     . MET B 1 190 ? -23.372 -24.423 14.362  1.00 36.52  ?  190 MET B O     1 
ATOM   4710 C  CB    . MET B 1 190 ? -22.904 -25.860 17.313  1.00 30.71  ?  190 MET B CB    1 
ATOM   4711 C  CG    . MET B 1 190 ? -22.971 -27.024 16.430  1.00 38.63  ?  190 MET B CG    1 
ATOM   4712 S  SD    . MET B 1 190 ? -21.666 -28.267 16.784  1.00 47.88  ?  190 MET B SD    1 
ATOM   4713 C  CE    . MET B 1 190 ? -21.612 -28.976 15.136  1.00 47.62  ?  190 MET B CE    1 
ATOM   4714 N  N     . LYS B 1 191 ? -21.652 -23.662 15.628  1.00 28.62  ?  191 LYS B N     1 
ATOM   4715 C  CA    . LYS B 1 191 ? -20.738 -23.302 14.532  1.00 29.27  ?  191 LYS B CA    1 
ATOM   4716 C  C     . LYS B 1 191 ? -19.396 -23.997 14.782  1.00 30.56  ?  191 LYS B C     1 
ATOM   4717 O  O     . LYS B 1 191 ? -18.920 -23.927 15.915  1.00 32.64  ?  191 LYS B O     1 
ATOM   4718 C  CB    . LYS B 1 191 ? -20.616 -21.794 14.497  1.00 27.51  ?  191 LYS B CB    1 
ATOM   4719 C  CG    . LYS B 1 191 ? -19.792 -21.257 13.347  1.00 37.73  ?  191 LYS B CG    1 
ATOM   4720 C  CD    . LYS B 1 191 ? -18.302 -21.212 13.608  1.00 40.40  ?  191 LYS B CD    1 
ATOM   4721 C  CE    . LYS B 1 191 ? -17.943 -20.097 14.547  1.00 42.24  ?  191 LYS B CE    1 
ATOM   4722 N  NZ    . LYS B 1 191 ? -16.488 -20.149 14.806  1.00 51.70  ?  191 LYS B NZ    1 
ATOM   4723 N  N     . ILE B 1 192 ? -18.794 -24.580 13.747  1.00 26.74  ?  192 ILE B N     1 
ATOM   4724 C  CA    . ILE B 1 192 ? -17.434 -25.187 13.784  1.00 24.98  ?  192 ILE B CA    1 
ATOM   4725 C  C     . ILE B 1 192 ? -16.683 -24.744 12.543  1.00 27.36  ?  192 ILE B C     1 
ATOM   4726 O  O     . ILE B 1 192 ? -17.324 -24.272 11.581  1.00 28.58  ?  192 ILE B O     1 
ATOM   4727 C  CB    . ILE B 1 192 ? -17.510 -26.715 13.858  1.00 25.54  ?  192 ILE B CB    1 
ATOM   4728 C  CG1   . ILE B 1 192 ? -18.130 -27.309 12.603  1.00 26.59  ?  192 ILE B CG1   1 
ATOM   4729 C  CG2   . ILE B 1 192 ? -18.281 -27.147 15.107  1.00 29.45  ?  192 ILE B CG2   1 
ATOM   4730 C  CD1   . ILE B 1 192 ? -18.156 -28.834 12.608  1.00 32.70  ?  192 ILE B CD1   1 
ATOM   4731 N  N     . GLU B 1 193 ? -15.365 -24.922 12.543  1.00 30.57  ?  193 GLU B N     1 
ATOM   4732 C  CA    . GLU B 1 193 ? -14.486 -24.649 11.386  1.00 28.06  ?  193 GLU B CA    1 
ATOM   4733 C  C     . GLU B 1 193 ? -13.568 -25.858 11.225  1.00 27.99  ?  193 GLU B C     1 
ATOM   4734 O  O     . GLU B 1 193 ? -13.238 -26.515 12.240  1.00 27.93  ?  193 GLU B O     1 
ATOM   4735 C  CB    . GLU B 1 193 ? -13.714 -23.350 11.615  1.00 30.62  ?  193 GLU B CB    1 
ATOM   4736 C  CG    . GLU B 1 193 ? -14.592 -22.183 11.975  1.00 35.37  ?  193 GLU B CG    1 
ATOM   4737 C  CD    . GLU B 1 193 ? -13.890 -20.846 12.163  1.00 42.32  ?  193 GLU B CD    1 
ATOM   4738 O  OE1   . GLU B 1 193 ? -12.656 -20.794 11.968  1.00 43.87  ?  193 GLU B OE1   1 
ATOM   4739 O  OE2   . GLU B 1 193 ? -14.616 -19.827 12.471  1.00 46.91  ?  193 GLU B OE2   1 
ATOM   4740 N  N     . PHE B 1 194 ? -13.197 -26.149 9.983   1.00 29.41  ?  194 PHE B N     1 
ATOM   4741 C  CA    . PHE B 1 194 ? -12.250 -27.231 9.634   1.00 30.68  ?  194 PHE B CA    1 
ATOM   4742 C  C     . PHE B 1 194 ? -10.969 -26.612 9.068   1.00 33.62  ?  194 PHE B C     1 
ATOM   4743 O  O     . PHE B 1 194 ? -10.977 -25.488 8.534   1.00 29.62  ?  194 PHE B O     1 
ATOM   4744 C  CB    . PHE B 1 194 ? -12.851 -28.174 8.587   1.00 27.86  ?  194 PHE B CB    1 
ATOM   4745 C  CG    . PHE B 1 194 ? -14.082 -28.908 9.024   1.00 27.83  ?  194 PHE B CG    1 
ATOM   4746 C  CD1   . PHE B 1 194 ? -15.340 -28.332 8.843   1.00 30.02  ?  194 PHE B CD1   1 
ATOM   4747 C  CD2   . PHE B 1 194 ? -13.983 -30.173 9.612   1.00 30.39  ?  194 PHE B CD2   1 
ATOM   4748 C  CE1   . PHE B 1 194 ? -16.480 -29.008 9.269   1.00 36.39  ?  194 PHE B CE1   1 
ATOM   4749 C  CE2   . PHE B 1 194 ? -15.125 -30.838 10.058  1.00 34.81  ?  194 PHE B CE2   1 
ATOM   4750 C  CZ    . PHE B 1 194 ? -16.376 -30.263 9.864   1.00 36.79  ?  194 PHE B CZ    1 
ATOM   4751 N  N     . GLY B 1 195 ? -9.879  -27.355 9.206   1.00 32.35  ?  195 GLY B N     1 
ATOM   4752 C  CA    . GLY B 1 195 ? -8.621  -27.036 8.530   1.00 30.65  ?  195 GLY B CA    1 
ATOM   4753 C  C     . GLY B 1 195 ? -7.976  -28.290 8.009   1.00 31.71  ?  195 GLY B C     1 
ATOM   4754 O  O     . GLY B 1 195 ? -8.527  -29.416 8.253   1.00 26.77  ?  195 GLY B O     1 
ATOM   4755 N  N     . VAL B 1 196 ? -6.907  -28.083 7.239   1.00 31.48  ?  196 VAL B N     1 
ATOM   4756 C  CA    . VAL B 1 196 ? -6.075  -29.185 6.678   1.00 34.33  ?  196 VAL B CA    1 
ATOM   4757 C  C     . VAL B 1 196 ? -4.840  -29.254 7.571   1.00 32.54  ?  196 VAL B C     1 
ATOM   4758 O  O     . VAL B 1 196 ? -4.138  -28.236 7.698   1.00 28.51  ?  196 VAL B O     1 
ATOM   4759 C  CB    . VAL B 1 196 ? -5.747  -28.941 5.192   1.00 34.55  ?  196 VAL B CB    1 
ATOM   4760 C  CG1   . VAL B 1 196 ? -5.099  -30.157 4.566   1.00 37.12  ?  196 VAL B CG1   1 
ATOM   4761 C  CG2   . VAL B 1 196 ? -6.977  -28.542 4.390   1.00 34.73  ?  196 VAL B CG2   1 
ATOM   4762 N  N     . ASP B 1 197 ? -4.630  -30.406 8.197   1.00 34.23  ?  197 ASP B N     1 
ATOM   4763 C  CA    . ASP B 1 197 ? -3.431  -30.688 9.023   1.00 34.30  ?  197 ASP B CA    1 
ATOM   4764 C  C     . ASP B 1 197 ? -2.245  -30.605 8.062   1.00 33.27  ?  197 ASP B C     1 
ATOM   4765 O  O     . ASP B 1 197 ? -2.270  -31.282 7.040   1.00 37.34  ?  197 ASP B O     1 
ATOM   4766 C  CB    . ASP B 1 197 ? -3.624  -32.008 9.750   1.00 38.53  ?  197 ASP B CB    1 
ATOM   4767 C  CG    . ASP B 1 197 ? -2.432  -32.530 10.524  1.00 43.04  ?  197 ASP B CG    1 
ATOM   4768 O  OD1   . ASP B 1 197 ? -1.325  -32.496 10.001  1.00 40.27  ?  197 ASP B OD1   1 
ATOM   4769 O  OD2   . ASP B 1 197 ? -2.665  -33.058 11.628  1.00 46.96  ?  197 ASP B OD2   1 
ATOM   4770 N  N     . VAL B 1 198 ? -1.286  -29.733 8.345   1.00 33.82  ?  198 VAL B N     1 
ATOM   4771 C  CA    . VAL B 1 198 ? -0.135  -29.472 7.432   1.00 37.77  ?  198 VAL B CA    1 
ATOM   4772 C  C     . VAL B 1 198 ? 0.758   -30.732 7.332   1.00 37.97  ?  198 VAL B C     1 
ATOM   4773 O  O     . VAL B 1 198 ? 1.445   -30.851 6.296   1.00 40.58  ?  198 VAL B O     1 
ATOM   4774 C  CB    . VAL B 1 198 ? 0.665   -28.236 7.866   1.00 34.05  ?  198 VAL B CB    1 
ATOM   4775 C  CG1   . VAL B 1 198 ? -0.205  -27.016 7.924   1.00 33.83  ?  198 VAL B CG1   1 
ATOM   4776 C  CG2   . VAL B 1 198 ? 1.354   -28.457 9.202   1.00 35.18  ?  198 VAL B CG2   1 
ATOM   4777 N  N     . THR B 1 199 ? 0.716   -31.650 8.301   1.00 35.27  ?  199 THR B N     1 
ATOM   4778 C  CA    . THR B 1 199 ? 1.530   -32.897 8.261   1.00 46.76  ?  199 THR B CA    1 
ATOM   4779 C  C     . THR B 1 199 ? 0.764   -34.016 7.530   1.00 47.10  ?  199 THR B C     1 
ATOM   4780 O  O     . THR B 1 199 ? 1.314   -34.550 6.573   1.00 58.49  ?  199 THR B O     1 
ATOM   4781 C  CB    . THR B 1 199 ? 1.992   -33.364 9.657   1.00 47.63  ?  199 THR B CB    1 
ATOM   4782 O  OG1   . THR B 1 199 ? 2.579   -32.261 10.346  1.00 44.40  ?  199 THR B OG1   1 
ATOM   4783 C  CG2   . THR B 1 199 ? 2.980   -34.515 9.585   1.00 44.91  ?  199 THR B CG2   1 
ATOM   4784 N  N     . THR B 1 200 ? -0.445  -34.368 7.974   1.00 48.44  ?  200 THR B N     1 
ATOM   4785 C  CA    . THR B 1 200 ? -1.208  -35.561 7.482   1.00 42.36  ?  200 THR B CA    1 
ATOM   4786 C  C     . THR B 1 200 ? -1.992  -35.203 6.210   1.00 38.05  ?  200 THR B C     1 
ATOM   4787 O  O     . THR B 1 200 ? -2.276  -36.119 5.463   1.00 36.87  ?  200 THR B O     1 
ATOM   4788 C  CB    . THR B 1 200 ? -2.129  -36.153 8.572   1.00 43.56  ?  200 THR B CB    1 
ATOM   4789 O  OG1   . THR B 1 200 ? -3.160  -35.210 8.889   1.00 37.14  ?  200 THR B OG1   1 
ATOM   4790 C  CG2   . THR B 1 200 ? -1.374  -36.559 9.832   1.00 39.84  ?  200 THR B CG2   1 
ATOM   4791 N  N     . LYS B 1 201 ? -2.350  -33.934 5.995   1.00 39.20  ?  201 LYS B N     1 
ATOM   4792 C  CA    . LYS B 1 201 ? -3.142  -33.475 4.812   1.00 44.75  ?  201 LYS B CA    1 
ATOM   4793 C  C     . LYS B 1 201 ? -4.603  -33.927 4.932   1.00 41.20  ?  201 LYS B C     1 
ATOM   4794 O  O     . LYS B 1 201 ? -5.339  -33.851 3.949   1.00 42.85  ?  201 LYS B O     1 
ATOM   4795 C  CB    . LYS B 1 201 ? -2.505  -34.001 3.515   1.00 42.55  ?  201 LYS B CB    1 
ATOM   4796 C  CG    . LYS B 1 201 ? -1.084  -33.523 3.302   1.00 42.29  ?  201 LYS B CG    1 
ATOM   4797 C  CD    . LYS B 1 201 ? -0.894  -32.062 3.647   1.00 44.32  ?  201 LYS B CD    1 
ATOM   4798 C  CE    . LYS B 1 201 ? 0.448   -31.522 3.208   1.00 48.36  ?  201 LYS B CE    1 
ATOM   4799 N  NZ    . LYS B 1 201 ? 1.531   -32.452 3.600   1.00 47.01  ?  201 LYS B NZ    1 
ATOM   4800 N  N     . GLU B 1 202 ? -5.012  -34.380 6.106   1.00 43.17  ?  202 GLU B N     1 
ATOM   4801 C  CA    . GLU B 1 202 ? -6.407  -34.779 6.366   1.00 44.46  ?  202 GLU B CA    1 
ATOM   4802 C  C     . GLU B 1 202 ? -7.207  -33.529 6.776   1.00 38.78  ?  202 GLU B C     1 
ATOM   4803 O  O     . GLU B 1 202 ? -6.665  -32.615 7.470   1.00 32.49  ?  202 GLU B O     1 
ATOM   4804 C  CB    . GLU B 1 202 ? -6.374  -35.905 7.387   1.00 54.54  ?  202 GLU B CB    1 
ATOM   4805 C  CG    . GLU B 1 202 ? -7.745  -36.347 7.840   1.00 72.45  ?  202 GLU B CG    1 
ATOM   4806 C  CD    . GLU B 1 202 ? -7.648  -37.395 8.934   1.00 77.18  ?  202 GLU B CD    1 
ATOM   4807 O  OE1   . GLU B 1 202 ? -6.724  -37.241 9.777   1.00 75.80  ?  202 GLU B OE1   1 
ATOM   4808 O  OE2   . GLU B 1 202 ? -8.452  -38.374 8.908   1.00 80.83  ?  202 GLU B OE2   1 
ATOM   4809 N  N     . ILE B 1 203 ? -8.443  -33.437 6.296   1.00 35.18  ?  203 ILE B N     1 
ATOM   4810 C  CA    . ILE B 1 203 ? -9.405  -32.421 6.803   1.00 34.89  ?  203 ILE B CA    1 
ATOM   4811 C  C     . ILE B 1 203 ? -9.826  -32.839 8.205   1.00 30.33  ?  203 ILE B C     1 
ATOM   4812 O  O     . ILE B 1 203 ? -10.318 -33.974 8.346   1.00 34.96  ?  203 ILE B O     1 
ATOM   4813 C  CB    . ILE B 1 203 ? -10.627 -32.244 5.900   1.00 31.32  ?  203 ILE B CB    1 
ATOM   4814 C  CG1   . ILE B 1 203 ? -10.230 -31.776 4.515   1.00 35.31  ?  203 ILE B CG1   1 
ATOM   4815 C  CG2   . ILE B 1 203 ? -11.563 -31.258 6.557   1.00 36.82  ?  203 ILE B CG2   1 
ATOM   4816 C  CD1   . ILE B 1 203 ? -11.390 -31.409 3.617   1.00 40.88  ?  203 ILE B CD1   1 
ATOM   4817 N  N     . VAL B 1 204 ? -9.674  -31.926 9.169   1.00 28.97  ?  204 VAL B N     1 
ATOM   4818 C  CA    . VAL B 1 204 ? -9.973  -32.158 10.608  1.00 27.22  ?  204 VAL B CA    1 
ATOM   4819 C  C     . VAL B 1 204 ? -10.702 -30.935 11.161  1.00 27.11  ?  204 VAL B C     1 
ATOM   4820 O  O     . VAL B 1 204 ? -10.484 -29.813 10.672  1.00 28.46  ?  204 VAL B O     1 
ATOM   4821 C  CB    . VAL B 1 204 ? -8.707  -32.469 11.426  1.00 27.76  ?  204 VAL B CB    1 
ATOM   4822 C  CG1   . VAL B 1 204 ? -7.996  -33.722 10.959  1.00 27.19  ?  204 VAL B CG1   1 
ATOM   4823 C  CG2   . VAL B 1 204 ? -7.731  -31.300 11.433  1.00 30.31  ?  204 VAL B CG2   1 
ATOM   4824 N  N     . LEU B 1 205 ? -11.591 -31.184 12.111  1.00 30.16  ?  205 LEU B N     1 
ATOM   4825 C  CA    . LEU B 1 205 ? -12.205 -30.170 13.004  1.00 31.75  ?  205 LEU B CA    1 
ATOM   4826 C  C     . LEU B 1 205 ? -11.041 -29.491 13.691  1.00 29.14  ?  205 LEU B C     1 
ATOM   4827 O  O     . LEU B 1 205 ? -10.095 -30.225 14.084  1.00 28.91  ?  205 LEU B O     1 
ATOM   4828 C  CB    . LEU B 1 205 ? -13.105 -30.870 14.028  1.00 29.26  ?  205 LEU B CB    1 
ATOM   4829 C  CG    . LEU B 1 205 ? -13.634 -30.012 15.168  1.00 28.03  ?  205 LEU B CG    1 
ATOM   4830 C  CD1   . LEU B 1 205 ? -14.596 -28.960 14.631  1.00 28.87  ?  205 LEU B CD1   1 
ATOM   4831 C  CD2   . LEU B 1 205 ? -14.327 -30.904 16.207  1.00 29.34  ?  205 LEU B CD2   1 
ATOM   4832 N  N     . ALA B 1 206 ? -11.105 -28.173 13.801  1.00 26.30  ?  206 ALA B N     1 
ATOM   4833 C  CA    . ALA B 1 206 ? -10.007 -27.334 14.305  1.00 28.59  ?  206 ALA B CA    1 
ATOM   4834 C  C     . ALA B 1 206 ? -10.623 -26.103 14.936  1.00 32.11  ?  206 ALA B C     1 
ATOM   4835 O  O     . ALA B 1 206 ? -11.775 -26.241 15.390  1.00 31.99  ?  206 ALA B O     1 
ATOM   4836 C  CB    . ALA B 1 206 ? -9.035  -27.007 13.202  1.00 29.11  ?  206 ALA B CB    1 
ATOM   4837 N  N     . ASP B 1 207 ? -9.860  -25.007 15.030  1.00 34.27  ?  207 ASP B N     1 
ATOM   4838 C  CA    . ASP B 1 207 ? -10.239 -23.826 15.858  1.00 37.43  ?  207 ASP B CA    1 
ATOM   4839 C  C     . ASP B 1 207 ? -10.594 -24.353 17.248  1.00 39.39  ?  207 ASP B C     1 
ATOM   4840 O  O     . ASP B 1 207 ? -9.789  -25.191 17.792  1.00 35.60  ?  207 ASP B O     1 
ATOM   4841 C  CB    . ASP B 1 207 ? -11.363 -23.006 15.216  1.00 38.99  ?  207 ASP B CB    1 
ATOM   4842 C  CG    . ASP B 1 207 ? -11.491 -21.604 15.818  1.00 50.65  ?  207 ASP B CG    1 
ATOM   4843 O  OD1   . ASP B 1 207 ? -10.446 -20.891 15.876  1.00 48.73  ?  207 ASP B OD1   1 
ATOM   4844 O  OD2   . ASP B 1 207 ? -12.642 -21.215 16.223  1.00 47.76  ?  207 ASP B OD2   1 
ATOM   4845 N  N     . VAL B 1 208 ? -11.727 -23.891 17.785  1.00 34.31  ?  208 VAL B N     1 
ATOM   4846 C  CA    . VAL B 1 208 ? -12.260 -24.302 19.112  1.00 38.37  ?  208 VAL B CA    1 
ATOM   4847 C  C     . VAL B 1 208 ? -13.751 -24.669 18.963  1.00 40.61  ?  208 VAL B C     1 
ATOM   4848 O  O     . VAL B 1 208 ? -14.396 -24.374 17.934  1.00 38.11  ?  208 VAL B O     1 
ATOM   4849 C  CB    . VAL B 1 208 ? -12.045 -23.212 20.183  1.00 34.72  ?  208 VAL B CB    1 
ATOM   4850 C  CG1   . VAL B 1 208 ? -10.570 -22.917 20.397  1.00 33.40  ?  208 VAL B CG1   1 
ATOM   4851 C  CG2   . VAL B 1 208 ? -12.788 -21.926 19.873  1.00 33.87  ?  208 VAL B CG2   1 
ATOM   4852 N  N     . ILE B 1 209 ? -14.266 -25.373 19.953  1.00 36.50  ?  209 ILE B N     1 
ATOM   4853 C  CA    . ILE B 1 209 ? -15.719 -25.404 20.255  1.00 37.25  ?  209 ILE B CA    1 
ATOM   4854 C  C     . ILE B 1 209 ? -15.852 -24.919 21.699  1.00 38.34  ?  209 ILE B C     1 
ATOM   4855 O  O     . ILE B 1 209 ? -15.386 -25.636 22.599  1.00 41.06  ?  209 ILE B O     1 
ATOM   4856 C  CB    . ILE B 1 209 ? -16.294 -26.816 20.042  1.00 32.66  ?  209 ILE B CB    1 
ATOM   4857 C  CG1   . ILE B 1 209 ? -16.283 -27.212 18.565  1.00 31.25  ?  209 ILE B CG1   1 
ATOM   4858 C  CG2   . ILE B 1 209 ? -17.691 -26.900 20.623  1.00 33.46  ?  209 ILE B CG2   1 
ATOM   4859 C  CD1   . ILE B 1 209 ? -16.680 -28.653 18.334  1.00 30.55  ?  209 ILE B CD1   1 
ATOM   4860 N  N     . ASP B 1 210 ? -16.403 -23.733 21.920  1.00 39.46  ?  210 ASP B N     1 
ATOM   4861 C  CA    . ASP B 1 210 ? -16.549 -23.188 23.294  1.00 40.20  ?  210 ASP B CA    1 
ATOM   4862 C  C     . ASP B 1 210 ? -17.947 -22.591 23.453  1.00 36.73  ?  210 ASP B C     1 
ATOM   4863 O  O     . ASP B 1 210 ? -18.798 -22.843 22.608  1.00 41.42  ?  210 ASP B O     1 
ATOM   4864 C  CB    . ASP B 1 210 ? -15.401 -22.215 23.614  1.00 40.59  ?  210 ASP B CB    1 
ATOM   4865 C  CG    . ASP B 1 210 ? -15.425 -20.928 22.819  1.00 45.94  ?  210 ASP B CG    1 
ATOM   4866 O  OD1   . ASP B 1 210 ? -16.487 -20.606 22.236  1.00 50.68  ?  210 ASP B OD1   1 
ATOM   4867 O  OD2   . ASP B 1 210 ? -14.387 -20.244 22.782  1.00 51.79  ?  210 ASP B OD2   1 
ATOM   4868 N  N     . ASN B 1 211 ? -18.149 -21.806 24.502  1.00 35.37  ?  211 ASN B N     1 
ATOM   4869 C  CA    . ASN B 1 211 ? -19.476 -21.265 24.857  1.00 38.25  ?  211 ASN B CA    1 
ATOM   4870 C  C     . ASN B 1 211 ? -19.924 -20.212 23.822  1.00 33.34  ?  211 ASN B C     1 
ATOM   4871 O  O     . ASN B 1 211 ? -21.080 -19.807 23.892  1.00 41.91  ?  211 ASN B O     1 
ATOM   4872 C  CB    . ASN B 1 211 ? -19.472 -20.743 26.295  1.00 38.13  ?  211 ASN B CB    1 
ATOM   4873 C  CG    . ASN B 1 211 ? -20.836 -20.844 26.939  1.00 41.90  ?  211 ASN B CG    1 
ATOM   4874 O  OD1   . ASN B 1 211 ? -21.622 -21.748 26.613  1.00 34.16  ?  211 ASN B OD1   1 
ATOM   4875 N  ND2   . ASN B 1 211 ? -21.127 -19.912 27.846  1.00 43.95  ?  211 ASN B ND2   1 
ATOM   4876 N  N     . ASP B 1 212 ? -19.055 -19.774 22.918  1.00 31.08  ?  212 ASP B N     1 
ATOM   4877 C  CA    . ASP B 1 212 ? -19.374 -18.822 21.810  1.00 36.18  ?  212 ASP B CA    1 
ATOM   4878 C  C     . ASP B 1 212 ? -19.878 -19.607 20.580  1.00 33.86  ?  212 ASP B C     1 
ATOM   4879 O  O     . ASP B 1 212 ? -20.583 -19.055 19.755  1.00 34.80  ?  212 ASP B O     1 
ATOM   4880 C  CB    . ASP B 1 212 ? -18.146 -18.000 21.381  1.00 40.17  ?  212 ASP B CB    1 
ATOM   4881 C  CG    . ASP B 1 212 ? -17.353 -17.320 22.513  1.00 52.34  ?  212 ASP B CG    1 
ATOM   4882 O  OD1   . ASP B 1 212 ? -17.665 -17.527 23.734  1.00 52.66  ?  212 ASP B OD1   1 
ATOM   4883 O  OD2   . ASP B 1 212 ? -16.412 -16.574 22.184  1.00 54.45  ?  212 ASP B OD2   1 
ATOM   4884 N  N     . SER B 1 213 ? -19.556 -20.891 20.517  1.00 34.03  ?  213 SER B N     1 
ATOM   4885 C  CA    . SER B 1 213 ? -19.757 -21.778 19.358  1.00 33.74  ?  213 SER B CA    1 
ATOM   4886 C  C     . SER B 1 213 ? -21.191 -22.307 19.256  1.00 30.96  ?  213 SER B C     1 
ATOM   4887 O  O     . SER B 1 213 ? -21.501 -22.811 18.199  1.00 36.24  ?  213 SER B O     1 
ATOM   4888 C  CB    . SER B 1 213 ? -18.814 -22.954 19.449  1.00 35.22  ?  213 SER B CB    1 
ATOM   4889 O  OG    . SER B 1 213 ? -17.486 -22.526 19.428  1.00 31.17  ?  213 SER B OG    1 
ATOM   4890 N  N     . TRP B 1 214 ? -22.001 -22.287 20.300  1.00 26.47  ?  214 TRP B N     1 
ATOM   4891 C  CA    . TRP B 1 214 ? -23.294 -23.021 20.293  1.00 28.23  ?  214 TRP B CA    1 
ATOM   4892 C  C     . TRP B 1 214 ? -24.382 -22.198 20.986  1.00 29.94  ?  214 TRP B C     1 
ATOM   4893 O  O     . TRP B 1 214 ? -24.064 -21.127 21.550  1.00 33.68  ?  214 TRP B O     1 
ATOM   4894 C  CB    . TRP B 1 214 ? -23.158 -24.409 20.942  1.00 25.84  ?  214 TRP B CB    1 
ATOM   4895 C  CG    . TRP B 1 214 ? -22.551 -24.424 22.318  1.00 30.27  ?  214 TRP B CG    1 
ATOM   4896 C  CD1   . TRP B 1 214 ? -22.697 -23.480 23.290  1.00 31.68  ?  214 TRP B CD1   1 
ATOM   4897 C  CD2   . TRP B 1 214 ? -21.712 -25.445 22.887  1.00 26.78  ?  214 TRP B CD2   1 
ATOM   4898 N  NE1   . TRP B 1 214 ? -22.014 -23.859 24.407  1.00 34.69  ?  214 TRP B NE1   1 
ATOM   4899 C  CE2   . TRP B 1 214 ? -21.375 -25.044 24.172  1.00 30.02  ?  214 TRP B CE2   1 
ATOM   4900 C  CE3   . TRP B 1 214 ? -21.181 -26.641 22.417  1.00 30.90  ?  214 TRP B CE3   1 
ATOM   4901 C  CZ2   . TRP B 1 214 ? -20.553 -25.795 25.000  1.00 32.67  ?  214 TRP B CZ2   1 
ATOM   4902 C  CZ3   . TRP B 1 214 ? -20.378 -27.400 23.233  1.00 30.31  ?  214 TRP B CZ3   1 
ATOM   4903 C  CH2   . TRP B 1 214 ? -20.081 -26.988 24.519  1.00 31.53  ?  214 TRP B CH2   1 
ATOM   4904 N  N     . ARG B 1 215 ? -25.605 -22.716 20.974  1.00 28.55  ?  215 ARG B N     1 
ATOM   4905 C  CA    . ARG B 1 215 ? -26.715 -22.230 21.834  1.00 33.85  ?  215 ARG B CA    1 
ATOM   4906 C  C     . ARG B 1 215 ? -27.166 -23.414 22.704  1.00 32.09  ?  215 ARG B C     1 
ATOM   4907 O  O     . ARG B 1 215 ? -27.395 -24.496 22.146  1.00 30.17  ?  215 ARG B O     1 
ATOM   4908 C  CB    . ARG B 1 215 ? -27.835 -21.595 20.993  1.00 31.24  ?  215 ARG B CB    1 
ATOM   4909 C  CG    . ARG B 1 215 ? -27.457 -20.281 20.334  1.00 30.38  ?  215 ARG B CG    1 
ATOM   4910 C  CD    . ARG B 1 215 ? -28.660 -19.689 19.623  1.00 33.61  ?  215 ARG B CD    1 
ATOM   4911 N  NE    . ARG B 1 215 ? -28.404 -18.385 19.053  1.00 31.50  ?  215 ARG B NE    1 
ATOM   4912 C  CZ    . ARG B 1 215 ? -28.338 -18.134 17.762  1.00 36.65  ?  215 ARG B CZ    1 
ATOM   4913 N  NH1   . ARG B 1 215 ? -28.537 -19.082 16.867  1.00 42.66  ?  215 ARG B NH1   1 
ATOM   4914 N  NH2   . ARG B 1 215 ? -28.095 -16.913 17.339  1.00 36.28  ?  215 ARG B NH2   1 
ATOM   4915 N  N     . LEU B 1 216 ? -27.203 -23.202 24.024  1.00 34.68  ?  216 LEU B N     1 
ATOM   4916 C  CA    . LEU B 1 216 ? -27.458 -24.222 25.079  1.00 35.74  ?  216 LEU B CA    1 
ATOM   4917 C  C     . LEU B 1 216 ? -28.651 -23.741 25.894  1.00 36.96  ?  216 LEU B C     1 
ATOM   4918 O  O     . LEU B 1 216 ? -28.504 -22.648 26.564  1.00 29.69  ?  216 LEU B O     1 
ATOM   4919 C  CB    . LEU B 1 216 ? -26.243 -24.311 26.006  1.00 37.95  ?  216 LEU B CB    1 
ATOM   4920 C  CG    . LEU B 1 216 ? -25.359 -25.546 25.940  1.00 40.66  ?  216 LEU B CG    1 
ATOM   4921 C  CD1   . LEU B 1 216 ? -24.502 -25.594 27.208  1.00 40.71  ?  216 LEU B CD1   1 
ATOM   4922 C  CD2   . LEU B 1 216 ? -26.177 -26.823 25.849  1.00 43.10  ?  216 LEU B CD2   1 
ATOM   4923 N  N     . TRP B 1 217 ? -29.769 -24.476 25.838  1.00 32.45  ?  217 TRP B N     1 
ATOM   4924 C  CA    . TRP B 1 217 ? -30.988 -24.115 26.595  1.00 35.07  ?  217 TRP B CA    1 
ATOM   4925 C  C     . TRP B 1 217 ? -31.274 -25.179 27.629  1.00 35.50  ?  217 TRP B C     1 
ATOM   4926 O  O     . TRP B 1 217 ? -31.753 -26.241 27.242  1.00 31.76  ?  217 TRP B O     1 
ATOM   4927 C  CB    . TRP B 1 217 ? -32.186 -23.934 25.669  1.00 33.23  ?  217 TRP B CB    1 
ATOM   4928 C  CG    . TRP B 1 217 ? -32.040 -22.840 24.674  1.00 30.44  ?  217 TRP B CG    1 
ATOM   4929 C  CD1   . TRP B 1 217 ? -31.085 -21.866 24.618  1.00 31.88  ?  217 TRP B CD1   1 
ATOM   4930 C  CD2   . TRP B 1 217 ? -32.942 -22.582 23.595  1.00 30.39  ?  217 TRP B CD2   1 
ATOM   4931 N  NE1   . TRP B 1 217 ? -31.319 -21.035 23.546  1.00 29.60  ?  217 TRP B NE1   1 
ATOM   4932 C  CE2   . TRP B 1 217 ? -32.455 -21.451 22.908  1.00 30.62  ?  217 TRP B CE2   1 
ATOM   4933 C  CE3   . TRP B 1 217 ? -34.098 -23.211 23.135  1.00 31.13  ?  217 TRP B CE3   1 
ATOM   4934 C  CZ2   . TRP B 1 217 ? -33.069 -20.960 21.760  1.00 33.54  ?  217 TRP B CZ2   1 
ATOM   4935 C  CZ3   . TRP B 1 217 ? -34.724 -22.702 22.015  1.00 32.64  ?  217 TRP B CZ3   1 
ATOM   4936 C  CH2   . TRP B 1 217 ? -34.199 -21.606 21.320  1.00 31.78  ?  217 TRP B CH2   1 
ATOM   4937 N  N     . PRO B 1 218 ? -31.022 -24.917 28.941  1.00 37.09  ?  218 PRO B N     1 
ATOM   4938 C  CA    . PRO B 1 218 ? -31.474 -25.833 30.005  1.00 39.76  ?  218 PRO B CA    1 
ATOM   4939 C  C     . PRO B 1 218 ? -32.993 -26.042 29.913  1.00 38.57  ?  218 PRO B C     1 
ATOM   4940 O  O     . PRO B 1 218 ? -33.681 -25.090 29.694  1.00 37.04  ?  218 PRO B O     1 
ATOM   4941 C  CB    . PRO B 1 218 ? -31.023 -25.192 31.326  1.00 36.73  ?  218 PRO B CB    1 
ATOM   4942 C  CG    . PRO B 1 218 ? -29.888 -24.245 30.881  1.00 38.58  ?  218 PRO B CG    1 
ATOM   4943 C  CD    . PRO B 1 218 ? -30.260 -23.785 29.474  1.00 35.78  ?  218 PRO B CD    1 
ATOM   4944 N  N     . SER B 1 219 ? -33.443 -27.296 29.972  1.00 44.77  ?  219 SER B N     1 
ATOM   4945 C  CA    . SER B 1 219 ? -34.869 -27.737 29.870  1.00 48.44  ?  219 SER B CA    1 
ATOM   4946 C  C     . SER B 1 219 ? -35.548 -27.227 28.584  1.00 41.27  ?  219 SER B C     1 
ATOM   4947 O  O     . SER B 1 219 ? -36.767 -27.004 28.606  1.00 43.43  ?  219 SER B O     1 
ATOM   4948 C  CB    . SER B 1 219 ? -35.641 -27.320 31.104  1.00 48.45  ?  219 SER B CB    1 
ATOM   4949 O  OG    . SER B 1 219 ? -35.013 -27.828 32.263  1.00 48.17  ?  219 SER B OG    1 
ATOM   4950 N  N     . GLY B 1 220 ? -34.782 -27.017 27.508  1.00 44.41  ?  220 GLY B N     1 
ATOM   4951 C  CA    . GLY B 1 220 ? -35.276 -26.455 26.237  1.00 37.30  ?  220 GLY B CA    1 
ATOM   4952 C  C     . GLY B 1 220 ? -35.785 -25.009 26.362  1.00 43.17  ?  220 GLY B C     1 
ATOM   4953 O  O     . GLY B 1 220 ? -36.426 -24.556 25.365  1.00 39.73  ?  220 GLY B O     1 
ATOM   4954 N  N     . ASP B 1 221 ? -35.435 -24.272 27.446  1.00 38.24  ?  221 ASP B N     1 
ATOM   4955 C  CA    . ASP B 1 221 ? -35.980 -22.923 27.765  1.00 42.64  ?  221 ASP B CA    1 
ATOM   4956 C  C     . ASP B 1 221 ? -35.001 -21.798 27.381  1.00 41.94  ?  221 ASP B C     1 
ATOM   4957 O  O     . ASP B 1 221 ? -34.065 -21.516 28.140  1.00 37.59  ?  221 ASP B O     1 
ATOM   4958 C  CB    . ASP B 1 221 ? -36.384 -22.836 29.243  1.00 47.60  ?  221 ASP B CB    1 
ATOM   4959 C  CG    . ASP B 1 221 ? -37.079 -21.541 29.637  1.00 46.05  ?  221 ASP B CG    1 
ATOM   4960 O  OD1   . ASP B 1 221 ? -37.180 -20.628 28.773  1.00 41.61  ?  221 ASP B OD1   1 
ATOM   4961 O  OD2   . ASP B 1 221 ? -37.496 -21.460 30.801  1.00 45.27  ?  221 ASP B OD2   1 
ATOM   4962 N  N     . ARG B 1 222 ? -35.291 -21.118 26.274  1.00 44.30  ?  222 ARG B N     1 
ATOM   4963 C  CA    . ARG B 1 222 ? -34.461 -20.035 25.678  1.00 47.38  ?  222 ARG B CA    1 
ATOM   4964 C  C     . ARG B 1 222 ? -34.113 -18.968 26.722  1.00 45.48  ?  222 ARG B C     1 
ATOM   4965 O  O     . ARG B 1 222 ? -33.042 -18.359 26.611  1.00 46.77  ?  222 ARG B O     1 
ATOM   4966 C  CB    . ARG B 1 222 ? -35.223 -19.402 24.514  1.00 48.39  ?  222 ARG B CB    1 
ATOM   4967 C  CG    . ARG B 1 222 ? -34.509 -18.269 23.797  1.00 58.91  ?  222 ARG B CG    1 
ATOM   4968 C  CD    . ARG B 1 222 ? -35.602 -17.336 23.286  1.00 72.43  ?  222 ARG B CD    1 
ATOM   4969 N  NE    . ARG B 1 222 ? -35.215 -16.428 22.222  1.00 85.29  ?  222 ARG B NE    1 
ATOM   4970 C  CZ    . ARG B 1 222 ? -35.918 -15.353 21.841  1.00 90.32  ?  222 ARG B CZ    1 
ATOM   4971 N  NH1   . ARG B 1 222 ? -37.059 -15.057 22.438  1.00 88.12  ?  222 ARG B NH1   1 
ATOM   4972 N  NH2   . ARG B 1 222 ? -35.473 -14.569 20.870  1.00 87.82  ?  222 ARG B NH2   1 
ATOM   4973 N  N     . SER B 1 223 ? -35.016 -18.701 27.660  1.00 46.34  ?  223 SER B N     1 
ATOM   4974 C  CA    . SER B 1 223 ? -34.848 -17.634 28.686  1.00 51.34  ?  223 SER B CA    1 
ATOM   4975 C  C     . SER B 1 223 ? -33.766 -18.064 29.698  1.00 50.28  ?  223 SER B C     1 
ATOM   4976 O  O     . SER B 1 223 ? -33.201 -17.178 30.333  1.00 54.10  ?  223 SER B O     1 
ATOM   4977 C  CB    . SER B 1 223 ? -36.164 -17.274 29.358  1.00 49.87  ?  223 SER B CB    1 
ATOM   4978 O  OG    . SER B 1 223 ? -36.461 -18.214 30.393  1.00 51.75  ?  223 SER B OG    1 
ATOM   4979 N  N     . GLN B 1 224 ? -33.459 -19.365 29.806  1.00 44.04  ?  224 GLN B N     1 
ATOM   4980 C  CA    . GLN B 1 224 ? -32.348 -19.921 30.636  1.00 41.07  ?  224 GLN B CA    1 
ATOM   4981 C  C     . GLN B 1 224 ? -31.050 -20.097 29.807  1.00 38.75  ?  224 GLN B C     1 
ATOM   4982 O  O     . GLN B 1 224 ? -30.126 -20.777 30.298  1.00 33.76  ?  224 GLN B O     1 
ATOM   4983 C  CB    . GLN B 1 224 ? -32.777 -21.276 31.230  1.00 45.61  ?  224 GLN B CB    1 
ATOM   4984 C  CG    . GLN B 1 224 ? -33.827 -21.213 32.338  1.00 46.16  ?  224 GLN B CG    1 
ATOM   4985 C  CD    . GLN B 1 224 ? -34.262 -22.591 32.798  1.00 47.91  ?  224 GLN B CD    1 
ATOM   4986 O  OE1   . GLN B 1 224 ? -33.479 -23.413 33.290  1.00 47.59  ?  224 GLN B OE1   1 
ATOM   4987 N  NE2   . GLN B 1 224 ? -35.541 -22.868 32.627  1.00 44.22  ?  224 GLN B NE2   1 
ATOM   4988 N  N     . GLN B 1 225 ? -30.961 -19.536 28.591  1.00 40.34  ?  225 GLN B N     1 
ATOM   4989 C  CA    . GLN B 1 225 ? -29.768 -19.638 27.702  1.00 44.21  ?  225 GLN B CA    1 
ATOM   4990 C  C     . GLN B 1 225 ? -28.472 -19.377 28.491  1.00 43.01  ?  225 GLN B C     1 
ATOM   4991 O  O     . GLN B 1 225 ? -28.416 -18.355 29.212  1.00 42.15  ?  225 GLN B O     1 
ATOM   4992 C  CB    . GLN B 1 225 ? -29.872 -18.697 26.495  1.00 50.07  ?  225 GLN B CB    1 
ATOM   4993 C  CG    . GLN B 1 225 ? -29.971 -17.204 26.826  1.00 48.44  ?  225 GLN B CG    1 
ATOM   4994 C  CD    . GLN B 1 225 ? -30.208 -16.359 25.589  1.00 48.57  ?  225 GLN B CD    1 
ATOM   4995 O  OE1   . GLN B 1 225 ? -30.411 -16.863 24.474  1.00 38.96  ?  225 GLN B OE1   1 
ATOM   4996 N  NE2   . GLN B 1 225 ? -30.152 -15.046 25.778  1.00 45.52  ?  225 GLN B NE2   1 
ATOM   4997 N  N     . LYS B 1 226 ? -27.496 -20.288 28.372  1.00 39.33  ?  226 LYS B N     1 
ATOM   4998 C  CA    . LYS B 1 226 ? -26.222 -20.283 29.148  1.00 41.72  ?  226 LYS B CA    1 
ATOM   4999 C  C     . LYS B 1 226 ? -25.046 -19.898 28.242  1.00 43.69  ?  226 LYS B C     1 
ATOM   5000 O  O     . LYS B 1 226 ? -23.950 -19.633 28.783  1.00 46.09  ?  226 LYS B O     1 
ATOM   5001 C  CB    . LYS B 1 226 ? -25.994 -21.646 29.792  1.00 41.58  ?  226 LYS B CB    1 
ATOM   5002 C  CG    . LYS B 1 226 ? -26.936 -21.956 30.943  1.00 48.53  ?  226 LYS B CG    1 
ATOM   5003 C  CD    . LYS B 1 226 ? -26.697 -21.050 32.162  1.00 51.44  ?  226 LYS B CD    1 
ATOM   5004 C  CE    . LYS B 1 226 ? -27.630 -21.355 33.323  1.00 51.85  ?  226 LYS B CE    1 
ATOM   5005 N  NZ    . LYS B 1 226 ? -28.972 -20.758 33.110  1.00 49.44  ?  226 LYS B NZ    1 
ATOM   5006 N  N     . ASP B 1 227 ? -25.283 -19.805 26.933  1.00 41.34  ?  227 ASP B N     1 
ATOM   5007 C  CA    . ASP B 1 227 ? -24.244 -19.551 25.901  1.00 38.99  ?  227 ASP B CA    1 
ATOM   5008 C  C     . ASP B 1 227 ? -23.998 -18.044 25.750  1.00 37.64  ?  227 ASP B C     1 
ATOM   5009 O  O     . ASP B 1 227 ? -24.603 -17.248 26.493  1.00 38.41  ?  227 ASP B O     1 
ATOM   5010 C  CB    . ASP B 1 227 ? -24.666 -20.201 24.580  1.00 47.25  ?  227 ASP B CB    1 
ATOM   5011 C  CG    . ASP B 1 227 ? -25.951 -19.631 24.007  1.00 48.55  ?  227 ASP B CG    1 
ATOM   5012 O  OD1   . ASP B 1 227 ? -27.063 -20.116 24.400  1.00 46.49  ?  227 ASP B OD1   1 
ATOM   5013 O  OD2   . ASP B 1 227 ? -25.826 -18.697 23.183  1.00 51.39  ?  227 ASP B OD2   1 
ATOM   5014 N  N     . LYS B 1 228 ? -23.172 -17.657 24.771  1.00 35.75  ?  228 LYS B N     1 
ATOM   5015 C  CA    . LYS B 1 228 ? -22.752 -16.250 24.569  1.00 36.57  ?  228 LYS B CA    1 
ATOM   5016 C  C     . LYS B 1 228 ? -23.907 -15.384 24.044  1.00 40.06  ?  228 LYS B C     1 
ATOM   5017 O  O     . LYS B 1 228 ? -23.748 -14.155 23.996  1.00 38.65  ?  228 LYS B O     1 
ATOM   5018 C  CB    . LYS B 1 228 ? -21.589 -16.201 23.579  1.00 40.32  ?  228 LYS B CB    1 
ATOM   5019 C  CG    . LYS B 1 228 ? -21.056 -14.800 23.277  1.00 42.45  ?  228 LYS B CG    1 
ATOM   5020 C  CD    . LYS B 1 228 ? -19.681 -14.823 22.695  1.00 47.42  ?  228 LYS B CD    1 
ATOM   5021 C  CE    . LYS B 1 228 ? -19.653 -14.165 21.339  1.00 44.58  ?  228 LYS B CE    1 
ATOM   5022 N  NZ    . LYS B 1 228 ? -18.380 -14.423 20.643  1.00 46.32  ?  228 LYS B NZ    1 
ATOM   5023 N  N     . GLN B 1 229 ? -25.016 -15.981 23.605  1.00 43.38  ?  229 GLN B N     1 
ATOM   5024 C  CA    . GLN B 1 229 ? -26.220 -15.225 23.179  1.00 43.93  ?  229 GLN B CA    1 
ATOM   5025 C  C     . GLN B 1 229 ? -26.668 -14.311 24.329  1.00 44.17  ?  229 GLN B C     1 
ATOM   5026 O  O     . GLN B 1 229 ? -27.232 -13.258 24.027  1.00 48.99  ?  229 GLN B O     1 
ATOM   5027 C  CB    . GLN B 1 229 ? -27.360 -16.165 22.782  1.00 44.03  ?  229 GLN B CB    1 
ATOM   5028 C  CG    . GLN B 1 229 ? -28.478 -15.486 22.013  1.00 42.44  ?  229 GLN B CG    1 
ATOM   5029 C  CD    . GLN B 1 229 ? -28.030 -14.875 20.700  1.00 42.04  ?  229 GLN B CD    1 
ATOM   5030 O  OE1   . GLN B 1 229 ? -27.315 -15.461 19.886  1.00 38.42  ?  229 GLN B OE1   1 
ATOM   5031 N  NE2   . GLN B 1 229 ? -28.465 -13.653 20.475  1.00 43.07  ?  229 GLN B NE2   1 
ATOM   5032 N  N     . SER B 1 230 ? -26.424 -14.691 25.586  1.00 45.51  ?  230 SER B N     1 
ATOM   5033 C  CA    . SER B 1 230 ? -26.779 -13.876 26.784  1.00 52.15  ?  230 SER B CA    1 
ATOM   5034 C  C     . SER B 1 230 ? -26.051 -12.521 26.744  1.00 48.99  ?  230 SER B C     1 
ATOM   5035 O  O     . SER B 1 230 ? -26.631 -11.553 27.198  1.00 61.67  ?  230 SER B O     1 
ATOM   5036 C  CB    . SER B 1 230 ? -26.497 -14.629 28.098  1.00 56.75  ?  230 SER B CB    1 
ATOM   5037 O  OG    . SER B 1 230 ? -25.131 -15.047 28.242  1.00 48.25  ?  230 SER B OG    1 
ATOM   5038 N  N     . TYR B 1 231 ? -24.832 -12.478 26.210  1.00 42.48  ?  231 TYR B N     1 
ATOM   5039 C  CA    . TYR B 1 231 ? -23.998 -11.266 26.028  1.00 45.14  ?  231 TYR B CA    1 
ATOM   5040 C  C     . TYR B 1 231 ? -24.398 -10.533 24.744  1.00 47.93  ?  231 TYR B C     1 
ATOM   5041 O  O     . TYR B 1 231 ? -24.471 -9.285  24.796  1.00 50.79  ?  231 TYR B O     1 
ATOM   5042 C  CB    . TYR B 1 231 ? -22.520 -11.663 25.984  1.00 46.93  ?  231 TYR B CB    1 
ATOM   5043 C  CG    . TYR B 1 231 ? -21.513 -10.568 25.708  1.00 41.63  ?  231 TYR B CG    1 
ATOM   5044 C  CD1   . TYR B 1 231 ? -21.256 -9.544  26.618  1.00 46.55  ?  231 TYR B CD1   1 
ATOM   5045 C  CD2   . TYR B 1 231 ? -20.743 -10.610 24.570  1.00 36.98  ?  231 TYR B CD2   1 
ATOM   5046 C  CE1   . TYR B 1 231 ? -20.274 -8.591  26.382  1.00 43.72  ?  231 TYR B CE1   1 
ATOM   5047 C  CE2   . TYR B 1 231 ? -19.769 -9.660  24.314  1.00 40.91  ?  231 TYR B CE2   1 
ATOM   5048 C  CZ    . TYR B 1 231 ? -19.521 -8.657  25.226  1.00 42.33  ?  231 TYR B CZ    1 
ATOM   5049 O  OH    . TYR B 1 231 ? -18.575 -7.730  24.923  1.00 46.21  ?  231 TYR B OH    1 
ATOM   5050 N  N     . ARG B 1 232 ? -24.631 -11.247 23.632  1.00 42.60  ?  232 ARG B N     1 
ATOM   5051 C  CA    . ARG B 1 232 ? -25.092 -10.612 22.362  1.00 46.15  ?  232 ARG B CA    1 
ATOM   5052 C  C     . ARG B 1 232 ? -26.415 -9.848  22.589  1.00 51.33  ?  232 ARG B C     1 
ATOM   5053 O  O     . ARG B 1 232 ? -26.571 -8.780  21.979  1.00 53.00  ?  232 ARG B O     1 
ATOM   5054 C  CB    . ARG B 1 232 ? -25.327 -11.637 21.246  1.00 49.92  ?  232 ARG B CB    1 
ATOM   5055 C  CG    . ARG B 1 232 ? -24.104 -12.448 20.835  1.00 48.47  ?  232 ARG B CG    1 
ATOM   5056 C  CD    . ARG B 1 232 ? -24.369 -13.263 19.571  1.00 40.94  ?  232 ARG B CD    1 
ATOM   5057 N  NE    . ARG B 1 232 ? -23.270 -14.195 19.332  1.00 39.43  ?  232 ARG B NE    1 
ATOM   5058 C  CZ    . ARG B 1 232 ? -23.286 -15.522 19.566  1.00 47.86  ?  232 ARG B CZ    1 
ATOM   5059 N  NH1   . ARG B 1 232 ? -22.190 -16.235 19.319  1.00 44.24  ?  232 ARG B NH1   1 
ATOM   5060 N  NH2   . ARG B 1 232 ? -24.383 -16.151 20.012  1.00 43.88  ?  232 ARG B NH2   1 
ATOM   5061 N  N     . ASP B 1 233 ? -27.312 -10.343 23.456  1.00 51.52  ?  233 ASP B N     1 
ATOM   5062 C  CA    . ASP B 1 233 ? -28.722 -9.851  23.587  1.00 58.64  ?  233 ASP B CA    1 
ATOM   5063 C  C     . ASP B 1 233 ? -28.771 -8.545  24.412  1.00 66.20  ?  233 ASP B C     1 
ATOM   5064 O  O     . ASP B 1 233 ? -29.725 -7.762  24.179  1.00 57.32  ?  233 ASP B O     1 
ATOM   5065 C  CB    . ASP B 1 233 ? -29.685 -10.915 24.166  1.00 53.90  ?  233 ASP B CB    1 
ATOM   5066 C  CG    . ASP B 1 233 ? -30.201 -11.975 23.181  1.00 57.79  ?  233 ASP B CG    1 
ATOM   5067 O  OD1   . ASP B 1 233 ? -29.929 -11.858 21.957  1.00 46.92  ?  233 ASP B OD1   1 
ATOM   5068 O  OD2   . ASP B 1 233 ? -30.879 -12.929 23.643  1.00 53.28  ?  233 ASP B OD2   1 
ATOM   5069 N  N     . LEU B 1 234 ? -27.784 -8.302  25.302  1.00 71.55  ?  234 LEU B N     1 
ATOM   5070 C  CA    . LEU B 1 234 ? -27.740 -7.130  26.234  1.00 69.71  ?  234 LEU B CA    1 
ATOM   5071 C  C     . LEU B 1 234 ? -27.934 -5.837  25.434  1.00 66.37  ?  234 LEU B C     1 
ATOM   5072 O  O     . LEU B 1 234 ? -27.192 -5.652  24.452  1.00 54.05  ?  234 LEU B O     1 
ATOM   5073 C  CB    . LEU B 1 234 ? -26.403 -7.076  26.986  1.00 67.01  ?  234 LEU B CB    1 
ATOM   5074 C  CG    . LEU B 1 234 ? -26.107 -8.239  27.928  1.00 66.94  ?  234 LEU B CG    1 
ATOM   5075 C  CD1   . LEU B 1 234 ? -24.774 -8.010  28.637  1.00 65.61  ?  234 LEU B CD1   1 
ATOM   5076 C  CD2   . LEU B 1 234 ? -27.250 -8.480  28.923  1.00 61.04  ?  234 LEU B CD2   1 
ATOM   5077 N  N     . LYS B 1 235 ? -28.903 -5.000  25.830  1.00 68.90  ?  235 LYS B N     1 
ATOM   5078 C  CA    . LYS B 1 235 ? -29.208 -3.725  25.134  1.00 75.06  ?  235 LYS B CA    1 
ATOM   5079 C  C     . LYS B 1 235 ? -27.935 -2.872  25.168  1.00 75.02  ?  235 LYS B C     1 
ATOM   5080 O  O     . LYS B 1 235 ? -27.457 -2.420  24.095  1.00 63.23  ?  235 LYS B O     1 
ATOM   5081 C  CB    . LYS B 1 235 ? -30.417 -3.048  25.792  1.00 88.24  ?  235 LYS B CB    1 
ATOM   5082 C  CG    . LYS B 1 235 ? -31.138 -2.000  24.941  1.00 102.94 ?  235 LYS B CG    1 
ATOM   5083 C  CD    . LYS B 1 235 ? -32.244 -2.543  24.038  1.00 100.69 ?  235 LYS B CD    1 
ATOM   5084 C  CE    . LYS B 1 235 ? -33.107 -1.440  23.456  1.00 95.28  ?  235 LYS B CE    1 
ATOM   5085 N  NZ    . LYS B 1 235 ? -34.107 -1.973  22.505  1.00 86.88  ?  235 LYS B NZ    1 
ATOM   5086 N  N     . GLU B 1 236 ? -27.412 -2.728  26.383  1.00 79.05  ?  236 GLU B N     1 
ATOM   5087 C  CA    . GLU B 1 236 ? -26.167 -1.988  26.678  1.00 78.88  ?  236 GLU B CA    1 
ATOM   5088 C  C     . GLU B 1 236 ? -25.398 -2.838  27.691  1.00 71.08  ?  236 GLU B C     1 
ATOM   5089 O  O     . GLU B 1 236 ? -26.049 -3.476  28.512  1.00 58.45  ?  236 GLU B O     1 
ATOM   5090 C  CB    . GLU B 1 236 ? -26.505 -0.547  27.073  1.00 89.37  ?  236 GLU B CB    1 
ATOM   5091 C  CG    . GLU B 1 236 ? -25.748 -0.024  28.273  1.00 104.58 ?  236 GLU B CG    1 
ATOM   5092 C  CD    . GLU B 1 236 ? -26.458 1.073   29.051  1.00 111.37 ?  236 GLU B CD    1 
ATOM   5093 O  OE1   . GLU B 1 236 ? -27.387 1.683   28.496  1.00 101.57 ?  236 GLU B OE1   1 
ATOM   5094 O  OE2   . GLU B 1 236 ? -26.081 1.315   30.213  1.00 92.90  ?  236 GLU B OE2   1 
ATOM   5095 N  N     . VAL B 1 237 ? -24.073 -2.886  27.558  1.00 62.28  ?  237 VAL B N     1 
ATOM   5096 C  CA    . VAL B 1 237 ? -23.169 -3.687  28.434  1.00 64.86  ?  237 VAL B CA    1 
ATOM   5097 C  C     . VAL B 1 237 ? -22.854 -2.868  29.695  1.00 67.49  ?  237 VAL B C     1 
ATOM   5098 O  O     . VAL B 1 237 ? -22.126 -1.852  29.590  1.00 67.92  ?  237 VAL B O     1 
ATOM   5099 C  CB    . VAL B 1 237 ? -21.867 -4.087  27.704  1.00 69.06  ?  237 VAL B CB    1 
ATOM   5100 C  CG1   . VAL B 1 237 ? -20.952 -4.950  28.577  1.00 65.30  ?  237 VAL B CG1   1 
ATOM   5101 C  CG2   . VAL B 1 237 ? -22.154 -4.760  26.368  1.00 72.52  ?  237 VAL B CG2   1 
ATOM   5102 N  N     . THR B 1 238 ? -23.374 -3.309  30.838  1.00 68.60  ?  238 THR B N     1 
ATOM   5103 C  CA    . THR B 1 238 ? -23.100 -2.741  32.181  1.00 67.43  ?  238 THR B CA    1 
ATOM   5104 C  C     . THR B 1 238 ? -22.182 -3.695  32.935  1.00 75.28  ?  238 THR B C     1 
ATOM   5105 O  O     . THR B 1 238 ? -22.056 -4.861  32.567  1.00 67.17  ?  238 THR B O     1 
ATOM   5106 C  CB    . THR B 1 238 ? -24.405 -2.463  32.942  1.00 68.14  ?  238 THR B CB    1 
ATOM   5107 O  OG1   . THR B 1 238 ? -25.047 -3.702  33.238  1.00 68.73  ?  238 THR B OG1   1 
ATOM   5108 C  CG2   . THR B 1 238 ? -25.366 -1.573  32.177  1.00 65.60  ?  238 THR B CG2   1 
ATOM   5109 N  N     . PRO B 1 239 ? -21.486 -3.222  33.995  1.00 90.53  ?  239 PRO B N     1 
ATOM   5110 C  CA    . PRO B 1 239 ? -20.755 -4.112  34.902  1.00 91.22  ?  239 PRO B CA    1 
ATOM   5111 C  C     . PRO B 1 239 ? -21.615 -5.228  35.524  1.00 78.70  ?  239 PRO B C     1 
ATOM   5112 O  O     . PRO B 1 239 ? -21.098 -6.332  35.698  1.00 69.19  ?  239 PRO B O     1 
ATOM   5113 C  CB    . PRO B 1 239 ? -20.212 -3.145  35.977  1.00 87.47  ?  239 PRO B CB    1 
ATOM   5114 C  CG    . PRO B 1 239 ? -20.055 -1.839  35.231  1.00 84.52  ?  239 PRO B CG    1 
ATOM   5115 C  CD    . PRO B 1 239 ? -21.266 -1.799  34.317  1.00 88.45  ?  239 PRO B CD    1 
ATOM   5116 N  N     . GLU B 1 240 ? -22.873 -4.936  35.866  1.00 74.28  ?  240 GLU B N     1 
ATOM   5117 C  CA    . GLU B 1 240 ? -23.809 -5.952  36.415  1.00 76.59  ?  240 GLU B CA    1 
ATOM   5118 C  C     . GLU B 1 240 ? -24.157 -6.976  35.310  1.00 78.19  ?  240 GLU B C     1 
ATOM   5119 O  O     . GLU B 1 240 ? -24.351 -8.183  35.620  1.00 64.59  ?  240 GLU B O     1 
ATOM   5120 C  CB    . GLU B 1 240 ? -25.062 -5.293  37.000  1.00 76.51  ?  240 GLU B CB    1 
ATOM   5121 C  CG    . GLU B 1 240 ? -25.927 -6.322  37.730  1.00 89.42  ?  240 GLU B CG    1 
ATOM   5122 C  CD    . GLU B 1 240 ? -27.444 -6.171  37.685  1.00 97.87  ?  240 GLU B CD    1 
ATOM   5123 O  OE1   . GLU B 1 240 ? -28.019 -5.896  38.740  1.00 90.61  ?  240 GLU B OE1   1 
ATOM   5124 O  OE2   . GLU B 1 240 ? -28.047 -6.373  36.605  1.00 94.79  ?  240 GLU B OE2   1 
ATOM   5125 N  N     . GLY B 1 241 ? -24.262 -6.505  34.062  1.00 67.79  ?  241 GLY B N     1 
ATOM   5126 C  CA    . GLY B 1 241 ? -24.548 -7.325  32.870  1.00 66.05  ?  241 GLY B CA    1 
ATOM   5127 C  C     . GLY B 1 241 ? -23.453 -8.338  32.578  1.00 60.94  ?  241 GLY B C     1 
ATOM   5128 O  O     . GLY B 1 241 ? -23.783 -9.466  32.180  1.00 63.79  ?  241 GLY B O     1 
ATOM   5129 N  N     . LEU B 1 242 ? -22.193 -7.950  32.750  1.00 58.48  ?  242 LEU B N     1 
ATOM   5130 C  CA    . LEU B 1 242 ? -21.009 -8.815  32.500  1.00 56.75  ?  242 LEU B CA    1 
ATOM   5131 C  C     . LEU B 1 242 ? -20.900 -9.928  33.547  1.00 47.84  ?  242 LEU B C     1 
ATOM   5132 O  O     . LEU B 1 242 ? -20.360 -10.976 33.174  1.00 51.79  ?  242 LEU B O     1 
ATOM   5133 C  CB    . LEU B 1 242 ? -19.728 -7.971  32.523  1.00 57.34  ?  242 LEU B CB    1 
ATOM   5134 C  CG    . LEU B 1 242 ? -19.234 -7.462  31.180  1.00 58.23  ?  242 LEU B CG    1 
ATOM   5135 C  CD1   . LEU B 1 242 ? -17.944 -6.677  31.359  1.00 63.60  ?  242 LEU B CD1   1 
ATOM   5136 C  CD2   . LEU B 1 242 ? -19.010 -8.618  30.226  1.00 66.57  ?  242 LEU B CD2   1 
ATOM   5137 N  N     . GLN B 1 243 ? -21.320 -9.691  34.795  1.00 46.72  ?  243 GLN B N     1 
ATOM   5138 C  CA    . GLN B 1 243 ? -21.263 -10.697 35.902  1.00 58.33  ?  243 GLN B CA    1 
ATOM   5139 C  C     . GLN B 1 243 ? -22.292 -11.811 35.618  1.00 50.19  ?  243 GLN B C     1 
ATOM   5140 O  O     . GLN B 1 243 ? -21.993 -12.966 35.909  1.00 44.95  ?  243 GLN B O     1 
ATOM   5141 C  CB    . GLN B 1 243 ? -21.508 -10.080 37.295  1.00 66.22  ?  243 GLN B CB    1 
ATOM   5142 C  CG    . GLN B 1 243 ? -20.386 -9.165  37.801  1.00 73.96  ?  243 GLN B CG    1 
ATOM   5143 C  CD    . GLN B 1 243 ? -19.006 -9.790  37.712  1.00 81.91  ?  243 GLN B CD    1 
ATOM   5144 O  OE1   . GLN B 1 243 ? -18.707 -10.784 38.378  1.00 71.96  ?  243 GLN B OE1   1 
ATOM   5145 N  NE2   . GLN B 1 243 ? -18.146 -9.233  36.868  1.00 68.18  ?  243 GLN B NE2   1 
ATOM   5146 N  N     . MET B 1 244 ? -23.465 -11.471 35.081  1.00 50.12  ?  244 MET B N     1 
ATOM   5147 C  CA    . MET B 1 244 ? -24.506 -12.444 34.657  1.00 56.51  ?  244 MET B CA    1 
ATOM   5148 C  C     . MET B 1 244 ? -23.937 -13.325 33.527  1.00 54.60  ?  244 MET B C     1 
ATOM   5149 O  O     . MET B 1 244 ? -24.029 -14.568 33.619  1.00 49.22  ?  244 MET B O     1 
ATOM   5150 C  CB    . MET B 1 244 ? -25.767 -11.733 34.155  1.00 60.54  ?  244 MET B CB    1 
ATOM   5151 C  CG    . MET B 1 244 ? -26.882 -12.711 33.783  1.00 71.07  ?  244 MET B CG    1 
ATOM   5152 S  SD    . MET B 1 244 ? -27.813 -12.258 32.299  1.00 75.35  ?  244 MET B SD    1 
ATOM   5153 C  CE    . MET B 1 244 ? -26.537 -12.341 31.048  1.00 62.22  ?  244 MET B CE    1 
ATOM   5154 N  N     . VAL B 1 245 ? -23.346 -12.706 32.500  1.00 47.62  ?  245 VAL B N     1 
ATOM   5155 C  CA    . VAL B 1 245 ? -22.667 -13.442 31.394  1.00 44.77  ?  245 VAL B CA    1 
ATOM   5156 C  C     . VAL B 1 245 ? -21.611 -14.380 32.004  1.00 48.01  ?  245 VAL B C     1 
ATOM   5157 O  O     . VAL B 1 245 ? -21.574 -15.577 31.638  1.00 54.96  ?  245 VAL B O     1 
ATOM   5158 C  CB    . VAL B 1 245 ? -22.076 -12.482 30.352  1.00 38.30  ?  245 VAL B CB    1 
ATOM   5159 C  CG1   . VAL B 1 245 ? -21.152 -13.192 29.375  1.00 38.14  ?  245 VAL B CG1   1 
ATOM   5160 C  CG2   . VAL B 1 245 ? -23.158 -11.749 29.583  1.00 37.83  ?  245 VAL B CG2   1 
ATOM   5161 N  N     . LYS B 1 246 ? -20.787 -13.877 32.913  1.00 44.90  ?  246 LYS B N     1 
ATOM   5162 C  CA    . LYS B 1 246 ? -19.699 -14.679 33.512  1.00 47.03  ?  246 LYS B CA    1 
ATOM   5163 C  C     . LYS B 1 246 ? -20.283 -15.909 34.220  1.00 44.97  ?  246 LYS B C     1 
ATOM   5164 O  O     . LYS B 1 246 ? -19.680 -16.992 34.068  1.00 39.61  ?  246 LYS B O     1 
ATOM   5165 C  CB    . LYS B 1 246 ? -18.846 -13.853 34.477  1.00 52.57  ?  246 LYS B CB    1 
ATOM   5166 C  CG    . LYS B 1 246 ? -17.662 -14.617 35.066  1.00 57.80  ?  246 LYS B CG    1 
ATOM   5167 C  CD    . LYS B 1 246 ? -16.693 -13.749 35.828  1.00 63.23  ?  246 LYS B CD    1 
ATOM   5168 C  CE    . LYS B 1 246 ? -15.834 -14.543 36.788  1.00 64.95  ?  246 LYS B CE    1 
ATOM   5169 N  NZ    . LYS B 1 246 ? -15.107 -13.669 37.728  1.00 63.41  ?  246 LYS B NZ    1 
ATOM   5170 N  N     . LYS B 1 247 ? -21.371 -15.750 34.974  1.00 39.33  ?  247 LYS B N     1 
ATOM   5171 C  CA    . LYS B 1 247 ? -22.041 -16.861 35.712  1.00 48.56  ?  247 LYS B CA    1 
ATOM   5172 C  C     . LYS B 1 247 ? -22.579 -17.928 34.739  1.00 39.20  ?  247 LYS B C     1 
ATOM   5173 O  O     . LYS B 1 247 ? -22.430 -19.128 35.019  1.00 40.60  ?  247 LYS B O     1 
ATOM   5174 C  CB    . LYS B 1 247 ? -23.120 -16.320 36.665  1.00 54.90  ?  247 LYS B CB    1 
ATOM   5175 C  CG    . LYS B 1 247 ? -22.578 -16.054 38.067  1.00 67.08  ?  247 LYS B CG    1 
ATOM   5176 C  CD    . LYS B 1 247 ? -23.194 -14.914 38.867  1.00 77.00  ?  247 LYS B CD    1 
ATOM   5177 C  CE    . LYS B 1 247 ? -22.109 -14.129 39.604  1.00 85.78  ?  247 LYS B CE    1 
ATOM   5178 N  NZ    . LYS B 1 247 ? -22.646 -13.310 40.706  1.00 81.17  ?  247 LYS B NZ    1 
ATOM   5179 N  N     . ASN B 1 248 ? -23.145 -17.509 33.616  1.00 39.63  ?  248 ASN B N     1 
ATOM   5180 C  CA    . ASN B 1 248 ? -23.586 -18.409 32.517  1.00 42.21  ?  248 ASN B CA    1 
ATOM   5181 C  C     . ASN B 1 248 ? -22.381 -19.224 32.009  1.00 40.38  ?  248 ASN B C     1 
ATOM   5182 O  O     . ASN B 1 248 ? -22.507 -20.469 31.963  1.00 35.38  ?  248 ASN B O     1 
ATOM   5183 C  CB    . ASN B 1 248 ? -24.280 -17.635 31.397  1.00 43.42  ?  248 ASN B CB    1 
ATOM   5184 C  CG    . ASN B 1 248 ? -25.638 -17.085 31.788  1.00 45.17  ?  248 ASN B CG    1 
ATOM   5185 O  OD1   . ASN B 1 248 ? -26.288 -17.567 32.723  1.00 49.15  ?  248 ASN B OD1   1 
ATOM   5186 N  ND2   . ASN B 1 248 ? -26.078 -16.069 31.070  1.00 48.90  ?  248 ASN B ND2   1 
ATOM   5187 N  N     . PHE B 1 249 ? -21.248 -18.567 31.720  1.00 35.90  ?  249 PHE B N     1 
ATOM   5188 C  CA    . PHE B 1 249 ? -20.001 -19.239 31.267  1.00 34.46  ?  249 PHE B CA    1 
ATOM   5189 C  C     . PHE B 1 249 ? -19.496 -20.196 32.353  1.00 34.53  ?  249 PHE B C     1 
ATOM   5190 O  O     . PHE B 1 249 ? -19.029 -21.276 32.013  1.00 31.74  ?  249 PHE B O     1 
ATOM   5191 C  CB    . PHE B 1 249 ? -18.932 -18.222 30.871  1.00 35.67  ?  249 PHE B CB    1 
ATOM   5192 C  CG    . PHE B 1 249 ? -19.094 -17.664 29.488  1.00 38.66  ?  249 PHE B CG    1 
ATOM   5193 C  CD1   . PHE B 1 249 ? -20.211 -16.912 29.154  1.00 55.02  ?  249 PHE B CD1   1 
ATOM   5194 C  CD2   . PHE B 1 249 ? -18.161 -17.911 28.499  1.00 47.90  ?  249 PHE B CD2   1 
ATOM   5195 C  CE1   . PHE B 1 249 ? -20.389 -16.404 27.873  1.00 47.46  ?  249 PHE B CE1   1 
ATOM   5196 C  CE2   . PHE B 1 249 ? -18.320 -17.378 27.228  1.00 45.41  ?  249 PHE B CE2   1 
ATOM   5197 C  CZ    . PHE B 1 249 ? -19.436 -16.631 26.918  1.00 46.99  ?  249 PHE B CZ    1 
ATOM   5198 N  N     . GLU B 1 250 ? -19.607 -19.830 33.632  1.00 41.32  ?  250 GLU B N     1 
ATOM   5199 C  CA    . GLU B 1 250 ? -19.148 -20.666 34.772  1.00 41.83  ?  250 GLU B CA    1 
ATOM   5200 C  C     . GLU B 1 250 ? -20.059 -21.892 34.920  1.00 37.88  ?  250 GLU B C     1 
ATOM   5201 O  O     . GLU B 1 250 ? -19.556 -23.015 35.230  1.00 34.95  ?  250 GLU B O     1 
ATOM   5202 C  CB    . GLU B 1 250 ? -19.150 -19.871 36.071  1.00 51.73  ?  250 GLU B CB    1 
ATOM   5203 C  CG    . GLU B 1 250 ? -17.866 -19.094 36.303  1.00 61.27  ?  250 GLU B CG    1 
ATOM   5204 C  CD    . GLU B 1 250 ? -17.938 -18.050 37.411  1.00 69.14  ?  250 GLU B CD    1 
ATOM   5205 O  OE1   . GLU B 1 250 ? -19.081 -17.776 37.977  1.00 65.82  ?  250 GLU B OE1   1 
ATOM   5206 O  OE2   . GLU B 1 250 ? -16.843 -17.502 37.710  1.00 76.15  ?  250 GLU B OE2   1 
ATOM   5207 N  N     . TRP B 1 251 ? -21.351 -21.689 34.711  1.00 33.60  ?  251 TRP B N     1 
ATOM   5208 C  CA    . TRP B 1 251 ? -22.352 -22.782 34.726  1.00 35.82  ?  251 TRP B CA    1 
ATOM   5209 C  C     . TRP B 1 251 ? -21.938 -23.846 33.697  1.00 34.28  ?  251 TRP B C     1 
ATOM   5210 O  O     . TRP B 1 251 ? -21.968 -25.046 34.018  1.00 34.45  ?  251 TRP B O     1 
ATOM   5211 C  CB    . TRP B 1 251 ? -23.736 -22.188 34.448  1.00 41.69  ?  251 TRP B CB    1 
ATOM   5212 C  CG    . TRP B 1 251 ? -24.861 -23.140 34.699  1.00 45.83  ?  251 TRP B CG    1 
ATOM   5213 C  CD1   . TRP B 1 251 ? -25.606 -23.238 35.837  1.00 45.85  ?  251 TRP B CD1   1 
ATOM   5214 C  CD2   . TRP B 1 251 ? -25.379 -24.126 33.788  1.00 42.96  ?  251 TRP B CD2   1 
ATOM   5215 N  NE1   . TRP B 1 251 ? -26.546 -24.220 35.695  1.00 45.48  ?  251 TRP B NE1   1 
ATOM   5216 C  CE2   . TRP B 1 251 ? -26.440 -24.778 34.454  1.00 41.58  ?  251 TRP B CE2   1 
ATOM   5217 C  CE3   . TRP B 1 251 ? -25.046 -24.522 32.489  1.00 39.02  ?  251 TRP B CE3   1 
ATOM   5218 C  CZ2   . TRP B 1 251 ? -27.176 -25.801 33.860  1.00 41.65  ?  251 TRP B CZ2   1 
ATOM   5219 C  CZ3   . TRP B 1 251 ? -25.765 -25.542 31.903  1.00 44.95  ?  251 TRP B CZ3   1 
ATOM   5220 C  CH2   . TRP B 1 251 ? -26.820 -26.167 32.581  1.00 42.25  ?  251 TRP B CH2   1 
ATOM   5221 N  N     . VAL B 1 252 ? -21.543 -23.416 32.497  1.00 31.45  ?  252 VAL B N     1 
ATOM   5222 C  CA    . VAL B 1 252 ? -21.166 -24.349 31.409  1.00 34.38  ?  252 VAL B CA    1 
ATOM   5223 C  C     . VAL B 1 252 ? -19.812 -24.972 31.753  1.00 36.28  ?  252 VAL B C     1 
ATOM   5224 O  O     . VAL B 1 252 ? -19.692 -26.208 31.597  1.00 32.32  ?  252 VAL B O     1 
ATOM   5225 C  CB    . VAL B 1 252 ? -21.152 -23.690 30.031  1.00 30.67  ?  252 VAL B CB    1 
ATOM   5226 C  CG1   . VAL B 1 252 ? -20.777 -24.683 28.970  1.00 28.99  ?  252 VAL B CG1   1 
ATOM   5227 C  CG2   . VAL B 1 252 ? -22.481 -23.064 29.691  1.00 34.27  ?  252 VAL B CG2   1 
ATOM   5228 N  N     . ALA B 1 253 ? -18.846 -24.161 32.193  1.00 35.71  ?  253 ALA B N     1 
ATOM   5229 C  CA    . ALA B 1 253 ? -17.499 -24.627 32.593  1.00 39.50  ?  253 ALA B CA    1 
ATOM   5230 C  C     . ALA B 1 253 ? -17.620 -25.771 33.597  1.00 37.47  ?  253 ALA B C     1 
ATOM   5231 O  O     . ALA B 1 253 ? -16.881 -26.752 33.452  1.00 42.24  ?  253 ALA B O     1 
ATOM   5232 C  CB    . ALA B 1 253 ? -16.680 -23.491 33.146  1.00 43.34  ?  253 ALA B CB    1 
ATOM   5233 N  N     . GLU B 1 254 ? -18.518 -25.665 34.573  1.00 40.77  ?  254 GLU B N     1 
ATOM   5234 C  CA    . GLU B 1 254 ? -18.663 -26.705 35.630  1.00 43.94  ?  254 GLU B CA    1 
ATOM   5235 C  C     . GLU B 1 254 ? -19.159 -28.005 34.984  1.00 42.67  ?  254 GLU B C     1 
ATOM   5236 O  O     . GLU B 1 254 ? -18.549 -29.060 35.184  1.00 48.15  ?  254 GLU B O     1 
ATOM   5237 C  CB    . GLU B 1 254 ? -19.629 -26.249 36.725  1.00 51.15  ?  254 GLU B CB    1 
ATOM   5238 C  CG    . GLU B 1 254 ? -19.642 -27.206 37.900  1.00 64.77  ?  254 GLU B CG    1 
ATOM   5239 C  CD    . GLU B 1 254 ? -20.832 -27.072 38.845  1.00 82.52  ?  254 GLU B CD    1 
ATOM   5240 O  OE1   . GLU B 1 254 ? -21.668 -28.025 38.889  1.00 90.91  ?  254 GLU B OE1   1 
ATOM   5241 O  OE2   . GLU B 1 254 ? -20.899 -26.044 39.579  1.00 72.90  ?  254 GLU B OE2   1 
ATOM   5242 N  N     . ARG B 1 255 ? -20.185 -27.921 34.145  1.00 41.14  ?  255 ARG B N     1 
ATOM   5243 C  CA    . ARG B 1 255 ? -20.926 -29.119 33.682  1.00 39.30  ?  255 ARG B CA    1 
ATOM   5244 C  C     . ARG B 1 255 ? -20.281 -29.790 32.479  1.00 39.32  ?  255 ARG B C     1 
ATOM   5245 O  O     . ARG B 1 255 ? -20.592 -30.956 32.278  1.00 37.98  ?  255 ARG B O     1 
ATOM   5246 C  CB    . ARG B 1 255 ? -22.362 -28.764 33.349  1.00 42.00  ?  255 ARG B CB    1 
ATOM   5247 C  CG    . ARG B 1 255 ? -23.263 -28.821 34.574  1.00 53.55  ?  255 ARG B CG    1 
ATOM   5248 C  CD    . ARG B 1 255 ? -24.325 -27.745 34.512  1.00 54.32  ?  255 ARG B CD    1 
ATOM   5249 N  NE    . ARG B 1 255 ? -25.051 -27.684 35.768  1.00 52.03  ?  255 ARG B NE    1 
ATOM   5250 C  CZ    . ARG B 1 255 ? -24.835 -26.786 36.737  1.00 57.00  ?  255 ARG B CZ    1 
ATOM   5251 N  NH1   . ARG B 1 255 ? -23.929 -25.820 36.628  1.00 59.56  ?  255 ARG B NH1   1 
ATOM   5252 N  NH2   . ARG B 1 255 ? -25.546 -26.864 37.840  1.00 57.54  ?  255 ARG B NH2   1 
ATOM   5253 N  N     . VAL B 1 256 ? -19.390 -29.119 31.740  1.00 35.32  ?  256 VAL B N     1 
ATOM   5254 C  CA    . VAL B 1 256 ? -18.844 -29.662 30.475  1.00 33.16  ?  256 VAL B CA    1 
ATOM   5255 C  C     . VAL B 1 256 ? -18.030 -30.924 30.776  1.00 35.39  ?  256 VAL B C     1 
ATOM   5256 O  O     . VAL B 1 256 ? -18.010 -31.785 29.908  1.00 34.22  ?  256 VAL B O     1 
ATOM   5257 C  CB    . VAL B 1 256 ? -18.048 -28.621 29.672  1.00 36.87  ?  256 VAL B CB    1 
ATOM   5258 C  CG1   . VAL B 1 256 ? -16.722 -28.259 30.309  1.00 38.32  ?  256 VAL B CG1   1 
ATOM   5259 C  CG2   . VAL B 1 256 ? -17.837 -29.096 28.244  1.00 36.56  ?  256 VAL B CG2   1 
ATOM   5260 N  N     . GLU B 1 257 ? -17.397 -31.032 31.944  1.00 37.79  ?  257 GLU B N     1 
ATOM   5261 C  CA    . GLU B 1 257 ? -16.548 -32.187 32.340  1.00 40.27  ?  257 GLU B CA    1 
ATOM   5262 C  C     . GLU B 1 257 ? -17.426 -33.434 32.529  1.00 37.51  ?  257 GLU B C     1 
ATOM   5263 O  O     . GLU B 1 257 ? -16.921 -34.558 32.347  1.00 40.79  ?  257 GLU B O     1 
ATOM   5264 C  CB    . GLU B 1 257 ? -15.800 -31.883 33.633  1.00 45.78  ?  257 GLU B CB    1 
ATOM   5265 C  CG    . GLU B 1 257 ? -14.492 -32.627 33.776  1.00 64.51  ?  257 GLU B CG    1 
ATOM   5266 C  CD    . GLU B 1 257 ? -13.486 -32.032 34.769  1.00 83.50  ?  257 GLU B CD    1 
ATOM   5267 O  OE1   . GLU B 1 257 ? -13.810 -30.986 35.434  1.00 63.92  ?  257 GLU B OE1   1 
ATOM   5268 O  OE2   . GLU B 1 257 ? -12.353 -32.606 34.873  1.00 88.28  ?  257 GLU B OE2   1 
ATOM   5269 N  N     . LEU B 1 258 ? -18.698 -33.258 32.875  1.00 31.40  ?  258 LEU B N     1 
ATOM   5270 C  CA    . LEU B 1 258 ? -19.609 -34.418 33.064  1.00 36.78  ?  258 LEU B CA    1 
ATOM   5271 C  C     . LEU B 1 258 ? -19.918 -35.098 31.721  1.00 36.19  ?  258 LEU B C     1 
ATOM   5272 O  O     . LEU B 1 258 ? -20.377 -36.235 31.746  1.00 37.05  ?  258 LEU B O     1 
ATOM   5273 C  CB    . LEU B 1 258 ? -20.903 -33.962 33.747  1.00 36.85  ?  258 LEU B CB    1 
ATOM   5274 C  CG    . LEU B 1 258 ? -20.758 -33.217 35.087  1.00 42.01  ?  258 LEU B CG    1 
ATOM   5275 C  CD1   . LEU B 1 258 ? -22.134 -32.813 35.626  1.00 40.36  ?  258 LEU B CD1   1 
ATOM   5276 C  CD2   . LEU B 1 258 ? -20.009 -34.023 36.140  1.00 35.70  ?  258 LEU B CD2   1 
ATOM   5277 N  N     . LEU B 1 259 ? -19.683 -34.430 30.583  1.00 33.01  ?  259 LEU B N     1 
ATOM   5278 C  CA    . LEU B 1 259 ? -19.901 -35.021 29.240  1.00 30.88  ?  259 LEU B CA    1 
ATOM   5279 C  C     . LEU B 1 259 ? -18.912 -36.157 29.004  1.00 30.25  ?  259 LEU B C     1 
ATOM   5280 O  O     . LEU B 1 259 ? -19.199 -37.005 28.140  1.00 37.78  ?  259 LEU B O     1 
ATOM   5281 C  CB    . LEU B 1 259 ? -19.794 -33.961 28.143  1.00 31.30  ?  259 LEU B CB    1 
ATOM   5282 C  CG    . LEU B 1 259 ? -21.100 -33.241 27.788  1.00 34.45  ?  259 LEU B CG    1 
ATOM   5283 C  CD1   . LEU B 1 259 ? -21.765 -32.604 29.025  1.00 36.68  ?  259 LEU B CD1   1 
ATOM   5284 C  CD2   . LEU B 1 259 ? -20.837 -32.175 26.737  1.00 39.41  ?  259 LEU B CD2   1 
ATOM   5285 N  N     . LEU B 1 260 ? -17.835 -36.224 29.774  1.00 33.41  ?  260 LEU B N     1 
ATOM   5286 C  CA    . LEU B 1 260 ? -16.816 -37.281 29.587  1.00 37.31  ?  260 LEU B CA    1 
ATOM   5287 C  C     . LEU B 1 260 ? -17.136 -38.474 30.476  1.00 39.80  ?  260 LEU B C     1 
ATOM   5288 O  O     . LEU B 1 260 ? -16.426 -39.482 30.375  1.00 36.49  ?  260 LEU B O     1 
ATOM   5289 C  CB    . LEU B 1 260 ? -15.437 -36.703 29.903  1.00 34.71  ?  260 LEU B CB    1 
ATOM   5290 C  CG    . LEU B 1 260 ? -14.992 -35.567 28.977  1.00 38.31  ?  260 LEU B CG    1 
ATOM   5291 C  CD1   . LEU B 1 260 ? -13.901 -34.743 29.630  1.00 44.80  ?  260 LEU B CD1   1 
ATOM   5292 C  CD2   . LEU B 1 260 ? -14.527 -36.095 27.639  1.00 35.01  ?  260 LEU B CD2   1 
ATOM   5293 N  N     . LYS B 1 261 ? -18.179 -38.366 31.296  1.00 39.81  ?  261 LYS B N     1 
ATOM   5294 C  CA    . LYS B 1 261 ? -18.475 -39.430 32.277  1.00 47.86  ?  261 LYS B CA    1 
ATOM   5295 C  C     . LYS B 1 261 ? -19.639 -40.303 31.792  1.00 38.56  ?  261 LYS B C     1 
ATOM   5296 O  O     . LYS B 1 261 ? -20.636 -39.788 31.324  1.00 29.15  ?  261 LYS B O     1 
ATOM   5297 C  CB    . LYS B 1 261 ? -18.716 -38.784 33.635  1.00 65.51  ?  261 LYS B CB    1 
ATOM   5298 C  CG    . LYS B 1 261 ? -19.222 -39.727 34.723  1.00 89.03  ?  261 LYS B CG    1 
ATOM   5299 C  CD    . LYS B 1 261 ? -20.114 -39.049 35.737  1.00 95.46  ?  261 LYS B CD    1 
ATOM   5300 C  CE    . LYS B 1 261 ? -19.333 -38.217 36.737  1.00 93.33  ?  261 LYS B CE    1 
ATOM   5301 N  NZ    . LYS B 1 261 ? -19.992 -38.211 38.061  1.00 92.48  ?  261 LYS B NZ    1 
ATOM   5302 N  N     . SER B 1 262 ? -19.467 -41.606 31.915  1.00 42.27  ?  262 SER B N     1 
ATOM   5303 C  CA    . SER B 1 262 ? -20.500 -42.613 31.568  1.00 53.60  ?  262 SER B CA    1 
ATOM   5304 C  C     . SER B 1 262 ? -21.549 -42.641 32.680  1.00 50.81  ?  262 SER B C     1 
ATOM   5305 O  O     . SER B 1 262 ? -21.230 -42.864 33.826  1.00 44.66  ?  262 SER B O     1 
ATOM   5306 C  CB    . SER B 1 262 ? -19.913 -43.993 31.314  1.00 59.01  ?  262 SER B CB    1 
ATOM   5307 O  OG    . SER B 1 262 ? -18.487 -43.974 31.408  1.00 58.27  ?  262 SER B OG    1 
ATOM   5308 N  N     . GLU B 1 263 ? -22.779 -42.402 32.307  1.00 58.82  ?  263 GLU B N     1 
ATOM   5309 C  CA    . GLU B 1 263 ? -23.931 -42.337 33.234  1.00 64.43  ?  263 GLU B CA    1 
ATOM   5310 C  C     . GLU B 1 263 ? -24.359 -43.782 33.606  1.00 62.17  ?  263 GLU B C     1 
ATOM   5311 O  O     . GLU B 1 263 ? -24.854 -43.979 34.733  1.00 68.65  ?  263 GLU B O     1 
ATOM   5312 C  CB    . GLU B 1 263 ? -25.005 -41.405 32.618  1.00 66.67  ?  263 GLU B CB    1 
ATOM   5313 C  CG    . GLU B 1 263 ? -25.650 -41.856 31.290  1.00 70.49  ?  263 GLU B CG    1 
ATOM   5314 C  CD    . GLU B 1 263 ? -24.773 -41.852 30.026  1.00 78.58  ?  263 GLU B CD    1 
ATOM   5315 O  OE1   . GLU B 1 263 ? -25.269 -41.354 28.983  1.00 50.24  ?  263 GLU B OE1   1 
ATOM   5316 O  OE2   . GLU B 1 263 ? -23.593 -42.408 30.072  1.00 67.69  ?  263 GLU B OE2   1 
ATOM   5317 N  N     . SER B 1 264 ? -24.131 -44.762 32.729  1.00 48.91  ?  264 SER B N     1 
ATOM   5318 C  CA    . SER B 1 264 ? -24.625 -46.155 32.864  1.00 47.79  ?  264 SER B CA    1 
ATOM   5319 C  C     . SER B 1 264 ? -23.516 -47.172 32.568  1.00 38.94  ?  264 SER B C     1 
ATOM   5320 O  O     . SER B 1 264 ? -22.740 -46.961 31.671  1.00 38.09  ?  264 SER B O     1 
ATOM   5321 C  CB    . SER B 1 264 ? -25.832 -46.382 31.955  1.00 53.05  ?  264 SER B CB    1 
ATOM   5322 O  OG    . SER B 1 264 ? -25.437 -46.741 30.639  1.00 56.42  ?  264 SER B OG    1 
ATOM   5323 N  N     . GLN B 1 265 ? -23.502 -48.282 33.292  1.00 40.45  ?  265 GLN B N     1 
ATOM   5324 C  CA    . GLN B 1 265 ? -22.524 -49.367 33.113  1.00 42.22  ?  265 GLN B CA    1 
ATOM   5325 C  C     . GLN B 1 265 ? -23.020 -50.365 32.048  1.00 36.69  ?  265 GLN B C     1 
ATOM   5326 O  O     . GLN B 1 265 ? -24.216 -50.569 31.869  1.00 37.40  ?  265 GLN B O     1 
ATOM   5327 C  CB    . GLN B 1 265 ? -22.247 -50.048 34.449  1.00 47.03  ?  265 GLN B CB    1 
ATOM   5328 C  CG    . GLN B 1 265 ? -21.555 -49.155 35.464  1.00 51.21  ?  265 GLN B CG    1 
ATOM   5329 C  CD    . GLN B 1 265 ? -21.390 -49.892 36.779  1.00 54.92  ?  265 GLN B CD    1 
ATOM   5330 O  OE1   . GLN B 1 265 ? -22.301 -49.934 37.616  1.00 48.46  ?  265 GLN B OE1   1 
ATOM   5331 N  NE2   . GLN B 1 265 ? -20.226 -50.504 36.948  1.00 46.49  ?  265 GLN B NE2   1 
ATOM   5332 N  N     . CYS B 1 266 ? -22.059 -50.960 31.360  1.00 33.87  ?  266 CYS B N     1 
ATOM   5333 C  CA    . CYS B 1 266 ? -22.233 -51.866 30.226  1.00 33.07  ?  266 CYS B CA    1 
ATOM   5334 C  C     . CYS B 1 266 ? -21.327 -53.057 30.468  1.00 33.97  ?  266 CYS B C     1 
ATOM   5335 O  O     . CYS B 1 266 ? -20.199 -52.837 30.952  1.00 30.71  ?  266 CYS B O     1 
ATOM   5336 C  CB    . CYS B 1 266 ? -21.782 -51.232 28.922  1.00 33.09  ?  266 CYS B CB    1 
ATOM   5337 S  SG    . CYS B 1 266 ? -22.582 -49.654 28.633  1.00 51.14  ?  266 CYS B SG    1 
ATOM   5338 N  N     . ARG B 1 267 ? -21.801 -54.233 30.076  1.00 31.70  ?  267 ARG B N     1 
ATOM   5339 C  CA    . ARG B 1 267 ? -21.003 -55.460 30.084  1.00 32.05  ?  267 ARG B CA    1 
ATOM   5340 C  C     . ARG B 1 267 ? -21.535 -56.432 29.035  1.00 29.17  ?  267 ARG B C     1 
ATOM   5341 O  O     . ARG B 1 267 ? -22.748 -56.585 28.940  1.00 25.60  ?  267 ARG B O     1 
ATOM   5342 C  CB    . ARG B 1 267 ? -21.079 -56.026 31.493  1.00 31.68  ?  267 ARG B CB    1 
ATOM   5343 C  CG    . ARG B 1 267 ? -20.315 -57.326 31.678  1.00 32.58  ?  267 ARG B CG    1 
ATOM   5344 C  CD    . ARG B 1 267 ? -20.201 -57.631 33.162  1.00 32.85  ?  267 ARG B CD    1 
ATOM   5345 N  NE    . ARG B 1 267 ? -21.526 -57.943 33.661  1.00 31.61  ?  267 ARG B NE    1 
ATOM   5346 C  CZ    . ARG B 1 267 ? -21.836 -58.138 34.917  1.00 30.66  ?  267 ARG B CZ    1 
ATOM   5347 N  NH1   . ARG B 1 267 ? -20.885 -58.052 35.827  1.00 28.59  ?  267 ARG B NH1   1 
ATOM   5348 N  NH2   . ARG B 1 267 ? -23.100 -58.413 35.252  1.00 34.43  ?  267 ARG B NH2   1 
ATOM   5349 N  N     . VAL B 1 268 ? -20.627 -57.061 28.288  1.00 30.26  ?  268 VAL B N     1 
ATOM   5350 C  CA    . VAL B 1 268 ? -20.921 -58.241 27.439  1.00 29.81  ?  268 VAL B CA    1 
ATOM   5351 C  C     . VAL B 1 268 ? -20.314 -59.464 28.127  1.00 29.64  ?  268 VAL B C     1 
ATOM   5352 O  O     . VAL B 1 268 ? -19.175 -59.357 28.589  1.00 29.33  ?  268 VAL B O     1 
ATOM   5353 C  CB    . VAL B 1 268 ? -20.386 -58.060 26.009  1.00 29.50  ?  268 VAL B CB    1 
ATOM   5354 C  CG1   . VAL B 1 268 ? -20.599 -59.299 25.186  1.00 27.33  ?  268 VAL B CG1   1 
ATOM   5355 C  CG2   . VAL B 1 268 ? -21.025 -56.863 25.335  1.00 29.07  ?  268 VAL B CG2   1 
ATOM   5356 N  N     . VAL B 1 269 ? -21.100 -60.539 28.241  1.00 25.11  ?  269 VAL B N     1 
ATOM   5357 C  CA    . VAL B 1 269 ? -20.640 -61.872 28.664  1.00 25.66  ?  269 VAL B CA    1 
ATOM   5358 C  C     . VAL B 1 269 ? -20.759 -62.810 27.477  1.00 27.62  ?  269 VAL B C     1 
ATOM   5359 O  O     . VAL B 1 269 ? -21.881 -62.996 26.988  1.00 25.29  ?  269 VAL B O     1 
ATOM   5360 C  CB    . VAL B 1 269 ? -21.448 -62.397 29.853  1.00 27.77  ?  269 VAL B CB    1 
ATOM   5361 C  CG1   . VAL B 1 269 ? -20.993 -63.795 30.237  1.00 29.43  ?  269 VAL B CG1   1 
ATOM   5362 C  CG2   . VAL B 1 269 ? -21.317 -61.486 31.058  1.00 30.66  ?  269 VAL B CG2   1 
ATOM   5363 N  N     . VAL B 1 270 ? -19.631 -63.332 27.017  1.00 30.53  ?  270 VAL B N     1 
ATOM   5364 C  CA    . VAL B 1 270 ? -19.567 -64.298 25.886  1.00 32.51  ?  270 VAL B CA    1 
ATOM   5365 C  C     . VAL B 1 270 ? -19.482 -65.695 26.469  1.00 33.91  ?  270 VAL B C     1 
ATOM   5366 O  O     . VAL B 1 270 ? -18.488 -65.970 27.126  1.00 39.93  ?  270 VAL B O     1 
ATOM   5367 C  CB    . VAL B 1 270 ? -18.381 -64.019 24.969  1.00 33.04  ?  270 VAL B CB    1 
ATOM   5368 C  CG1   . VAL B 1 270 ? -18.381 -64.993 23.794  1.00 36.19  ?  270 VAL B CG1   1 
ATOM   5369 C  CG2   . VAL B 1 270 ? -18.424 -62.576 24.490  1.00 34.65  ?  270 VAL B CG2   1 
ATOM   5370 N  N     . LEU B 1 271 ? -20.511 -66.498 26.287  1.00 31.49  ?  271 LEU B N     1 
ATOM   5371 C  CA    . LEU B 1 271 ? -20.553 -67.873 26.793  1.00 29.80  ?  271 LEU B CA    1 
ATOM   5372 C  C     . LEU B 1 271 ? -20.235 -68.788 25.617  1.00 31.89  ?  271 LEU B C     1 
ATOM   5373 O  O     . LEU B 1 271 ? -20.989 -68.704 24.631  1.00 27.89  ?  271 LEU B O     1 
ATOM   5374 C  CB    . LEU B 1 271 ? -21.962 -68.152 27.323  1.00 33.83  ?  271 LEU B CB    1 
ATOM   5375 C  CG    . LEU B 1 271 ? -22.496 -67.193 28.381  1.00 35.90  ?  271 LEU B CG    1 
ATOM   5376 C  CD1   . LEU B 1 271 ? -23.984 -67.452 28.635  1.00 41.40  ?  271 LEU B CD1   1 
ATOM   5377 C  CD2   . LEU B 1 271 ? -21.734 -67.375 29.664  1.00 36.97  ?  271 LEU B CD2   1 
ATOM   5378 N  N     . MET B 1 272 ? -19.198 -69.634 25.752  1.00 31.45  ?  272 MET B N     1 
ATOM   5379 C  CA    . MET B 1 272 ? -18.756 -70.602 24.728  1.00 33.42  ?  272 MET B CA    1 
ATOM   5380 C  C     . MET B 1 272 ? -18.922 -72.026 25.253  1.00 35.33  ?  272 MET B C     1 
ATOM   5381 O  O     . MET B 1 272 ? -18.526 -72.315 26.414  1.00 36.63  ?  272 MET B O     1 
ATOM   5382 C  CB    . MET B 1 272 ? -17.317 -70.365 24.282  1.00 33.79  ?  272 MET B CB    1 
ATOM   5383 C  CG    . MET B 1 272 ? -16.247 -70.926 25.195  1.00 40.28  ?  272 MET B CG    1 
ATOM   5384 S  SD    . MET B 1 272 ? -14.573 -70.299 24.759  1.00 46.27  ?  272 MET B SD    1 
ATOM   5385 C  CE    . MET B 1 272 ? -14.687 -68.604 25.345  1.00 49.74  ?  272 MET B CE    1 
ATOM   5386 N  N     . GLY B 1 273 ? -19.544 -72.873 24.430  1.00 40.79  ?  273 GLY B N     1 
ATOM   5387 C  CA    . GLY B 1 273 ? -19.759 -74.312 24.697  1.00 41.82  ?  273 GLY B CA    1 
ATOM   5388 C  C     . GLY B 1 273 ? -18.464 -75.134 24.673  1.00 37.15  ?  273 GLY B C     1 
ATOM   5389 O  O     . GLY B 1 273 ? -18.486 -76.213 25.242  1.00 35.67  ?  273 GLY B O     1 
ATOM   5390 N  N     . SER B 1 274 ? -17.376 -74.624 24.095  1.00 35.99  ?  274 SER B N     1 
ATOM   5391 C  CA    . SER B 1 274 ? -16.094 -75.341 23.878  1.00 39.11  ?  274 SER B CA    1 
ATOM   5392 C  C     . SER B 1 274 ? -14.942 -74.345 23.759  1.00 37.47  ?  274 SER B C     1 
ATOM   5393 O  O     . SER B 1 274 ? -15.127 -73.310 23.116  1.00 39.71  ?  274 SER B O     1 
ATOM   5394 C  CB    . SER B 1 274 ? -16.193 -76.237 22.625  1.00 43.87  ?  274 SER B CB    1 
ATOM   5395 O  OG    . SER B 1 274 ? -15.040 -77.082 22.506  1.00 42.24  ?  274 SER B OG    1 
ATOM   5396 N  N     . THR B 1 275 ? -13.785 -74.649 24.336  1.00 37.87  ?  275 THR B N     1 
ATOM   5397 C  CA    . THR B 1 275 ? -12.579 -73.790 24.277  1.00 36.99  ?  275 THR B CA    1 
ATOM   5398 C  C     . THR B 1 275 ? -11.944 -73.859 22.875  1.00 42.67  ?  275 THR B C     1 
ATOM   5399 O  O     . THR B 1 275 ? -11.023 -73.059 22.611  1.00 45.57  ?  275 THR B O     1 
ATOM   5400 C  CB    . THR B 1 275 ? -11.539 -74.205 25.315  1.00 40.03  ?  275 THR B CB    1 
ATOM   5401 O  OG1   . THR B 1 275 ? -11.268 -75.594 25.137  1.00 36.34  ?  275 THR B OG1   1 
ATOM   5402 C  CG2   . THR B 1 275 ? -11.982 -73.918 26.742  1.00 49.07  ?  275 THR B CG2   1 
ATOM   5403 N  N     . SER B 1 276 ? -12.413 -74.741 21.989  1.00 36.71  ?  276 SER B N     1 
ATOM   5404 C  CA    . SER B 1 276 ? -11.982 -74.739 20.564  1.00 50.72  ?  276 SER B CA    1 
ATOM   5405 C  C     . SER B 1 276 ? -12.564 -73.528 19.801  1.00 51.63  ?  276 SER B C     1 
ATOM   5406 O  O     . SER B 1 276 ? -12.024 -73.189 18.735  1.00 52.02  ?  276 SER B O     1 
ATOM   5407 C  CB    . SER B 1 276 ? -12.336 -76.044 19.897  1.00 51.93  ?  276 SER B CB    1 
ATOM   5408 O  OG    . SER B 1 276 ? -13.732 -76.156 19.732  1.00 54.63  ?  276 SER B OG    1 
ATOM   5409 N  N     . ASP B 1 277 ? -13.611 -72.877 20.338  1.00 51.54  ?  277 ASP B N     1 
ATOM   5410 C  CA    . ASP B 1 277 ? -14.278 -71.695 19.735  1.00 44.10  ?  277 ASP B CA    1 
ATOM   5411 C  C     . ASP B 1 277 ? -13.704 -70.420 20.375  1.00 42.92  ?  277 ASP B C     1 
ATOM   5412 O  O     . ASP B 1 277 ? -14.247 -69.314 20.128  1.00 37.21  ?  277 ASP B O     1 
ATOM   5413 C  CB    . ASP B 1 277 ? -15.797 -71.846 19.830  1.00 46.40  ?  277 ASP B CB    1 
ATOM   5414 C  CG    . ASP B 1 277 ? -16.364 -73.002 18.997  1.00 49.35  ?  277 ASP B CG    1 
ATOM   5415 O  OD1   . ASP B 1 277 ? -15.942 -73.158 17.813  1.00 59.03  ?  277 ASP B OD1   1 
ATOM   5416 O  OD2   . ASP B 1 277 ? -17.211 -73.754 19.522  1.00 47.48  ?  277 ASP B OD2   1 
ATOM   5417 N  N     . LEU B 1 278 ? -12.600 -70.545 21.107  1.00 37.10  ?  278 LEU B N     1 
ATOM   5418 C  CA    . LEU B 1 278 ? -11.911 -69.406 21.780  1.00 42.40  ?  278 LEU B CA    1 
ATOM   5419 C  C     . LEU B 1 278 ? -11.530 -68.309 20.774  1.00 39.43  ?  278 LEU B C     1 
ATOM   5420 O  O     . LEU B 1 278 ? -11.774 -67.138 21.065  1.00 39.70  ?  278 LEU B O     1 
ATOM   5421 C  CB    . LEU B 1 278 ? -10.681 -69.938 22.524  1.00 38.49  ?  278 LEU B CB    1 
ATOM   5422 C  CG    . LEU B 1 278 ? -9.838  -68.883 23.227  1.00 43.89  ?  278 LEU B CG    1 
ATOM   5423 C  CD1   . LEU B 1 278 ? -10.673 -68.124 24.246  1.00 45.13  ?  278 LEU B CD1   1 
ATOM   5424 C  CD2   . LEU B 1 278 ? -8.605  -69.503 23.906  1.00 41.27  ?  278 LEU B CD2   1 
ATOM   5425 N  N     . GLY B 1 279 ? -10.905 -68.670 19.656  1.00 40.22  ?  279 GLY B N     1 
ATOM   5426 C  CA    . GLY B 1 279 ? -10.530 -67.714 18.603  1.00 38.65  ?  279 GLY B CA    1 
ATOM   5427 C  C     . GLY B 1 279 ? -11.707 -66.824 18.240  1.00 40.19  ?  279 GLY B C     1 
ATOM   5428 O  O     . GLY B 1 279 ? -11.542 -65.598 18.145  1.00 39.76  ?  279 GLY B O     1 
ATOM   5429 N  N     . HIS B 1 280 ? -12.876 -67.418 18.021  1.00 39.54  ?  280 HIS B N     1 
ATOM   5430 C  CA    . HIS B 1 280 ? -14.099 -66.690 17.591  1.00 38.10  ?  280 HIS B CA    1 
ATOM   5431 C  C     . HIS B 1 280 ? -14.494 -65.722 18.717  1.00 36.31  ?  280 HIS B C     1 
ATOM   5432 O  O     . HIS B 1 280 ? -14.821 -64.583 18.412  1.00 35.70  ?  280 HIS B O     1 
ATOM   5433 C  CB    . HIS B 1 280 ? -15.159 -67.726 17.176  1.00 40.58  ?  280 HIS B CB    1 
ATOM   5434 C  CG    . HIS B 1 280 ? -16.473 -67.165 16.760  1.00 40.91  ?  280 HIS B CG    1 
ATOM   5435 N  ND1   . HIS B 1 280 ? -16.816 -66.989 15.435  1.00 44.36  ?  280 HIS B ND1   1 
ATOM   5436 C  CD2   . HIS B 1 280 ? -17.557 -66.826 17.488  1.00 44.28  ?  280 HIS B CD2   1 
ATOM   5437 C  CE1   . HIS B 1 280 ? -18.046 -66.520 15.354  1.00 50.98  ?  280 HIS B CE1   1 
ATOM   5438 N  NE2   . HIS B 1 280 ? -18.530 -66.410 16.612  1.00 51.68  ?  280 HIS B NE2   1 
ATOM   5439 N  N     . CYS B 1 281 ? -14.419 -66.151 19.972  1.00 31.10  ?  281 CYS B N     1 
ATOM   5440 C  CA    . CYS B 1 281 ? -14.785 -65.323 21.153  1.00 37.56  ?  281 CYS B CA    1 
ATOM   5441 C  C     . CYS B 1 281 ? -13.768 -64.191 21.368  1.00 39.37  ?  281 CYS B C     1 
ATOM   5442 O  O     . CYS B 1 281 ? -14.173 -63.123 21.815  1.00 40.65  ?  281 CYS B O     1 
ATOM   5443 C  CB    . CYS B 1 281 ? -14.929 -66.182 22.403  1.00 34.24  ?  281 CYS B CB    1 
ATOM   5444 S  SG    . CYS B 1 281 ? -16.216 -67.455 22.206  1.00 42.06  ?  281 CYS B SG    1 
ATOM   5445 N  N     . GLU B 1 282 ? -12.489 -64.416 21.092  1.00 39.46  ?  282 GLU B N     1 
ATOM   5446 C  CA    . GLU B 1 282 ? -11.435 -63.358 21.156  1.00 46.29  ?  282 GLU B CA    1 
ATOM   5447 C  C     . GLU B 1 282 ? -11.820 -62.177 20.238  1.00 38.91  ?  282 GLU B C     1 
ATOM   5448 O  O     . GLU B 1 282 ? -11.608 -61.044 20.633  1.00 40.70  ?  282 GLU B O     1 
ATOM   5449 C  CB    . GLU B 1 282 ? -10.065 -63.897 20.717  1.00 57.43  ?  282 GLU B CB    1 
ATOM   5450 C  CG    . GLU B 1 282 ? -9.474  -64.987 21.600  1.00 70.36  ?  282 GLU B CG    1 
ATOM   5451 C  CD    . GLU B 1 282 ? -8.864  -64.512 22.905  1.00 82.12  ?  282 GLU B CD    1 
ATOM   5452 O  OE1   . GLU B 1 282 ? -9.164  -63.370 23.325  1.00 80.28  ?  282 GLU B OE1   1 
ATOM   5453 O  OE2   . GLU B 1 282 ? -8.086  -65.298 23.506  1.00 84.68  ?  282 GLU B OE2   1 
ATOM   5454 N  N     . LYS B 1 283 ? -12.362 -62.446 19.049  1.00 36.90  ?  283 LYS B N     1 
ATOM   5455 C  CA    . LYS B 1 283 ? -12.788 -61.428 18.060  1.00 42.40  ?  283 LYS B CA    1 
ATOM   5456 C  C     . LYS B 1 283 ? -13.955 -60.592 18.601  1.00 39.77  ?  283 LYS B C     1 
ATOM   5457 O  O     . LYS B 1 283 ? -13.956 -59.379 18.397  1.00 40.92  ?  283 LYS B O     1 
ATOM   5458 C  CB    . LYS B 1 283 ? -13.165 -62.092 16.731  1.00 48.78  ?  283 LYS B CB    1 
ATOM   5459 C  CG    . LYS B 1 283 ? -11.984 -62.692 15.972  1.00 53.65  ?  283 LYS B CG    1 
ATOM   5460 C  CD    . LYS B 1 283 ? -12.288 -63.344 14.641  1.00 55.37  ?  283 LYS B CD    1 
ATOM   5461 C  CE    . LYS B 1 283 ? -11.100 -64.190 14.227  1.00 66.35  ?  283 LYS B CE    1 
ATOM   5462 N  NZ    . LYS B 1 283 ? -11.256 -64.774 12.881  1.00 74.85  ?  283 LYS B NZ    1 
ATOM   5463 N  N     . ILE B 1 284 ? -14.914 -61.221 19.284  1.00 35.16  ?  284 ILE B N     1 
ATOM   5464 C  CA    . ILE B 1 284 ? -16.031 -60.516 19.946  1.00 35.94  ?  284 ILE B CA    1 
ATOM   5465 C  C     . ILE B 1 284 ? -15.451 -59.595 21.026  1.00 33.49  ?  284 ILE B C     1 
ATOM   5466 O  O     . ILE B 1 284 ? -15.843 -58.417 21.075  1.00 34.04  ?  284 ILE B O     1 
ATOM   5467 C  CB    . ILE B 1 284 ? -17.066 -61.503 20.497  1.00 34.76  ?  284 ILE B CB    1 
ATOM   5468 C  CG1   . ILE B 1 284 ? -17.610 -62.384 19.368  1.00 36.99  ?  284 ILE B CG1   1 
ATOM   5469 C  CG2   . ILE B 1 284 ? -18.197 -60.751 21.228  1.00 35.24  ?  284 ILE B CG2   1 
ATOM   5470 C  CD1   . ILE B 1 284 ? -18.531 -63.492 19.829  1.00 37.56  ?  284 ILE B CD1   1 
ATOM   5471 N  N     . LYS B 1 285 ? -14.560 -60.110 21.856  1.00 32.88  ?  285 LYS B N     1 
ATOM   5472 C  CA    . LYS B 1 285 ? -13.983 -59.353 22.991  1.00 38.04  ?  285 LYS B CA    1 
ATOM   5473 C  C     . LYS B 1 285 ? -13.165 -58.162 22.465  1.00 36.97  ?  285 LYS B C     1 
ATOM   5474 O  O     . LYS B 1 285 ? -13.270 -57.055 23.029  1.00 36.35  ?  285 LYS B O     1 
ATOM   5475 C  CB    . LYS B 1 285 ? -13.110 -60.271 23.845  1.00 37.34  ?  285 LYS B CB    1 
ATOM   5476 C  CG    . LYS B 1 285 ? -12.487 -59.573 25.039  1.00 37.24  ?  285 LYS B CG    1 
ATOM   5477 C  CD    . LYS B 1 285 ? -11.740 -60.536 25.909  1.00 41.51  ?  285 LYS B CD    1 
ATOM   5478 C  CE    . LYS B 1 285 ? -11.014 -59.857 27.039  1.00 47.17  ?  285 LYS B CE    1 
ATOM   5479 N  NZ    . LYS B 1 285 ? -10.757 -60.873 28.086  1.00 60.56  ?  285 LYS B NZ    1 
ATOM   5480 N  N     . LYS B 1 286 ? -12.362 -58.375 21.430  1.00 36.60  ?  286 LYS B N     1 
ATOM   5481 C  CA    . LYS B 1 286 ? -11.534 -57.309 20.846  1.00 39.30  ?  286 LYS B CA    1 
ATOM   5482 C  C     . LYS B 1 286 ? -12.450 -56.188 20.374  1.00 38.67  ?  286 LYS B C     1 
ATOM   5483 O  O     . LYS B 1 286 ? -12.191 -55.000 20.767  1.00 35.95  ?  286 LYS B O     1 
ATOM   5484 C  CB    . LYS B 1 286 ? -10.705 -57.812 19.667  1.00 46.88  ?  286 LYS B CB    1 
ATOM   5485 C  CG    . LYS B 1 286 ? -9.722  -56.777 19.140  1.00 49.54  ?  286 LYS B CG    1 
ATOM   5486 C  CD    . LYS B 1 286 ? -8.680  -57.351 18.238  1.00 61.15  ?  286 LYS B CD    1 
ATOM   5487 C  CE    . LYS B 1 286 ? -8.119  -56.340 17.264  1.00 66.85  ?  286 LYS B CE    1 
ATOM   5488 N  NZ    . LYS B 1 286 ? -7.669  -57.025 16.028  1.00 71.34  ?  286 LYS B NZ    1 
ATOM   5489 N  N     . ALA B 1 287 ? -13.473 -56.555 19.593  1.00 32.51  ?  287 ALA B N     1 
ATOM   5490 C  CA    . ALA B 1 287 ? -14.444 -55.621 18.990  1.00 35.12  ?  287 ALA B CA    1 
ATOM   5491 C  C     . ALA B 1 287 ? -15.228 -54.868 20.065  1.00 36.67  ?  287 ALA B C     1 
ATOM   5492 O  O     . ALA B 1 287 ? -15.567 -53.708 19.812  1.00 37.95  ?  287 ALA B O     1 
ATOM   5493 C  CB    . ALA B 1 287 ? -15.367 -56.366 18.062  1.00 37.42  ?  287 ALA B CB    1 
ATOM   5494 N  N     . CYS B 1 288 ? -15.543 -55.512 21.188  1.00 33.52  ?  288 CYS B N     1 
ATOM   5495 C  CA    . CYS B 1 288 ? -16.207 -54.862 22.362  1.00 43.05  ?  288 CYS B CA    1 
ATOM   5496 C  C     . CYS B 1 288 ? -15.284 -53.789 22.947  1.00 45.09  ?  288 CYS B C     1 
ATOM   5497 O  O     . CYS B 1 288 ? -15.802 -52.707 23.276  1.00 42.39  ?  288 CYS B O     1 
ATOM   5498 C  CB    . CYS B 1 288 ? -16.585 -55.830 23.479  1.00 38.77  ?  288 CYS B CB    1 
ATOM   5499 S  SG    . CYS B 1 288 ? -18.088 -56.791 23.129  1.00 40.47  ?  288 CYS B SG    1 
ATOM   5500 N  N     . GLY B 1 289 ? -13.985 -54.089 23.069  1.00 44.33  ?  289 GLY B N     1 
ATOM   5501 C  CA    . GLY B 1 289 ? -12.952 -53.139 23.532  1.00 40.19  ?  289 GLY B CA    1 
ATOM   5502 C  C     . GLY B 1 289 ? -12.954 -51.863 22.710  1.00 40.65  ?  289 GLY B C     1 
ATOM   5503 O  O     . GLY B 1 289 ? -12.771 -50.818 23.298  1.00 41.01  ?  289 GLY B O     1 
ATOM   5504 N  N     . ASN B 1 290 ? -13.206 -51.943 21.399  1.00 39.10  ?  290 ASN B N     1 
ATOM   5505 C  CA    . ASN B 1 290 ? -13.251 -50.774 20.488  1.00 43.18  ?  290 ASN B CA    1 
ATOM   5506 C  C     . ASN B 1 290 ? -14.382 -49.804 20.864  1.00 41.62  ?  290 ASN B C     1 
ATOM   5507 O  O     . ASN B 1 290 ? -14.252 -48.603 20.487  1.00 49.47  ?  290 ASN B O     1 
ATOM   5508 C  CB    . ASN B 1 290 ? -13.398 -51.187 19.013  1.00 43.64  ?  290 ASN B CB    1 
ATOM   5509 C  CG    . ASN B 1 290 ? -12.172 -51.876 18.454  1.00 44.37  ?  290 ASN B CG    1 
ATOM   5510 O  OD1   . ASN B 1 290 ? -11.071 -51.756 18.995  1.00 46.02  ?  290 ASN B OD1   1 
ATOM   5511 N  ND2   . ASN B 1 290 ? -12.359 -52.622 17.380  1.00 40.84  ?  290 ASN B ND2   1 
ATOM   5512 N  N     . PHE B 1 291 ? -15.472 -50.294 21.476  1.00 39.08  ?  291 PHE B N     1 
ATOM   5513 C  CA    . PHE B 1 291 ? -16.639 -49.481 21.927  1.00 41.36  ?  291 PHE B CA    1 
ATOM   5514 C  C     . PHE B 1 291 ? -16.516 -49.058 23.409  1.00 37.04  ?  291 PHE B C     1 
ATOM   5515 O  O     . PHE B 1 291 ? -17.407 -48.332 23.874  1.00 43.56  ?  291 PHE B O     1 
ATOM   5516 C  CB    . PHE B 1 291 ? -17.925 -50.234 21.608  1.00 38.80  ?  291 PHE B CB    1 
ATOM   5517 C  CG    . PHE B 1 291 ? -18.198 -50.366 20.135  1.00 42.10  ?  291 PHE B CG    1 
ATOM   5518 C  CD1   . PHE B 1 291 ? -18.569 -49.268 19.374  1.00 43.67  ?  291 PHE B CD1   1 
ATOM   5519 C  CD2   . PHE B 1 291 ? -18.077 -51.593 19.496  1.00 45.09  ?  291 PHE B CD2   1 
ATOM   5520 C  CE1   . PHE B 1 291 ? -18.761 -49.395 18.008  1.00 39.50  ?  291 PHE B CE1   1 
ATOM   5521 C  CE2   . PHE B 1 291 ? -18.286 -51.712 18.130  1.00 35.92  ?  291 PHE B CE2   1 
ATOM   5522 C  CZ    . PHE B 1 291 ? -18.646 -50.615 17.404  1.00 35.72  ?  291 PHE B CZ    1 
ATOM   5523 N  N     . GLY B 1 292 ? -15.439 -49.470 24.099  1.00 34.68  ?  292 GLY B N     1 
ATOM   5524 C  CA    . GLY B 1 292 ? -15.148 -49.222 25.518  1.00 32.08  ?  292 GLY B CA    1 
ATOM   5525 C  C     . GLY B 1 292 ? -16.087 -49.998 26.434  1.00 35.37  ?  292 GLY B C     1 
ATOM   5526 O  O     . GLY B 1 292 ? -16.357 -49.526 27.523  1.00 39.16  ?  292 GLY B O     1 
ATOM   5527 N  N     . ILE B 1 293 ? -16.554 -51.167 26.000  1.00 36.06  ?  293 ILE B N     1 
ATOM   5528 C  CA    . ILE B 1 293 ? -17.482 -52.071 26.751  1.00 34.86  ?  293 ILE B CA    1 
ATOM   5529 C  C     . ILE B 1 293 ? -16.656 -53.247 27.279  1.00 34.62  ?  293 ILE B C     1 
ATOM   5530 O  O     . ILE B 1 293 ? -16.029 -53.980 26.511  1.00 29.22  ?  293 ILE B O     1 
ATOM   5531 C  CB    . ILE B 1 293 ? -18.642 -52.533 25.850  1.00 34.06  ?  293 ILE B CB    1 
ATOM   5532 C  CG1   . ILE B 1 293 ? -19.450 -51.341 25.328  1.00 37.17  ?  293 ILE B CG1   1 
ATOM   5533 C  CG2   . ILE B 1 293 ? -19.533 -53.557 26.534  1.00 38.83  ?  293 ILE B CG2   1 
ATOM   5534 C  CD1   . ILE B 1 293 ? -20.360 -51.733 24.182  1.00 39.83  ?  293 ILE B CD1   1 
ATOM   5535 N  N     . PRO B 1 294 ? -16.565 -53.401 28.615  1.00 30.46  ?  294 PRO B N     1 
ATOM   5536 C  CA    . PRO B 1 294 ? -15.917 -54.559 29.211  1.00 32.76  ?  294 PRO B CA    1 
ATOM   5537 C  C     . PRO B 1 294 ? -16.629 -55.849 28.716  1.00 36.67  ?  294 PRO B C     1 
ATOM   5538 O  O     . PRO B 1 294 ? -17.841 -55.856 28.561  1.00 35.15  ?  294 PRO B O     1 
ATOM   5539 C  CB    . PRO B 1 294 ? -16.158 -54.411 30.734  1.00 35.23  ?  294 PRO B CB    1 
ATOM   5540 C  CG    . PRO B 1 294 ? -16.603 -52.959 30.954  1.00 36.76  ?  294 PRO B CG    1 
ATOM   5541 C  CD    . PRO B 1 294 ? -17.156 -52.485 29.613  1.00 35.72  ?  294 PRO B CD    1 
ATOM   5542 N  N     . CYS B 1 295 ? -15.863 -56.915 28.504  1.00 29.54  ?  295 CYS B N     1 
ATOM   5543 C  CA    . CYS B 1 295 ? -16.297 -58.178 27.906  1.00 33.40  ?  295 CYS B CA    1 
ATOM   5544 C  C     . CYS B 1 295 ? -15.581 -59.333 28.615  1.00 34.59  ?  295 CYS B C     1 
ATOM   5545 O  O     . CYS B 1 295 ? -14.379 -59.401 28.551  1.00 38.35  ?  295 CYS B O     1 
ATOM   5546 C  CB    . CYS B 1 295 ? -15.996 -58.181 26.414  1.00 36.24  ?  295 CYS B CB    1 
ATOM   5547 S  SG    . CYS B 1 295 ? -16.596 -59.656 25.568  1.00 42.31  ?  295 CYS B SG    1 
ATOM   5548 N  N     . GLU B 1 296 ? -16.355 -60.230 29.213  1.00 40.62  ?  296 GLU B N     1 
ATOM   5549 C  CA    . GLU B 1 296 ? -15.870 -61.426 29.930  1.00 44.06  ?  296 GLU B CA    1 
ATOM   5550 C  C     . GLU B 1 296 ? -16.158 -62.672 29.088  1.00 39.44  ?  296 GLU B C     1 
ATOM   5551 O  O     . GLU B 1 296 ? -17.278 -62.738 28.525  1.00 35.67  ?  296 GLU B O     1 
ATOM   5552 C  CB    . GLU B 1 296 ? -16.559 -61.496 31.295  1.00 48.95  ?  296 GLU B CB    1 
ATOM   5553 C  CG    . GLU B 1 296 ? -16.332 -60.233 32.111  1.00 54.84  ?  296 GLU B CG    1 
ATOM   5554 C  CD    . GLU B 1 296 ? -16.620 -60.379 33.580  1.00 54.15  ?  296 GLU B CD    1 
ATOM   5555 O  OE1   . GLU B 1 296 ? -16.883 -59.341 34.178  1.00 58.84  ?  296 GLU B OE1   1 
ATOM   5556 O  OE2   . GLU B 1 296 ? -16.626 -61.531 34.097  1.00 51.17  ?  296 GLU B OE2   1 
ATOM   5557 N  N     . LEU B 1 297 ? -15.176 -63.592 29.012  1.00 33.26  ?  297 LEU B N     1 
ATOM   5558 C  CA    . LEU B 1 297 ? -15.325 -64.935 28.421  1.00 34.59  ?  297 LEU B CA    1 
ATOM   5559 C  C     . LEU B 1 297 ? -15.591 -65.975 29.529  1.00 31.41  ?  297 LEU B C     1 
ATOM   5560 O  O     . LEU B 1 297 ? -14.948 -65.921 30.604  1.00 28.94  ?  297 LEU B O     1 
ATOM   5561 C  CB    . LEU B 1 297 ? -14.077 -65.282 27.596  1.00 39.78  ?  297 LEU B CB    1 
ATOM   5562 C  CG    . LEU B 1 297 ? -13.596 -64.227 26.610  1.00 44.58  ?  297 LEU B CG    1 
ATOM   5563 C  CD1   . LEU B 1 297 ? -12.434 -64.790 25.809  1.00 51.84  ?  297 LEU B CD1   1 
ATOM   5564 C  CD2   . LEU B 1 297 ? -14.678 -63.762 25.654  1.00 43.38  ?  297 LEU B CD2   1 
ATOM   5565 N  N     . ARG B 1 298 ? -16.517 -66.896 29.258  1.00 30.39  ?  298 ARG B N     1 
ATOM   5566 C  CA    . ARG B 1 298 ? -16.934 -67.950 30.204  1.00 30.60  ?  298 ARG B CA    1 
ATOM   5567 C  C     . ARG B 1 298 ? -17.155 -69.216 29.385  1.00 32.53  ?  298 ARG B C     1 
ATOM   5568 O  O     . ARG B 1 298 ? -17.517 -69.125 28.234  1.00 31.72  ?  298 ARG B O     1 
ATOM   5569 C  CB    . ARG B 1 298 ? -18.177 -67.533 31.004  1.00 29.57  ?  298 ARG B CB    1 
ATOM   5570 C  CG    . ARG B 1 298 ? -18.002 -66.322 31.911  1.00 28.93  ?  298 ARG B CG    1 
ATOM   5571 C  CD    . ARG B 1 298 ? -16.906 -66.488 32.934  1.00 31.42  ?  298 ARG B CD    1 
ATOM   5572 N  NE    . ARG B 1 298 ? -17.193 -67.584 33.856  1.00 30.54  ?  298 ARG B NE    1 
ATOM   5573 C  CZ    . ARG B 1 298 ? -17.817 -67.453 35.031  1.00 36.26  ?  298 ARG B CZ    1 
ATOM   5574 N  NH1   . ARG B 1 298 ? -18.257 -66.277 35.458  1.00 31.24  ?  298 ARG B NH1   1 
ATOM   5575 N  NH2   . ARG B 1 298 ? -18.016 -68.513 35.790  1.00 34.52  ?  298 ARG B NH2   1 
ATOM   5576 N  N     . VAL B 1 299 ? -16.854 -70.356 29.972  1.00 30.85  ?  299 VAL B N     1 
ATOM   5577 C  CA    . VAL B 1 299 ? -16.961 -71.665 29.290  1.00 32.63  ?  299 VAL B CA    1 
ATOM   5578 C  C     . VAL B 1 299 ? -18.112 -72.389 29.999  1.00 31.40  ?  299 VAL B C     1 
ATOM   5579 O  O     . VAL B 1 299 ? -18.009 -72.563 31.183  1.00 28.68  ?  299 VAL B O     1 
ATOM   5580 C  CB    . VAL B 1 299 ? -15.642 -72.464 29.378  1.00 30.38  ?  299 VAL B CB    1 
ATOM   5581 C  CG1   . VAL B 1 299 ? -15.780 -73.832 28.717  1.00 28.72  ?  299 VAL B CG1   1 
ATOM   5582 C  CG2   . VAL B 1 299 ? -14.474 -71.685 28.790  1.00 29.74  ?  299 VAL B CG2   1 
ATOM   5583 N  N     . THR B 1 300 ? -19.142 -72.806 29.267  1.00 30.33  ?  300 THR B N     1 
ATOM   5584 C  CA    . THR B 1 300 ? -20.265 -73.594 29.819  1.00 34.86  ?  300 THR B CA    1 
ATOM   5585 C  C     . THR B 1 300 ? -20.998 -74.278 28.675  1.00 34.01  ?  300 THR B C     1 
ATOM   5586 O  O     . THR B 1 300 ? -21.178 -73.620 27.635  1.00 42.07  ?  300 THR B O     1 
ATOM   5587 C  CB    . THR B 1 300 ? -21.238 -72.692 30.614  1.00 43.20  ?  300 THR B CB    1 
ATOM   5588 O  OG1   . THR B 1 300 ? -22.257 -73.549 31.154  1.00 42.86  ?  300 THR B OG1   1 
ATOM   5589 C  CG2   . THR B 1 300 ? -21.834 -71.548 29.807  1.00 35.12  ?  300 THR B CG2   1 
ATOM   5590 N  N     . SER B 1 301 ? -21.484 -75.497 28.879  1.00 32.24  ?  301 SER B N     1 
ATOM   5591 C  CA    . SER B 1 301 ? -22.266 -76.242 27.857  1.00 36.35  ?  301 SER B CA    1 
ATOM   5592 C  C     . SER B 1 301 ? -23.686 -76.416 28.354  1.00 34.85  ?  301 SER B C     1 
ATOM   5593 O  O     . SER B 1 301 ? -23.836 -76.860 29.479  1.00 37.62  ?  301 SER B O     1 
ATOM   5594 C  CB    . SER B 1 301 ? -21.640 -77.588 27.511  1.00 40.24  ?  301 SER B CB    1 
ATOM   5595 O  OG    . SER B 1 301 ? -22.557 -78.421 26.850  1.00 41.24  ?  301 SER B OG    1 
ATOM   5596 N  N     . ALA B 1 302 ? -24.675 -76.063 27.540  1.00 37.76  ?  302 ALA B N     1 
ATOM   5597 C  CA    . ALA B 1 302 ? -26.098 -76.277 27.883  1.00 38.59  ?  302 ALA B CA    1 
ATOM   5598 C  C     . ALA B 1 302 ? -26.350 -77.780 27.879  1.00 36.12  ?  302 ALA B C     1 
ATOM   5599 O  O     . ALA B 1 302 ? -27.149 -78.232 28.680  1.00 35.66  ?  302 ALA B O     1 
ATOM   5600 C  CB    . ALA B 1 302 ? -27.026 -75.536 26.941  1.00 42.78  ?  302 ALA B CB    1 
ATOM   5601 N  N     . HIS B 1 303 ? -25.677 -78.514 26.995  1.00 38.58  ?  303 HIS B N     1 
ATOM   5602 C  CA    . HIS B 1 303 ? -25.924 -79.968 26.776  1.00 39.92  ?  303 HIS B CA    1 
ATOM   5603 C  C     . HIS B 1 303 ? -25.366 -80.757 27.963  1.00 37.69  ?  303 HIS B C     1 
ATOM   5604 O  O     . HIS B 1 303 ? -26.060 -81.609 28.475  1.00 42.29  ?  303 HIS B O     1 
ATOM   5605 C  CB    . HIS B 1 303 ? -25.355 -80.419 25.418  1.00 38.59  ?  303 HIS B CB    1 
ATOM   5606 C  CG    . HIS B 1 303 ? -25.952 -79.725 24.227  1.00 44.43  ?  303 HIS B CG    1 
ATOM   5607 N  ND1   . HIS B 1 303 ? -27.198 -79.117 24.229  1.00 45.16  ?  303 HIS B ND1   1 
ATOM   5608 C  CD2   . HIS B 1 303 ? -25.516 -79.599 22.957  1.00 43.34  ?  303 HIS B CD2   1 
ATOM   5609 C  CE1   . HIS B 1 303 ? -27.478 -78.641 23.043  1.00 43.86  ?  303 HIS B CE1   1 
ATOM   5610 N  NE2   . HIS B 1 303 ? -26.467 -78.921 22.231  1.00 43.93  ?  303 HIS B NE2   1 
ATOM   5611 N  N     . LYS B 1 304 ? -24.171 -80.417 28.420  1.00 43.39  ?  304 LYS B N     1 
ATOM   5612 C  CA    . LYS B 1 304 ? -23.366 -81.282 29.319  1.00 47.75  ?  304 LYS B CA    1 
ATOM   5613 C  C     . LYS B 1 304 ? -23.328 -80.696 30.738  1.00 44.18  ?  304 LYS B C     1 
ATOM   5614 O  O     . LYS B 1 304 ? -22.918 -81.429 31.657  1.00 49.34  ?  304 LYS B O     1 
ATOM   5615 C  CB    . LYS B 1 304 ? -21.958 -81.447 28.715  1.00 50.36  ?  304 LYS B CB    1 
ATOM   5616 C  CG    . LYS B 1 304 ? -21.962 -82.083 27.332  1.00 54.27  ?  304 LYS B CG    1 
ATOM   5617 C  CD    . LYS B 1 304 ? -20.602 -82.479 26.779  1.00 60.82  ?  304 LYS B CD    1 
ATOM   5618 C  CE    . LYS B 1 304 ? -19.807 -81.296 26.248  1.00 72.05  ?  304 LYS B CE    1 
ATOM   5619 N  NZ    . LYS B 1 304 ? -19.305 -81.508 24.863  1.00 70.75  ?  304 LYS B NZ    1 
ATOM   5620 N  N     . GLY B 1 305 ? -23.690 -79.423 30.916  1.00 39.84  ?  305 GLY B N     1 
ATOM   5621 C  CA    . GLY B 1 305 ? -23.639 -78.742 32.224  1.00 37.86  ?  305 GLY B CA    1 
ATOM   5622 C  C     . GLY B 1 305 ? -24.689 -77.648 32.346  1.00 35.62  ?  305 GLY B C     1 
ATOM   5623 O  O     . GLY B 1 305 ? -24.343 -76.506 32.642  1.00 40.89  ?  305 GLY B O     1 
ATOM   5624 N  N     . PRO B 1 306 ? -25.984 -77.960 32.087  1.00 34.01  ?  306 PRO B N     1 
ATOM   5625 C  CA    . PRO B 1 306 ? -27.037 -76.941 32.097  1.00 33.76  ?  306 PRO B CA    1 
ATOM   5626 C  C     . PRO B 1 306 ? -27.220 -76.293 33.477  1.00 34.54  ?  306 PRO B C     1 
ATOM   5627 O  O     . PRO B 1 306 ? -27.518 -75.131 33.537  1.00 37.11  ?  306 PRO B O     1 
ATOM   5628 C  CB    . PRO B 1 306 ? -28.299 -77.703 31.671  1.00 30.88  ?  306 PRO B CB    1 
ATOM   5629 C  CG    . PRO B 1 306 ? -27.998 -79.136 31.968  1.00 31.15  ?  306 PRO B CG    1 
ATOM   5630 C  CD    . PRO B 1 306 ? -26.504 -79.307 31.817  1.00 29.65  ?  306 PRO B CD    1 
ATOM   5631 N  N     . ASP B 1 307 ? -27.062 -77.073 34.543  1.00 41.18  ?  307 ASP B N     1 
ATOM   5632 C  CA    . ASP B 1 307 ? -27.070 -76.600 35.970  1.00 45.84  ?  307 ASP B CA    1 
ATOM   5633 C  C     . ASP B 1 307 ? -26.021 -75.468 36.131  1.00 36.57  ?  307 ASP B C     1 
ATOM   5634 O  O     . ASP B 1 307 ? -26.345 -74.434 36.686  1.00 34.18  ?  307 ASP B O     1 
ATOM   5635 C  CB    . ASP B 1 307 ? -26.829 -77.791 36.927  1.00 49.03  ?  307 ASP B CB    1 
ATOM   5636 C  CG    . ASP B 1 307 ? -25.502 -78.555 36.671  1.00 60.95  ?  307 ASP B CG    1 
ATOM   5637 O  OD1   . ASP B 1 307 ? -25.142 -78.840 35.484  1.00 52.34  ?  307 ASP B OD1   1 
ATOM   5638 O  OD2   . ASP B 1 307 ? -24.793 -78.843 37.645  1.00 58.94  ?  307 ASP B OD2   1 
ATOM   5639 N  N     . GLU B 1 308 ? -24.829 -75.644 35.572  1.00 36.28  ?  308 GLU B N     1 
ATOM   5640 C  CA    . GLU B 1 308 ? -23.696 -74.687 35.647  1.00 35.94  ?  308 GLU B CA    1 
ATOM   5641 C  C     . GLU B 1 308 ? -23.990 -73.461 34.773  1.00 35.79  ?  308 GLU B C     1 
ATOM   5642 O  O     . GLU B 1 308 ? -23.650 -72.353 35.194  1.00 32.86  ?  308 GLU B O     1 
ATOM   5643 C  CB    . GLU B 1 308 ? -22.395 -75.388 35.249  1.00 37.05  ?  308 GLU B CB    1 
ATOM   5644 C  CG    . GLU B 1 308 ? -21.143 -74.550 35.474  1.00 44.49  ?  308 GLU B CG    1 
ATOM   5645 C  CD    . GLU B 1 308 ? -20.897 -73.987 36.877  1.00 48.65  ?  308 GLU B CD    1 
ATOM   5646 O  OE1   . GLU B 1 308 ? -21.696 -74.305 37.784  1.00 44.81  ?  308 GLU B OE1   1 
ATOM   5647 O  OE2   . GLU B 1 308 ? -19.893 -73.174 37.057  1.00 47.09  ?  308 GLU B OE2   1 
ATOM   5648 N  N     . THR B 1 309 ? -24.587 -73.645 33.587  1.00 33.10  ?  309 THR B N     1 
ATOM   5649 C  CA    . THR B 1 309 ? -24.995 -72.533 32.703  1.00 31.64  ?  309 THR B CA    1 
ATOM   5650 C  C     . THR B 1 309 ? -25.902 -71.567 33.465  1.00 29.42  ?  309 THR B C     1 
ATOM   5651 O  O     . THR B 1 309 ? -25.656 -70.362 33.440  1.00 30.37  ?  309 THR B O     1 
ATOM   5652 C  CB    . THR B 1 309 ? -25.694 -73.072 31.447  1.00 38.10  ?  309 THR B CB    1 
ATOM   5653 O  OG1   . THR B 1 309 ? -24.817 -74.039 30.873  1.00 37.28  ?  309 THR B OG1   1 
ATOM   5654 C  CG2   . THR B 1 309 ? -26.013 -71.993 30.424  1.00 36.49  ?  309 THR B CG2   1 
ATOM   5655 N  N     . LEU B 1 310 ? -26.922 -72.091 34.131  1.00 31.01  ?  310 LEU B N     1 
ATOM   5656 C  CA    . LEU B 1 310 ? -27.887 -71.283 34.927  1.00 34.26  ?  310 LEU B CA    1 
ATOM   5657 C  C     . LEU B 1 310 ? -27.201 -70.558 36.096  1.00 30.85  ?  310 LEU B C     1 
ATOM   5658 O  O     . LEU B 1 310 ? -27.588 -69.410 36.359  1.00 26.81  ?  310 LEU B O     1 
ATOM   5659 C  CB    . LEU B 1 310 ? -28.993 -72.202 35.460  1.00 36.17  ?  310 LEU B CB    1 
ATOM   5660 C  CG    . LEU B 1 310 ? -29.816 -72.915 34.380  1.00 42.11  ?  310 LEU B CG    1 
ATOM   5661 C  CD1   . LEU B 1 310 ? -30.878 -73.806 35.051  1.00 46.49  ?  310 LEU B CD1   1 
ATOM   5662 C  CD2   . LEU B 1 310 ? -30.449 -71.925 33.385  1.00 35.87  ?  310 LEU B CD2   1 
ATOM   5663 N  N     . ARG B 1 311 ? -26.273 -71.215 36.804  1.00 30.05  ?  311 ARG B N     1 
ATOM   5664 C  CA    . ARG B 1 311 ? -25.522 -70.611 37.939  1.00 30.31  ?  311 ARG B CA    1 
ATOM   5665 C  C     . ARG B 1 311 ? -24.647 -69.456 37.405  1.00 30.59  ?  311 ARG B C     1 
ATOM   5666 O  O     . ARG B 1 311 ? -24.609 -68.387 38.039  1.00 30.50  ?  311 ARG B O     1 
ATOM   5667 C  CB    . ARG B 1 311 ? -24.703 -71.663 38.691  1.00 34.70  ?  311 ARG B CB    1 
ATOM   5668 C  CG    . ARG B 1 311 ? -24.373 -71.258 40.130  1.00 42.30  ?  311 ARG B CG    1 
ATOM   5669 C  CD    . ARG B 1 311 ? -23.219 -72.018 40.795  1.00 45.06  ?  311 ARG B CD    1 
ATOM   5670 N  NE    . ARG B 1 311 ? -22.000 -72.038 39.972  1.00 46.68  ?  311 ARG B NE    1 
ATOM   5671 C  CZ    . ARG B 1 311 ? -21.174 -70.994 39.746  1.00 45.84  ?  311 ARG B CZ    1 
ATOM   5672 N  NH1   . ARG B 1 311 ? -21.409 -69.816 40.311  1.00 42.82  ?  311 ARG B NH1   1 
ATOM   5673 N  NH2   . ARG B 1 311 ? -20.118 -71.136 38.938  1.00 43.39  ?  311 ARG B NH2   1 
ATOM   5674 N  N     . ILE B 1 312 ? -24.001 -69.618 36.242  1.00 29.40  ?  312 ILE B N     1 
ATOM   5675 C  CA    . ILE B 1 312 ? -23.141 -68.558 35.649  1.00 29.08  ?  312 ILE B CA    1 
ATOM   5676 C  C     . ILE B 1 312 ? -24.031 -67.371 35.247  1.00 27.33  ?  312 ILE B C     1 
ATOM   5677 O  O     . ILE B 1 312 ? -23.679 -66.210 35.558  1.00 29.08  ?  312 ILE B O     1 
ATOM   5678 C  CB    . ILE B 1 312 ? -22.283 -69.123 34.511  1.00 29.16  ?  312 ILE B CB    1 
ATOM   5679 C  CG1   . ILE B 1 312 ? -21.275 -70.129 35.069  1.00 30.23  ?  312 ILE B CG1   1 
ATOM   5680 C  CG2   . ILE B 1 312 ? -21.591 -68.010 33.742  1.00 26.56  ?  312 ILE B CG2   1 
ATOM   5681 C  CD1   . ILE B 1 312 ? -20.625 -71.006 34.013  1.00 32.95  ?  312 ILE B CD1   1 
ATOM   5682 N  N     . LYS B 1 313 ? -25.145 -67.668 34.608  1.00 24.53  ?  313 LYS B N     1 
ATOM   5683 C  CA    . LYS B 1 313 ? -26.167 -66.665 34.246  1.00 27.40  ?  313 LYS B CA    1 
ATOM   5684 C  C     . LYS B 1 313 ? -26.499 -65.865 35.498  1.00 28.80  ?  313 LYS B C     1 
ATOM   5685 O  O     . LYS B 1 313 ? -26.442 -64.625 35.417  1.00 28.97  ?  313 LYS B O     1 
ATOM   5686 C  CB    . LYS B 1 313 ? -27.385 -67.363 33.626  1.00 30.06  ?  313 LYS B CB    1 
ATOM   5687 C  CG    . LYS B 1 313 ? -28.643 -66.519 33.561  1.00 33.45  ?  313 LYS B CG    1 
ATOM   5688 C  CD    . LYS B 1 313 ? -29.892 -67.341 33.274  1.00 38.90  ?  313 LYS B CD    1 
ATOM   5689 C  CE    . LYS B 1 313 ? -30.436 -68.113 34.472  1.00 38.30  ?  313 LYS B CE    1 
ATOM   5690 N  NZ    . LYS B 1 313 ? -31.217 -67.273 35.411  1.00 35.96  ?  313 LYS B NZ    1 
ATOM   5691 N  N     . ALA B 1 314 ? -26.785 -66.552 36.613  1.00 27.04  ?  314 ALA B N     1 
ATOM   5692 C  CA    . ALA B 1 314 ? -27.204 -65.930 37.901  1.00 29.67  ?  314 ALA B CA    1 
ATOM   5693 C  C     . ALA B 1 314 ? -26.146 -64.958 38.438  1.00 27.99  ?  314 ALA B C     1 
ATOM   5694 O  O     . ALA B 1 314 ? -26.540 -63.936 38.994  1.00 28.21  ?  314 ALA B O     1 
ATOM   5695 C  CB    . ALA B 1 314 ? -27.530 -66.975 38.942  1.00 29.87  ?  314 ALA B CB    1 
ATOM   5696 N  N     . GLU B 1 315 ? -24.859 -65.258 38.273  1.00 28.76  ?  315 GLU B N     1 
ATOM   5697 C  CA    . GLU B 1 315 ? -23.763 -64.385 38.757  1.00 32.29  ?  315 GLU B CA    1 
ATOM   5698 C  C     . GLU B 1 315 ? -23.865 -63.024 38.072  1.00 30.07  ?  315 GLU B C     1 
ATOM   5699 O  O     . GLU B 1 315 ? -23.579 -62.035 38.717  1.00 34.95  ?  315 GLU B O     1 
ATOM   5700 C  CB    . GLU B 1 315 ? -22.383 -64.961 38.452  1.00 40.46  ?  315 GLU B CB    1 
ATOM   5701 C  CG    . GLU B 1 315 ? -21.863 -66.047 39.372  1.00 43.05  ?  315 GLU B CG    1 
ATOM   5702 C  CD    . GLU B 1 315 ? -20.515 -66.630 38.888  1.00 50.81  ?  315 GLU B CD    1 
ATOM   5703 O  OE1   . GLU B 1 315 ? -19.927 -66.073 37.942  1.00 56.95  ?  315 GLU B OE1   1 
ATOM   5704 O  OE2   . GLU B 1 315 ? -20.033 -67.645 39.439  1.00 51.29  ?  315 GLU B OE2   1 
ATOM   5705 N  N     . TYR B 1 316 ? -24.226 -62.987 36.787  1.00 33.99  ?  316 TYR B N     1 
ATOM   5706 C  CA    . TYR B 1 316 ? -24.233 -61.746 35.966  1.00 31.71  ?  316 TYR B CA    1 
ATOM   5707 C  C     . TYR B 1 316 ? -25.591 -61.043 36.045  1.00 29.14  ?  316 TYR B C     1 
ATOM   5708 O  O     . TYR B 1 316 ? -25.662 -59.839 35.869  1.00 35.83  ?  316 TYR B O     1 
ATOM   5709 C  CB    . TYR B 1 316 ? -23.840 -62.096 34.528  1.00 34.68  ?  316 TYR B CB    1 
ATOM   5710 C  CG    . TYR B 1 316 ? -22.406 -62.522 34.400  1.00 30.02  ?  316 TYR B CG    1 
ATOM   5711 C  CD1   . TYR B 1 316 ? -21.383 -61.618 34.625  1.00 33.49  ?  316 TYR B CD1   1 
ATOM   5712 C  CD2   . TYR B 1 316 ? -22.074 -63.813 34.060  1.00 30.67  ?  316 TYR B CD2   1 
ATOM   5713 C  CE1   . TYR B 1 316 ? -20.054 -61.993 34.533  1.00 32.81  ?  316 TYR B CE1   1 
ATOM   5714 C  CE2   . TYR B 1 316 ? -20.762 -64.206 33.932  1.00 31.31  ?  316 TYR B CE2   1 
ATOM   5715 C  CZ    . TYR B 1 316 ? -19.752 -63.293 34.165  1.00 34.15  ?  316 TYR B CZ    1 
ATOM   5716 O  OH    . TYR B 1 316 ? -18.461 -63.681 34.045  1.00 34.94  ?  316 TYR B OH    1 
ATOM   5717 N  N     . GLU B 1 317 ? -26.654 -61.795 36.244  1.00 29.44  ?  317 GLU B N     1 
ATOM   5718 C  CA    . GLU B 1 317 ? -28.005 -61.249 36.531  1.00 34.73  ?  317 GLU B CA    1 
ATOM   5719 C  C     . GLU B 1 317 ? -28.033 -60.520 37.886  1.00 34.77  ?  317 GLU B C     1 
ATOM   5720 O  O     . GLU B 1 317 ? -28.861 -59.600 38.033  1.00 31.81  ?  317 GLU B O     1 
ATOM   5721 C  CB    . GLU B 1 317 ? -29.047 -62.380 36.573  1.00 36.53  ?  317 GLU B CB    1 
ATOM   5722 C  CG    . GLU B 1 317 ? -29.537 -62.819 35.203  1.00 37.03  ?  317 GLU B CG    1 
ATOM   5723 C  CD    . GLU B 1 317 ? -30.490 -64.004 35.281  1.00 42.19  ?  317 GLU B CD    1 
ATOM   5724 O  OE1   . GLU B 1 317 ? -30.374 -64.796 36.284  1.00 39.74  ?  317 GLU B OE1   1 
ATOM   5725 O  OE2   . GLU B 1 317 ? -31.370 -64.136 34.372  1.00 41.40  ?  317 GLU B OE2   1 
ATOM   5726 N  N     . GLY B 1 318 ? -27.185 -60.935 38.839  1.00 32.21  ?  318 GLY B N     1 
ATOM   5727 C  CA    . GLY B 1 318 ? -27.388 -60.684 40.264  1.00 31.73  ?  318 GLY B CA    1 
ATOM   5728 C  C     . GLY B 1 318 ? -26.611 -59.513 40.834  1.00 35.09  ?  318 GLY B C     1 
ATOM   5729 O  O     . GLY B 1 318 ? -26.845 -59.250 42.037  1.00 41.94  ?  318 GLY B O     1 
ATOM   5730 N  N     . ASP B 1 319 ? -25.715 -58.852 40.079  1.00 36.55  ?  319 ASP B N     1 
ATOM   5731 C  CA    . ASP B 1 319 ? -24.759 -57.849 40.657  1.00 36.32  ?  319 ASP B CA    1 
ATOM   5732 C  C     . ASP B 1 319 ? -25.101 -56.426 40.223  1.00 34.49  ?  319 ASP B C     1 
ATOM   5733 O  O     . ASP B 1 319 ? -24.301 -55.531 40.479  1.00 41.35  ?  319 ASP B O     1 
ATOM   5734 C  CB    . ASP B 1 319 ? -23.301 -58.223 40.379  1.00 39.52  ?  319 ASP B CB    1 
ATOM   5735 C  CG    . ASP B 1 319 ? -22.848 -58.128 38.922  1.00 44.57  ?  319 ASP B CG    1 
ATOM   5736 O  OD1   . ASP B 1 319 ? -23.730 -57.960 38.050  1.00 50.21  ?  319 ASP B OD1   1 
ATOM   5737 O  OD2   . ASP B 1 319 ? -21.589 -58.216 38.673  1.00 43.13  ?  319 ASP B OD2   1 
ATOM   5738 N  N     . GLY B 1 320 ? -26.239 -56.220 39.583  1.00 36.33  ?  320 GLY B N     1 
ATOM   5739 C  CA    . GLY B 1 320 ? -26.764 -54.876 39.271  1.00 39.76  ?  320 GLY B CA    1 
ATOM   5740 C  C     . GLY B 1 320 ? -26.174 -54.251 38.016  1.00 41.04  ?  320 GLY B C     1 
ATOM   5741 O  O     . GLY B 1 320 ? -26.477 -53.069 37.779  1.00 42.97  ?  320 GLY B O     1 
ATOM   5742 N  N     . ILE B 1 321 ? -25.366 -54.970 37.236  1.00 37.06  ?  321 ILE B N     1 
ATOM   5743 C  CA    . ILE B 1 321 ? -24.712 -54.390 36.018  1.00 39.78  ?  321 ILE B CA    1 
ATOM   5744 C  C     . ILE B 1 321 ? -25.453 -54.836 34.755  1.00 36.78  ?  321 ILE B C     1 
ATOM   5745 O  O     . ILE B 1 321 ? -25.505 -56.025 34.463  1.00 35.16  ?  321 ILE B O     1 
ATOM   5746 C  CB    . ILE B 1 321 ? -23.221 -54.750 35.981  1.00 38.54  ?  321 ILE B CB    1 
ATOM   5747 C  CG1   . ILE B 1 321 ? -22.487 -54.069 37.142  1.00 43.00  ?  321 ILE B CG1   1 
ATOM   5748 C  CG2   . ILE B 1 321 ? -22.623 -54.417 34.641  1.00 37.21  ?  321 ILE B CG2   1 
ATOM   5749 C  CD1   . ILE B 1 321 ? -21.035 -54.494 37.301  1.00 46.19  ?  321 ILE B CD1   1 
ATOM   5750 N  N     . PRO B 1 322 ? -26.027 -53.889 33.974  1.00 32.56  ?  322 PRO B N     1 
ATOM   5751 C  CA    . PRO B 1 322 ? -26.690 -54.204 32.713  1.00 36.28  ?  322 PRO B CA    1 
ATOM   5752 C  C     . PRO B 1 322 ? -25.787 -55.023 31.772  1.00 32.49  ?  322 PRO B C     1 
ATOM   5753 O  O     . PRO B 1 322 ? -24.706 -54.566 31.458  1.00 30.78  ?  322 PRO B O     1 
ATOM   5754 C  CB    . PRO B 1 322 ? -26.973 -52.818 32.076  1.00 34.64  ?  322 PRO B CB    1 
ATOM   5755 C  CG    . PRO B 1 322 ? -27.011 -51.861 33.218  1.00 34.98  ?  322 PRO B CG    1 
ATOM   5756 C  CD    . PRO B 1 322 ? -26.029 -52.440 34.224  1.00 34.47  ?  322 PRO B CD    1 
ATOM   5757 N  N     . THR B 1 323 ? -26.274 -56.182 31.343  1.00 28.16  ?  323 THR B N     1 
ATOM   5758 C  CA    . THR B 1 323 ? -25.483 -57.227 30.660  1.00 27.87  ?  323 THR B CA    1 
ATOM   5759 C  C     . THR B 1 323 ? -26.189 -57.685 29.371  1.00 30.39  ?  323 THR B C     1 
ATOM   5760 O  O     . THR B 1 323 ? -27.424 -57.918 29.401  1.00 29.85  ?  323 THR B O     1 
ATOM   5761 C  CB    . THR B 1 323 ? -25.223 -58.399 31.615  1.00 27.55  ?  323 THR B CB    1 
ATOM   5762 O  OG1   . THR B 1 323 ? -24.473 -57.875 32.717  1.00 30.73  ?  323 THR B OG1   1 
ATOM   5763 C  CG2   . THR B 1 323 ? -24.433 -59.516 30.967  1.00 29.27  ?  323 THR B CG2   1 
ATOM   5764 N  N     . VAL B 1 324 ? -25.418 -57.850 28.300  1.00 27.19  ?  324 VAL B N     1 
ATOM   5765 C  CA    . VAL B 1 324 ? -25.828 -58.578 27.079  1.00 28.64  ?  324 VAL B CA    1 
ATOM   5766 C  C     . VAL B 1 324 ? -24.994 -59.871 27.027  1.00 26.96  ?  324 VAL B C     1 
ATOM   5767 O  O     . VAL B 1 324 ? -23.808 -59.765 27.082  1.00 25.09  ?  324 VAL B O     1 
ATOM   5768 C  CB    . VAL B 1 324 ? -25.622 -57.735 25.808  1.00 28.60  ?  324 VAL B CB    1 
ATOM   5769 C  CG1   . VAL B 1 324 ? -25.895 -58.575 24.572  1.00 27.55  ?  324 VAL B CG1   1 
ATOM   5770 C  CG2   . VAL B 1 324 ? -26.499 -56.484 25.802  1.00 31.05  ?  324 VAL B CG2   1 
ATOM   5771 N  N     . PHE B 1 325 ? -25.658 -61.019 26.920  1.00 25.15  ?  325 PHE B N     1 
ATOM   5772 C  CA    . PHE B 1 325 ? -25.079 -62.361 26.768  1.00 26.80  ?  325 PHE B CA    1 
ATOM   5773 C  C     . PHE B 1 325 ? -24.926 -62.643 25.269  1.00 27.40  ?  325 PHE B C     1 
ATOM   5774 O  O     . PHE B 1 325 ? -25.838 -62.382 24.498  1.00 25.63  ?  325 PHE B O     1 
ATOM   5775 C  CB    . PHE B 1 325 ? -25.964 -63.428 27.430  1.00 26.72  ?  325 PHE B CB    1 
ATOM   5776 C  CG    . PHE B 1 325 ? -26.075 -63.351 28.936  1.00 29.35  ?  325 PHE B CG    1 
ATOM   5777 C  CD1   . PHE B 1 325 ? -25.003 -63.693 29.752  1.00 31.62  ?  325 PHE B CD1   1 
ATOM   5778 C  CD2   . PHE B 1 325 ? -27.261 -62.960 29.542  1.00 29.39  ?  325 PHE B CD2   1 
ATOM   5779 C  CE1   . PHE B 1 325 ? -25.113 -63.616 31.136  1.00 32.61  ?  325 PHE B CE1   1 
ATOM   5780 C  CE2   . PHE B 1 325 ? -27.373 -62.872 30.921  1.00 28.93  ?  325 PHE B CE2   1 
ATOM   5781 C  CZ    . PHE B 1 325 ? -26.295 -63.202 31.714  1.00 33.78  ?  325 PHE B CZ    1 
ATOM   5782 N  N     . VAL B 1 326 ? -23.786 -63.177 24.878  1.00 27.57  ?  326 VAL B N     1 
ATOM   5783 C  CA    . VAL B 1 326 ? -23.516 -63.632 23.490  1.00 28.05  ?  326 VAL B CA    1 
ATOM   5784 C  C     . VAL B 1 326 ? -23.185 -65.121 23.551  1.00 29.99  ?  326 VAL B C     1 
ATOM   5785 O  O     . VAL B 1 326 ? -22.209 -65.484 24.224  1.00 27.39  ?  326 VAL B O     1 
ATOM   5786 C  CB    . VAL B 1 326 ? -22.403 -62.807 22.822  1.00 29.68  ?  326 VAL B CB    1 
ATOM   5787 C  CG1   . VAL B 1 326 ? -22.136 -63.313 21.427  1.00 30.23  ?  326 VAL B CG1   1 
ATOM   5788 C  CG2   . VAL B 1 326 ? -22.730 -61.304 22.761  1.00 30.67  ?  326 VAL B CG2   1 
ATOM   5789 N  N     . ALA B 1 327 ? -24.038 -65.958 22.964  1.00 30.36  ?  327 ALA B N     1 
ATOM   5790 C  CA    . ALA B 1 327 ? -23.922 -67.435 23.007  1.00 30.61  ?  327 ALA B CA    1 
ATOM   5791 C  C     . ALA B 1 327 ? -23.176 -67.906 21.764  1.00 29.63  ?  327 ALA B C     1 
ATOM   5792 O  O     . ALA B 1 327 ? -23.637 -67.629 20.628  1.00 30.71  ?  327 ALA B O     1 
ATOM   5793 C  CB    . ALA B 1 327 ? -25.283 -68.075 23.095  1.00 32.19  ?  327 ALA B CB    1 
ATOM   5794 N  N     . VAL B 1 328 ? -22.034 -68.551 21.986  1.00 29.02  ?  328 VAL B N     1 
ATOM   5795 C  CA    . VAL B 1 328 ? -21.167 -69.136 20.940  1.00 26.85  ?  328 VAL B CA    1 
ATOM   5796 C  C     . VAL B 1 328 ? -21.172 -70.657 21.108  1.00 27.63  ?  328 VAL B C     1 
ATOM   5797 O  O     . VAL B 1 328 ? -20.437 -71.173 21.979  1.00 28.25  ?  328 VAL B O     1 
ATOM   5798 C  CB    . VAL B 1 328 ? -19.762 -68.520 21.017  1.00 26.41  ?  328 VAL B CB    1 
ATOM   5799 C  CG1   . VAL B 1 328 ? -18.799 -69.186 20.037  1.00 28.97  ?  328 VAL B CG1   1 
ATOM   5800 C  CG2   . VAL B 1 328 ? -19.821 -67.019 20.747  1.00 24.77  ?  328 VAL B CG2   1 
ATOM   5801 N  N     . ALA B 1 329 ? -22.001 -71.352 20.332  1.00 29.86  ?  329 ALA B N     1 
ATOM   5802 C  CA    . ALA B 1 329 ? -22.119 -72.828 20.323  1.00 30.80  ?  329 ALA B CA    1 
ATOM   5803 C  C     . ALA B 1 329 ? -22.122 -73.309 18.880  1.00 36.21  ?  329 ALA B C     1 
ATOM   5804 O  O     . ALA B 1 329 ? -22.998 -72.880 18.100  1.00 44.72  ?  329 ALA B O     1 
ATOM   5805 C  CB    . ALA B 1 329 ? -23.366 -73.281 21.013  1.00 34.17  ?  329 ALA B CB    1 
ATOM   5806 N  N     . GLY B 1 330 ? -21.145 -74.141 18.530  1.00 38.51  ?  330 GLY B N     1 
ATOM   5807 C  CA    . GLY B 1 330 ? -21.065 -74.812 17.218  1.00 39.80  ?  330 GLY B CA    1 
ATOM   5808 C  C     . GLY B 1 330 ? -22.107 -75.916 17.125  1.00 44.66  ?  330 GLY B C     1 
ATOM   5809 O  O     . GLY B 1 330 ? -22.676 -76.314 18.189  1.00 37.95  ?  330 GLY B O     1 
ATOM   5810 N  N     . ARG B 1 331 ? -22.397 -76.365 15.893  1.00 47.67  ?  331 ARG B N     1 
ATOM   5811 C  CA    . ARG B 1 331 ? -23.378 -77.452 15.624  1.00 44.10  ?  331 ARG B CA    1 
ATOM   5812 C  C     . ARG B 1 331 ? -24.714 -77.039 16.258  1.00 42.39  ?  331 ARG B C     1 
ATOM   5813 O  O     . ARG B 1 331 ? -25.076 -75.857 16.116  1.00 51.27  ?  331 ARG B O     1 
ATOM   5814 C  CB    . ARG B 1 331 ? -22.805 -78.779 16.140  1.00 42.48  ?  331 ARG B CB    1 
ATOM   5815 C  CG    . ARG B 1 331 ? -21.327 -78.955 15.812  1.00 40.01  ?  331 ARG B CG    1 
ATOM   5816 C  CD    . ARG B 1 331 ? -20.814 -80.256 16.333  1.00 47.45  ?  331 ARG B CD    1 
ATOM   5817 N  NE    . ARG B 1 331 ? -19.550 -80.551 15.703  1.00 55.69  ?  331 ARG B NE    1 
ATOM   5818 C  CZ    . ARG B 1 331 ? -18.770 -81.566 16.032  1.00 56.17  ?  331 ARG B CZ    1 
ATOM   5819 N  NH1   . ARG B 1 331 ? -19.135 -82.410 16.982  1.00 54.20  ?  331 ARG B NH1   1 
ATOM   5820 N  NH2   . ARG B 1 331 ? -17.617 -81.713 15.410  1.00 59.72  ?  331 ARG B NH2   1 
ATOM   5821 N  N     . SER B 1 332 ? -25.418 -77.960 16.915  1.00 37.17  ?  332 SER B N     1 
ATOM   5822 C  CA    . SER B 1 332 ? -26.783 -77.744 17.456  1.00 36.76  ?  332 SER B CA    1 
ATOM   5823 C  C     . SER B 1 332 ? -26.670 -76.799 18.668  1.00 37.96  ?  332 SER B C     1 
ATOM   5824 O  O     . SER B 1 332 ? -26.262 -77.236 19.751  1.00 39.45  ?  332 SER B O     1 
ATOM   5825 C  CB    . SER B 1 332 ? -27.466 -79.061 17.769  1.00 34.86  ?  332 SER B CB    1 
ATOM   5826 O  OG    . SER B 1 332 ? -28.733 -78.864 18.343  1.00 33.41  ?  332 SER B OG    1 
ATOM   5827 N  N     . ASN B 1 333 ? -26.992 -75.526 18.442  1.00 39.37  ?  333 ASN B N     1 
ATOM   5828 C  CA    . ASN B 1 333 ? -26.856 -74.425 19.430  1.00 43.92  ?  333 ASN B CA    1 
ATOM   5829 C  C     . ASN B 1 333 ? -28.033 -74.565 20.391  1.00 39.89  ?  333 ASN B C     1 
ATOM   5830 O  O     . ASN B 1 333 ? -29.149 -74.193 19.980  1.00 43.00  ?  333 ASN B O     1 
ATOM   5831 C  CB    . ASN B 1 333 ? -26.752 -73.050 18.731  1.00 45.64  ?  333 ASN B CB    1 
ATOM   5832 C  CG    . ASN B 1 333 ? -26.832 -71.865 19.680  1.00 41.82  ?  333 ASN B CG    1 
ATOM   5833 O  OD1   . ASN B 1 333 ? -26.708 -72.047 20.887  1.00 40.46  ?  333 ASN B OD1   1 
ATOM   5834 N  ND2   . ASN B 1 333 ? -27.091 -70.671 19.164  1.00 34.28  ?  333 ASN B ND2   1 
ATOM   5835 N  N     . GLY B 1 334 ? -27.793 -75.113 21.588  1.00 42.20  ?  334 GLY B N     1 
ATOM   5836 C  CA    . GLY B 1 334 ? -28.760 -75.146 22.715  1.00 38.26  ?  334 GLY B CA    1 
ATOM   5837 C  C     . GLY B 1 334 ? -28.491 -74.075 23.754  1.00 34.20  ?  334 GLY B C     1 
ATOM   5838 O  O     . GLY B 1 334 ? -29.375 -73.768 24.557  1.00 37.75  ?  334 GLY B O     1 
ATOM   5839 N  N     . LEU B 1 335 ? -27.301 -73.490 23.731  1.00 35.98  ?  335 LEU B N     1 
ATOM   5840 C  CA    . LEU B 1 335 ? -26.816 -72.515 24.735  1.00 31.58  ?  335 LEU B CA    1 
ATOM   5841 C  C     . LEU B 1 335 ? -27.550 -71.185 24.560  1.00 33.94  ?  335 LEU B C     1 
ATOM   5842 O  O     . LEU B 1 335 ? -27.955 -70.606 25.581  1.00 42.09  ?  335 LEU B O     1 
ATOM   5843 C  CB    . LEU B 1 335 ? -25.308 -72.375 24.576  1.00 32.10  ?  335 LEU B CB    1 
ATOM   5844 C  CG    . LEU B 1 335 ? -24.649 -71.359 25.498  1.00 36.64  ?  335 LEU B CG    1 
ATOM   5845 C  CD1   . LEU B 1 335 ? -24.818 -71.802 26.963  1.00 35.69  ?  335 LEU B CD1   1 
ATOM   5846 C  CD2   . LEU B 1 335 ? -23.176 -71.180 25.102  1.00 35.12  ?  335 LEU B CD2   1 
ATOM   5847 N  N     . GLY B 1 336 ? -27.754 -70.720 23.328  1.00 33.06  ?  336 GLY B N     1 
ATOM   5848 C  CA    . GLY B 1 336 ? -28.533 -69.492 23.071  1.00 35.47  ?  336 GLY B CA    1 
ATOM   5849 C  C     . GLY B 1 336 ? -29.968 -69.652 23.562  1.00 34.18  ?  336 GLY B C     1 
ATOM   5850 O  O     . GLY B 1 336 ? -30.446 -68.905 24.408  1.00 34.08  ?  336 GLY B O     1 
ATOM   5851 N  N     . PRO B 1 337 ? -30.704 -70.627 22.998  1.00 35.36  ?  337 PRO B N     1 
ATOM   5852 C  CA    . PRO B 1 337 ? -32.047 -70.966 23.469  1.00 35.55  ?  337 PRO B CA    1 
ATOM   5853 C  C     . PRO B 1 337 ? -32.221 -71.101 24.994  1.00 37.20  ?  337 PRO B C     1 
ATOM   5854 O  O     . PRO B 1 337 ? -33.077 -70.424 25.526  1.00 40.28  ?  337 PRO B O     1 
ATOM   5855 C  CB    . PRO B 1 337 ? -32.300 -72.302 22.765  1.00 34.17  ?  337 PRO B CB    1 
ATOM   5856 C  CG    . PRO B 1 337 ? -31.583 -72.121 21.450  1.00 37.74  ?  337 PRO B CG    1 
ATOM   5857 C  CD    . PRO B 1 337 ? -30.303 -71.388 21.805  1.00 34.10  ?  337 PRO B CD    1 
ATOM   5858 N  N     . VAL B 1 338 ? -31.478 -71.990 25.649  1.00 31.83  ?  338 VAL B N     1 
ATOM   5859 C  CA    . VAL B 1 338 ? -31.564 -72.193 27.122  1.00 33.16  ?  338 VAL B CA    1 
ATOM   5860 C  C     . VAL B 1 338 ? -31.383 -70.838 27.825  1.00 31.06  ?  338 VAL B C     1 
ATOM   5861 O  O     . VAL B 1 338 ? -32.217 -70.518 28.685  1.00 35.18  ?  338 VAL B O     1 
ATOM   5862 C  CB    . VAL B 1 338 ? -30.574 -73.261 27.640  1.00 37.62  ?  338 VAL B CB    1 
ATOM   5863 C  CG1   . VAL B 1 338 ? -30.475 -73.269 29.146  1.00 43.88  ?  338 VAL B CG1   1 
ATOM   5864 C  CG2   . VAL B 1 338 ? -30.991 -74.643 27.184  1.00 48.27  ?  338 VAL B CG2   1 
ATOM   5865 N  N     . MET B 1 339 ? -30.349 -70.079 27.481  1.00 25.53  ?  339 MET B N     1 
ATOM   5866 C  CA    . MET B 1 339 ? -30.044 -68.806 28.142  1.00 28.48  ?  339 MET B CA    1 
ATOM   5867 C  C     . MET B 1 339 ? -31.236 -67.878 27.911  1.00 31.01  ?  339 MET B C     1 
ATOM   5868 O  O     . MET B 1 339 ? -31.756 -67.271 28.858  1.00 29.55  ?  339 MET B O     1 
ATOM   5869 C  CB    . MET B 1 339 ? -28.776 -68.162 27.570  1.00 31.10  ?  339 MET B CB    1 
ATOM   5870 C  CG    . MET B 1 339 ? -27.486 -68.680 28.159  1.00 31.98  ?  339 MET B CG    1 
ATOM   5871 S  SD    . MET B 1 339 ? -27.362 -68.358 29.941  1.00 38.46  ?  339 MET B SD    1 
ATOM   5872 C  CE    . MET B 1 339 ? -27.403 -66.554 29.942  1.00 38.52  ?  339 MET B CE    1 
ATOM   5873 N  N     . SER B 1 340 ? -31.691 -67.807 26.669  1.00 29.47  ?  340 SER B N     1 
ATOM   5874 C  CA    . SER B 1 340 ? -32.765 -66.901 26.234  1.00 29.22  ?  340 SER B CA    1 
ATOM   5875 C  C     . SER B 1 340 ? -34.020 -67.191 27.055  1.00 30.27  ?  340 SER B C     1 
ATOM   5876 O  O     . SER B 1 340 ? -34.722 -66.232 27.409  1.00 32.15  ?  340 SER B O     1 
ATOM   5877 C  CB    . SER B 1 340 ? -32.979 -67.043 24.755  1.00 30.51  ?  340 SER B CB    1 
ATOM   5878 O  OG    . SER B 1 340 ? -33.989 -66.151 24.344  1.00 36.38  ?  340 SER B OG    1 
ATOM   5879 N  N     . GLY B 1 341 ? -34.278 -68.467 27.356  1.00 28.63  ?  341 GLY B N     1 
ATOM   5880 C  CA    . GLY B 1 341 ? -35.508 -68.899 28.040  1.00 32.93  ?  341 GLY B CA    1 
ATOM   5881 C  C     . GLY B 1 341 ? -35.459 -68.611 29.531  1.00 34.35  ?  341 GLY B C     1 
ATOM   5882 O  O     . GLY B 1 341 ? -36.497 -68.649 30.170  1.00 40.61  ?  341 GLY B O     1 
ATOM   5883 N  N     . ASN B 1 342 ? -34.287 -68.307 30.078  1.00 33.51  ?  342 ASN B N     1 
ATOM   5884 C  CA    . ASN B 1 342 ? -34.089 -68.223 31.553  1.00 33.88  ?  342 ASN B CA    1 
ATOM   5885 C  C     . ASN B 1 342 ? -33.533 -66.861 31.995  1.00 35.46  ?  342 ASN B C     1 
ATOM   5886 O  O     . ASN B 1 342 ? -33.231 -66.757 33.166  1.00 36.46  ?  342 ASN B O     1 
ATOM   5887 C  CB    . ASN B 1 342 ? -33.217 -69.390 32.017  1.00 33.08  ?  342 ASN B CB    1 
ATOM   5888 C  CG    . ASN B 1 342 ? -33.937 -70.704 31.814  1.00 34.58  ?  342 ASN B CG    1 
ATOM   5889 O  OD1   . ASN B 1 342 ? -34.703 -71.100 32.684  1.00 36.24  ?  342 ASN B OD1   1 
ATOM   5890 N  ND2   . ASN B 1 342 ? -33.732 -71.362 30.673  1.00 30.47  ?  342 ASN B ND2   1 
ATOM   5891 N  N     . THR B 1 343 ? -33.442 -65.853 31.109  1.00 33.86  ?  343 THR B N     1 
ATOM   5892 C  CA    . THR B 1 343 ? -33.016 -64.483 31.491  1.00 33.19  ?  343 THR B CA    1 
ATOM   5893 C  C     . THR B 1 343 ? -33.928 -63.455 30.827  1.00 31.51  ?  343 THR B C     1 
ATOM   5894 O  O     . THR B 1 343 ? -34.422 -63.713 29.737  1.00 27.26  ?  343 THR B O     1 
ATOM   5895 C  CB    . THR B 1 343 ? -31.522 -64.219 31.248  1.00 31.70  ?  343 THR B CB    1 
ATOM   5896 O  OG1   . THR B 1 343 ? -31.212 -62.955 31.834  1.00 32.08  ?  343 THR B OG1   1 
ATOM   5897 C  CG2   . THR B 1 343 ? -31.148 -64.208 29.788  1.00 31.82  ?  343 THR B CG2   1 
ATOM   5898 N  N     . ALA B 1 344 ? -34.136 -62.335 31.523  1.00 32.78  ?  344 ALA B N     1 
ATOM   5899 C  CA    . ALA B 1 344 ? -34.829 -61.143 31.012  1.00 33.42  ?  344 ALA B CA    1 
ATOM   5900 C  C     . ALA B 1 344 ? -33.838 -60.246 30.246  1.00 35.30  ?  344 ALA B C     1 
ATOM   5901 O  O     . ALA B 1 344 ? -34.281 -59.284 29.546  1.00 31.58  ?  344 ALA B O     1 
ATOM   5902 C  CB    . ALA B 1 344 ? -35.464 -60.425 32.155  1.00 28.68  ?  344 ALA B CB    1 
ATOM   5903 N  N     . TYR B 1 345 ? -32.538 -60.513 30.349  1.00 31.07  ?  345 TYR B N     1 
ATOM   5904 C  CA    . TYR B 1 345 ? -31.524 -59.728 29.593  1.00 31.41  ?  345 TYR B CA    1 
ATOM   5905 C  C     . TYR B 1 345 ? -31.498 -60.232 28.152  1.00 27.23  ?  345 TYR B C     1 
ATOM   5906 O  O     . TYR B 1 345 ? -31.805 -61.391 27.908  1.00 27.94  ?  345 TYR B O     1 
ATOM   5907 C  CB    . TYR B 1 345 ? -30.128 -59.831 30.231  1.00 32.93  ?  345 TYR B CB    1 
ATOM   5908 C  CG    . TYR B 1 345 ? -29.931 -59.074 31.516  1.00 31.46  ?  345 TYR B CG    1 
ATOM   5909 C  CD1   . TYR B 1 345 ? -30.760 -58.027 31.888  1.00 32.40  ?  345 TYR B CD1   1 
ATOM   5910 C  CD2   . TYR B 1 345 ? -28.869 -59.375 32.338  1.00 32.40  ?  345 TYR B CD2   1 
ATOM   5911 C  CE1   . TYR B 1 345 ? -30.563 -57.327 33.063  1.00 34.04  ?  345 TYR B CE1   1 
ATOM   5912 C  CE2   . TYR B 1 345 ? -28.630 -58.656 33.500  1.00 35.50  ?  345 TYR B CE2   1 
ATOM   5913 C  CZ    . TYR B 1 345 ? -29.491 -57.645 33.879  1.00 37.51  ?  345 TYR B CZ    1 
ATOM   5914 O  OH    . TYR B 1 345 ? -29.247 -56.962 35.048  1.00 39.75  ?  345 TYR B OH    1 
ATOM   5915 N  N     . PRO B 1 346 ? -31.019 -59.428 27.185  1.00 24.26  ?  346 PRO B N     1 
ATOM   5916 C  CA    . PRO B 1 346 ? -30.897 -59.883 25.810  1.00 26.06  ?  346 PRO B CA    1 
ATOM   5917 C  C     . PRO B 1 346 ? -29.868 -60.998 25.651  1.00 24.45  ?  346 PRO B C     1 
ATOM   5918 O  O     . PRO B 1 346 ? -28.842 -60.918 26.275  1.00 25.17  ?  346 PRO B O     1 
ATOM   5919 C  CB    . PRO B 1 346 ? -30.367 -58.650 25.043  1.00 28.42  ?  346 PRO B CB    1 
ATOM   5920 C  CG    . PRO B 1 346 ? -30.531 -57.468 26.005  1.00 28.05  ?  346 PRO B CG    1 
ATOM   5921 C  CD    . PRO B 1 346 ? -30.490 -58.065 27.381  1.00 24.67  ?  346 PRO B CD    1 
ATOM   5922 N  N     . VAL B 1 347 ? -30.148 -61.961 24.774  1.00 28.67  ?  347 VAL B N     1 
ATOM   5923 C  CA    . VAL B 1 347 ? -29.166 -63.007 24.325  1.00 26.54  ?  347 VAL B CA    1 
ATOM   5924 C  C     . VAL B 1 347 ? -29.026 -62.932 22.796  1.00 27.37  ?  347 VAL B C     1 
ATOM   5925 O  O     . VAL B 1 347 ? -30.040 -62.814 22.090  1.00 29.01  ?  347 VAL B O     1 
ATOM   5926 C  CB    . VAL B 1 347 ? -29.598 -64.403 24.747  1.00 27.20  ?  347 VAL B CB    1 
ATOM   5927 C  CG1   . VAL B 1 347 ? -28.557 -65.417 24.361  1.00 28.37  ?  347 VAL B CG1   1 
ATOM   5928 C  CG2   . VAL B 1 347 ? -29.903 -64.465 26.224  1.00 31.03  ?  347 VAL B CG2   1 
ATOM   5929 N  N     . ILE B 1 348 ? -27.792 -62.946 22.325  1.00 27.24  ?  348 ILE B N     1 
ATOM   5930 C  CA    . ILE B 1 348 ? -27.404 -62.979 20.896  1.00 27.86  ?  348 ILE B CA    1 
ATOM   5931 C  C     . ILE B 1 348 ? -26.687 -64.305 20.677  1.00 28.48  ?  348 ILE B C     1 
ATOM   5932 O  O     . ILE B 1 348 ? -25.704 -64.583 21.385  1.00 25.13  ?  348 ILE B O     1 
ATOM   5933 C  CB    . ILE B 1 348 ? -26.485 -61.788 20.528  1.00 31.04  ?  348 ILE B CB    1 
ATOM   5934 C  CG1   . ILE B 1 348 ? -27.148 -60.433 20.809  1.00 31.60  ?  348 ILE B CG1   1 
ATOM   5935 C  CG2   . ILE B 1 348 ? -26.051 -61.879 19.071  1.00 33.08  ?  348 ILE B CG2   1 
ATOM   5936 C  CD1   . ILE B 1 348 ? -26.162 -59.276 20.807  1.00 32.26  ?  348 ILE B CD1   1 
ATOM   5937 N  N     . SER B 1 349 ? -27.169 -65.112 19.733  1.00 31.18  ?  349 SER B N     1 
ATOM   5938 C  CA    . SER B 1 349 ? -26.417 -66.290 19.242  1.00 31.31  ?  349 SER B CA    1 
ATOM   5939 C  C     . SER B 1 349 ? -25.480 -65.767 18.161  1.00 32.51  ?  349 SER B C     1 
ATOM   5940 O  O     . SER B 1 349 ? -25.963 -65.129 17.214  1.00 35.86  ?  349 SER B O     1 
ATOM   5941 C  CB    . SER B 1 349 ? -27.314 -67.380 18.747  1.00 34.08  ?  349 SER B CB    1 
ATOM   5942 O  OG    . SER B 1 349 ? -28.014 -68.035 19.825  1.00 36.21  ?  349 SER B OG    1 
ATOM   5943 N  N     . CYS B 1 350 ? -24.178 -65.936 18.349  1.00 31.61  ?  350 CYS B N     1 
ATOM   5944 C  CA    . CYS B 1 350 ? -23.154 -65.701 17.310  1.00 29.29  ?  350 CYS B CA    1 
ATOM   5945 C  C     . CYS B 1 350 ? -22.410 -67.014 17.070  1.00 27.85  ?  350 CYS B C     1 
ATOM   5946 O  O     . CYS B 1 350 ? -21.331 -67.265 17.612  1.00 28.02  ?  350 CYS B O     1 
ATOM   5947 C  CB    . CYS B 1 350 ? -22.252 -64.562 17.735  1.00 28.88  ?  350 CYS B CB    1 
ATOM   5948 S  SG    . CYS B 1 350 ? -21.034 -64.195 16.465  1.00 37.79  ?  350 CYS B SG    1 
ATOM   5949 N  N     . PRO B 1 351 ? -23.010 -67.945 16.303  1.00 31.12  ?  351 PRO B N     1 
ATOM   5950 C  CA    . PRO B 1 351 ? -22.430 -69.279 16.131  1.00 35.16  ?  351 PRO B CA    1 
ATOM   5951 C  C     . PRO B 1 351 ? -21.191 -69.246 15.245  1.00 34.29  ?  351 PRO B C     1 
ATOM   5952 O  O     . PRO B 1 351 ? -21.161 -68.496 14.294  1.00 37.66  ?  351 PRO B O     1 
ATOM   5953 C  CB    . PRO B 1 351 ? -23.565 -70.090 15.486  1.00 34.03  ?  351 PRO B CB    1 
ATOM   5954 C  CG    . PRO B 1 351 ? -24.382 -69.055 14.774  1.00 31.81  ?  351 PRO B CG    1 
ATOM   5955 C  CD    . PRO B 1 351 ? -24.282 -67.785 15.583  1.00 26.95  ?  351 PRO B CD    1 
ATOM   5956 N  N     . PRO B 1 352 ? -20.138 -70.042 15.542  1.00 44.62  ?  352 PRO B N     1 
ATOM   5957 C  CA    . PRO B 1 352 ? -18.936 -70.107 14.694  1.00 46.29  ?  352 PRO B CA    1 
ATOM   5958 C  C     . PRO B 1 352 ? -19.138 -71.003 13.461  1.00 41.40  ?  352 PRO B C     1 
ATOM   5959 O  O     . PRO B 1 352 ? -18.603 -72.078 13.400  1.00 43.65  ?  352 PRO B O     1 
ATOM   5960 C  CB    . PRO B 1 352 ? -17.909 -70.725 15.650  1.00 43.25  ?  352 PRO B CB    1 
ATOM   5961 C  CG    . PRO B 1 352 ? -18.754 -71.721 16.437  1.00 44.99  ?  352 PRO B CG    1 
ATOM   5962 C  CD    . PRO B 1 352 ? -20.076 -70.999 16.674  1.00 45.02  ?  352 PRO B CD    1 
ATOM   5963 N  N     . LEU B 1 353 ? -19.959 -70.539 12.525  1.00 44.69  ?  353 LEU B N     1 
ATOM   5964 C  CA    . LEU B 1 353 ? -20.288 -71.226 11.254  1.00 45.44  ?  353 LEU B CA    1 
ATOM   5965 C  C     . LEU B 1 353 ? -19.053 -71.228 10.343  1.00 46.61  ?  353 LEU B C     1 
ATOM   5966 O  O     . LEU B 1 353 ? -18.382 -70.190 10.247  1.00 48.74  ?  353 LEU B O     1 
ATOM   5967 C  CB    . LEU B 1 353 ? -21.432 -70.481 10.567  1.00 43.97  ?  353 LEU B CB    1 
ATOM   5968 C  CG    . LEU B 1 353 ? -22.701 -70.350 11.387  1.00 42.41  ?  353 LEU B CG    1 
ATOM   5969 C  CD1   . LEU B 1 353 ? -23.770 -69.627 10.574  1.00 46.94  ?  353 LEU B CD1   1 
ATOM   5970 C  CD2   . LEU B 1 353 ? -23.196 -71.712 11.884  1.00 39.76  ?  353 LEU B CD2   1 
ATOM   5971 N  N     . THR B 1 354 ? -18.803 -72.357 9.694   1.00 44.56  ?  354 THR B N     1 
ATOM   5972 C  CA    . THR B 1 354 ? -17.860 -72.508 8.555   1.00 48.04  ?  354 THR B CA    1 
ATOM   5973 C  C     . THR B 1 354 ? -18.691 -72.932 7.343   1.00 46.21  ?  354 THR B C     1 
ATOM   5974 O  O     . THR B 1 354 ? -19.837 -73.349 7.502   1.00 44.41  ?  354 THR B O     1 
ATOM   5975 C  CB    . THR B 1 354 ? -16.719 -73.475 8.929   1.00 49.46  ?  354 THR B CB    1 
ATOM   5976 O  OG1   . THR B 1 354 ? -17.260 -74.796 8.870   1.00 49.53  ?  354 THR B OG1   1 
ATOM   5977 C  CG2   . THR B 1 354 ? -16.133 -73.225 10.308  1.00 50.41  ?  354 THR B CG2   1 
ATOM   5978 N  N     . PRO B 1 355 ? -18.161 -72.847 6.093   1.00 52.13  ?  355 PRO B N     1 
ATOM   5979 C  CA    . PRO B 1 355 ? -18.932 -73.260 4.908   1.00 49.88  ?  355 PRO B CA    1 
ATOM   5980 C  C     . PRO B 1 355 ? -19.256 -74.771 4.805   1.00 46.59  ?  355 PRO B C     1 
ATOM   5981 O  O     . PRO B 1 355 ? -20.160 -75.150 4.050   1.00 44.15  ?  355 PRO B O     1 
ATOM   5982 C  CB    . PRO B 1 355 ? -18.048 -72.818 3.733   1.00 51.96  ?  355 PRO B CB    1 
ATOM   5983 C  CG    . PRO B 1 355 ? -17.116 -71.766 4.346   1.00 51.03  ?  355 PRO B CG    1 
ATOM   5984 C  CD    . PRO B 1 355 ? -16.836 -72.282 5.739   1.00 50.80  ?  355 PRO B CD    1 
ATOM   5985 N  N     . ASP B 1 356 ? -18.602 -75.595 5.616   1.00 40.45  ?  356 ASP B N     1 
ATOM   5986 C  CA    . ASP B 1 356 ? -18.787 -77.063 5.610   1.00 45.85  ?  356 ASP B CA    1 
ATOM   5987 C  C     . ASP B 1 356 ? -20.227 -77.446 6.024   1.00 39.96  ?  356 ASP B C     1 
ATOM   5988 O  O     . ASP B 1 356 ? -20.890 -78.163 5.247   1.00 37.27  ?  356 ASP B O     1 
ATOM   5989 C  CB    . ASP B 1 356 ? -17.710 -77.718 6.489   1.00 57.21  ?  356 ASP B CB    1 
ATOM   5990 C  CG    . ASP B 1 356 ? -16.351 -77.882 5.824   1.00 58.98  ?  356 ASP B CG    1 
ATOM   5991 O  OD1   . ASP B 1 356 ? -16.214 -77.611 4.576   1.00 52.99  ?  356 ASP B OD1   1 
ATOM   5992 O  OD2   . ASP B 1 356 ? -15.468 -78.375 6.540   1.00 61.77  ?  356 ASP B OD2   1 
ATOM   5993 N  N     . TRP B 1 357 ? -20.676 -77.014 7.205   1.00 35.40  ?  357 TRP B N     1 
ATOM   5994 C  CA    . TRP B 1 357 ? -22.002 -77.386 7.771   1.00 37.16  ?  357 TRP B CA    1 
ATOM   5995 C  C     . TRP B 1 357 ? -22.788 -76.143 8.260   1.00 36.71  ?  357 TRP B C     1 
ATOM   5996 O  O     . TRP B 1 357 ? -23.831 -76.338 8.903   1.00 35.73  ?  357 TRP B O     1 
ATOM   5997 C  CB    . TRP B 1 357 ? -21.781 -78.388 8.904   1.00 35.02  ?  357 TRP B CB    1 
ATOM   5998 C  CG    . TRP B 1 357 ? -21.097 -79.649 8.476   1.00 38.98  ?  357 TRP B CG    1 
ATOM   5999 C  CD1   . TRP B 1 357 ? -19.794 -79.972 8.712   1.00 40.52  ?  357 TRP B CD1   1 
ATOM   6000 C  CD2   . TRP B 1 357 ? -21.673 -80.775 7.773   1.00 38.93  ?  357 TRP B CD2   1 
ATOM   6001 N  NE1   . TRP B 1 357 ? -19.527 -81.228 8.230   1.00 44.34  ?  357 TRP B NE1   1 
ATOM   6002 C  CE2   . TRP B 1 357 ? -20.649 -81.747 7.639   1.00 39.76  ?  357 TRP B CE2   1 
ATOM   6003 C  CE3   . TRP B 1 357 ? -22.945 -81.062 7.248   1.00 39.33  ?  357 TRP B CE3   1 
ATOM   6004 C  CZ2   . TRP B 1 357 ? -20.839 -82.975 6.993   1.00 36.65  ?  357 TRP B CZ2   1 
ATOM   6005 C  CZ3   . TRP B 1 357 ? -23.142 -82.283 6.628   1.00 42.53  ?  357 TRP B CZ3   1 
ATOM   6006 C  CH2   . TRP B 1 357 ? -22.102 -83.221 6.491   1.00 40.16  ?  357 TRP B CH2   1 
ATOM   6007 N  N     . GLY B 1 358 ? -22.325 -74.924 7.965   1.00 30.65  ?  358 GLY B N     1 
ATOM   6008 C  CA    . GLY B 1 358 ? -22.919 -73.659 8.452   1.00 34.88  ?  358 GLY B CA    1 
ATOM   6009 C  C     . GLY B 1 358 ? -24.349 -73.440 7.980   1.00 35.41  ?  358 GLY B C     1 
ATOM   6010 O  O     . GLY B 1 358 ? -25.174 -73.013 8.800   1.00 37.82  ?  358 GLY B O     1 
ATOM   6011 N  N     . VAL B 1 359 ? -24.637 -73.772 6.729   1.00 36.28  ?  359 VAL B N     1 
ATOM   6012 C  CA    . VAL B 1 359 ? -26.013 -73.757 6.141   1.00 42.65  ?  359 VAL B CA    1 
ATOM   6013 C  C     . VAL B 1 359 ? -26.959 -74.632 6.986   1.00 42.40  ?  359 VAL B C     1 
ATOM   6014 O  O     . VAL B 1 359 ? -28.147 -74.300 7.072   1.00 44.91  ?  359 VAL B O     1 
ATOM   6015 C  CB    . VAL B 1 359 ? -25.998 -74.226 4.668   1.00 46.32  ?  359 VAL B CB    1 
ATOM   6016 C  CG1   . VAL B 1 359 ? -27.417 -74.347 4.100   1.00 42.84  ?  359 VAL B CG1   1 
ATOM   6017 C  CG2   . VAL B 1 359 ? -25.102 -73.337 3.783   1.00 46.13  ?  359 VAL B CG2   1 
ATOM   6018 N  N     . GLN B 1 360 ? -26.479 -75.735 7.562   1.00 39.89  ?  360 GLN B N     1 
ATOM   6019 C  CA    . GLN B 1 360 ? -27.326 -76.693 8.332   1.00 41.08  ?  360 GLN B CA    1 
ATOM   6020 C  C     . GLN B 1 360 ? -27.431 -76.230 9.796   1.00 42.79  ?  360 GLN B C     1 
ATOM   6021 O  O     . GLN B 1 360 ? -28.552 -76.236 10.329  1.00 42.99  ?  360 GLN B O     1 
ATOM   6022 C  CB    . GLN B 1 360 ? -26.758 -78.114 8.244   1.00 37.54  ?  360 GLN B CB    1 
ATOM   6023 C  CG    . GLN B 1 360 ? -26.980 -78.769 6.895   1.00 38.01  ?  360 GLN B CG    1 
ATOM   6024 C  CD    . GLN B 1 360 ? -26.103 -78.232 5.786   1.00 36.69  ?  360 GLN B CD    1 
ATOM   6025 O  OE1   . GLN B 1 360 ? -24.903 -78.033 5.948   1.00 42.36  ?  360 GLN B OE1   1 
ATOM   6026 N  NE2   . GLN B 1 360 ? -26.715 -77.977 4.644   1.00 33.03  ?  360 GLN B NE2   1 
ATOM   6027 N  N     . ASP B 1 361 ? -26.307 -75.798 10.390  1.00 45.21  ?  361 ASP B N     1 
ATOM   6028 C  CA    . ASP B 1 361 ? -26.175 -75.469 11.838  1.00 40.52  ?  361 ASP B CA    1 
ATOM   6029 C  C     . ASP B 1 361 ? -26.959 -74.203 12.214  1.00 39.60  ?  361 ASP B C     1 
ATOM   6030 O  O     . ASP B 1 361 ? -27.498 -74.174 13.345  1.00 38.26  ?  361 ASP B O     1 
ATOM   6031 C  CB    . ASP B 1 361 ? -24.712 -75.323 12.215  1.00 38.60  ?  361 ASP B CB    1 
ATOM   6032 C  CG    . ASP B 1 361 ? -23.968 -76.656 12.264  1.00 46.87  ?  361 ASP B CG    1 
ATOM   6033 O  OD1   . ASP B 1 361 ? -24.660 -77.730 12.410  1.00 43.21  ?  361 ASP B OD1   1 
ATOM   6034 O  OD2   . ASP B 1 361 ? -22.699 -76.612 12.154  1.00 39.74  ?  361 ASP B OD2   1 
ATOM   6035 N  N     . VAL B 1 362 ? -27.030 -73.211 11.316  1.00 35.20  ?  362 VAL B N     1 
ATOM   6036 C  CA    . VAL B 1 362 ? -27.614 -71.859 11.594  1.00 39.93  ?  362 VAL B CA    1 
ATOM   6037 C  C     . VAL B 1 362 ? -29.083 -71.972 12.048  1.00 36.05  ?  362 VAL B C     1 
ATOM   6038 O  O     . VAL B 1 362 ? -29.535 -71.144 12.844  1.00 30.01  ?  362 VAL B O     1 
ATOM   6039 C  CB    . VAL B 1 362 ? -27.494 -70.925 10.380  1.00 37.66  ?  362 VAL B CB    1 
ATOM   6040 C  CG1   . VAL B 1 362 ? -28.473 -71.313 9.279   1.00 36.44  ?  362 VAL B CG1   1 
ATOM   6041 C  CG2   . VAL B 1 362 ? -27.676 -69.467 10.790  1.00 38.78  ?  362 VAL B CG2   1 
ATOM   6042 N  N     . TRP B 1 363 ? -29.809 -72.965 11.550  1.00 36.72  ?  363 TRP B N     1 
ATOM   6043 C  CA    . TRP B 1 363 ? -31.256 -73.096 11.815  1.00 40.30  ?  363 TRP B CA    1 
ATOM   6044 C  C     . TRP B 1 363 ? -31.522 -73.391 13.303  1.00 38.76  ?  363 TRP B C     1 
ATOM   6045 O  O     . TRP B 1 363 ? -32.605 -73.018 13.799  1.00 35.94  ?  363 TRP B O     1 
ATOM   6046 C  CB    . TRP B 1 363 ? -31.877 -74.111 10.837  1.00 39.86  ?  363 TRP B CB    1 
ATOM   6047 C  CG    . TRP B 1 363 ? -31.952 -73.543 9.453   1.00 36.45  ?  363 TRP B CG    1 
ATOM   6048 C  CD1   . TRP B 1 363 ? -31.078 -73.754 8.420   1.00 35.93  ?  363 TRP B CD1   1 
ATOM   6049 C  CD2   . TRP B 1 363 ? -32.911 -72.589 8.970   1.00 35.58  ?  363 TRP B CD2   1 
ATOM   6050 N  NE1   . TRP B 1 363 ? -31.444 -73.022 7.326   1.00 30.57  ?  363 TRP B NE1   1 
ATOM   6051 C  CE2   . TRP B 1 363 ? -32.555 -72.290 7.631   1.00 33.33  ?  363 TRP B CE2   1 
ATOM   6052 C  CE3   . TRP B 1 363 ? -34.043 -71.985 9.522   1.00 36.93  ?  363 TRP B CE3   1 
ATOM   6053 C  CZ2   . TRP B 1 363 ? -33.281 -71.400 6.852   1.00 37.91  ?  363 TRP B CZ2   1 
ATOM   6054 C  CZ3   . TRP B 1 363 ? -34.770 -71.107 8.742   1.00 36.61  ?  363 TRP B CZ3   1 
ATOM   6055 C  CH2   . TRP B 1 363 ? -34.403 -70.833 7.429   1.00 37.96  ?  363 TRP B CH2   1 
ATOM   6056 N  N     . SER B 1 364 ? -30.567 -73.984 14.013  1.00 35.53  ?  364 SER B N     1 
ATOM   6057 C  CA    . SER B 1 364 ? -30.707 -74.255 15.467  1.00 37.52  ?  364 SER B CA    1 
ATOM   6058 C  C     . SER B 1 364 ? -30.683 -72.947 16.275  1.00 37.07  ?  364 SER B C     1 
ATOM   6059 O  O     . SER B 1 364 ? -31.162 -72.982 17.430  1.00 39.84  ?  364 SER B O     1 
ATOM   6060 C  CB    . SER B 1 364 ? -29.652 -75.243 15.950  1.00 33.57  ?  364 SER B CB    1 
ATOM   6061 O  OG    . SER B 1 364 ? -28.367 -74.673 15.873  1.00 37.38  ?  364 SER B OG    1 
ATOM   6062 N  N     . SER B 1 365 ? -30.129 -71.856 15.719  1.00 32.57  ?  365 SER B N     1 
ATOM   6063 C  CA    . SER B 1 365 ? -30.173 -70.484 16.303  1.00 32.93  ?  365 SER B CA    1 
ATOM   6064 C  C     . SER B 1 365 ? -31.466 -69.722 15.901  1.00 35.20  ?  365 SER B C     1 
ATOM   6065 O  O     . SER B 1 365 ? -31.941 -68.871 16.689  1.00 33.33  ?  365 SER B O     1 
ATOM   6066 C  CB    . SER B 1 365 ? -28.934 -69.691 15.907  1.00 30.76  ?  365 SER B CB    1 
ATOM   6067 O  OG    . SER B 1 365 ? -27.763 -70.351 16.348  1.00 28.29  ?  365 SER B OG    1 
ATOM   6068 N  N     . LEU B 1 366 ? -32.006 -70.011 14.712  1.00 35.82  ?  366 LEU B N     1 
ATOM   6069 C  CA    . LEU B 1 366 ? -33.054 -69.203 14.028  1.00 39.00  ?  366 LEU B CA    1 
ATOM   6070 C  C     . LEU B 1 366 ? -34.481 -69.666 14.353  1.00 39.39  ?  366 LEU B C     1 
ATOM   6071 O  O     . LEU B 1 366 ? -35.359 -68.790 14.480  1.00 40.54  ?  366 LEU B O     1 
ATOM   6072 C  CB    . LEU B 1 366 ? -32.849 -69.308 12.521  1.00 39.86  ?  366 LEU B CB    1 
ATOM   6073 C  CG    . LEU B 1 366 ? -31.659 -68.545 11.972  1.00 40.86  ?  366 LEU B CG    1 
ATOM   6074 C  CD1   . LEU B 1 366 ? -31.514 -68.846 10.491  1.00 43.03  ?  366 LEU B CD1   1 
ATOM   6075 C  CD2   . LEU B 1 366 ? -31.826 -67.054 12.238  1.00 43.60  ?  366 LEU B CD2   1 
ATOM   6076 N  N     . ARG B 1 367 ? -34.748 -70.971 14.381  1.00 41.17  ?  367 ARG B N     1 
ATOM   6077 C  CA    . ARG B 1 367 ? -36.130 -71.501 14.547  1.00 39.12  ?  367 ARG B CA    1 
ATOM   6078 C  C     . ARG B 1 367 ? -36.275 -71.999 15.978  1.00 37.80  ?  367 ARG B C     1 
ATOM   6079 O  O     . ARG B 1 367 ? -35.763 -73.067 16.281  1.00 43.07  ?  367 ARG B O     1 
ATOM   6080 C  CB    . ARG B 1 367 ? -36.454 -72.548 13.476  1.00 43.20  ?  367 ARG B CB    1 
ATOM   6081 C  CG    . ARG B 1 367 ? -37.020 -71.918 12.206  1.00 41.75  ?  367 ARG B CG    1 
ATOM   6082 C  CD    . ARG B 1 367 ? -37.383 -72.909 11.120  1.00 40.14  ?  367 ARG B CD    1 
ATOM   6083 N  NE    . ARG B 1 367 ? -38.251 -73.979 11.598  1.00 36.44  ?  367 ARG B NE    1 
ATOM   6084 C  CZ    . ARG B 1 367 ? -39.545 -73.848 11.832  1.00 38.00  ?  367 ARG B CZ    1 
ATOM   6085 N  NH1   . ARG B 1 367 ? -40.147 -72.683 11.639  1.00 36.85  ?  367 ARG B NH1   1 
ATOM   6086 N  NH2   . ARG B 1 367 ? -40.246 -74.893 12.242  1.00 38.16  ?  367 ARG B NH2   1 
ATOM   6087 N  N     . LEU B 1 368 ? -36.914 -71.190 16.813  1.00 41.74  ?  368 LEU B N     1 
ATOM   6088 C  CA    . LEU B 1 368 ? -37.012 -71.356 18.281  1.00 45.64  ?  368 LEU B CA    1 
ATOM   6089 C  C     . LEU B 1 368 ? -38.492 -71.505 18.656  1.00 48.09  ?  368 LEU B C     1 
ATOM   6090 O  O     . LEU B 1 368 ? -39.385 -70.927 18.003  1.00 41.98  ?  368 LEU B O     1 
ATOM   6091 C  CB    . LEU B 1 368 ? -36.364 -70.140 18.962  1.00 44.54  ?  368 LEU B CB    1 
ATOM   6092 C  CG    . LEU B 1 368 ? -34.959 -69.782 18.481  1.00 49.58  ?  368 LEU B CG    1 
ATOM   6093 C  CD1   . LEU B 1 368 ? -34.396 -68.614 19.263  1.00 52.30  ?  368 LEU B CD1   1 
ATOM   6094 C  CD2   . LEU B 1 368 ? -34.024 -70.977 18.570  1.00 47.13  ?  368 LEU B CD2   1 
ATOM   6095 N  N     . PRO B 1 369 ? -38.804 -72.285 19.725  1.00 53.94  ?  369 PRO B N     1 
ATOM   6096 C  CA    . PRO B 1 369 ? -40.168 -72.349 20.252  1.00 51.33  ?  369 PRO B CA    1 
ATOM   6097 C  C     . PRO B 1 369 ? -40.648 -70.959 20.670  1.00 45.16  ?  369 PRO B C     1 
ATOM   6098 O  O     . PRO B 1 369 ? -39.785 -70.093 20.855  1.00 36.67  ?  369 PRO B O     1 
ATOM   6099 C  CB    . PRO B 1 369 ? -40.088 -73.256 21.491  1.00 52.83  ?  369 PRO B CB    1 
ATOM   6100 C  CG    . PRO B 1 369 ? -38.607 -73.440 21.764  1.00 53.15  ?  369 PRO B CG    1 
ATOM   6101 C  CD    . PRO B 1 369 ? -37.880 -73.166 20.462  1.00 48.34  ?  369 PRO B CD    1 
ATOM   6102 N  N     . SER B 1 370 ? -41.966 -70.782 20.785  1.00 46.88  ?  370 SER B N     1 
ATOM   6103 C  CA    . SER B 1 370 ? -42.586 -69.478 21.146  1.00 55.58  ?  370 SER B CA    1 
ATOM   6104 C  C     . SER B 1 370 ? -42.098 -69.096 22.546  1.00 53.43  ?  370 SER B C     1 
ATOM   6105 O  O     . SER B 1 370 ? -41.721 -70.028 23.307  1.00 49.63  ?  370 SER B O     1 
ATOM   6106 C  CB    . SER B 1 370 ? -44.091 -69.520 21.070  1.00 58.59  ?  370 SER B CB    1 
ATOM   6107 O  OG    . SER B 1 370 ? -44.600 -70.307 22.137  1.00 66.47  ?  370 SER B OG    1 
ATOM   6108 N  N     . GLY B 1 371 ? -42.070 -67.794 22.856  1.00 49.41  ?  371 GLY B N     1 
ATOM   6109 C  CA    . GLY B 1 371 ? -41.676 -67.302 24.187  1.00 50.89  ?  371 GLY B CA    1 
ATOM   6110 C  C     . GLY B 1 371 ? -40.174 -67.072 24.326  1.00 53.67  ?  371 GLY B C     1 
ATOM   6111 O  O     . GLY B 1 371 ? -39.726 -66.851 25.483  1.00 55.24  ?  371 GLY B O     1 
ATOM   6112 N  N     . LEU B 1 372 ? -39.425 -67.096 23.213  1.00 50.92  ?  372 LEU B N     1 
ATOM   6113 C  CA    . LEU B 1 372 ? -37.945 -66.873 23.151  1.00 52.26  ?  372 LEU B CA    1 
ATOM   6114 C  C     . LEU B 1 372 ? -37.654 -65.672 22.234  1.00 51.78  ?  372 LEU B C     1 
ATOM   6115 O  O     . LEU B 1 372 ? -38.107 -65.661 21.045  1.00 49.63  ?  372 LEU B O     1 
ATOM   6116 C  CB    . LEU B 1 372 ? -37.244 -68.148 22.656  1.00 48.32  ?  372 LEU B CB    1 
ATOM   6117 C  CG    . LEU B 1 372 ? -36.726 -69.106 23.732  1.00 53.14  ?  372 LEU B CG    1 
ATOM   6118 C  CD1   . LEU B 1 372 ? -37.808 -69.570 24.663  1.00 60.03  ?  372 LEU B CD1   1 
ATOM   6119 C  CD2   . LEU B 1 372 ? -36.079 -70.318 23.104  1.00 65.38  ?  372 LEU B CD2   1 
ATOM   6120 N  N     . GLY B 1 373 ? -36.929 -64.693 22.764  1.00 49.23  ?  373 GLY B N     1 
ATOM   6121 C  CA    . GLY B 1 373 ? -36.542 -63.473 22.036  1.00 48.66  ?  373 GLY B CA    1 
ATOM   6122 C  C     . GLY B 1 373 ? -35.136 -63.562 21.477  1.00 47.79  ?  373 GLY B C     1 
ATOM   6123 O  O     . GLY B 1 373 ? -34.708 -62.593 20.816  1.00 52.13  ?  373 GLY B O     1 
ATOM   6124 N  N     . CYS B 1 374 ? -34.433 -64.673 21.711  1.00 44.68  ?  374 CYS B N     1 
ATOM   6125 C  CA    . CYS B 1 374 ? -33.036 -64.889 21.258  1.00 42.44  ?  374 CYS B CA    1 
ATOM   6126 C  C     . CYS B 1 374 ? -32.893 -64.366 19.811  1.00 43.72  ?  374 CYS B C     1 
ATOM   6127 O  O     . CYS B 1 374 ? -33.685 -64.805 18.940  1.00 38.16  ?  374 CYS B O     1 
ATOM   6128 C  CB    . CYS B 1 374 ? -32.680 -66.369 21.347  1.00 46.26  ?  374 CYS B CB    1 
ATOM   6129 S  SG    . CYS B 1 374 ? -30.898 -66.681 21.196  1.00 59.80  ?  374 CYS B SG    1 
ATOM   6130 N  N     . SER B 1 375 ? -31.945 -63.448 19.581  1.00 38.98  ?  375 SER B N     1 
ATOM   6131 C  CA    . SER B 1 375 ? -31.572 -62.902 18.252  1.00 40.06  ?  375 SER B CA    1 
ATOM   6132 C  C     . SER B 1 375 ? -30.343 -63.625 17.677  1.00 39.49  ?  375 SER B C     1 
ATOM   6133 O  O     . SER B 1 375 ? -29.598 -64.271 18.436  1.00 41.07  ?  375 SER B O     1 
ATOM   6134 C  CB    . SER B 1 375 ? -31.363 -61.392 18.319  1.00 41.36  ?  375 SER B CB    1 
ATOM   6135 O  OG    . SER B 1 375 ? -30.094 -61.085 18.846  1.00 41.23  ?  375 SER B OG    1 
ATOM   6136 N  N     . THR B 1 376 ? -30.121 -63.503 16.359  1.00 37.62  ?  376 THR B N     1 
ATOM   6137 C  CA    . THR B 1 376 ? -28.949 -64.080 15.662  1.00 35.11  ?  376 THR B CA    1 
ATOM   6138 C  C     . THR B 1 376 ? -28.132 -62.990 14.960  1.00 34.99  ?  376 THR B C     1 
ATOM   6139 O  O     . THR B 1 376 ? -28.710 -62.165 14.267  1.00 35.25  ?  376 THR B O     1 
ATOM   6140 C  CB    . THR B 1 376 ? -29.395 -65.184 14.707  1.00 36.23  ?  376 THR B CB    1 
ATOM   6141 O  OG1   . THR B 1 376 ? -30.221 -66.073 15.448  1.00 34.89  ?  376 THR B OG1   1 
ATOM   6142 C  CG2   . THR B 1 376 ? -28.227 -65.967 14.151  1.00 37.34  ?  376 THR B CG2   1 
ATOM   6143 N  N     . VAL B 1 377 ? -26.817 -63.036 15.128  1.00 32.27  ?  377 VAL B N     1 
ATOM   6144 C  CA    . VAL B 1 377 ? -25.841 -62.211 14.367  1.00 33.26  ?  377 VAL B CA    1 
ATOM   6145 C  C     . VAL B 1 377 ? -24.670 -63.122 14.010  1.00 35.94  ?  377 VAL B C     1 
ATOM   6146 O  O     . VAL B 1 377 ? -24.003 -63.592 14.922  1.00 36.35  ?  377 VAL B O     1 
ATOM   6147 C  CB    . VAL B 1 377 ? -25.373 -60.983 15.170  1.00 30.64  ?  377 VAL B CB    1 
ATOM   6148 C  CG1   . VAL B 1 377 ? -24.516 -60.020 14.330  1.00 33.09  ?  377 VAL B CG1   1 
ATOM   6149 C  CG2   . VAL B 1 377 ? -26.545 -60.210 15.713  1.00 29.41  ?  377 VAL B CG2   1 
ATOM   6150 N  N     . LEU B 1 378 ? -24.428 -63.328 12.721  1.00 39.49  ?  378 LEU B N     1 
ATOM   6151 C  CA    . LEU B 1 378 ? -23.380 -64.260 12.226  1.00 41.09  ?  378 LEU B CA    1 
ATOM   6152 C  C     . LEU B 1 378 ? -21.976 -63.664 12.397  1.00 43.11  ?  378 LEU B C     1 
ATOM   6153 O  O     . LEU B 1 378 ? -21.053 -64.456 12.767  1.00 51.49  ?  378 LEU B O     1 
ATOM   6154 C  CB    . LEU B 1 378 ? -23.675 -64.648 10.778  1.00 36.41  ?  378 LEU B CB    1 
ATOM   6155 C  CG    . LEU B 1 378 ? -25.036 -65.332 10.605  1.00 41.81  ?  378 LEU B CG    1 
ATOM   6156 C  CD1   . LEU B 1 378 ? -25.167 -65.926 9.221   1.00 40.62  ?  378 LEU B CD1   1 
ATOM   6157 C  CD2   . LEU B 1 378 ? -25.301 -66.406 11.683  1.00 40.01  ?  378 LEU B CD2   1 
ATOM   6158 N  N     . SER B 1 379 ? -21.794 -62.357 12.184  1.00 39.07  ?  379 SER B N     1 
ATOM   6159 C  CA    . SER B 1 379 ? -20.450 -61.723 12.292  1.00 39.22  ?  379 SER B CA    1 
ATOM   6160 C  C     . SER B 1 379 ? -20.086 -61.597 13.773  1.00 41.38  ?  379 SER B C     1 
ATOM   6161 O  O     . SER B 1 379 ? -20.896 -61.160 14.580  1.00 38.13  ?  379 SER B O     1 
ATOM   6162 C  CB    . SER B 1 379 ? -20.403 -60.397 11.575  1.00 40.91  ?  379 SER B CB    1 
ATOM   6163 O  OG    . SER B 1 379 ? -19.135 -59.768 11.769  1.00 42.83  ?  379 SER B OG    1 
ATOM   6164 N  N     . PRO B 1 380 ? -18.884 -62.019 14.201  1.00 42.37  ?  380 PRO B N     1 
ATOM   6165 C  CA    . PRO B 1 380 ? -18.435 -61.756 15.565  1.00 39.44  ?  380 PRO B CA    1 
ATOM   6166 C  C     . PRO B 1 380 ? -18.196 -60.255 15.853  1.00 36.17  ?  380 PRO B C     1 
ATOM   6167 O  O     . PRO B 1 380 ? -18.622 -59.808 16.890  1.00 37.18  ?  380 PRO B O     1 
ATOM   6168 C  CB    . PRO B 1 380 ? -17.146 -62.585 15.710  1.00 40.62  ?  380 PRO B CB    1 
ATOM   6169 C  CG    . PRO B 1 380 ? -16.695 -62.903 14.298  1.00 45.86  ?  380 PRO B CG    1 
ATOM   6170 C  CD    . PRO B 1 380 ? -17.911 -62.777 13.404  1.00 44.36  ?  380 PRO B CD    1 
ATOM   6171 N  N     . GLU B 1 381 ? -17.562 -59.499 14.960  1.00 33.81  ?  381 GLU B N     1 
ATOM   6172 C  CA    . GLU B 1 381 ? -17.473 -58.012 15.083  1.00 36.11  ?  381 GLU B CA    1 
ATOM   6173 C  C     . GLU B 1 381 ? -18.889 -57.418 15.091  1.00 31.55  ?  381 GLU B C     1 
ATOM   6174 O  O     . GLU B 1 381 ? -19.167 -56.532 15.907  1.00 31.44  ?  381 GLU B O     1 
ATOM   6175 C  CB    . GLU B 1 381 ? -16.650 -57.364 13.962  1.00 39.81  ?  381 GLU B CB    1 
ATOM   6176 C  CG    . GLU B 1 381 ? -15.168 -57.709 14.001  1.00 45.20  ?  381 GLU B CG    1 
ATOM   6177 C  CD    . GLU B 1 381 ? -14.812 -59.090 13.453  1.00 51.28  ?  381 GLU B CD    1 
ATOM   6178 O  OE1   . GLU B 1 381 ? -15.703 -59.764 12.798  1.00 46.91  ?  381 GLU B OE1   1 
ATOM   6179 O  OE2   . GLU B 1 381 ? -13.649 -59.512 13.708  1.00 54.72  ?  381 GLU B OE2   1 
ATOM   6180 N  N     . GLY B 1 382 ? -19.770 -57.946 14.252  1.00 30.92  ?  382 GLY B N     1 
ATOM   6181 C  CA    . GLY B 1 382 ? -21.183 -57.541 14.189  1.00 32.71  ?  382 GLY B CA    1 
ATOM   6182 C  C     . GLY B 1 382 ? -21.918 -57.734 15.507  1.00 30.94  ?  382 GLY B C     1 
ATOM   6183 O  O     . GLY B 1 382 ? -22.781 -56.879 15.828  1.00 30.17  ?  382 GLY B O     1 
ATOM   6184 N  N     . SER B 1 383 ? -21.635 -58.807 16.250  1.00 29.38  ?  383 SER B N     1 
ATOM   6185 C  CA    . SER B 1 383 ? -22.379 -59.130 17.486  1.00 31.17  ?  383 SER B CA    1 
ATOM   6186 C  C     . SER B 1 383 ? -21.961 -58.111 18.546  1.00 33.03  ?  383 SER B C     1 
ATOM   6187 O  O     . SER B 1 383 ? -22.839 -57.625 19.329  1.00 29.97  ?  383 SER B O     1 
ATOM   6188 C  CB    . SER B 1 383 ? -22.217 -60.569 17.910  1.00 31.92  ?  383 SER B CB    1 
ATOM   6189 O  OG    . SER B 1 383 ? -20.901 -60.865 18.322  1.00 34.18  ?  383 SER B OG    1 
ATOM   6190 N  N     . ALA B 1 384 ? -20.706 -57.685 18.483  1.00 32.84  ?  384 ALA B N     1 
ATOM   6191 C  CA    . ALA B 1 384 ? -20.183 -56.654 19.418  1.00 34.24  ?  384 ALA B CA    1 
ATOM   6192 C  C     . ALA B 1 384 ? -20.868 -55.328 19.088  1.00 28.91  ?  384 ALA B C     1 
ATOM   6193 O  O     . ALA B 1 384 ? -21.369 -54.685 19.971  1.00 30.07  ?  384 ALA B O     1 
ATOM   6194 C  CB    . ALA B 1 384 ? -18.688 -56.571 19.329  1.00 33.75  ?  384 ALA B CB    1 
ATOM   6195 N  N     . GLN B 1 385 ? -20.934 -54.986 17.818  1.00 30.02  ?  385 GLN B N     1 
ATOM   6196 C  CA    . GLN B 1 385 ? -21.551 -53.724 17.351  1.00 31.03  ?  385 GLN B CA    1 
ATOM   6197 C  C     . GLN B 1 385 ? -23.037 -53.703 17.745  1.00 30.42  ?  385 GLN B C     1 
ATOM   6198 O  O     . GLN B 1 385 ? -23.558 -52.643 18.168  1.00 26.34  ?  385 GLN B O     1 
ATOM   6199 C  CB    . GLN B 1 385 ? -21.345 -53.587 15.848  1.00 33.42  ?  385 GLN B CB    1 
ATOM   6200 C  CG    . GLN B 1 385 ? -22.033 -52.365 15.264  1.00 42.29  ?  385 GLN B CG    1 
ATOM   6201 C  CD    . GLN B 1 385 ? -21.706 -52.137 13.820  1.00 43.32  ?  385 GLN B CD    1 
ATOM   6202 O  OE1   . GLN B 1 385 ? -20.969 -52.895 13.197  1.00 45.38  ?  385 GLN B OE1   1 
ATOM   6203 N  NE2   . GLN B 1 385 ? -22.309 -51.097 13.277  1.00 48.39  ?  385 GLN B NE2   1 
ATOM   6204 N  N     . PHE B 1 386 ? -23.710 -54.848 17.657  1.00 29.22  ?  386 PHE B N     1 
ATOM   6205 C  CA    . PHE B 1 386 ? -25.135 -54.915 18.025  1.00 27.53  ?  386 PHE B CA    1 
ATOM   6206 C  C     . PHE B 1 386 ? -25.239 -54.689 19.523  1.00 27.11  ?  386 PHE B C     1 
ATOM   6207 O  O     . PHE B 1 386 ? -26.106 -53.895 19.963  1.00 29.22  ?  386 PHE B O     1 
ATOM   6208 C  CB    . PHE B 1 386 ? -25.780 -56.226 17.589  1.00 30.05  ?  386 PHE B CB    1 
ATOM   6209 C  CG    . PHE B 1 386 ? -27.272 -56.181 17.738  1.00 31.34  ?  386 PHE B CG    1 
ATOM   6210 C  CD1   . PHE B 1 386 ? -28.054 -55.323 16.981  1.00 39.32  ?  386 PHE B CD1   1 
ATOM   6211 C  CD2   . PHE B 1 386 ? -27.898 -56.994 18.651  1.00 40.29  ?  386 PHE B CD2   1 
ATOM   6212 C  CE1   . PHE B 1 386 ? -29.431 -55.282 17.134  1.00 38.17  ?  386 PHE B CE1   1 
ATOM   6213 C  CE2   . PHE B 1 386 ? -29.273 -56.972 18.802  1.00 40.11  ?  386 PHE B CE2   1 
ATOM   6214 C  CZ    . PHE B 1 386 ? -30.038 -56.121 18.031  1.00 37.59  ?  386 PHE B CZ    1 
ATOM   6215 N  N     . ALA B 1 387 ? -24.368 -55.344 20.292  1.00 25.98  ?  387 ALA B N     1 
ATOM   6216 C  CA    . ALA B 1 387 ? -24.299 -55.166 21.769  1.00 23.24  ?  387 ALA B CA    1 
ATOM   6217 C  C     . ALA B 1 387 ? -24.068 -53.687 22.067  1.00 21.85  ?  387 ALA B C     1 
ATOM   6218 O  O     . ALA B 1 387 ? -24.694 -53.150 22.983  1.00 22.64  ?  387 ALA B O     1 
ATOM   6219 C  CB    . ALA B 1 387 ? -23.211 -56.030 22.370  1.00 25.40  ?  387 ALA B CB    1 
ATOM   6220 N  N     . ALA B 1 388 ? -23.198 -53.030 21.321  1.00 19.63  ?  388 ALA B N     1 
ATOM   6221 C  CA    . ALA B 1 388 ? -22.900 -51.592 21.503  1.00 22.75  ?  388 ALA B CA    1 
ATOM   6222 C  C     . ALA B 1 388 ? -24.150 -50.745 21.242  1.00 22.82  ?  388 ALA B C     1 
ATOM   6223 O  O     . ALA B 1 388 ? -24.457 -49.860 22.029  1.00 25.99  ?  388 ALA B O     1 
ATOM   6224 C  CB    . ALA B 1 388 ? -21.774 -51.197 20.579  1.00 23.35  ?  388 ALA B CB    1 
ATOM   6225 N  N     . GLN B 1 389 ? -24.852 -51.045 20.155  1.00 26.79  ?  389 GLN B N     1 
ATOM   6226 C  CA    . GLN B 1 389 ? -26.092 -50.344 19.762  1.00 27.96  ?  389 GLN B CA    1 
ATOM   6227 C  C     . GLN B 1 389 ? -27.114 -50.452 20.903  1.00 29.71  ?  389 GLN B C     1 
ATOM   6228 O  O     . GLN B 1 389 ? -27.787 -49.441 21.212  1.00 27.35  ?  389 GLN B O     1 
ATOM   6229 C  CB    . GLN B 1 389 ? -26.608 -50.914 18.437  1.00 28.49  ?  389 GLN B CB    1 
ATOM   6230 C  CG    . GLN B 1 389 ? -25.815 -50.445 17.232  1.00 24.89  ?  389 GLN B CG    1 
ATOM   6231 C  CD    . GLN B 1 389 ? -26.113 -51.270 16.011  1.00 30.34  ?  389 GLN B CD    1 
ATOM   6232 O  OE1   . GLN B 1 389 ? -26.874 -52.244 16.066  1.00 31.56  ?  389 GLN B OE1   1 
ATOM   6233 N  NE2   . GLN B 1 389 ? -25.473 -50.912 14.902  1.00 29.96  ?  389 GLN B NE2   1 
ATOM   6234 N  N     . ILE B 1 390 ? -27.241 -51.628 21.516  1.00 28.50  ?  390 ILE B N     1 
ATOM   6235 C  CA    . ILE B 1 390 ? -28.147 -51.834 22.687  1.00 25.82  ?  390 ILE B CA    1 
ATOM   6236 C  C     . ILE B 1 390 ? -27.709 -50.904 23.821  1.00 28.02  ?  390 ILE B C     1 
ATOM   6237 O  O     . ILE B 1 390 ? -28.566 -50.231 24.420  1.00 29.88  ?  390 ILE B O     1 
ATOM   6238 C  CB    . ILE B 1 390 ? -28.144 -53.304 23.122  1.00 25.64  ?  390 ILE B CB    1 
ATOM   6239 C  CG1   . ILE B 1 390 ? -28.846 -54.180 22.092  1.00 23.54  ?  390 ILE B CG1   1 
ATOM   6240 C  CG2   . ILE B 1 390 ? -28.744 -53.459 24.511  1.00 28.32  ?  390 ILE B CG2   1 
ATOM   6241 C  CD1   . ILE B 1 390 ? -28.572 -55.642 22.226  1.00 23.62  ?  390 ILE B CD1   1 
ATOM   6242 N  N     . PHE B 1 391 ? -26.413 -50.841 24.132  1.00 27.46  ?  391 PHE B N     1 
ATOM   6243 C  CA    . PHE B 1 391 ? -25.935 -50.010 25.260  1.00 25.60  ?  391 PHE B CA    1 
ATOM   6244 C  C     . PHE B 1 391 ? -25.988 -48.539 24.885  1.00 25.11  ?  391 PHE B C     1 
ATOM   6245 O  O     . PHE B 1 391 ? -26.100 -47.696 25.799  1.00 29.57  ?  391 PHE B O     1 
ATOM   6246 C  CB    . PHE B 1 391 ? -24.566 -50.464 25.706  1.00 24.98  ?  391 PHE B CB    1 
ATOM   6247 C  CG    . PHE B 1 391 ? -24.625 -51.773 26.444  1.00 28.08  ?  391 PHE B CG    1 
ATOM   6248 C  CD1   . PHE B 1 391 ? -25.389 -51.900 27.588  1.00 30.21  ?  391 PHE B CD1   1 
ATOM   6249 C  CD2   . PHE B 1 391 ? -23.880 -52.862 26.024  1.00 31.59  ?  391 PHE B CD2   1 
ATOM   6250 C  CE1   . PHE B 1 391 ? -25.412 -53.094 28.285  1.00 33.86  ?  391 PHE B CE1   1 
ATOM   6251 C  CE2   . PHE B 1 391 ? -23.902 -54.058 26.722  1.00 30.47  ?  391 PHE B CE2   1 
ATOM   6252 C  CZ    . PHE B 1 391 ? -24.682 -54.183 27.831  1.00 32.26  ?  391 PHE B CZ    1 
ATOM   6253 N  N     . GLY B 1 392 ? -25.922 -48.249 23.596  1.00 24.04  ?  392 GLY B N     1 
ATOM   6254 C  CA    . GLY B 1 392 ? -25.944 -46.877 23.083  1.00 26.65  ?  392 GLY B CA    1 
ATOM   6255 C  C     . GLY B 1 392 ? -27.255 -46.194 23.393  1.00 30.15  ?  392 GLY B C     1 
ATOM   6256 O  O     . GLY B 1 392 ? -27.290 -44.942 23.413  1.00 29.27  ?  392 GLY B O     1 
ATOM   6257 N  N     . LEU B 1 393 ? -28.325 -46.957 23.654  1.00 31.29  ?  393 LEU B N     1 
ATOM   6258 C  CA    . LEU B 1 393 ? -29.622 -46.358 24.054  1.00 32.82  ?  393 LEU B CA    1 
ATOM   6259 C  C     . LEU B 1 393 ? -29.493 -45.622 25.397  1.00 32.25  ?  393 LEU B C     1 
ATOM   6260 O  O     . LEU B 1 393 ? -30.219 -44.642 25.590  1.00 34.39  ?  393 LEU B O     1 
ATOM   6261 C  CB    . LEU B 1 393 ? -30.680 -47.457 24.089  1.00 33.03  ?  393 LEU B CB    1 
ATOM   6262 C  CG    . LEU B 1 393 ? -31.054 -48.045 22.731  1.00 33.35  ?  393 LEU B CG    1 
ATOM   6263 C  CD1   . LEU B 1 393 ? -31.994 -49.232 22.887  1.00 29.14  ?  393 LEU B CD1   1 
ATOM   6264 C  CD2   . LEU B 1 393 ? -31.633 -46.989 21.806  1.00 33.30  ?  393 LEU B CD2   1 
ATOM   6265 N  N     . SER B 1 394 ? -28.563 -46.032 26.258  1.00 34.49  ?  394 SER B N     1 
ATOM   6266 C  CA    . SER B 1 394 ? -28.382 -45.526 27.656  1.00 36.69  ?  394 SER B CA    1 
ATOM   6267 C  C     . SER B 1 394 ? -27.049 -44.812 27.831  1.00 34.08  ?  394 SER B C     1 
ATOM   6268 O  O     . SER B 1 394 ? -26.952 -44.045 28.781  1.00 39.71  ?  394 SER B O     1 
ATOM   6269 C  CB    . SER B 1 394 ? -28.417 -46.638 28.676  1.00 34.75  ?  394 SER B CB    1 
ATOM   6270 O  OG    . SER B 1 394 ? -29.418 -47.573 28.356  1.00 44.63  ?  394 SER B OG    1 
ATOM   6271 N  N     . ASN B 1 395 ? -26.051 -45.106 26.991  1.00 31.41  ?  395 ASN B N     1 
ATOM   6272 C  CA    . ASN B 1 395 ? -24.669 -44.623 27.193  1.00 29.30  ?  395 ASN B CA    1 
ATOM   6273 C  C     . ASN B 1 395 ? -24.266 -43.759 26.000  1.00 26.96  ?  395 ASN B C     1 
ATOM   6274 O  O     . ASN B 1 395 ? -24.065 -44.279 24.932  1.00 27.68  ?  395 ASN B O     1 
ATOM   6275 C  CB    . ASN B 1 395 ? -23.718 -45.793 27.459  1.00 32.33  ?  395 ASN B CB    1 
ATOM   6276 C  CG    . ASN B 1 395 ? -22.350 -45.336 27.929  1.00 31.61  ?  395 ASN B CG    1 
ATOM   6277 O  OD1   . ASN B 1 395 ? -21.682 -44.496 27.304  1.00 31.75  ?  395 ASN B OD1   1 
ATOM   6278 N  ND2   . ASN B 1 395 ? -21.929 -45.907 29.028  1.00 30.87  ?  395 ASN B ND2   1 
ATOM   6279 N  N     . HIS B 1 396 ? -24.130 -42.470 26.229  1.00 29.30  ?  396 HIS B N     1 
ATOM   6280 C  CA    . HIS B 1 396 ? -23.850 -41.451 25.208  1.00 28.52  ?  396 HIS B CA    1 
ATOM   6281 C  C     . HIS B 1 396 ? -22.430 -41.670 24.651  1.00 30.28  ?  396 HIS B C     1 
ATOM   6282 O  O     . HIS B 1 396 ? -22.200 -41.385 23.463  1.00 34.69  ?  396 HIS B O     1 
ATOM   6283 C  CB    . HIS B 1 396 ? -24.146 -40.080 25.807  1.00 29.57  ?  396 HIS B CB    1 
ATOM   6284 C  CG    . HIS B 1 396 ? -23.019 -39.497 26.586  1.00 34.10  ?  396 HIS B CG    1 
ATOM   6285 N  ND1   . HIS B 1 396 ? -22.914 -39.700 27.958  1.00 33.97  ?  396 HIS B ND1   1 
ATOM   6286 C  CD2   . HIS B 1 396 ? -21.985 -38.696 26.221  1.00 35.48  ?  396 HIS B CD2   1 
ATOM   6287 C  CE1   . HIS B 1 396 ? -21.840 -39.064 28.407  1.00 38.52  ?  396 HIS B CE1   1 
ATOM   6288 N  NE2   . HIS B 1 396 ? -21.253 -38.427 27.359  1.00 39.36  ?  396 HIS B NE2   1 
ATOM   6289 N  N     . LEU B 1 397 ? -21.514 -42.213 25.439  1.00 31.43  ?  397 LEU B N     1 
ATOM   6290 C  CA    . LEU B 1 397 ? -20.116 -42.477 24.990  1.00 31.39  ?  397 LEU B CA    1 
ATOM   6291 C  C     . LEU B 1 397 ? -20.131 -43.615 23.976  1.00 26.42  ?  397 LEU B C     1 
ATOM   6292 O  O     . LEU B 1 397 ? -19.521 -43.454 22.925  1.00 23.57  ?  397 LEU B O     1 
ATOM   6293 C  CB    . LEU B 1 397 ? -19.202 -42.757 26.190  1.00 31.48  ?  397 LEU B CB    1 
ATOM   6294 C  CG    . LEU B 1 397 ? -19.094 -41.567 27.153  1.00 34.96  ?  397 LEU B CG    1 
ATOM   6295 C  CD1   . LEU B 1 397 ? -18.270 -41.891 28.358  1.00 32.96  ?  397 LEU B CD1   1 
ATOM   6296 C  CD2   . LEU B 1 397 ? -18.510 -40.347 26.458  1.00 36.18  ?  397 LEU B CD2   1 
ATOM   6297 N  N     . VAL B 1 398 ? -20.846 -44.696 24.268  1.00 28.04  ?  398 VAL B N     1 
ATOM   6298 C  CA    . VAL B 1 398 ? -20.961 -45.838 23.319  1.00 23.93  ?  398 VAL B CA    1 
ATOM   6299 C  C     . VAL B 1 398 ? -21.670 -45.334 22.053  1.00 24.03  ?  398 VAL B C     1 
ATOM   6300 O  O     . VAL B 1 398 ? -21.184 -45.565 20.931  1.00 20.78  ?  398 VAL B O     1 
ATOM   6301 C  CB    . VAL B 1 398 ? -21.693 -47.026 23.958  1.00 24.67  ?  398 VAL B CB    1 
ATOM   6302 C  CG1   . VAL B 1 398 ? -21.915 -48.134 22.926  1.00 23.69  ?  398 VAL B CG1   1 
ATOM   6303 C  CG2   . VAL B 1 398 ? -20.937 -47.576 25.152  1.00 27.21  ?  398 VAL B CG2   1 
ATOM   6304 N  N     . TRP B 1 399 ? -22.799 -44.647 22.230  1.00 26.39  ?  399 TRP B N     1 
ATOM   6305 C  CA    . TRP B 1 399 ? -23.589 -44.094 21.107  1.00 26.71  ?  399 TRP B CA    1 
ATOM   6306 C  C     . TRP B 1 399 ? -22.640 -43.314 20.188  1.00 27.63  ?  399 TRP B C     1 
ATOM   6307 O  O     . TRP B 1 399 ? -22.663 -43.530 18.982  1.00 32.15  ?  399 TRP B O     1 
ATOM   6308 C  CB    . TRP B 1 399 ? -24.725 -43.203 21.619  1.00 25.11  ?  399 TRP B CB    1 
ATOM   6309 C  CG    . TRP B 1 399 ? -25.656 -42.786 20.528  1.00 25.47  ?  399 TRP B CG    1 
ATOM   6310 C  CD1   . TRP B 1 399 ? -26.729 -43.492 20.070  1.00 26.96  ?  399 TRP B CD1   1 
ATOM   6311 C  CD2   . TRP B 1 399 ? -25.539 -41.653 19.668  1.00 24.05  ?  399 TRP B CD2   1 
ATOM   6312 N  NE1   . TRP B 1 399 ? -27.310 -42.853 19.015  1.00 24.73  ?  399 TRP B NE1   1 
ATOM   6313 C  CE2   . TRP B 1 399 ? -26.597 -41.729 18.737  1.00 26.00  ?  399 TRP B CE2   1 
ATOM   6314 C  CE3   . TRP B 1 399 ? -24.656 -40.590 19.575  1.00 24.28  ?  399 TRP B CE3   1 
ATOM   6315 C  CZ2   . TRP B 1 399 ? -26.807 -40.757 17.755  1.00 29.51  ?  399 TRP B CZ2   1 
ATOM   6316 C  CZ3   . TRP B 1 399 ? -24.851 -39.635 18.585  1.00 29.91  ?  399 TRP B CZ3   1 
ATOM   6317 C  CH2   . TRP B 1 399 ? -25.903 -39.718 17.685  1.00 28.75  ?  399 TRP B CH2   1 
ATOM   6318 N  N     . SER B 1 400 ? -21.830 -42.429 20.760  1.00 29.63  ?  400 SER B N     1 
ATOM   6319 C  CA    . SER B 1 400 ? -20.985 -41.467 20.016  1.00 28.50  ?  400 SER B CA    1 
ATOM   6320 C  C     . SER B 1 400 ? -19.937 -42.225 19.206  1.00 28.67  ?  400 SER B C     1 
ATOM   6321 O  O     . SER B 1 400 ? -19.658 -41.801 18.066  1.00 32.87  ?  400 SER B O     1 
ATOM   6322 C  CB    . SER B 1 400 ? -20.351 -40.515 20.989  1.00 32.55  ?  400 SER B CB    1 
ATOM   6323 O  OG    . SER B 1 400 ? -21.333 -39.754 21.652  1.00 32.90  ?  400 SER B OG    1 
ATOM   6324 N  N     . LYS B 1 401 ? -19.385 -43.319 19.743  1.00 26.84  ?  401 LYS B N     1 
ATOM   6325 C  CA    . LYS B 1 401 ? -18.412 -44.132 18.969  1.00 27.27  ?  401 LYS B CA    1 
ATOM   6326 C  C     . LYS B 1 401 ? -19.142 -44.742 17.780  1.00 29.10  ?  401 LYS B C     1 
ATOM   6327 O  O     . LYS B 1 401 ? -18.521 -44.828 16.716  1.00 31.24  ?  401 LYS B O     1 
ATOM   6328 C  CB    . LYS B 1 401 ? -17.750 -45.221 19.802  1.00 27.87  ?  401 LYS B CB    1 
ATOM   6329 C  CG    . LYS B 1 401 ? -16.885 -44.706 20.940  1.00 27.58  ?  401 LYS B CG    1 
ATOM   6330 C  CD    . LYS B 1 401 ? -15.849 -45.733 21.410  1.00 34.43  ?  401 LYS B CD    1 
ATOM   6331 C  CE    . LYS B 1 401 ? -15.452 -45.646 22.869  1.00 34.21  ?  401 LYS B CE    1 
ATOM   6332 N  NZ    . LYS B 1 401 ? -15.213 -44.268 23.307  1.00 34.94  ?  401 LYS B NZ    1 
ATOM   6333 N  N     . LEU B 1 402 ? -20.404 -45.161 17.949  1.00 25.92  ?  402 LEU B N     1 
ATOM   6334 C  CA    . LEU B 1 402 ? -21.150 -45.814 16.861  1.00 25.47  ?  402 LEU B CA    1 
ATOM   6335 C  C     . LEU B 1 402 ? -21.397 -44.758 15.778  1.00 27.61  ?  402 LEU B C     1 
ATOM   6336 O  O     . LEU B 1 402 ? -21.182 -45.079 14.606  1.00 25.71  ?  402 LEU B O     1 
ATOM   6337 C  CB    . LEU B 1 402 ? -22.479 -46.350 17.392  1.00 24.11  ?  402 LEU B CB    1 
ATOM   6338 C  CG    . LEU B 1 402 ? -22.381 -47.586 18.239  1.00 23.77  ?  402 LEU B CG    1 
ATOM   6339 C  CD1   . LEU B 1 402 ? -23.655 -47.733 19.047  1.00 23.48  ?  402 LEU B CD1   1 
ATOM   6340 C  CD2   . LEU B 1 402 ? -22.109 -48.818 17.368  1.00 23.83  ?  402 LEU B CD2   1 
ATOM   6341 N  N     . ARG B 1 403 ? -21.827 -43.556 16.194  1.00 26.03  ?  403 ARG B N     1 
ATOM   6342 C  CA    . ARG B 1 403 ? -22.159 -42.431 15.296  1.00 27.25  ?  403 ARG B CA    1 
ATOM   6343 C  C     . ARG B 1 403 ? -20.917 -41.992 14.520  1.00 26.40  ?  403 ARG B C     1 
ATOM   6344 O  O     . ARG B 1 403 ? -21.053 -41.731 13.323  1.00 32.51  ?  403 ARG B O     1 
ATOM   6345 C  CB    . ARG B 1 403 ? -22.746 -41.242 16.061  1.00 27.99  ?  403 ARG B CB    1 
ATOM   6346 C  CG    . ARG B 1 403 ? -23.213 -40.113 15.168  1.00 27.33  ?  403 ARG B CG    1 
ATOM   6347 C  CD    . ARG B 1 403 ? -24.305 -40.561 14.226  1.00 27.91  ?  403 ARG B CD    1 
ATOM   6348 N  NE    . ARG B 1 403 ? -24.635 -39.500 13.266  1.00 26.69  ?  403 ARG B NE    1 
ATOM   6349 C  CZ    . ARG B 1 403 ? -24.049 -39.310 12.099  1.00 30.66  ?  403 ARG B CZ    1 
ATOM   6350 N  NH1   . ARG B 1 403 ? -23.094 -40.130 11.663  1.00 31.86  ?  403 ARG B NH1   1 
ATOM   6351 N  NH2   . ARG B 1 403 ? -24.463 -38.310 11.343  1.00 28.65  ?  403 ARG B NH2   1 
ATOM   6352 N  N     . ALA B 1 404 ? -19.772 -41.874 15.165  1.00 25.20  ?  404 ALA B N     1 
ATOM   6353 C  CA    . ALA B 1 404 ? -18.526 -41.423 14.521  1.00 27.82  ?  404 ALA B CA    1 
ATOM   6354 C  C     . ALA B 1 404 ? -18.059 -42.523 13.567  1.00 30.37  ?  404 ALA B C     1 
ATOM   6355 O  O     . ALA B 1 404 ? -17.518 -42.212 12.466  1.00 28.62  ?  404 ALA B O     1 
ATOM   6356 C  CB    . ALA B 1 404 ? -17.475 -41.098 15.542  1.00 28.32  ?  404 ALA B CB    1 
ATOM   6357 N  N     . SER B 1 405 ? -18.299 -43.775 13.924  1.00 29.01  ?  405 SER B N     1 
ATOM   6358 C  CA    . SER B 1 405 ? -17.938 -44.934 13.064  1.00 32.53  ?  405 SER B CA    1 
ATOM   6359 C  C     . SER B 1 405 ? -18.768 -44.908 11.750  1.00 29.35  ?  405 SER B C     1 
ATOM   6360 O  O     . SER B 1 405 ? -18.226 -45.257 10.665  1.00 28.72  ?  405 SER B O     1 
ATOM   6361 C  CB    . SER B 1 405 ? -18.056 -46.222 13.834  1.00 29.56  ?  405 SER B CB    1 
ATOM   6362 O  OG    . SER B 1 405 ? -17.894 -47.326 12.981  1.00 35.32  ?  405 SER B OG    1 
ATOM   6363 N  N     . ILE B 1 406 ? -20.040 -44.540 11.815  1.00 28.42  ?  406 ILE B N     1 
ATOM   6364 C  CA    . ILE B 1 406 ? -20.871 -44.357 10.602  1.00 26.61  ?  406 ILE B CA    1 
ATOM   6365 C  C     . ILE B 1 406 ? -20.223 -43.281 9.728   1.00 30.76  ?  406 ILE B C     1 
ATOM   6366 O  O     . ILE B 1 406 ? -20.039 -43.532 8.513   1.00 29.06  ?  406 ILE B O     1 
ATOM   6367 C  CB    . ILE B 1 406 ? -22.307 -44.054 10.975  1.00 28.63  ?  406 ILE B CB    1 
ATOM   6368 C  CG1   . ILE B 1 406 ? -22.964 -45.308 11.577  1.00 34.64  ?  406 ILE B CG1   1 
ATOM   6369 C  CG2   . ILE B 1 406 ? -23.082 -43.527 9.770   1.00 29.81  ?  406 ILE B CG2   1 
ATOM   6370 C  CD1   . ILE B 1 406 ? -24.332 -45.057 12.264  1.00 34.65  ?  406 ILE B CD1   1 
ATOM   6371 N  N     . LEU B 1 407 ? -19.791 -42.168 10.316  1.00 28.51  ?  407 LEU B N     1 
ATOM   6372 C  CA    . LEU B 1 407 ? -19.119 -41.097 9.535   1.00 27.53  ?  407 LEU B CA    1 
ATOM   6373 C  C     . LEU B 1 407 ? -17.830 -41.643 8.900   1.00 26.79  ?  407 LEU B C     1 
ATOM   6374 O  O     . LEU B 1 407 ? -17.659 -41.507 7.693   1.00 28.31  ?  407 LEU B O     1 
ATOM   6375 C  CB    . LEU B 1 407 ? -18.821 -39.917 10.467  1.00 28.31  ?  407 LEU B CB    1 
ATOM   6376 C  CG    . LEU B 1 407 ? -17.996 -38.794 9.852   1.00 30.48  ?  407 LEU B CG    1 
ATOM   6377 C  CD1   . LEU B 1 407 ? -18.822 -38.139 8.741   1.00 36.14  ?  407 LEU B CD1   1 
ATOM   6378 C  CD2   . LEU B 1 407 ? -17.555 -37.743 10.881  1.00 24.54  ?  407 LEU B CD2   1 
ATOM   6379 N  N     . ASN B 1 408 ? -16.933 -42.226 9.698   1.00 26.68  ?  408 ASN B N     1 
ATOM   6380 C  CA    . ASN B 1 408 ? -15.577 -42.610 9.269   1.00 24.87  ?  408 ASN B CA    1 
ATOM   6381 C  C     . ASN B 1 408 ? -15.704 -43.635 8.138   1.00 27.44  ?  408 ASN B C     1 
ATOM   6382 O  O     . ASN B 1 408 ? -14.990 -43.537 7.143   1.00 26.45  ?  408 ASN B O     1 
ATOM   6383 C  CB    . ASN B 1 408 ? -14.712 -43.032 10.449  1.00 27.86  ?  408 ASN B CB    1 
ATOM   6384 C  CG    . ASN B 1 408 ? -14.257 -41.856 11.318  1.00 31.18  ?  408 ASN B CG    1 
ATOM   6385 O  OD1   . ASN B 1 408 ? -14.043 -40.752 10.823  1.00 33.38  ?  408 ASN B OD1   1 
ATOM   6386 N  ND2   . ASN B 1 408 ? -14.165 -42.045 12.633  1.00 29.83  ?  408 ASN B ND2   1 
ATOM   6387 N  N     . THR B 1 409 ? -16.603 -44.597 8.259   1.00 28.70  ?  409 THR B N     1 
ATOM   6388 C  CA    . THR B 1 409 ? -16.844 -45.625 7.214   1.00 26.78  ?  409 THR B CA    1 
ATOM   6389 C  C     . THR B 1 409 ? -17.285 -44.951 5.908   1.00 27.17  ?  409 THR B C     1 
ATOM   6390 O  O     . THR B 1 409 ? -16.845 -45.350 4.824   1.00 29.79  ?  409 THR B O     1 
ATOM   6391 C  CB    . THR B 1 409 ? -17.918 -46.590 7.692   1.00 29.73  ?  409 THR B CB    1 
ATOM   6392 O  OG1   . THR B 1 409 ? -17.392 -47.218 8.848   1.00 33.16  ?  409 THR B OG1   1 
ATOM   6393 C  CG2   . THR B 1 409 ? -18.307 -47.622 6.664   1.00 35.95  ?  409 THR B CG2   1 
ATOM   6394 N  N     . TRP B 1 410 ? -18.181 -43.979 6.002   1.00 27.38  ?  410 TRP B N     1 
ATOM   6395 C  CA    . TRP B 1 410 ? -18.704 -43.230 4.862   1.00 25.40  ?  410 TRP B CA    1 
ATOM   6396 C  C     . TRP B 1 410 ? -17.553 -42.450 4.239   1.00 28.75  ?  410 TRP B C     1 
ATOM   6397 O  O     . TRP B 1 410 ? -17.393 -42.487 3.014   1.00 27.44  ?  410 TRP B O     1 
ATOM   6398 C  CB    . TRP B 1 410 ? -19.837 -42.319 5.342   1.00 32.08  ?  410 TRP B CB    1 
ATOM   6399 C  CG    . TRP B 1 410 ? -20.484 -41.539 4.254   1.00 32.42  ?  410 TRP B CG    1 
ATOM   6400 C  CD1   . TRP B 1 410 ? -21.509 -41.948 3.476   1.00 35.17  ?  410 TRP B CD1   1 
ATOM   6401 C  CD2   . TRP B 1 410 ? -20.091 -40.244 3.787   1.00 34.56  ?  410 TRP B CD2   1 
ATOM   6402 N  NE1   . TRP B 1 410 ? -21.817 -40.970 2.574   1.00 40.95  ?  410 TRP B NE1   1 
ATOM   6403 C  CE2   . TRP B 1 410 ? -20.943 -39.927 2.723   1.00 37.47  ?  410 TRP B CE2   1 
ATOM   6404 C  CE3   . TRP B 1 410 ? -19.145 -39.309 4.194   1.00 36.70  ?  410 TRP B CE3   1 
ATOM   6405 C  CZ2   . TRP B 1 410 ? -20.871 -38.709 2.055   1.00 40.88  ?  410 TRP B CZ2   1 
ATOM   6406 C  CZ3   . TRP B 1 410 ? -19.080 -38.101 3.546   1.00 39.23  ?  410 TRP B CZ3   1 
ATOM   6407 C  CH2   . TRP B 1 410 ? -19.926 -37.809 2.473   1.00 40.84  ?  410 TRP B CH2   1 
ATOM   6408 N  N     . ILE B 1 411 ? -16.754 -41.781 5.053   1.00 29.46  ?  411 ILE B N     1 
ATOM   6409 C  CA    . ILE B 1 411 ? -15.591 -41.007 4.558   1.00 28.59  ?  411 ILE B CA    1 
ATOM   6410 C  C     . ILE B 1 411 ? -14.656 -41.950 3.795   1.00 33.57  ?  411 ILE B C     1 
ATOM   6411 O  O     . ILE B 1 411 ? -14.190 -41.557 2.674   1.00 34.05  ?  411 ILE B O     1 
ATOM   6412 C  CB    . ILE B 1 411 ? -14.876 -40.273 5.697   1.00 31.62  ?  411 ILE B CB    1 
ATOM   6413 C  CG1   . ILE B 1 411 ? -15.705 -39.085 6.195   1.00 32.06  ?  411 ILE B CG1   1 
ATOM   6414 C  CG2   . ILE B 1 411 ? -13.487 -39.847 5.252   1.00 30.97  ?  411 ILE B CG2   1 
ATOM   6415 C  CD1   . ILE B 1 411 ? -15.142 -38.414 7.424   1.00 37.01  ?  411 ILE B CD1   1 
ATOM   6416 N  N     . SER B 1 412 ? -14.363 -43.133 4.321   1.00 29.13  ?  412 SER B N     1 
ATOM   6417 C  CA    . SER B 1 412 ? -13.373 -44.013 3.656   1.00 35.78  ?  412 SER B CA    1 
ATOM   6418 C  C     . SER B 1 412 ? -13.938 -44.539 2.306   1.00 36.15  ?  412 SER B C     1 
ATOM   6419 O  O     . SER B 1 412 ? -13.108 -44.684 1.394   1.00 39.61  ?  412 SER B O     1 
ATOM   6420 C  CB    . SER B 1 412 ? -12.839 -45.081 4.622   1.00 36.41  ?  412 SER B CB    1 
ATOM   6421 O  OG    . SER B 1 412 ? -13.747 -46.150 4.748   1.00 44.84  ?  412 SER B OG    1 
ATOM   6422 N  N     . LEU B 1 413 ? -15.261 -44.741 2.134   1.00 32.40  ?  413 LEU B N     1 
ATOM   6423 C  CA    . LEU B 1 413 ? -15.878 -45.037 0.801   1.00 32.95  ?  413 LEU B CA    1 
ATOM   6424 C  C     . LEU B 1 413 ? -15.640 -43.866 -0.153  1.00 30.27  ?  413 LEU B C     1 
ATOM   6425 O  O     . LEU B 1 413 ? -15.206 -44.142 -1.275  1.00 30.32  ?  413 LEU B O     1 
ATOM   6426 C  CB    . LEU B 1 413 ? -17.387 -45.340 0.887   1.00 32.02  ?  413 LEU B CB    1 
ATOM   6427 C  CG    . LEU B 1 413 ? -17.725 -46.710 1.493   1.00 35.57  ?  413 LEU B CG    1 
ATOM   6428 C  CD1   . LEU B 1 413 ? -19.134 -46.757 2.059   1.00 39.40  ?  413 LEU B CD1   1 
ATOM   6429 C  CD2   . LEU B 1 413 ? -17.510 -47.829 0.518   1.00 35.94  ?  413 LEU B CD2   1 
ATOM   6430 N  N     . LYS B 1 414 ? -15.948 -42.639 0.249   1.00 26.09  ?  414 LYS B N     1 
ATOM   6431 C  CA    . LYS B 1 414 ? -15.668 -41.422 -0.568  1.00 34.07  ?  414 LYS B CA    1 
ATOM   6432 C  C     . LYS B 1 414 ? -14.190 -41.404 -1.012  1.00 32.33  ?  414 LYS B C     1 
ATOM   6433 O  O     . LYS B 1 414 ? -13.943 -41.104 -2.177  1.00 32.05  ?  414 LYS B O     1 
ATOM   6434 C  CB    . LYS B 1 414 ? -15.964 -40.121 0.197   1.00 36.02  ?  414 LYS B CB    1 
ATOM   6435 C  CG    . LYS B 1 414 ? -17.424 -39.882 0.583   1.00 36.10  ?  414 LYS B CG    1 
ATOM   6436 C  CD    . LYS B 1 414 ? -18.311 -39.412 -0.535  1.00 40.99  ?  414 LYS B CD    1 
ATOM   6437 C  CE    . LYS B 1 414 ? -17.835 -38.134 -1.187  1.00 41.98  ?  414 LYS B CE    1 
ATOM   6438 N  NZ    . LYS B 1 414 ? -18.835 -37.668 -2.183  1.00 41.57  ?  414 LYS B NZ    1 
ATOM   6439 N  N     . GLN B 1 415 ? -13.247 -41.722 -0.119  1.00 35.12  ?  415 GLN B N     1 
ATOM   6440 C  CA    . GLN B 1 415 ? -11.776 -41.689 -0.383  1.00 37.30  ?  415 GLN B CA    1 
ATOM   6441 C  C     . GLN B 1 415 ? -11.427 -42.809 -1.367  1.00 32.87  ?  415 GLN B C     1 
ATOM   6442 O  O     . GLN B 1 415 ? -10.672 -42.530 -2.300  1.00 30.18  ?  415 GLN B O     1 
ATOM   6443 C  CB    . GLN B 1 415 ? -10.900 -41.759 0.890   1.00 37.78  ?  415 GLN B CB    1 
ATOM   6444 C  CG    . GLN B 1 415 ? -11.043 -40.590 1.867   1.00 44.26  ?  415 GLN B CG    1 
ATOM   6445 C  CD    . GLN B 1 415 ? -10.641 -39.196 1.398   1.00 52.81  ?  415 GLN B CD    1 
ATOM   6446 O  OE1   . GLN B 1 415 ? -10.481 -38.899 0.224   1.00 54.10  ?  415 GLN B OE1   1 
ATOM   6447 N  NE2   . GLN B 1 415 ? -10.530 -38.266 2.331   1.00 56.48  ?  415 GLN B NE2   1 
ATOM   6448 N  N     . ALA B 1 416 ? -11.943 -44.022 -1.178  1.00 32.06  ?  416 ALA B N     1 
ATOM   6449 C  CA    . ALA B 1 416 ? -11.687 -45.169 -2.098  1.00 31.30  ?  416 ALA B CA    1 
ATOM   6450 C  C     . ALA B 1 416 ? -12.289 -44.861 -3.479  1.00 31.88  ?  416 ALA B C     1 
ATOM   6451 O  O     . ALA B 1 416 ? -11.692 -45.258 -4.457  1.00 27.99  ?  416 ALA B O     1 
ATOM   6452 C  CB    . ALA B 1 416 ? -12.270 -46.467 -1.561  1.00 30.30  ?  416 ALA B CB    1 
ATOM   6453 N  N     . ASP B 1 417 ? -13.459 -44.216 -3.544  1.00 32.51  ?  417 ASP B N     1 
ATOM   6454 C  CA    . ASP B 1 417 ? -14.095 -43.883 -4.840  1.00 34.65  ?  417 ASP B CA    1 
ATOM   6455 C  C     . ASP B 1 417 ? -13.204 -42.851 -5.544  1.00 36.26  ?  417 ASP B C     1 
ATOM   6456 O  O     . ASP B 1 417 ? -12.973 -43.017 -6.746  1.00 37.80  ?  417 ASP B O     1 
ATOM   6457 C  CB    . ASP B 1 417 ? -15.536 -43.388 -4.694  1.00 33.16  ?  417 ASP B CB    1 
ATOM   6458 C  CG    . ASP B 1 417 ? -16.223 -43.115 -6.035  1.00 37.60  ?  417 ASP B CG    1 
ATOM   6459 O  OD1   . ASP B 1 417 ? -16.154 -44.013 -6.942  1.00 36.69  ?  417 ASP B OD1   1 
ATOM   6460 O  OD2   . ASP B 1 417 ? -16.816 -42.007 -6.197  1.00 33.10  ?  417 ASP B OD2   1 
ATOM   6461 N  N     . LYS B 1 418 ? -12.720 -41.844 -4.809  1.00 37.11  ?  418 LYS B N     1 
ATOM   6462 C  CA    . LYS B 1 418 ? -11.820 -40.792 -5.352  1.00 40.58  ?  418 LYS B CA    1 
ATOM   6463 C  C     . LYS B 1 418 ? -10.556 -41.456 -5.941  1.00 43.19  ?  418 LYS B C     1 
ATOM   6464 O  O     . LYS B 1 418 ? -10.156 -41.073 -7.057  1.00 41.15  ?  418 LYS B O     1 
ATOM   6465 C  CB    . LYS B 1 418 ? -11.473 -39.741 -4.297  1.00 44.84  ?  418 LYS B CB    1 
ATOM   6466 C  CG    . LYS B 1 418 ? -10.662 -38.557 -4.819  1.00 49.42  ?  418 LYS B CG    1 
ATOM   6467 C  CD    . LYS B 1 418 ? -10.533 -37.400 -3.872  1.00 55.98  ?  418 LYS B CD    1 
ATOM   6468 C  CE    . LYS B 1 418 ? -9.320  -36.530 -4.160  1.00 65.41  ?  418 LYS B CE    1 
ATOM   6469 N  NZ    . LYS B 1 418 ? -9.391  -35.210 -3.475  1.00 65.87  ?  418 LYS B NZ    1 
ATOM   6470 N  N     . LYS B 1 419 ? -9.977  -42.437 -5.251  1.00 37.71  ?  419 LYS B N     1 
ATOM   6471 C  CA    . LYS B 1 419 ? -8.748  -43.130 -5.687  1.00 43.75  ?  419 LYS B CA    1 
ATOM   6472 C  C     . LYS B 1 419 ? -9.018  -43.864 -7.007  1.00 51.96  ?  419 LYS B C     1 
ATOM   6473 O  O     . LYS B 1 419 ? -8.274  -43.618 -7.990  1.00 43.88  ?  419 LYS B O     1 
ATOM   6474 C  CB    . LYS B 1 419 ? -8.257  -44.066 -4.578  1.00 51.04  ?  419 LYS B CB    1 
ATOM   6475 C  CG    . LYS B 1 419 ? -7.198  -45.103 -4.921  1.00 65.18  ?  419 LYS B CG    1 
ATOM   6476 C  CD    . LYS B 1 419 ? -6.794  -45.910 -3.687  1.00 80.47  ?  419 LYS B CD    1 
ATOM   6477 C  CE    . LYS B 1 419 ? -5.296  -46.038 -3.485  1.00 91.26  ?  419 LYS B CE    1 
ATOM   6478 N  NZ    . LYS B 1 419 ? -4.795  -47.259 -4.149  1.00 89.52  ?  419 LYS B NZ    1 
ATOM   6479 N  N     . ILE B 1 420 ? -10.022 -44.746 -7.028  1.00 53.55  ?  420 ILE B N     1 
ATOM   6480 C  CA    . ILE B 1 420 ? -10.324 -45.619 -8.205  1.00 54.90  ?  420 ILE B CA    1 
ATOM   6481 C  C     . ILE B 1 420 ? -10.795 -44.783 -9.408  1.00 45.84  ?  420 ILE B C     1 
ATOM   6482 O  O     . ILE B 1 420 ? -10.552 -45.200 -10.518 1.00 41.06  ?  420 ILE B O     1 
ATOM   6483 C  CB    . ILE B 1 420 ? -11.352 -46.673 -7.805  1.00 57.16  ?  420 ILE B CB    1 
ATOM   6484 C  CG1   . ILE B 1 420 ? -11.266 -47.907 -8.685  1.00 59.07  ?  420 ILE B CG1   1 
ATOM   6485 C  CG2   . ILE B 1 420 ? -12.746 -46.075 -7.810  1.00 61.97  ?  420 ILE B CG2   1 
ATOM   6486 C  CD1   . ILE B 1 420 ? -11.662 -49.146 -7.933  1.00 72.22  ?  420 ILE B CD1   1 
ATOM   6487 N  N     . ARG B 1 421 ? -11.379 -43.612 -9.173  1.00 46.74  ?  421 ARG B N     1 
ATOM   6488 C  CA    . ARG B 1 421 ? -11.779 -42.654 -10.234 1.00 50.13  ?  421 ARG B CA    1 
ATOM   6489 C  C     . ARG B 1 421 ? -10.549 -42.181 -11.023 1.00 55.73  ?  421 ARG B C     1 
ATOM   6490 O  O     . ARG B 1 421 ? -10.715 -41.916 -12.215 1.00 57.43  ?  421 ARG B O     1 
ATOM   6491 C  CB    . ARG B 1 421 ? -12.438 -41.404 -9.647  1.00 49.22  ?  421 ARG B CB    1 
ATOM   6492 C  CG    . ARG B 1 421 ? -13.934 -41.494 -9.453  1.00 47.08  ?  421 ARG B CG    1 
ATOM   6493 C  CD    . ARG B 1 421 ? -14.586 -40.138 -9.389  1.00 51.63  ?  421 ARG B CD    1 
ATOM   6494 N  NE    . ARG B 1 421 ? -13.938 -39.118 -8.566  1.00 53.74  ?  421 ARG B NE    1 
ATOM   6495 C  CZ    . ARG B 1 421 ? -14.225 -38.844 -7.281  1.00 51.15  ?  421 ARG B CZ    1 
ATOM   6496 N  NH1   . ARG B 1 421 ? -15.105 -39.549 -6.578  1.00 50.59  ?  421 ARG B NH1   1 
ATOM   6497 N  NH2   . ARG B 1 421 ? -13.587 -37.862 -6.685  1.00 49.44  ?  421 ARG B NH2   1 
ATOM   6498 N  N     . GLU B 1 422 ? -9.387  -42.031 -10.373 1.00 58.96  ?  422 GLU B N     1 
ATOM   6499 C  CA    . GLU B 1 422 ? -8.104  -41.654 -11.044 1.00 71.22  ?  422 GLU B CA    1 
ATOM   6500 C  C     . GLU B 1 422 ? -7.692  -42.738 -12.061 1.00 81.61  ?  422 GLU B C     1 
ATOM   6501 O  O     . GLU B 1 422 ? -7.210  -42.387 -13.166 1.00 85.82  ?  422 GLU B O     1 
ATOM   6502 C  CB    . GLU B 1 422 ? -6.975  -41.448 -10.034 1.00 74.95  ?  422 GLU B CB    1 
ATOM   6503 C  CG    . GLU B 1 422 ? -7.233  -40.325 -9.032  1.00 88.08  ?  422 GLU B CG    1 
ATOM   6504 C  CD    . GLU B 1 422 ? -6.397  -40.349 -7.745  1.00 88.41  ?  422 GLU B CD    1 
ATOM   6505 O  OE1   . GLU B 1 422 ? -5.525  -41.280 -7.590  1.00 63.21  ?  422 GLU B OE1   1 
ATOM   6506 O  OE2   . GLU B 1 422 ? -6.609  -39.421 -6.886  1.00 78.96  ?  422 GLU B OE2   1 
ATOM   6507 N  N     . CYS B 1 423 ? -7.926  -44.011 -11.729 1.00 87.35  ?  423 CYS B N     1 
ATOM   6508 C  CA    . CYS B 1 423 ? -7.681  -45.196 -12.604 1.00 85.56  ?  423 CYS B CA    1 
ATOM   6509 C  C     . CYS B 1 423 ? -8.781  -45.350 -13.670 1.00 81.87  ?  423 CYS B C     1 
ATOM   6510 O  O     . CYS B 1 423 ? -8.954  -46.486 -14.124 1.00 73.69  ?  423 CYS B O     1 
ATOM   6511 C  CB    . CYS B 1 423 ? -7.603  -46.490 -11.785 1.00 91.29  ?  423 CYS B CB    1 
ATOM   6512 S  SG    . CYS B 1 423 ? -6.726  -46.355 -10.197 1.00 82.24  ?  423 CYS B SG    1 
ATOM   6513 N  N     . ASN B 1 424 ? -9.444  -44.256 -14.075 1.00 84.33  ?  424 ASN B N     1 
ATOM   6514 C  CA    . ASN B 1 424 ? -10.549 -44.325 -15.074 1.00 83.99  ?  424 ASN B CA    1 
ATOM   6515 C  C     . ASN B 1 424 ? -10.377 -43.296 -16.197 1.00 82.61  ?  424 ASN B C     1 
ATOM   6516 O  O     . ASN B 1 424 ? -11.176 -43.344 -17.124 1.00 84.31  ?  424 ASN B O     1 
ATOM   6517 C  CB    . ASN B 1 424 ? -11.904 -43.915 -14.490 1.00 76.15  ?  424 ASN B CB    1 
ATOM   6518 C  CG    . ASN B 1 424 ? -12.723 -44.998 -13.820 1.00 68.12  ?  424 ASN B CG    1 
ATOM   6519 O  OD1   . ASN B 1 424 ? -12.559 -46.180 -14.070 1.00 57.30  ?  424 ASN B OD1   1 
ATOM   6520 N  ND2   . ASN B 1 424 ? -13.623 -44.587 -12.955 1.00 52.84  ?  424 ASN B ND2   1 
ATOM   6521 N  N     . LEU B 1 425 ? -9.407  -42.388 -16.098 1.00 97.22  ?  425 LEU B N     1 
ATOM   6522 C  CA    . LEU B 1 425 ? -9.186  -41.276 -17.080 1.00 103.33 ?  425 LEU B CA    1 
ATOM   6523 C  C     . LEU B 1 425 ? -8.411  -41.764 -18.325 1.00 94.74  ?  425 LEU B C     1 
ATOM   6524 O  O     . LEU B 1 425 ? -7.434  -42.517 -18.301 1.00 74.95  ?  425 LEU B O     1 
ATOM   6525 C  CB    . LEU B 1 425 ? -8.471  -40.117 -16.365 1.00 98.45  ?  425 LEU B CB    1 
ATOM   6526 C  CG    . LEU B 1 425 ? -9.377  -39.110 -15.637 1.00 97.53  ?  425 LEU B CG    1 
ATOM   6527 C  CD1   . LEU B 1 425 ? -10.277 -39.776 -14.602 1.00 102.76 ?  425 LEU B CD1   1 
ATOM   6528 C  CD2   . LEU B 1 425 ? -8.557  -38.007 -14.972 1.00 96.19  ?  425 LEU B CD2   1 
HETATM 6529 P  PG    . ANP C 2 .   ? -50.104 -64.711 61.472  1.00 60.30  ?  501 ANP A PG    1 
HETATM 6530 O  O1G   . ANP C 2 .   ? -49.710 -64.194 60.101  1.00 61.07  ?  501 ANP A O1G   1 
HETATM 6531 O  O2G   . ANP C 2 .   ? -50.933 -65.954 61.251  1.00 42.78  ?  501 ANP A O2G   1 
HETATM 6532 O  O3G   . ANP C 2 .   ? -48.817 -64.967 62.221  1.00 48.15  ?  501 ANP A O3G   1 
HETATM 6533 P  PB    . ANP C 2 .   ? -50.704 -62.056 62.413  1.00 42.16  ?  501 ANP A PB    1 
HETATM 6534 O  O1B   . ANP C 2 .   ? -50.920 -61.639 63.810  1.00 40.53  ?  501 ANP A O1B   1 
HETATM 6535 O  O2B   . ANP C 2 .   ? -49.482 -61.570 61.658  1.00 47.72  ?  501 ANP A O2B   1 
HETATM 6536 N  N3B   . ANP C 2 .   ? -51.015 -63.627 62.298  1.00 47.20  ?  501 ANP A N3B   1 
HETATM 6537 P  PA    . ANP C 2 .   ? -52.310 -60.120 60.882  1.00 43.91  ?  501 ANP A PA    1 
HETATM 6538 O  O1A   . ANP C 2 .   ? -53.020 -59.283 61.859  1.00 42.87  ?  501 ANP A O1A   1 
HETATM 6539 O  O2A   . ANP C 2 .   ? -51.112 -59.522 60.226  1.00 41.74  ?  501 ANP A O2A   1 
HETATM 6540 O  O3A   . ANP C 2 .   ? -51.952 -61.498 61.588  1.00 42.55  ?  501 ANP A O3A   1 
HETATM 6541 O  "O5'" . ANP C 2 .   ? -53.337 -60.607 59.746  1.00 41.78  ?  501 ANP A "O5'" 1 
HETATM 6542 C  "C5'" . ANP C 2 .   ? -54.596 -61.237 60.017  1.00 40.90  ?  501 ANP A "C5'" 1 
HETATM 6543 C  "C4'" . ANP C 2 .   ? -54.747 -62.476 59.162  1.00 39.83  ?  501 ANP A "C4'" 1 
HETATM 6544 O  "O4'" . ANP C 2 .   ? -55.094 -62.122 57.800  1.00 36.80  ?  501 ANP A "O4'" 1 
HETATM 6545 C  "C3'" . ANP C 2 .   ? -53.478 -63.323 58.988  1.00 41.87  ?  501 ANP A "C3'" 1 
HETATM 6546 O  "O3'" . ANP C 2 .   ? -53.532 -64.440 59.847  1.00 53.23  ?  501 ANP A "O3'" 1 
HETATM 6547 C  "C2'" . ANP C 2 .   ? -53.470 -63.737 57.510  1.00 39.04  ?  501 ANP A "C2'" 1 
HETATM 6548 O  "O2'" . ANP C 2 .   ? -53.341 -65.133 57.344  1.00 43.50  ?  501 ANP A "O2'" 1 
HETATM 6549 C  "C1'" . ANP C 2 .   ? -54.823 -63.248 57.009  1.00 35.01  ?  501 ANP A "C1'" 1 
HETATM 6550 N  N9    . ANP C 2 .   ? -54.856 -62.870 55.631  1.00 38.06  ?  501 ANP A N9    1 
HETATM 6551 C  C8    . ANP C 2 .   ? -53.965 -62.076 54.957  1.00 39.90  ?  501 ANP A C8    1 
HETATM 6552 N  N7    . ANP C 2 .   ? -54.270 -61.921 53.687  1.00 36.39  ?  501 ANP A N7    1 
HETATM 6553 C  C5    . ANP C 2 .   ? -55.435 -62.644 53.523  1.00 34.25  ?  501 ANP A C5    1 
HETATM 6554 C  C6    . ANP C 2 .   ? -56.275 -62.845 52.428  1.00 37.62  ?  501 ANP A C6    1 
HETATM 6555 N  N6    . ANP C 2 .   ? -56.070 -62.314 51.230  1.00 37.91  ?  501 ANP A N6    1 
HETATM 6556 N  N1    . ANP C 2 .   ? -57.367 -63.609 52.615  1.00 35.01  ?  501 ANP A N1    1 
HETATM 6557 C  C2    . ANP C 2 .   ? -57.589 -64.107 53.835  1.00 42.68  ?  501 ANP A C2    1 
HETATM 6558 N  N3    . ANP C 2 .   ? -56.872 -63.986 54.943  1.00 40.67  ?  501 ANP A N3    1 
HETATM 6559 C  C4    . ANP C 2 .   ? -55.802 -63.229 54.713  1.00 38.53  ?  501 ANP A C4    1 
HETATM 6560 C  C10   . OK8 D 3 .   ? -41.465 -62.063 60.799  1.00 48.47  ?  502 OK8 A C10   1 
HETATM 6561 C  C20   . OK8 D 3 .   ? -36.270 -61.568 56.081  1.00 35.96  ?  502 OK8 A C20   1 
HETATM 6562 C  C21   . OK8 D 3 .   ? -36.194 -60.132 56.667  1.00 35.64  ?  502 OK8 A C21   1 
HETATM 6563 O  O01   . OK8 D 3 .   ? -45.697 -60.030 63.192  1.00 119.94 ?  502 OK8 A O01   1 
HETATM 6564 C  C02   . OK8 D 3 .   ? -44.661 -60.153 62.474  1.00 98.37  ?  502 OK8 A C02   1 
HETATM 6565 O  O03   . OK8 D 3 .   ? -44.572 -59.608 61.348  1.00 103.79 -1 502 OK8 A O03   1 
HETATM 6566 C  C04   . OK8 D 3 .   ? -43.445 -60.928 62.973  1.00 77.88  ?  502 OK8 A C04   1 
HETATM 6567 C  C05   . OK8 D 3 .   ? -42.217 -60.164 62.449  1.00 74.29  ?  502 OK8 A C05   1 
HETATM 6568 C  C06   . OK8 D 3 .   ? -41.155 -59.946 63.567  1.00 70.07  ?  502 OK8 A C06   1 
HETATM 6569 O  O07   . OK8 D 3 .   ? -41.162 -60.770 64.513  1.00 68.47  ?  502 OK8 A O07   1 
HETATM 6570 O  O08   . OK8 D 3 .   ? -40.300 -59.019 63.426  1.00 58.40  -1 502 OK8 A O08   1 
HETATM 6571 N  N09   . OK8 D 3 .   ? -41.487 -60.807 61.318  1.00 68.29  ?  502 OK8 A N09   1 
HETATM 6572 O  O11   . OK8 D 3 .   ? -42.029 -62.983 61.249  1.00 49.31  ?  502 OK8 A O11   1 
HETATM 6573 C  C12   . OK8 D 3 .   ? -40.538 -62.299 59.739  1.00 53.03  ?  502 OK8 A C12   1 
HETATM 6574 N  N13   . OK8 D 3 .   ? -39.864 -63.504 59.444  1.00 50.96  ?  502 OK8 A N13   1 
HETATM 6575 C  C14   . OK8 D 3 .   ? -38.980 -63.197 58.461  1.00 46.16  ?  502 OK8 A C14   1 
HETATM 6576 N  N15   . OK8 D 3 .   ? -39.041 -61.771 58.144  1.00 42.06  ?  502 OK8 A N15   1 
HETATM 6577 C  C16   . OK8 D 3 .   ? -40.020 -61.243 58.918  1.00 44.83  ?  502 OK8 A C16   1 
HETATM 6578 N  N17   . OK8 D 3 .   ? -40.343 -59.937 58.789  1.00 42.78  ?  502 OK8 A N17   1 
HETATM 6579 C  C18   . OK8 D 3 .   ? -38.287 -61.063 57.100  1.00 34.80  ?  502 OK8 A C18   1 
HETATM 6580 O  O19   . OK8 D 3 .   ? -37.558 -61.991 56.446  1.00 31.59  ?  502 OK8 A O19   1 
HETATM 6581 O  O22   . OK8 D 3 .   ? -36.459 -59.308 55.648  1.00 29.45  ?  502 OK8 A O22   1 
HETATM 6582 C  C23   . OK8 D 3 .   ? -37.295 -60.054 57.724  1.00 33.92  ?  502 OK8 A C23   1 
HETATM 6583 O  O24   . OK8 D 3 .   ? -37.859 -58.805 57.769  1.00 37.80  ?  502 OK8 A O24   1 
HETATM 6584 C  C25   . OK8 D 3 .   ? -35.233 -62.538 56.750  1.00 34.47  ?  502 OK8 A C25   1 
HETATM 6585 O  O26   . OK8 D 3 .   ? -35.334 -62.399 58.090  1.00 31.07  ?  502 OK8 A O26   1 
HETATM 6586 P  P27   . OK8 D 3 .   ? -34.345 -63.468 59.133  1.00 31.70  ?  502 OK8 A P27   1 
HETATM 6587 O  O28   . OK8 D 3 .   ? -34.722 -62.906 60.474  1.00 37.36  ?  502 OK8 A O28   1 
HETATM 6588 O  O29   . OK8 D 3 .   ? -34.811 -64.895 58.802  1.00 27.55  -1 502 OK8 A O29   1 
HETATM 6589 O  O30   . OK8 D 3 .   ? -32.940 -63.132 58.758  1.00 31.74  -1 502 OK8 A O30   1 
HETATM 6590 C  C1    . EDO E 4 .   ? -33.922 -51.687 34.933  1.00 63.03  ?  503 EDO A C1    1 
HETATM 6591 O  O1    . EDO E 4 .   ? -33.300 -52.970 34.758  1.00 57.94  ?  503 EDO A O1    1 
HETATM 6592 C  C2    . EDO E 4 .   ? -32.986 -50.603 35.395  1.00 60.85  ?  503 EDO A C2    1 
HETATM 6593 O  O2    . EDO E 4 .   ? -32.835 -50.600 36.820  1.00 73.34  ?  503 EDO A O2    1 
HETATM 6594 C  C1    . EDO F 4 .   ? -47.611 -67.142 41.221  1.00 61.02  ?  504 EDO A C1    1 
HETATM 6595 O  O1    . EDO F 4 .   ? -47.638 -68.517 41.464  1.00 62.80  ?  504 EDO A O1    1 
HETATM 6596 C  C2    . EDO F 4 .   ? -47.768 -66.423 42.500  1.00 61.82  ?  504 EDO A C2    1 
HETATM 6597 O  O2    . EDO F 4 .   ? -48.198 -65.084 42.346  1.00 59.81  ?  504 EDO A O2    1 
HETATM 6598 C  C1    . EDO G 4 .   ? -38.128 -66.785 16.873  1.00 65.48  ?  505 EDO A C1    1 
HETATM 6599 O  O1    . EDO G 4 .   ? -37.085 -66.337 16.054  1.00 59.49  ?  505 EDO A O1    1 
HETATM 6600 C  C2    . EDO G 4 .   ? -39.002 -67.800 16.221  1.00 65.46  ?  505 EDO A C2    1 
HETATM 6601 O  O2    . EDO G 4 .   ? -38.283 -68.936 15.860  1.00 56.35  ?  505 EDO A O2    1 
HETATM 6602 C  C1    . EDO H 4 .   ? -30.997 -36.103 20.696  1.00 45.91  ?  506 EDO A C1    1 
HETATM 6603 O  O1    . EDO H 4 .   ? -29.762 -36.866 20.698  1.00 43.27  ?  506 EDO A O1    1 
HETATM 6604 C  C2    . EDO H 4 .   ? -31.942 -36.550 19.633  1.00 46.21  ?  506 EDO A C2    1 
HETATM 6605 O  O2    . EDO H 4 .   ? -32.472 -37.852 19.855  1.00 51.12  ?  506 EDO A O2    1 
HETATM 6606 MG MG    . MG  I 5 .   ? -48.781 -61.064 59.598  1.00 48.67  ?  507 MG  A MG    1 
HETATM 6607 MG MG    . MG  J 5 .   ? -40.332 -65.412 60.805  1.00 50.24  ?  508 MG  A MG    1 
HETATM 6608 C  C1    . EDO K 4 .   ? -29.378 -57.248 40.651  1.00 39.57  ?  701 EDO B C1    1 
HETATM 6609 O  O1    . EDO K 4 .   ? -29.224 -57.350 39.264  1.00 38.12  ?  701 EDO B O1    1 
HETATM 6610 C  C2    . EDO K 4 .   ? -30.285 -56.111 40.955  1.00 42.81  ?  701 EDO B C2    1 
HETATM 6611 O  O2    . EDO K 4 .   ? -31.549 -56.210 40.309  1.00 45.04  ?  701 EDO B O2    1 
HETATM 6612 P  PG    . ANP L 2 .   ? -11.025 -15.589 12.474  1.00 67.38  ?  702 ANP B PG    1 
HETATM 6613 O  O1G   . ANP L 2 .   ? -11.425 -16.962 12.984  1.00 70.64  ?  702 ANP B O1G   1 
HETATM 6614 O  O2G   . ANP L 2 .   ? -10.153 -15.745 11.246  1.00 51.63  ?  702 ANP B O2G   1 
HETATM 6615 O  O3G   . ANP L 2 .   ? -12.270 -14.811 12.146  1.00 51.63  ?  702 ANP B O3G   1 
HETATM 6616 P  PB    . ANP L 2 .   ? -10.412 -14.603 15.124  1.00 43.36  ?  702 ANP B PB    1 
HETATM 6617 O  O1B   . ANP L 2 .   ? -10.239 -13.215 15.638  1.00 44.00  ?  702 ANP B O1B   1 
HETATM 6618 O  O2B   . ANP L 2 .   ? -11.605 -15.406 15.576  1.00 46.82  ?  702 ANP B O2B   1 
HETATM 6619 N  N3B   . ANP L 2 .   ? -10.119 -14.779 13.566  1.00 59.70  ?  702 ANP B N3B   1 
HETATM 6620 P  PA    . ANP L 2 .   ? -8.869  -16.200 16.999  1.00 42.59  ?  702 ANP B PA    1 
HETATM 6621 O  O1A   . ANP L 2 .   ? -8.152  -15.371 17.981  1.00 42.73  ?  702 ANP B O1A   1 
HETATM 6622 O  O2A   . ANP L 2 .   ? -10.126 -16.825 17.476  1.00 51.77  ?  702 ANP B O2A   1 
HETATM 6623 O  O3A   . ANP L 2 .   ? -9.129  -15.340 15.671  1.00 49.02  ?  702 ANP B O3A   1 
HETATM 6624 O  "O5'" . ANP L 2 .   ? -7.926  -17.338 16.374  1.00 40.01  ?  702 ANP B "O5'" 1 
HETATM 6625 C  "C5'" . ANP L 2 .   ? -6.577  -17.065 15.953  1.00 37.97  ?  702 ANP B "C5'" 1 
HETATM 6626 C  "C4'" . ANP L 2 .   ? -6.311  -17.828 14.688  1.00 37.01  ?  702 ANP B "C4'" 1 
HETATM 6627 O  "O4'" . ANP L 2 .   ? -5.997  -19.209 15.000  1.00 36.11  ?  702 ANP B "O4'" 1 
HETATM 6628 C  "C3'" . ANP L 2 .   ? -7.479  -17.915 13.695  1.00 40.30  ?  702 ANP B "C3'" 1 
HETATM 6629 O  "O3'" . ANP L 2 .   ? -7.150  -17.217 12.502  1.00 40.72  ?  702 ANP B "O3'" 1 
HETATM 6630 C  "C2'" . ANP L 2 .   ? -7.660  -19.420 13.442  1.00 37.73  ?  702 ANP B "C2'" 1 
HETATM 6631 O  "O2'" . ANP L 2 .   ? -7.885  -19.715 12.084  1.00 42.94  ?  702 ANP B "O2'" 1 
HETATM 6632 C  "C1'" . ANP L 2 .   ? -6.316  -19.976 13.873  1.00 35.17  ?  702 ANP B "C1'" 1 
HETATM 6633 N  N9    . ANP L 2 .   ? -6.321  -21.345 14.239  1.00 36.90  ?  702 ANP B N9    1 
HETATM 6634 C  C8    . ANP L 2 .   ? -7.244  -22.004 14.974  1.00 34.65  ?  702 ANP B C8    1 
HETATM 6635 N  N7    . ANP L 2 .   ? -6.954  -23.273 15.142  1.00 34.14  ?  702 ANP B N7    1 
HETATM 6636 C  C5    . ANP L 2 .   ? -5.756  -23.450 14.479  1.00 33.82  ?  702 ANP B C5    1 
HETATM 6637 C  C6    . ANP L 2 .   ? -4.928  -24.561 14.286  1.00 33.54  ?  702 ANP B C6    1 
HETATM 6638 N  N6    . ANP L 2 .   ? -5.182  -25.782 14.741  1.00 27.55  ?  702 ANP B N6    1 
HETATM 6639 N  N1    . ANP L 2 .   ? -3.808  -24.364 13.561  1.00 32.28  ?  702 ANP B N1    1 
HETATM 6640 C  C2    . ANP L 2 .   ? -3.557  -23.142 13.087  1.00 39.54  ?  702 ANP B C2    1 
HETATM 6641 N  N3    . ANP L 2 .   ? -4.268  -22.023 13.204  1.00 39.00  ?  702 ANP B N3    1 
HETATM 6642 C  C4    . ANP L 2 .   ? -5.364  -22.257 13.915  1.00 37.42  ?  702 ANP B C4    1 
HETATM 6643 C  C10   . OK8 M 3 .   ? -19.776 -16.213 15.128  1.00 50.08  ?  703 OK8 B C10   1 
HETATM 6644 C  C20   . OK8 M 3 .   ? -24.869 -20.913 15.355  1.00 40.15  ?  703 OK8 B C20   1 
HETATM 6645 C  C21   . OK8 M 3 .   ? -25.106 -20.326 16.771  1.00 37.22  ?  703 OK8 B C21   1 
HETATM 6646 O  O01   . OK8 M 3 .   ? -16.119 -14.735 17.574  1.00 84.46  ?  703 OK8 B O01   1 
HETATM 6647 C  C02   . OK8 M 3 .   ? -16.747 -13.788 17.032  1.00 83.89  ?  703 OK8 B C02   1 
HETATM 6648 O  O03   . OK8 M 3 .   ? -16.573 -12.531 17.304  1.00 79.18  -1 703 OK8 B O03   1 
HETATM 6649 C  C04   . OK8 M 3 .   ? -17.798 -14.253 16.096  1.00 73.13  ?  703 OK8 B C04   1 
HETATM 6650 C  C05   . OK8 M 3 .   ? -18.831 -14.823 17.018  1.00 73.24  ?  703 OK8 B C05   1 
HETATM 6651 C  C06   . OK8 M 3 .   ? -19.844 -13.656 17.493  1.00 66.30  ?  703 OK8 B C06   1 
HETATM 6652 O  O07   . OK8 M 3 .   ? -19.787 -12.551 16.911  1.00 71.82  ?  703 OK8 B O07   1 
HETATM 6653 O  O08   . OK8 M 3 .   ? -20.673 -13.901 18.386  1.00 52.44  -1 703 OK8 B O08   1 
HETATM 6654 N  N09   . OK8 M 3 .   ? -19.602 -15.832 16.436  1.00 69.70  ?  703 OK8 B N09   1 
HETATM 6655 O  O11   . OK8 M 3 .   ? -19.284 -15.673 14.181  1.00 52.03  ?  703 OK8 B O11   1 
HETATM 6656 C  C12   . OK8 M 3 .   ? -20.734 -17.277 14.873  1.00 50.14  ?  703 OK8 B C12   1 
HETATM 6657 N  N13   . OK8 M 3 .   ? -21.351 -17.583 13.692  1.00 46.36  ?  703 OK8 B N13   1 
HETATM 6658 C  C14   . OK8 M 3 .   ? -22.197 -18.599 13.982  1.00 47.78  ?  703 OK8 B C14   1 
HETATM 6659 N  N15   . OK8 M 3 .   ? -22.193 -18.875 15.374  1.00 46.09  ?  703 OK8 B N15   1 
HETATM 6660 C  C16   . OK8 M 3 .   ? -21.282 -18.067 15.915  1.00 45.51  ?  703 OK8 B C16   1 
HETATM 6661 N  N17   . OK8 M 3 .   ? -21.018 -18.143 17.252  1.00 42.84  ?  703 OK8 B N17   1 
HETATM 6662 C  C18   . OK8 M 3 .   ? -22.956 -19.920 16.100  1.00 42.04  ?  703 OK8 B C18   1 
HETATM 6663 O  O19   . OK8 M 3 .   ? -23.528 -20.801 15.202  1.00 39.91  ?  703 OK8 B O19   1 
HETATM 6664 O  O22   . OK8 M 3 .   ? -24.895 -21.309 17.660  1.00 35.49  ?  703 OK8 B O22   1 
HETATM 6665 C  C23   . OK8 M 3 .   ? -24.065 -19.265 16.950  1.00 39.73  ?  703 OK8 B C23   1 
HETATM 6666 O  O24   . OK8 M 3 .   ? -23.610 -19.169 18.251  1.00 37.11  ?  703 OK8 B O24   1 
HETATM 6667 C  C25   . OK8 M 3 .   ? -25.560 -20.082 14.206  1.00 39.24  ?  703 OK8 B C25   1 
HETATM 6668 O  O26   . OK8 M 3 .   ? -25.995 -18.940 14.699  1.00 38.75  ?  703 OK8 B O26   1 
HETATM 6669 P  P27   . OK8 M 3 .   ? -26.882 -17.782 13.645  1.00 40.43  ?  703 OK8 B P27   1 
HETATM 6670 O  O28   . OK8 M 3 .   ? -26.507 -16.535 14.426  1.00 39.76  ?  703 OK8 B O28   1 
HETATM 6671 O  O29   . OK8 M 3 .   ? -26.338 -18.016 12.219  1.00 33.90  -1 703 OK8 B O29   1 
HETATM 6672 O  O30   . OK8 M 3 .   ? -28.286 -18.238 13.855  1.00 39.75  -1 703 OK8 B O30   1 
HETATM 6673 C  C1    . EDO N 4 .   ? -13.071 -78.169 27.313  1.00 76.24  ?  704 EDO B C1    1 
HETATM 6674 O  O1    . EDO N 4 .   ? -13.802 -79.072 28.142  1.00 70.92  ?  704 EDO B O1    1 
HETATM 6675 C  C2    . EDO N 4 .   ? -13.960 -77.156 26.677  1.00 64.80  ?  704 EDO B C2    1 
HETATM 6676 O  O2    . EDO N 4 .   ? -14.421 -77.518 25.403  1.00 66.59  ?  704 EDO B O2    1 
HETATM 6677 MG MG    . MG  O 5 .   ? -12.257 -17.536 16.073  1.00 53.16  ?  705 MG  B MG    1 
HETATM 6678 MG MG    . MG  P 5 .   ? -20.788 -16.193 11.908  1.00 37.09  ?  706 MG  B MG    1 
HETATM 6679 O  O     . HOH Q 6 .   ? -30.751 -72.449 54.463  1.00 34.80  ?  601 HOH A O     1 
HETATM 6680 O  O     . HOH Q 6 .   ? -50.278 -64.035 57.916  1.00 55.72  ?  602 HOH A O     1 
HETATM 6681 O  O     . HOH Q 6 .   ? -38.136 -75.881 44.560  1.00 39.39  ?  603 HOH A O     1 
HETATM 6682 O  O     . HOH Q 6 .   ? -34.935 -66.386 14.989  1.00 35.37  ?  604 HOH A O     1 
HETATM 6683 O  O     . HOH Q 6 .   ? -49.594 -54.888 33.140  1.00 45.38  ?  605 HOH A O     1 
HETATM 6684 O  O     . HOH Q 6 .   ? -42.647 -55.469 3.708   1.00 33.59  ?  606 HOH A O     1 
HETATM 6685 O  O     . HOH Q 6 .   ? -28.078 -42.545 14.518  1.00 27.33  ?  607 HOH A O     1 
HETATM 6686 O  O     . HOH Q 6 .   ? -36.926 -61.138 3.499   1.00 32.65  ?  608 HOH A O     1 
HETATM 6687 O  O     . HOH Q 6 .   ? -39.590 -45.159 1.152   1.00 34.35  ?  609 HOH A O     1 
HETATM 6688 O  O     . HOH Q 6 .   ? -37.565 -47.949 77.967  1.00 42.65  ?  610 HOH A O     1 
HETATM 6689 O  O     . HOH Q 6 .   ? -22.052 -57.904 50.198  1.00 42.71  ?  611 HOH A O     1 
HETATM 6690 O  O     . HOH Q 6 .   ? -42.117 -67.718 0.903   1.00 24.18  ?  612 HOH A O     1 
HETATM 6691 O  O     . HOH Q 6 .   ? -50.163 -63.146 35.234  1.00 47.16  ?  613 HOH A O     1 
HETATM 6692 O  O     . HOH Q 6 .   ? -30.225 -39.984 17.964  1.00 36.88  ?  614 HOH A O     1 
HETATM 6693 O  O     . HOH Q 6 .   ? -24.489 -53.582 50.822  1.00 46.57  ?  615 HOH A O     1 
HETATM 6694 O  O     . HOH Q 6 .   ? -29.853 -56.655 46.426  1.00 29.60  ?  616 HOH A O     1 
HETATM 6695 O  O     . HOH Q 6 .   ? -46.972 -63.292 61.780  1.00 49.61  ?  617 HOH A O     1 
HETATM 6696 O  O     . HOH Q 6 .   ? -31.019 -54.060 34.586  1.00 36.99  ?  618 HOH A O     1 
HETATM 6697 O  O     . HOH Q 6 .   ? -33.120 -63.124 24.297  1.00 24.67  ?  619 HOH A O     1 
HETATM 6698 O  O     . HOH Q 6 .   ? -42.156 -43.782 23.804  1.00 25.68  ?  620 HOH A O     1 
HETATM 6699 O  O     . HOH Q 6 .   ? -45.926 -57.199 60.486  1.00 44.19  ?  621 HOH A O     1 
HETATM 6700 O  O     . HOH Q 6 .   ? -33.783 -56.743 29.947  1.00 25.43  ?  622 HOH A O     1 
HETATM 6701 O  O     . HOH Q 6 .   ? -60.128 -63.782 42.640  1.00 38.65  ?  623 HOH A O     1 
HETATM 6702 O  O     . HOH Q 6 .   ? -27.071 -62.547 62.556  1.00 36.19  ?  624 HOH A O     1 
HETATM 6703 O  O     . HOH Q 6 .   ? -32.001 -64.144 0.329   1.00 32.15  ?  625 HOH A O     1 
HETATM 6704 O  O     . HOH Q 6 .   ? -44.101 -53.862 34.852  1.00 24.17  ?  626 HOH A O     1 
HETATM 6705 O  O     . HOH Q 6 .   ? -23.977 -43.669 6.128   1.00 39.90  ?  627 HOH A O     1 
HETATM 6706 O  O     . HOH Q 6 .   ? -31.665 -56.280 -1.116  1.00 35.60  ?  628 HOH A O     1 
HETATM 6707 O  O     . HOH Q 6 .   ? -28.914 -54.486 60.762  1.00 47.58  ?  629 HOH A O     1 
HETATM 6708 O  O     . HOH Q 6 .   ? -32.099 -54.190 57.758  1.00 33.87  ?  630 HOH A O     1 
HETATM 6709 O  O     . HOH Q 6 .   ? -38.244 -68.335 39.589  1.00 30.13  ?  631 HOH A O     1 
HETATM 6710 O  O     . HOH Q 6 .   ? -28.785 -60.255 11.215  1.00 34.11  ?  632 HOH A O     1 
HETATM 6711 O  O     . HOH Q 6 .   ? -46.876 -61.459 51.531  1.00 29.53  ?  633 HOH A O     1 
HETATM 6712 O  O     . HOH Q 6 .   ? -48.255 -79.819 52.067  1.00 37.53  ?  634 HOH A O     1 
HETATM 6713 O  O     . HOH Q 6 .   ? -32.027 -50.082 27.186  1.00 34.27  ?  635 HOH A O     1 
HETATM 6714 O  O     . HOH Q 6 .   ? -33.298 -58.277 40.507  1.00 25.72  ?  636 HOH A O     1 
HETATM 6715 O  O     . HOH Q 6 .   ? -49.733 -67.628 55.798  1.00 38.19  ?  637 HOH A O     1 
HETATM 6716 O  O     . HOH Q 6 .   ? -34.293 -40.554 19.507  1.00 28.69  ?  638 HOH A O     1 
HETATM 6717 O  O     . HOH Q 6 .   ? -24.184 -48.856 11.660  1.00 46.32  ?  639 HOH A O     1 
HETATM 6718 O  O     . HOH Q 6 .   ? -30.317 -62.308 54.720  1.00 23.80  ?  640 HOH A O     1 
HETATM 6719 O  O     . HOH Q 6 .   ? -56.250 -55.484 40.703  1.00 35.89  ?  641 HOH A O     1 
HETATM 6720 O  O     . HOH Q 6 .   ? -43.560 -51.813 31.031  1.00 40.32  ?  642 HOH A O     1 
HETATM 6721 O  O     . HOH Q 6 .   ? -56.227 -51.815 41.975  1.00 42.17  ?  643 HOH A O     1 
HETATM 6722 O  O     . HOH Q 6 .   ? -49.454 -42.224 58.286  1.00 45.38  ?  644 HOH A O     1 
HETATM 6723 O  O     . HOH Q 6 .   ? -52.338 -44.854 60.439  1.00 36.01  ?  645 HOH A O     1 
HETATM 6724 O  O     . HOH Q 6 .   ? -32.325 -53.093 45.194  1.00 30.42  ?  646 HOH A O     1 
HETATM 6725 O  O     . HOH Q 6 .   ? -28.352 -74.576 61.124  1.00 44.47  ?  647 HOH A O     1 
HETATM 6726 O  O     . HOH Q 6 .   ? -28.080 -36.488 18.628  1.00 23.94  ?  648 HOH A O     1 
HETATM 6727 O  O     . HOH Q 6 .   ? -25.011 -51.328 11.978  1.00 43.57  ?  649 HOH A O     1 
HETATM 6728 O  O     . HOH Q 6 .   ? -32.313 -43.787 59.120  1.00 44.00  ?  650 HOH A O     1 
HETATM 6729 O  O     . HOH Q 6 .   ? -43.863 -59.377 66.176  1.00 46.25  ?  651 HOH A O     1 
HETATM 6730 O  O     . HOH Q 6 .   ? -23.983 -58.110 44.061  1.00 44.93  ?  652 HOH A O     1 
HETATM 6731 O  O     . HOH Q 6 .   ? -32.439 -46.242 33.136  1.00 41.74  ?  653 HOH A O     1 
HETATM 6732 O  O     . HOH Q 6 .   ? -34.935 -62.079 4.910   1.00 35.94  ?  654 HOH A O     1 
HETATM 6733 O  O     . HOH Q 6 .   ? -52.167 -44.740 53.036  1.00 38.08  ?  655 HOH A O     1 
HETATM 6734 O  O     . HOH Q 6 .   ? -22.202 -47.710 8.355   1.00 39.36  ?  656 HOH A O     1 
HETATM 6735 O  O     . HOH Q 6 .   ? -23.660 -67.218 45.759  1.00 30.25  ?  657 HOH A O     1 
HETATM 6736 O  O     . HOH Q 6 .   ? -48.496 -59.019 61.817  1.00 57.55  ?  658 HOH A O     1 
HETATM 6737 O  O     . HOH Q 6 .   ? -44.463 -42.743 47.852  1.00 33.50  ?  659 HOH A O     1 
HETATM 6738 O  O     . HOH Q 6 .   ? -27.919 -69.561 46.066  1.00 33.77  ?  660 HOH A O     1 
HETATM 6739 O  O     . HOH Q 6 .   ? -55.924 -49.602 44.222  1.00 40.74  ?  661 HOH A O     1 
HETATM 6740 O  O     . HOH Q 6 .   ? -40.451 -59.517 71.756  1.00 51.50  ?  662 HOH A O     1 
HETATM 6741 O  O     . HOH Q 6 .   ? -44.085 -59.021 70.166  1.00 49.99  ?  663 HOH A O     1 
HETATM 6742 O  O     . HOH Q 6 .   ? -51.524 -54.240 16.387  1.00 40.43  ?  664 HOH A O     1 
HETATM 6743 O  O     . HOH Q 6 .   ? -35.886 -73.745 54.002  1.00 26.09  ?  665 HOH A O     1 
HETATM 6744 O  O     . HOH Q 6 .   ? -33.112 -64.496 36.943  1.00 43.17  ?  666 HOH A O     1 
HETATM 6745 O  O     . HOH Q 6 .   ? -46.111 -55.409 75.396  1.00 49.09  ?  667 HOH A O     1 
HETATM 6746 O  O     . HOH Q 6 .   ? -47.193 -69.342 52.461  1.00 24.70  ?  668 HOH A O     1 
HETATM 6747 O  O     . HOH Q 6 .   ? -47.726 -71.293 68.632  1.00 45.67  ?  669 HOH A O     1 
HETATM 6748 O  O     . HOH Q 6 .   ? -37.268 -58.022 7.112   1.00 35.30  ?  670 HOH A O     1 
HETATM 6749 O  O     . HOH Q 6 .   ? -46.108 -65.278 30.029  1.00 43.46  ?  671 HOH A O     1 
HETATM 6750 O  O     . HOH Q 6 .   ? -22.178 -66.609 60.906  1.00 33.57  ?  672 HOH A O     1 
HETATM 6751 O  O     . HOH Q 6 .   ? -63.095 -52.935 43.462  1.00 48.24  ?  673 HOH A O     1 
HETATM 6752 O  O     . HOH Q 6 .   ? -37.652 -55.620 58.591  1.00 44.47  ?  674 HOH A O     1 
HETATM 6753 O  O     . HOH Q 6 .   ? -44.304 -64.759 62.423  1.00 38.44  ?  675 HOH A O     1 
HETATM 6754 O  O     . HOH Q 6 .   ? -48.955 -68.297 36.500  1.00 45.97  ?  676 HOH A O     1 
HETATM 6755 O  O     . HOH Q 6 .   ? -47.573 -65.055 38.870  1.00 30.32  ?  677 HOH A O     1 
HETATM 6756 O  O     . HOH Q 6 .   ? -38.914 -38.504 54.035  1.00 38.62  ?  678 HOH A O     1 
HETATM 6757 O  O     . HOH Q 6 .   ? -48.997 -60.672 18.502  1.00 37.61  ?  679 HOH A O     1 
HETATM 6758 O  O     . HOH Q 6 .   ? -49.890 -69.178 39.902  1.00 45.35  ?  680 HOH A O     1 
HETATM 6759 O  O     . HOH Q 6 .   ? -44.115 -82.165 58.110  1.00 35.98  ?  681 HOH A O     1 
HETATM 6760 O  O     . HOH Q 6 .   ? -37.696 -78.669 60.964  1.00 36.21  ?  682 HOH A O     1 
HETATM 6761 O  O     . HOH Q 6 .   ? -45.560 -60.900 32.467  1.00 31.74  ?  683 HOH A O     1 
HETATM 6762 O  O     . HOH Q 6 .   ? -47.035 -82.514 42.823  1.00 39.61  ?  684 HOH A O     1 
HETATM 6763 O  O     . HOH Q 6 .   ? -51.299 -58.576 5.786   1.00 43.11  ?  685 HOH A O     1 
HETATM 6764 O  O     . HOH Q 6 .   ? -37.245 -61.902 61.358  1.00 44.72  ?  686 HOH A O     1 
HETATM 6765 O  O     . HOH Q 6 .   ? -53.200 -60.842 40.154  1.00 30.52  ?  687 HOH A O     1 
HETATM 6766 O  O     . HOH Q 6 .   ? -40.011 -70.145 31.414  1.00 34.10  ?  688 HOH A O     1 
HETATM 6767 O  O     . HOH Q 6 .   ? -37.314 -66.350 58.925  1.00 39.60  ?  689 HOH A O     1 
HETATM 6768 O  O     . HOH Q 6 .   ? -37.991 -67.838 61.823  1.00 44.93  ?  690 HOH A O     1 
HETATM 6769 O  O     . HOH Q 6 .   ? -49.090 -69.808 34.288  1.00 39.78  ?  691 HOH A O     1 
HETATM 6770 O  O     . HOH Q 6 .   ? -59.486 -43.069 54.357  1.00 37.57  ?  692 HOH A O     1 
HETATM 6771 O  O     . HOH Q 6 .   ? -27.934 -50.116 13.383  1.00 39.37  ?  693 HOH A O     1 
HETATM 6772 O  O     . HOH Q 6 .   ? -35.787 -65.574 61.478  1.00 54.49  ?  694 HOH A O     1 
HETATM 6773 O  O     . HOH Q 6 .   ? -43.924 -61.255 22.709  1.00 35.29  ?  695 HOH A O     1 
HETATM 6774 O  O     . HOH Q 6 .   ? -39.129 -68.014 37.148  1.00 28.15  ?  696 HOH A O     1 
HETATM 6775 O  O     . HOH Q 6 .   ? -45.527 -54.762 62.992  1.00 45.72  ?  697 HOH A O     1 
HETATM 6776 O  O     . HOH Q 6 .   ? -41.396 -56.199 1.438   1.00 32.74  ?  698 HOH A O     1 
HETATM 6777 O  O     . HOH Q 6 .   ? -53.902 -60.499 50.392  1.00 37.04  ?  699 HOH A O     1 
HETATM 6778 O  O     . HOH Q 6 .   ? -41.392 -65.701 28.836  1.00 37.47  ?  700 HOH A O     1 
HETATM 6779 O  O     . HOH Q 6 .   ? -41.905 -45.534 27.369  1.00 32.06  ?  701 HOH A O     1 
HETATM 6780 O  O     . HOH Q 6 .   ? -30.824 -48.781 62.781  1.00 41.69  ?  702 HOH A O     1 
HETATM 6781 O  O     . HOH Q 6 .   ? -51.398 -60.278 37.735  1.00 43.16  ?  703 HOH A O     1 
HETATM 6782 O  O     . HOH Q 6 .   ? -54.628 -78.415 55.929  1.00 42.01  ?  704 HOH A O     1 
HETATM 6783 O  O     . HOH Q 6 .   ? -50.776 -55.874 68.617  1.00 41.99  ?  705 HOH A O     1 
HETATM 6784 O  O     . HOH Q 6 .   ? -31.850 -60.048 34.201  1.00 22.67  ?  706 HOH A O     1 
HETATM 6785 O  O     . HOH Q 6 .   ? -32.074 -46.680 61.779  1.00 40.89  ?  707 HOH A O     1 
HETATM 6786 O  O     . HOH Q 6 .   ? -39.928 -58.210 75.402  1.00 37.12  ?  708 HOH A O     1 
HETATM 6787 O  O     . HOH Q 6 .   ? -26.191 -41.560 11.114  1.00 31.39  ?  709 HOH A O     1 
HETATM 6788 O  O     . HOH Q 6 .   ? -21.832 -66.397 7.187   1.00 42.48  ?  710 HOH A O     1 
HETATM 6789 O  O     . HOH Q 6 .   ? -26.946 -56.467 46.170  1.00 37.83  ?  711 HOH A O     1 
HETATM 6790 O  O     . HOH Q 6 .   ? -68.604 -55.009 61.288  1.00 38.43  ?  712 HOH A O     1 
HETATM 6791 O  O     . HOH Q 6 .   ? -18.008 -64.620 2.875   1.00 45.32  ?  713 HOH A O     1 
HETATM 6792 O  O     . HOH Q 6 .   ? -27.507 -62.900 1.150   1.00 48.46  ?  714 HOH A O     1 
HETATM 6793 O  O     . HOH Q 6 .   ? -30.553 -42.645 54.105  1.00 45.25  ?  715 HOH A O     1 
HETATM 6794 O  O     . HOH Q 6 .   ? -18.414 -65.471 54.123  1.00 34.54  ?  716 HOH A O     1 
HETATM 6795 O  O     . HOH Q 6 .   ? -30.935 -62.333 39.736  1.00 27.32  ?  717 HOH A O     1 
HETATM 6796 O  O     . HOH Q 6 .   ? -69.753 -54.864 50.176  1.00 37.72  ?  718 HOH A O     1 
HETATM 6797 O  O     . HOH Q 6 .   ? -19.437 -56.621 10.916  1.00 42.82  ?  719 HOH A O     1 
HETATM 6798 O  O     . HOH Q 6 .   ? -57.960 -44.307 58.494  1.00 43.74  ?  720 HOH A O     1 
HETATM 6799 O  O     . HOH Q 6 .   ? -54.482 -49.477 66.532  1.00 51.73  ?  721 HOH A O     1 
HETATM 6800 O  O     . HOH Q 6 .   ? -52.032 -73.117 41.731  1.00 32.07  ?  722 HOH A O     1 
HETATM 6801 O  O     . HOH Q 6 .   ? -18.467 -60.343 53.170  1.00 41.32  ?  723 HOH A O     1 
HETATM 6802 O  O     . HOH Q 6 .   ? -65.572 -65.230 61.457  1.00 52.15  ?  724 HOH A O     1 
HETATM 6803 O  O     . HOH Q 6 .   ? -20.164 -48.625 10.599  1.00 42.01  ?  725 HOH A O     1 
HETATM 6804 O  O     . HOH Q 6 .   ? -48.918 -53.809 29.303  1.00 48.72  ?  726 HOH A O     1 
HETATM 6805 O  O     . HOH Q 6 .   ? -33.533 -59.816 63.836  1.00 35.17  ?  727 HOH A O     1 
HETATM 6806 O  O     . HOH Q 6 .   ? -36.617 -57.629 68.821  1.00 38.83  ?  728 HOH A O     1 
HETATM 6807 O  O     . HOH Q 6 .   ? -29.801 -56.866 59.243  1.00 38.17  ?  729 HOH A O     1 
HETATM 6808 O  O     . HOH Q 6 .   ? -40.724 -37.222 15.294  1.00 43.83  ?  730 HOH A O     1 
HETATM 6809 O  O     . HOH Q 6 .   ? -56.233 -63.589 42.691  1.00 44.45  ?  731 HOH A O     1 
HETATM 6810 O  O     . HOH Q 6 .   ? -43.002 -54.086 76.947  1.00 43.56  ?  732 HOH A O     1 
HETATM 6811 O  O     . HOH Q 6 .   ? -47.131 -50.506 -0.081  1.00 37.76  ?  733 HOH A O     1 
HETATM 6812 O  O     . HOH Q 6 .   ? -41.993 -49.331 75.127  1.00 41.86  ?  734 HOH A O     1 
HETATM 6813 O  O     . HOH Q 6 .   ? -35.098 -41.871 28.352  1.00 33.00  ?  735 HOH A O     1 
HETATM 6814 O  O     . HOH Q 6 .   ? -56.807 -67.925 56.118  1.00 40.67  ?  736 HOH A O     1 
HETATM 6815 O  O     . HOH Q 6 .   ? -34.576 -41.759 61.543  1.00 41.28  ?  737 HOH A O     1 
HETATM 6816 O  O     . HOH Q 6 .   ? -36.247 -53.185 0.904   1.00 47.99  ?  738 HOH A O     1 
HETATM 6817 O  O     . HOH Q 6 .   ? -31.982 -38.811 1.853   1.00 47.15  ?  739 HOH A O     1 
HETATM 6818 O  O     . HOH Q 6 .   ? -32.426 -60.395 38.755  1.00 27.73  ?  740 HOH A O     1 
HETATM 6819 O  O     . HOH Q 6 .   ? -48.601 -51.510 33.619  1.00 40.42  ?  741 HOH A O     1 
HETATM 6820 O  O     . HOH Q 6 .   ? -54.492 -68.133 58.565  1.00 42.48  ?  742 HOH A O     1 
HETATM 6821 O  O     . HOH Q 6 .   ? -47.525 -45.468 19.155  1.00 52.40  ?  743 HOH A O     1 
HETATM 6822 O  O     . HOH Q 6 .   ? -53.751 -54.363 68.868  1.00 55.43  ?  744 HOH A O     1 
HETATM 6823 O  O     . HOH Q 6 .   ? -51.645 -53.041 18.984  1.00 51.00  ?  745 HOH A O     1 
HETATM 6824 O  O     . HOH Q 6 .   ? -36.972 -59.669 67.417  1.00 37.71  ?  746 HOH A O     1 
HETATM 6825 O  O     . HOH Q 6 .   ? -33.518 -34.223 21.866  1.00 33.31  ?  747 HOH A O     1 
HETATM 6826 O  O     . HOH Q 6 .   ? -37.548 -58.303 71.248  1.00 45.76  ?  748 HOH A O     1 
HETATM 6827 O  O     . HOH Q 6 .   ? -35.391 -68.152 36.186  1.00 37.43  ?  749 HOH A O     1 
HETATM 6828 O  O     . HOH Q 6 .   ? -34.099 -69.018 61.902  1.00 44.97  ?  750 HOH A O     1 
HETATM 6829 O  O     . HOH Q 6 .   ? -29.784 -54.404 44.973  1.00 36.36  ?  751 HOH A O     1 
HETATM 6830 O  O     . HOH Q 6 .   ? -51.411 -40.837 59.954  1.00 47.79  ?  752 HOH A O     1 
HETATM 6831 O  O     . HOH Q 6 .   ? -37.835 -69.910 35.650  1.00 40.91  ?  753 HOH A O     1 
HETATM 6832 O  O     . HOH R 6 .   ? -39.022 -16.610 10.592  1.00 36.86  ?  801 HOH B O     1 
HETATM 6833 O  O     . HOH R 6 .   ? -8.852  -23.441 37.800  1.00 42.20  ?  802 HOH B O     1 
HETATM 6834 O  O     . HOH R 6 .   ? -30.298 -22.788 4.604   1.00 33.34  ?  803 HOH B O     1 
HETATM 6835 O  O     . HOH R 6 .   ? -1.508  -23.128 9.478   1.00 42.27  ?  804 HOH B O     1 
HETATM 6836 O  O     . HOH R 6 .   ? -10.715 -19.101 12.433  1.00 49.72  ?  805 HOH B O     1 
HETATM 6837 O  O     . HOH R 6 .   ? -18.043 -73.044 35.588  1.00 34.75  ?  806 HOH B O     1 
HETATM 6838 O  O     . HOH R 6 .   ? -23.603 -18.781 21.633  1.00 31.88  ?  807 HOH B O     1 
HETATM 6839 O  O     . HOH R 6 .   ? -10.174 -19.021 23.448  1.00 39.17  ?  808 HOH B O     1 
HETATM 6840 O  O     . HOH R 6 .   ? -31.241 -30.279 20.636  1.00 24.54  ?  809 HOH B O     1 
HETATM 6841 O  O     . HOH R 6 .   ? -8.842  -24.185 31.952  1.00 36.40  ?  810 HOH B O     1 
HETATM 6842 O  O     . HOH R 6 .   ? -2.269  -23.910 2.483   1.00 45.15  ?  811 HOH B O     1 
HETATM 6843 O  O     . HOH R 6 .   ? -4.689  -36.160 10.659  1.00 45.13  ?  812 HOH B O     1 
HETATM 6844 O  O     . HOH R 6 .   ? -26.835 -57.695 36.345  1.00 28.57  ?  813 HOH B O     1 
HETATM 6845 O  O     . HOH R 6 .   ? -1.571  -34.593 13.274  1.00 39.00  ?  814 HOH B O     1 
HETATM 6846 O  O     . HOH R 6 .   ? -14.524 -44.236 13.801  1.00 33.68  ?  815 HOH B O     1 
HETATM 6847 O  O     . HOH R 6 .   ? -24.444 -73.433 15.851  1.00 34.65  ?  816 HOH B O     1 
HETATM 6848 O  O     . HOH R 6 .   ? -15.593 -14.330 22.988  1.00 36.61  ?  817 HOH B O     1 
HETATM 6849 O  O     . HOH R 6 .   ? -2.029  -22.762 30.241  1.00 38.79  ?  818 HOH B O     1 
HETATM 6850 O  O     . HOH R 6 .   ? -21.555 -75.852 31.930  1.00 28.04  ?  819 HOH B O     1 
HETATM 6851 O  O     . HOH R 6 .   ? -17.166 -19.022 -5.170  1.00 35.74  ?  820 HOH B O     1 
HETATM 6852 O  O     . HOH R 6 .   ? -33.981 -14.229 14.484  1.00 32.82  ?  821 HOH B O     1 
HETATM 6853 O  O     . HOH R 6 .   ? -6.830  -22.038 24.427  1.00 34.41  ?  822 HOH B O     1 
HETATM 6854 O  O     . HOH R 6 .   ? -33.552 -31.182 24.134  1.00 39.53  ?  823 HOH B O     1 
HETATM 6855 O  O     . HOH R 6 .   ? -18.398 -73.219 21.714  1.00 42.05  ?  824 HOH B O     1 
HETATM 6856 O  O     . HOH R 6 .   ? -32.827 -35.881 13.248  1.00 27.23  ?  825 HOH B O     1 
HETATM 6857 O  O     . HOH R 6 .   ? -12.579 -16.055 17.847  1.00 57.81  ?  826 HOH B O     1 
HETATM 6858 O  O     . HOH R 6 .   ? -29.311 -49.600 26.803  1.00 37.58  ?  827 HOH B O     1 
HETATM 6859 O  O     . HOH R 6 .   ? -13.056 -25.000 -2.849  1.00 26.37  ?  828 HOH B O     1 
HETATM 6860 O  O     . HOH R 6 .   ? -13.595 -12.713 12.777  1.00 60.46  ?  829 HOH B O     1 
HETATM 6861 O  O     . HOH R 6 .   ? -28.486 -63.842 40.664  1.00 32.35  ?  830 HOH B O     1 
HETATM 6862 O  O     . HOH R 6 .   ? -23.808 -83.318 33.153  1.00 38.23  ?  831 HOH B O     1 
HETATM 6863 O  O     . HOH R 6 .   ? -17.755 -41.436 -3.875  1.00 38.17  ?  832 HOH B O     1 
HETATM 6864 O  O     . HOH R 6 .   ? -26.431 -72.022 14.896  1.00 28.52  ?  833 HOH B O     1 
HETATM 6865 O  O     . HOH R 6 .   ? -16.344 -6.883  16.335  1.00 58.24  ?  834 HOH B O     1 
HETATM 6866 O  O     . HOH R 6 .   ? -30.556 -67.827 18.614  1.00 49.68  ?  835 HOH B O     1 
HETATM 6867 O  O     . HOH R 6 .   ? -28.067 -52.732 13.798  1.00 34.82  ?  836 HOH B O     1 
HETATM 6868 O  O     . HOH R 6 .   ? -8.621  -16.756 32.258  1.00 42.96  ?  837 HOH B O     1 
HETATM 6869 O  O     . HOH R 6 .   ? -16.660 -22.734 16.942  1.00 41.56  ?  838 HOH B O     1 
HETATM 6870 O  O     . HOH R 6 .   ? -30.911 -22.168 14.770  1.00 28.91  ?  839 HOH B O     1 
HETATM 6871 O  O     . HOH R 6 .   ? -11.597 -20.870 9.231   1.00 42.78  ?  840 HOH B O     1 
HETATM 6872 O  O     . HOH R 6 .   ? -14.191 -24.456 7.866   1.00 29.77  ?  841 HOH B O     1 
HETATM 6873 O  O     . HOH R 6 .   ? -17.498 -54.488 15.664  1.00 35.65  ?  842 HOH B O     1 
HETATM 6874 O  O     . HOH R 6 .   ? -32.727 -65.916 16.314  1.00 46.41  ?  843 HOH B O     1 
HETATM 6875 O  O     . HOH R 6 .   ? -36.246 -65.522 19.139  1.00 40.89  ?  844 HOH B O     1 
HETATM 6876 O  O     . HOH R 6 .   ? -23.993 -69.713 18.986  1.00 29.53  ?  845 HOH B O     1 
HETATM 6877 O  O     . HOH R 6 .   ? -15.611 -39.333 -3.305  1.00 32.76  ?  846 HOH B O     1 
HETATM 6878 O  O     . HOH R 6 .   ? -33.277 -62.253 34.501  1.00 29.70  ?  847 HOH B O     1 
HETATM 6879 O  O     . HOH R 6 .   ? -31.060 -59.079 36.582  1.00 26.02  ?  848 HOH B O     1 
HETATM 6880 O  O     . HOH R 6 .   ? -23.153 -37.369 8.783   1.00 22.84  ?  849 HOH B O     1 
HETATM 6881 O  O     . HOH R 6 .   ? 0.283   -31.122 11.727  1.00 42.61  ?  850 HOH B O     1 
HETATM 6882 O  O     . HOH R 6 .   ? -29.279 -76.570 12.908  1.00 26.70  ?  851 HOH B O     1 
HETATM 6883 O  O     . HOH R 6 .   ? -5.762  -32.750 27.299  1.00 48.10  ?  852 HOH B O     1 
HETATM 6884 O  O     . HOH R 6 .   ? -17.311 -14.401 12.814  1.00 42.04  ?  853 HOH B O     1 
HETATM 6885 O  O     . HOH R 6 .   ? -17.185 -42.065 22.988  1.00 28.16  ?  854 HOH B O     1 
HETATM 6886 O  O     . HOH R 6 .   ? -25.429 -22.806 3.148   1.00 28.86  ?  855 HOH B O     1 
HETATM 6887 O  O     . HOH R 6 .   ? -31.738 -67.800 38.030  1.00 34.22  ?  856 HOH B O     1 
HETATM 6888 O  O     . HOH R 6 .   ? -19.268 -53.141 33.492  1.00 31.97  ?  857 HOH B O     1 
HETATM 6889 O  O     . HOH R 6 .   ? -16.167 -19.524 25.878  1.00 45.59  ?  858 HOH B O     1 
HETATM 6890 O  O     . HOH R 6 .   ? -12.330 -40.300 8.742   1.00 39.25  ?  859 HOH B O     1 
HETATM 6891 O  O     . HOH R 6 .   ? -27.686 -46.875 20.266  1.00 24.75  ?  860 HOH B O     1 
HETATM 6892 O  O     . HOH R 6 .   ? -8.819  -32.444 27.450  1.00 44.55  ?  861 HOH B O     1 
HETATM 6893 O  O     . HOH R 6 .   ? -18.415 -76.186 19.137  1.00 42.91  ?  862 HOH B O     1 
HETATM 6894 O  O     . HOH R 6 .   ? -12.387 -42.683 7.326   1.00 37.39  ?  863 HOH B O     1 
HETATM 6895 O  O     . HOH R 6 .   ? -16.333 -14.660 10.699  1.00 46.29  ?  864 HOH B O     1 
HETATM 6896 O  O     . HOH R 6 .   ? -28.501 -14.705 14.964  1.00 41.90  ?  865 HOH B O     1 
HETATM 6897 O  O     . HOH R 6 .   ? -12.993 -46.493 19.231  1.00 51.88  ?  866 HOH B O     1 
HETATM 6898 O  O     . HOH R 6 .   ? -13.332 -79.133 23.445  1.00 46.35  ?  867 HOH B O     1 
HETATM 6899 O  O     . HOH R 6 .   ? -28.979 -31.644 23.760  1.00 27.35  ?  868 HOH B O     1 
HETATM 6900 O  O     . HOH R 6 .   ? -30.173 -36.745 14.737  1.00 36.57  ?  869 HOH B O     1 
HETATM 6901 O  O     . HOH R 6 .   ? -23.412 -37.590 -0.908  1.00 37.63  ?  870 HOH B O     1 
HETATM 6902 O  O     . HOH R 6 .   ? -4.929  -34.211 12.735  1.00 43.88  ?  871 HOH B O     1 
HETATM 6903 O  O     . HOH R 6 .   ? -17.634 -23.465 37.177  1.00 40.60  ?  872 HOH B O     1 
HETATM 6904 O  O     . HOH R 6 .   ? -14.479 -25.371 15.348  1.00 23.47  ?  873 HOH B O     1 
HETATM 6905 O  O     . HOH R 6 .   ? -28.812 -15.469 31.008  1.00 43.46  ?  874 HOH B O     1 
HETATM 6906 O  O     . HOH R 6 .   ? -10.662 -45.972 1.906   1.00 37.96  ?  875 HOH B O     1 
HETATM 6907 O  O     . HOH R 6 .   ? -13.680 -38.004 11.678  1.00 35.19  ?  876 HOH B O     1 
HETATM 6908 O  O     . HOH R 6 .   ? -40.938 -16.887 15.594  1.00 44.74  ?  877 HOH B O     1 
HETATM 6909 O  O     . HOH R 6 .   ? -22.241 -39.822 8.988   1.00 25.80  ?  878 HOH B O     1 
HETATM 6910 O  O     . HOH R 6 .   ? -29.268 -18.961 22.944  1.00 38.08  ?  879 HOH B O     1 
HETATM 6911 O  O     . HOH R 6 .   ? -29.743 -77.990 20.858  1.00 38.77  ?  880 HOH B O     1 
HETATM 6912 O  O     . HOH R 6 .   ? -9.925  -39.082 16.394  1.00 38.73  ?  881 HOH B O     1 
HETATM 6913 O  O     . HOH R 6 .   ? -8.207  -36.868 15.978  1.00 35.06  ?  882 HOH B O     1 
HETATM 6914 O  O     . HOH R 6 .   ? -24.126 -28.416 3.034   1.00 35.49  ?  883 HOH B O     1 
HETATM 6915 O  O     . HOH R 6 .   ? -18.465 -74.641 33.104  1.00 44.87  ?  884 HOH B O     1 
HETATM 6916 O  O     . HOH R 6 .   ? -21.204 -45.676 6.989   1.00 31.77  ?  885 HOH B O     1 
HETATM 6917 O  O     . HOH R 6 .   ? -9.871  -71.276 18.805  1.00 41.29  ?  886 HOH B O     1 
HETATM 6918 O  O     . HOH R 6 .   ? -36.913 -26.166 23.022  1.00 46.97  ?  887 HOH B O     1 
HETATM 6919 O  O     . HOH R 6 .   ? -25.721 -48.490 35.169  1.00 40.22  ?  888 HOH B O     1 
HETATM 6920 O  O     . HOH R 6 .   ? -28.841 -38.107 16.578  1.00 25.36  ?  889 HOH B O     1 
HETATM 6921 O  O     . HOH R 6 .   ? -7.489  -26.571 16.621  1.00 33.84  ?  890 HOH B O     1 
HETATM 6922 O  O     . HOH R 6 .   ? -42.755 -22.544 11.472  1.00 39.57  ?  891 HOH B O     1 
HETATM 6923 O  O     . HOH R 6 .   ? -33.508 -30.462 7.517   1.00 45.68  ?  892 HOH B O     1 
HETATM 6924 O  O     . HOH R 6 .   ? -11.059 -30.694 33.043  1.00 41.02  ?  893 HOH B O     1 
HETATM 6925 O  O     . HOH R 6 .   ? -33.890 -75.661 14.050  1.00 37.00  ?  894 HOH B O     1 
HETATM 6926 O  O     . HOH R 6 .   ? -25.862 -25.624 -0.954  1.00 32.59  ?  895 HOH B O     1 
HETATM 6927 O  O     . HOH R 6 .   ? -30.769 -22.944 34.404  1.00 31.69  ?  896 HOH B O     1 
HETATM 6928 O  O     . HOH R 6 .   ? -23.042 -75.936 4.880   1.00 34.72  ?  897 HOH B O     1 
HETATM 6929 O  O     . HOH R 6 .   ? -24.010 -48.451 13.979  1.00 34.10  ?  898 HOH B O     1 
HETATM 6930 O  O     . HOH R 6 .   ? 8.594   -27.591 21.698  1.00 42.24  ?  899 HOH B O     1 
HETATM 6931 O  O     . HOH R 6 .   ? -15.615 -43.139 30.786  1.00 37.17  ?  900 HOH B O     1 
HETATM 6932 O  O     . HOH R 6 .   ? -40.829 -29.939 12.481  1.00 35.06  ?  901 HOH B O     1 
HETATM 6933 O  O     . HOH R 6 .   ? -34.966 -65.635 35.418  1.00 40.38  ?  902 HOH B O     1 
HETATM 6934 O  O     . HOH R 6 .   ? -11.465 -31.199 37.491  1.00 45.42  ?  903 HOH B O     1 
HETATM 6935 O  O     . HOH R 6 .   ? -37.919 -21.941 24.556  1.00 40.40  ?  904 HOH B O     1 
HETATM 6936 O  O     . HOH R 6 .   ? -32.771 -21.596 4.313   1.00 43.12  ?  905 HOH B O     1 
HETATM 6937 O  O     . HOH R 6 .   ? -9.914  -53.225 21.955  1.00 44.34  ?  906 HOH B O     1 
HETATM 6938 O  O     . HOH R 6 .   ? -29.567 -42.886 16.849  1.00 31.94  ?  907 HOH B O     1 
HETATM 6939 O  O     . HOH R 6 .   ? -23.747 -60.271 10.902  1.00 37.02  ?  908 HOH B O     1 
HETATM 6940 O  O     . HOH R 6 .   ? -1.641  -28.117 -4.607  1.00 40.98  ?  909 HOH B O     1 
HETATM 6941 O  O     . HOH R 6 .   ? -27.854 -43.465 33.915  1.00 49.00  ?  910 HOH B O     1 
HETATM 6942 O  O     . HOH R 6 .   ? -42.546 -23.721 16.118  1.00 49.01  ?  911 HOH B O     1 
HETATM 6943 O  O     . HOH R 6 .   ? -19.298 -49.299 31.519  1.00 38.82  ?  912 HOH B O     1 
HETATM 6944 O  O     . HOH R 6 .   ? -23.813 -15.201 15.599  1.00 42.02  ?  913 HOH B O     1 
HETATM 6945 O  O     . HOH R 6 .   ? -31.317 -17.367 20.003  1.00 39.31  ?  914 HOH B O     1 
HETATM 6946 O  O     . HOH R 6 .   ? -11.369 -37.321 7.994   1.00 44.94  ?  915 HOH B O     1 
HETATM 6947 O  O     . HOH R 6 .   ? -29.462 -42.372 22.991  1.00 45.12  ?  916 HOH B O     1 
HETATM 6948 O  O     . HOH R 6 .   ? -25.381 -15.494 10.377  1.00 47.76  ?  917 HOH B O     1 
HETATM 6949 O  O     . HOH R 6 .   ? 4.961   -30.375 9.143   1.00 46.57  ?  918 HOH B O     1 
HETATM 6950 O  O     . HOH R 6 .   ? -33.348 -70.358 35.593  1.00 41.28  ?  919 HOH B O     1 
HETATM 6951 O  O     . HOH R 6 .   ? -13.973 -66.840 13.735  1.00 40.59  ?  920 HOH B O     1 
HETATM 6952 O  O     . HOH R 6 .   ? -31.618 -40.529 23.485  1.00 50.28  ?  921 HOH B O     1 
HETATM 6953 O  O     . HOH R 6 .   ? -13.613 -71.128 16.512  1.00 39.56  ?  922 HOH B O     1 
HETATM 6954 O  O     . HOH R 6 .   ? -18.174 -46.820 28.322  1.00 34.79  ?  923 HOH B O     1 
HETATM 6955 O  O     . HOH R 6 .   ? -28.765 -38.407 8.655   1.00 45.30  ?  924 HOH B O     1 
HETATM 6956 O  O     . HOH R 6 .   ? -23.244 -17.465 10.857  1.00 41.36  ?  925 HOH B O     1 
HETATM 6957 O  O     . HOH R 6 .   ? -13.398 -35.526 9.196   1.00 29.77  ?  926 HOH B O     1 
HETATM 6958 O  O     . HOH R 6 .   ? -31.752 -19.609 3.251   1.00 38.18  ?  927 HOH B O     1 
HETATM 6959 O  O     . HOH R 6 .   ? -19.237 -78.492 18.827  1.00 45.25  ?  928 HOH B O     1 
HETATM 6960 O  O     . HOH R 6 .   ? -31.303 -15.416 18.592  1.00 35.51  ?  929 HOH B O     1 
HETATM 6961 O  O     . HOH R 6 .   ? -8.693  -46.031 -0.652  1.00 43.09  ?  930 HOH B O     1 
HETATM 6962 O  O     . HOH R 6 .   ? 5.269   -27.695 9.724   1.00 39.08  ?  931 HOH B O     1 
HETATM 6963 O  O     . HOH R 6 .   ? -42.917 -24.515 13.644  1.00 37.64  ?  932 HOH B O     1 
HETATM 6964 O  O     . HOH R 6 .   ? -31.624 -32.330 22.600  1.00 27.09  ?  933 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   THR 3   3   ?   ?   ?   A . n 
A 1 4   ALA 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   VAL 6   6   ?   ?   ?   A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  TYR 14  14  14  TYR TYR A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  VAL 21  21  21  VAL VAL A . n 
A 1 22  TYR 22  22  22  TYR TYR A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  GLY 29  29  29  GLY GLY A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  THR 40  40  40  THR THR A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  ASN 43  43  43  ASN ASN A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  ASN 58  58  58  ASN ASN A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  GLU 70  70  70  GLU GLU A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ILE 73  73  73  ILE ILE A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  THR 78  78  78  THR THR A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  CYS 81  81  81  CYS CYS A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  PHE 86  86  86  PHE PHE A . n 
A 1 87  ILE 87  87  87  ILE ILE A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  CYS 91  91  91  CYS CYS A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  MET 93  93  93  MET MET A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  TRP 98  98  98  TRP TRP A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 CYS 100 100 100 CYS CYS A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 THR 105 105 105 THR THR A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 TYR 122 122 122 TYR TYR A . n 
A 1 123 PRO 123 123 123 PRO PRO A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 PHE 130 130 130 PHE PHE A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 ASP 132 132 132 ASP ASP A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 PRO 138 138 138 PRO PRO A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 TRP 140 140 140 TRP TRP A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 GLN 144 144 144 GLN GLN A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 ALA 147 147 147 ALA ALA A . n 
A 1 148 ALA 148 148 148 ALA ALA A . n 
A 1 149 LYS 149 149 149 LYS LYS A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 CYS 151 151 151 CYS CYS A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ILE 157 157 157 ILE ILE A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 GLN 159 159 159 GLN GLN A . n 
A 1 160 THR 160 160 160 THR THR A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 MET 165 165 165 MET MET A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 THR 169 169 169 THR THR A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 GLU 174 174 174 GLU GLU A . n 
A 1 175 ILE 175 175 175 ILE ILE A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 LYS 178 178 178 LYS LYS A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 TRP 180 180 180 TRP TRP A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 GLN 183 183 183 GLN GLN A . n 
A 1 184 ASN 184 184 184 ASN ASN A . n 
A 1 185 CYS 185 185 185 CYS CYS A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 PHE 194 194 194 PHE PHE A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 THR 199 199 199 THR THR A . n 
A 1 200 THR 200 200 200 THR THR A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ASP 207 207 207 ASP ASP A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 ILE 209 209 209 ILE ILE A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 ASN 211 211 211 ASN ASN A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 TRP 214 214 214 TRP TRP A . n 
A 1 215 ARG 215 215 215 ARG ARG A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 TRP 217 217 217 TRP TRP A . n 
A 1 218 PRO 218 218 218 PRO PRO A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 ASP 221 221 221 ASP ASP A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 ASP 227 227 227 ASP ASP A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 GLN 229 229 229 GLN GLN A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 TYR 231 231 231 TYR TYR A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 LYS 235 235 235 LYS LYS A . n 
A 1 236 GLU 236 236 236 GLU GLU A . n 
A 1 237 VAL 237 237 237 VAL VAL A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 PRO 239 239 239 PRO PRO A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 GLN 243 243 243 GLN GLN A . n 
A 1 244 MET 244 244 244 MET MET A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 LYS 246 246 246 LYS LYS A . n 
A 1 247 LYS 247 247 247 LYS LYS A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 PHE 249 249 249 PHE PHE A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 TRP 251 251 251 TRP TRP A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 VAL 256 256 256 VAL VAL A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 LYS 261 261 261 LYS LYS A . n 
A 1 262 SER 262 262 262 SER SER A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 SER 264 264 264 SER SER A . n 
A 1 265 GLN 265 265 265 GLN GLN A . n 
A 1 266 CYS 266 266 266 CYS CYS A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 VAL 268 268 268 VAL VAL A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 MET 272 272 272 MET MET A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 SER 274 274 274 SER SER A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 ASP 277 277 277 ASP ASP A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 HIS 280 280 280 HIS HIS A . n 
A 1 281 CYS 281 281 281 CYS CYS A . n 
A 1 282 GLU 282 282 282 GLU GLU A . n 
A 1 283 LYS 283 283 283 LYS LYS A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 LYS 285 285 285 LYS LYS A . n 
A 1 286 LYS 286 286 286 LYS LYS A . n 
A 1 287 ALA 287 287 287 ALA ALA A . n 
A 1 288 CYS 288 288 288 CYS CYS A . n 
A 1 289 GLY 289 289 289 GLY GLY A . n 
A 1 290 ASN 290 290 290 ASN ASN A . n 
A 1 291 PHE 291 291 291 PHE PHE A . n 
A 1 292 GLY 292 292 292 GLY GLY A . n 
A 1 293 ILE 293 293 293 ILE ILE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 CYS 295 295 295 CYS CYS A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 ARG 298 298 298 ARG ARG A . n 
A 1 299 VAL 299 299 299 VAL VAL A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 SER 301 301 301 SER SER A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 HIS 303 303 303 HIS HIS A . n 
A 1 304 LYS 304 304 304 LYS LYS A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 PRO 306 306 306 PRO PRO A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 GLU 308 308 308 GLU GLU A . n 
A 1 309 THR 309 309 309 THR THR A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 ARG 311 311 311 ARG ARG A . n 
A 1 312 ILE 312 312 312 ILE ILE A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 GLU 315 315 315 GLU GLU A . n 
A 1 316 TYR 316 316 316 TYR TYR A . n 
A 1 317 GLU 317 317 317 GLU GLU A . n 
A 1 318 GLY 318 318 318 GLY GLY A . n 
A 1 319 ASP 319 319 319 ASP ASP A . n 
A 1 320 GLY 320 320 320 GLY GLY A . n 
A 1 321 ILE 321 321 321 ILE ILE A . n 
A 1 322 PRO 322 322 322 PRO PRO A . n 
A 1 323 THR 323 323 323 THR THR A . n 
A 1 324 VAL 324 324 324 VAL VAL A . n 
A 1 325 PHE 325 325 325 PHE PHE A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 ALA 329 329 329 ALA ALA A . n 
A 1 330 GLY 330 330 330 GLY GLY A . n 
A 1 331 ARG 331 331 331 ARG ARG A . n 
A 1 332 SER 332 332 332 SER SER A . n 
A 1 333 ASN 333 333 333 ASN ASN A . n 
A 1 334 GLY 334 334 334 GLY GLY A . n 
A 1 335 LEU 335 335 335 LEU LEU A . n 
A 1 336 GLY 336 336 336 GLY GLY A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 VAL 338 338 338 VAL VAL A . n 
A 1 339 MET 339 339 339 MET MET A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 GLY 341 341 341 GLY GLY A . n 
A 1 342 ASN 342 342 342 ASN ASN A . n 
A 1 343 THR 343 343 343 THR THR A . n 
A 1 344 ALA 344 344 344 ALA ALA A . n 
A 1 345 TYR 345 345 345 TYR TYR A . n 
A 1 346 PRO 346 346 346 PRO PRO A . n 
A 1 347 VAL 347 347 347 VAL VAL A . n 
A 1 348 ILE 348 348 348 ILE ILE A . n 
A 1 349 SER 349 349 349 SER SER A . n 
A 1 350 CYS 350 350 350 CYS CYS A . n 
A 1 351 PRO 351 351 351 PRO PRO A . n 
A 1 352 PRO 352 352 352 PRO PRO A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 THR 354 354 354 THR THR A . n 
A 1 355 PRO 355 355 355 PRO PRO A . n 
A 1 356 ASP 356 356 356 ASP ASP A . n 
A 1 357 TRP 357 357 357 TRP TRP A . n 
A 1 358 GLY 358 358 358 GLY GLY A . n 
A 1 359 VAL 359 359 359 VAL VAL A . n 
A 1 360 GLN 360 360 360 GLN GLN A . n 
A 1 361 ASP 361 361 361 ASP ASP A . n 
A 1 362 VAL 362 362 362 VAL VAL A . n 
A 1 363 TRP 363 363 363 TRP TRP A . n 
A 1 364 SER 364 364 364 SER SER A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 ARG 367 367 367 ARG ARG A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 PRO 369 369 369 PRO PRO A . n 
A 1 370 SER 370 370 370 SER SER A . n 
A 1 371 GLY 371 371 371 GLY GLY A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 GLY 373 373 373 GLY GLY A . n 
A 1 374 CYS 374 374 374 CYS CYS A . n 
A 1 375 SER 375 375 375 SER SER A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 VAL 377 377 377 VAL VAL A . n 
A 1 378 LEU 378 378 378 LEU LEU A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 PRO 380 380 380 PRO PRO A . n 
A 1 381 GLU 381 381 381 GLU GLU A . n 
A 1 382 GLY 382 382 382 GLY GLY A . n 
A 1 383 SER 383 383 383 SER SER A . n 
A 1 384 ALA 384 384 384 ALA ALA A . n 
A 1 385 GLN 385 385 385 GLN GLN A . n 
A 1 386 PHE 386 386 386 PHE PHE A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 ALA 388 388 388 ALA ALA A . n 
A 1 389 GLN 389 389 389 GLN GLN A . n 
A 1 390 ILE 390 390 390 ILE ILE A . n 
A 1 391 PHE 391 391 391 PHE PHE A . n 
A 1 392 GLY 392 392 392 GLY GLY A . n 
A 1 393 LEU 393 393 393 LEU LEU A . n 
A 1 394 SER 394 394 394 SER SER A . n 
A 1 395 ASN 395 395 395 ASN ASN A . n 
A 1 396 HIS 396 396 396 HIS HIS A . n 
A 1 397 LEU 397 397 397 LEU LEU A . n 
A 1 398 VAL 398 398 398 VAL VAL A . n 
A 1 399 TRP 399 399 399 TRP TRP A . n 
A 1 400 SER 400 400 400 SER SER A . n 
A 1 401 LYS 401 401 401 LYS LYS A . n 
A 1 402 LEU 402 402 402 LEU LEU A . n 
A 1 403 ARG 403 403 403 ARG ARG A . n 
A 1 404 ALA 404 404 404 ALA ALA A . n 
A 1 405 SER 405 405 405 SER SER A . n 
A 1 406 ILE 406 406 406 ILE ILE A . n 
A 1 407 LEU 407 407 407 LEU LEU A . n 
A 1 408 ASN 408 408 408 ASN ASN A . n 
A 1 409 THR 409 409 409 THR THR A . n 
A 1 410 TRP 410 410 410 TRP TRP A . n 
A 1 411 ILE 411 411 411 ILE ILE A . n 
A 1 412 SER 412 412 412 SER SER A . n 
A 1 413 LEU 413 413 413 LEU LEU A . n 
A 1 414 LYS 414 414 414 LYS LYS A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 ALA 416 416 416 ALA ALA A . n 
A 1 417 ASP 417 417 417 ASP ASP A . n 
A 1 418 LYS 418 418 418 LYS LYS A . n 
A 1 419 LYS 419 419 419 LYS LYS A . n 
A 1 420 ILE 420 420 420 ILE ILE A . n 
A 1 421 ARG 421 421 421 ARG ARG A . n 
A 1 422 GLU 422 422 422 GLU GLU A . n 
A 1 423 CYS 423 423 423 CYS CYS A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   THR 3   3   ?   ?   ?   B . n 
B 1 4   ALA 4   4   ?   ?   ?   B . n 
B 1 5   GLU 5   5   ?   ?   ?   B . n 
B 1 6   VAL 6   6   ?   ?   ?   B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  GLY 10  10  10  GLY GLY B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  LYS 12  12  12  LYS LYS B . n 
B 1 13  LEU 13  13  13  LEU LEU B . n 
B 1 14  TYR 14  14  14  TYR TYR B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  THR 18  18  18  THR THR B . n 
B 1 19  LYS 19  19  19  LYS LYS B . n 
B 1 20  GLU 20  20  20  GLU GLU B . n 
B 1 21  VAL 21  21  21  VAL VAL B . n 
B 1 22  TYR 22  22  22  TYR TYR B . n 
B 1 23  GLU 23  23  23  GLU GLU B . n 
B 1 24  LEU 24  24  24  LEU LEU B . n 
B 1 25  LEU 25  25  25  LEU LEU B . n 
B 1 26  ASP 26  26  26  ASP ASP B . n 
B 1 27  SER 27  27  27  SER SER B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  GLY 29  29  29  GLY GLY B . n 
B 1 30  LYS 30  30  30  LYS LYS B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLN 34  34  34  GLN GLN B . n 
B 1 35  SER 35  35  35  SER SER B . n 
B 1 36  LYS 36  36  36  LYS LYS B . n 
B 1 37  ASP 37  37  37  ASP ASP B . n 
B 1 38  GLN 38  38  38  GLN GLN B . n 
B 1 39  ILE 39  39  39  ILE ILE B . n 
B 1 40  THR 40  40  40  THR THR B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  GLY 42  42  42  GLY GLY B . n 
B 1 43  ASN 43  43  43  ASN ASN B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  LYS 47  47  47  LYS LYS B . n 
B 1 48  ASN 48  48  48  ASN ASN B . n 
B 1 49  HIS 49  49  49  HIS HIS B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  GLY 52  52  52  GLY GLY B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ALA 54  54  54  ALA ALA B . n 
B 1 55  ALA 55  55  55  ALA ALA B . n 
B 1 56  ILE 56  56  56  ILE ILE B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  ASN 58  58  58  ASN ASN B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  ILE 60  60  60  ILE ILE B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  CYS 63  63  63  CYS CYS B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  GLN 69  69  69  GLN GLN B . n 
B 1 70  GLU 70  70  70  GLU GLU B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  GLY 72  72  72  GLY GLY B . n 
B 1 73  ILE 73  73  73  ILE ILE B . n 
B 1 74  LYS 74  74  74  LYS LYS B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  PHE 77  77  77  PHE PHE B . n 
B 1 78  THR 78  78  78  THR THR B . n 
B 1 79  ARG 79  79  79  ARG ARG B . n 
B 1 80  LYS 80  80  80  LYS LYS B . n 
B 1 81  CYS 81  81  81  CYS CYS B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  GLU 83  83  83  GLU GLU B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  PHE 86  86  86  PHE PHE B . n 
B 1 87  ILE 87  87  87  ILE ILE B . n 
B 1 88  ALA 88  88  88  ALA ALA B . n 
B 1 89  PRO 89  89  89  PRO PRO B . n 
B 1 90  GLN 90  90  90  GLN GLN B . n 
B 1 91  CYS 91  91  91  CYS CYS B . n 
B 1 92  GLU 92  92  92  GLU GLU B . n 
B 1 93  MET 93  93  93  MET MET B . n 
B 1 94  ILE 94  94  94  ILE ILE B . n 
B 1 95  PRO 95  95  95  PRO PRO B . n 
B 1 96  ILE 96  96  96  ILE ILE B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  TRP 98  98  98  TRP TRP B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 CYS 100 100 100 CYS CYS B . n 
B 1 101 ARG 101 101 101 ARG ARG B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 THR 105 105 105 THR THR B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 SER 107 107 107 SER SER B . n 
B 1 108 PHE 108 108 108 PHE PHE B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 LYS 110 110 110 LYS LYS B . n 
B 1 111 ARG 111 111 111 ARG ARG B . n 
B 1 112 ASN 112 112 112 ASN ASN B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 GLY 114 114 114 GLY GLY B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 LYS 116 116 116 LYS LYS B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 GLY 118 118 118 GLY GLY B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 LYS 120 120 120 LYS LYS B . n 
B 1 121 PHE 121 121 121 PHE PHE B . n 
B 1 122 TYR 122 122 122 TYR TYR B . n 
B 1 123 PRO 123 123 123 PRO PRO B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 LYS 125 125 125 LYS LYS B . n 
B 1 126 VAL 126 126 126 VAL VAL B . n 
B 1 127 GLU 127 127 127 GLU GLU B . n 
B 1 128 LEU 128 128 128 LEU LEU B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 PHE 130 130 130 PHE PHE B . n 
B 1 131 LYS 131 131 131 LYS LYS B . n 
B 1 132 ASP 132 132 132 ASP ASP B . n 
B 1 133 ASP 133 133 133 ASP ASP B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 ASN 135 135 135 ASN ASN B . n 
B 1 136 ASN 136 136 136 ASN ASN B . n 
B 1 137 ASP 137 137 137 ASP ASP B . n 
B 1 138 PRO 138 138 138 PRO PRO B . n 
B 1 139 GLN 139 139 139 GLN GLN B . n 
B 1 140 TRP 140 140 140 TRP TRP B . n 
B 1 141 SER 141 141 141 SER SER B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLU 143 143 143 GLU GLU B . n 
B 1 144 GLN 144 144 144 GLN GLN B . n 
B 1 145 LEU 145 145 145 LEU LEU B . n 
B 1 146 ILE 146 146 146 ILE ILE B . n 
B 1 147 ALA 147 147 147 ALA ALA B . n 
B 1 148 ALA 148 148 148 ALA ALA B . n 
B 1 149 LYS 149 149 149 LYS LYS B . n 
B 1 150 PHE 150 150 150 PHE PHE B . n 
B 1 151 CYS 151 151 151 CYS CYS B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 LEU 155 155 155 LEU LEU B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 ILE 157 157 157 ILE ILE B . n 
B 1 158 GLY 158 158 158 GLY GLY B . n 
B 1 159 GLN 159 159 159 GLN GLN B . n 
B 1 160 THR 160 160 160 THR THR B . n 
B 1 161 GLU 161 161 161 GLU GLU B . n 
B 1 162 VAL 162 162 162 VAL VAL B . n 
B 1 163 ASP 163 163 163 ASP ASP B . n 
B 1 164 ILE 164 164 164 ILE ILE B . n 
B 1 165 MET 165 165 165 MET MET B . n 
B 1 166 SER 166 166 166 SER SER B . n 
B 1 167 HIS 167 167 167 HIS HIS B . n 
B 1 168 ALA 168 168 168 ALA ALA B . n 
B 1 169 THR 169 169 169 THR THR B . n 
B 1 170 GLN 170 170 170 GLN GLN B . n 
B 1 171 ALA 171 171 171 ALA ALA B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 PHE 173 173 173 PHE PHE B . n 
B 1 174 GLU 174 174 174 GLU GLU B . n 
B 1 175 ILE 175 175 175 ILE ILE B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 GLU 177 177 177 GLU GLU B . n 
B 1 178 LYS 178 178 178 LYS LYS B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 TRP 180 180 180 TRP TRP B . n 
B 1 181 LEU 181 181 181 LEU LEU B . n 
B 1 182 PRO 182 182 182 PRO PRO B . n 
B 1 183 GLN 183 183 183 GLN GLN B . n 
B 1 184 ASN 184 184 184 ASN ASN B . n 
B 1 185 CYS 185 185 185 CYS CYS B . n 
B 1 186 THR 186 186 186 THR THR B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 VAL 188 188 188 VAL VAL B . n 
B 1 189 ASP 189 189 189 ASP ASP B . n 
B 1 190 MET 190 190 190 MET MET B . n 
B 1 191 LYS 191 191 191 LYS LYS B . n 
B 1 192 ILE 192 192 192 ILE ILE B . n 
B 1 193 GLU 193 193 193 GLU GLU B . n 
B 1 194 PHE 194 194 194 PHE PHE B . n 
B 1 195 GLY 195 195 195 GLY GLY B . n 
B 1 196 VAL 196 196 196 VAL VAL B . n 
B 1 197 ASP 197 197 197 ASP ASP B . n 
B 1 198 VAL 198 198 198 VAL VAL B . n 
B 1 199 THR 199 199 199 THR THR B . n 
B 1 200 THR 200 200 200 THR THR B . n 
B 1 201 LYS 201 201 201 LYS LYS B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 ILE 203 203 203 ILE ILE B . n 
B 1 204 VAL 204 204 204 VAL VAL B . n 
B 1 205 LEU 205 205 205 LEU LEU B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ASP 207 207 207 ASP ASP B . n 
B 1 208 VAL 208 208 208 VAL VAL B . n 
B 1 209 ILE 209 209 209 ILE ILE B . n 
B 1 210 ASP 210 210 210 ASP ASP B . n 
B 1 211 ASN 211 211 211 ASN ASN B . n 
B 1 212 ASP 212 212 212 ASP ASP B . n 
B 1 213 SER 213 213 213 SER SER B . n 
B 1 214 TRP 214 214 214 TRP TRP B . n 
B 1 215 ARG 215 215 215 ARG ARG B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 TRP 217 217 217 TRP TRP B . n 
B 1 218 PRO 218 218 218 PRO PRO B . n 
B 1 219 SER 219 219 219 SER SER B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 ASP 221 221 221 ASP ASP B . n 
B 1 222 ARG 222 222 222 ARG ARG B . n 
B 1 223 SER 223 223 223 SER SER B . n 
B 1 224 GLN 224 224 224 GLN GLN B . n 
B 1 225 GLN 225 225 225 GLN GLN B . n 
B 1 226 LYS 226 226 226 LYS LYS B . n 
B 1 227 ASP 227 227 227 ASP ASP B . n 
B 1 228 LYS 228 228 228 LYS LYS B . n 
B 1 229 GLN 229 229 229 GLN GLN B . n 
B 1 230 SER 230 230 230 SER SER B . n 
B 1 231 TYR 231 231 231 TYR TYR B . n 
B 1 232 ARG 232 232 232 ARG ARG B . n 
B 1 233 ASP 233 233 233 ASP ASP B . n 
B 1 234 LEU 234 234 234 LEU LEU B . n 
B 1 235 LYS 235 235 235 LYS LYS B . n 
B 1 236 GLU 236 236 236 GLU GLU B . n 
B 1 237 VAL 237 237 237 VAL VAL B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 PRO 239 239 239 PRO PRO B . n 
B 1 240 GLU 240 240 240 GLU GLU B . n 
B 1 241 GLY 241 241 241 GLY GLY B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 GLN 243 243 243 GLN GLN B . n 
B 1 244 MET 244 244 244 MET MET B . n 
B 1 245 VAL 245 245 245 VAL VAL B . n 
B 1 246 LYS 246 246 246 LYS LYS B . n 
B 1 247 LYS 247 247 247 LYS LYS B . n 
B 1 248 ASN 248 248 248 ASN ASN B . n 
B 1 249 PHE 249 249 249 PHE PHE B . n 
B 1 250 GLU 250 250 250 GLU GLU B . n 
B 1 251 TRP 251 251 251 TRP TRP B . n 
B 1 252 VAL 252 252 252 VAL VAL B . n 
B 1 253 ALA 253 253 253 ALA ALA B . n 
B 1 254 GLU 254 254 254 GLU GLU B . n 
B 1 255 ARG 255 255 255 ARG ARG B . n 
B 1 256 VAL 256 256 256 VAL VAL B . n 
B 1 257 GLU 257 257 257 GLU GLU B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 LEU 259 259 259 LEU LEU B . n 
B 1 260 LEU 260 260 260 LEU LEU B . n 
B 1 261 LYS 261 261 261 LYS LYS B . n 
B 1 262 SER 262 262 262 SER SER B . n 
B 1 263 GLU 263 263 263 GLU GLU B . n 
B 1 264 SER 264 264 264 SER SER B . n 
B 1 265 GLN 265 265 265 GLN GLN B . n 
B 1 266 CYS 266 266 266 CYS CYS B . n 
B 1 267 ARG 267 267 267 ARG ARG B . n 
B 1 268 VAL 268 268 268 VAL VAL B . n 
B 1 269 VAL 269 269 269 VAL VAL B . n 
B 1 270 VAL 270 270 270 VAL VAL B . n 
B 1 271 LEU 271 271 271 LEU LEU B . n 
B 1 272 MET 272 272 272 MET MET B . n 
B 1 273 GLY 273 273 273 GLY GLY B . n 
B 1 274 SER 274 274 274 SER SER B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 SER 276 276 276 SER SER B . n 
B 1 277 ASP 277 277 277 ASP ASP B . n 
B 1 278 LEU 278 278 278 LEU LEU B . n 
B 1 279 GLY 279 279 279 GLY GLY B . n 
B 1 280 HIS 280 280 280 HIS HIS B . n 
B 1 281 CYS 281 281 281 CYS CYS B . n 
B 1 282 GLU 282 282 282 GLU GLU B . n 
B 1 283 LYS 283 283 283 LYS LYS B . n 
B 1 284 ILE 284 284 284 ILE ILE B . n 
B 1 285 LYS 285 285 285 LYS LYS B . n 
B 1 286 LYS 286 286 286 LYS LYS B . n 
B 1 287 ALA 287 287 287 ALA ALA B . n 
B 1 288 CYS 288 288 288 CYS CYS B . n 
B 1 289 GLY 289 289 289 GLY GLY B . n 
B 1 290 ASN 290 290 290 ASN ASN B . n 
B 1 291 PHE 291 291 291 PHE PHE B . n 
B 1 292 GLY 292 292 292 GLY GLY B . n 
B 1 293 ILE 293 293 293 ILE ILE B . n 
B 1 294 PRO 294 294 294 PRO PRO B . n 
B 1 295 CYS 295 295 295 CYS CYS B . n 
B 1 296 GLU 296 296 296 GLU GLU B . n 
B 1 297 LEU 297 297 297 LEU LEU B . n 
B 1 298 ARG 298 298 298 ARG ARG B . n 
B 1 299 VAL 299 299 299 VAL VAL B . n 
B 1 300 THR 300 300 300 THR THR B . n 
B 1 301 SER 301 301 301 SER SER B . n 
B 1 302 ALA 302 302 302 ALA ALA B . n 
B 1 303 HIS 303 303 303 HIS HIS B . n 
B 1 304 LYS 304 304 304 LYS LYS B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 PRO 306 306 306 PRO PRO B . n 
B 1 307 ASP 307 307 307 ASP ASP B . n 
B 1 308 GLU 308 308 308 GLU GLU B . n 
B 1 309 THR 309 309 309 THR THR B . n 
B 1 310 LEU 310 310 310 LEU LEU B . n 
B 1 311 ARG 311 311 311 ARG ARG B . n 
B 1 312 ILE 312 312 312 ILE ILE B . n 
B 1 313 LYS 313 313 313 LYS LYS B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 GLU 315 315 315 GLU GLU B . n 
B 1 316 TYR 316 316 316 TYR TYR B . n 
B 1 317 GLU 317 317 317 GLU GLU B . n 
B 1 318 GLY 318 318 318 GLY GLY B . n 
B 1 319 ASP 319 319 319 ASP ASP B . n 
B 1 320 GLY 320 320 320 GLY GLY B . n 
B 1 321 ILE 321 321 321 ILE ILE B . n 
B 1 322 PRO 322 322 322 PRO PRO B . n 
B 1 323 THR 323 323 323 THR THR B . n 
B 1 324 VAL 324 324 324 VAL VAL B . n 
B 1 325 PHE 325 325 325 PHE PHE B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 ALA 327 327 327 ALA ALA B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 ALA 329 329 329 ALA ALA B . n 
B 1 330 GLY 330 330 330 GLY GLY B . n 
B 1 331 ARG 331 331 331 ARG ARG B . n 
B 1 332 SER 332 332 332 SER SER B . n 
B 1 333 ASN 333 333 333 ASN ASN B . n 
B 1 334 GLY 334 334 334 GLY GLY B . n 
B 1 335 LEU 335 335 335 LEU LEU B . n 
B 1 336 GLY 336 336 336 GLY GLY B . n 
B 1 337 PRO 337 337 337 PRO PRO B . n 
B 1 338 VAL 338 338 338 VAL VAL B . n 
B 1 339 MET 339 339 339 MET MET B . n 
B 1 340 SER 340 340 340 SER SER B . n 
B 1 341 GLY 341 341 341 GLY GLY B . n 
B 1 342 ASN 342 342 342 ASN ASN B . n 
B 1 343 THR 343 343 343 THR THR B . n 
B 1 344 ALA 344 344 344 ALA ALA B . n 
B 1 345 TYR 345 345 345 TYR TYR B . n 
B 1 346 PRO 346 346 346 PRO PRO B . n 
B 1 347 VAL 347 347 347 VAL VAL B . n 
B 1 348 ILE 348 348 348 ILE ILE B . n 
B 1 349 SER 349 349 349 SER SER B . n 
B 1 350 CYS 350 350 350 CYS CYS B . n 
B 1 351 PRO 351 351 351 PRO PRO B . n 
B 1 352 PRO 352 352 352 PRO PRO B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 THR 354 354 354 THR THR B . n 
B 1 355 PRO 355 355 355 PRO PRO B . n 
B 1 356 ASP 356 356 356 ASP ASP B . n 
B 1 357 TRP 357 357 357 TRP TRP B . n 
B 1 358 GLY 358 358 358 GLY GLY B . n 
B 1 359 VAL 359 359 359 VAL VAL B . n 
B 1 360 GLN 360 360 360 GLN GLN B . n 
B 1 361 ASP 361 361 361 ASP ASP B . n 
B 1 362 VAL 362 362 362 VAL VAL B . n 
B 1 363 TRP 363 363 363 TRP TRP B . n 
B 1 364 SER 364 364 364 SER SER B . n 
B 1 365 SER 365 365 365 SER SER B . n 
B 1 366 LEU 366 366 366 LEU LEU B . n 
B 1 367 ARG 367 367 367 ARG ARG B . n 
B 1 368 LEU 368 368 368 LEU LEU B . n 
B 1 369 PRO 369 369 369 PRO PRO B . n 
B 1 370 SER 370 370 370 SER SER B . n 
B 1 371 GLY 371 371 371 GLY GLY B . n 
B 1 372 LEU 372 372 372 LEU LEU B . n 
B 1 373 GLY 373 373 373 GLY GLY B . n 
B 1 374 CYS 374 374 374 CYS CYS B . n 
B 1 375 SER 375 375 375 SER SER B . n 
B 1 376 THR 376 376 376 THR THR B . n 
B 1 377 VAL 377 377 377 VAL VAL B . n 
B 1 378 LEU 378 378 378 LEU LEU B . n 
B 1 379 SER 379 379 379 SER SER B . n 
B 1 380 PRO 380 380 380 PRO PRO B . n 
B 1 381 GLU 381 381 381 GLU GLU B . n 
B 1 382 GLY 382 382 382 GLY GLY B . n 
B 1 383 SER 383 383 383 SER SER B . n 
B 1 384 ALA 384 384 384 ALA ALA B . n 
B 1 385 GLN 385 385 385 GLN GLN B . n 
B 1 386 PHE 386 386 386 PHE PHE B . n 
B 1 387 ALA 387 387 387 ALA ALA B . n 
B 1 388 ALA 388 388 388 ALA ALA B . n 
B 1 389 GLN 389 389 389 GLN GLN B . n 
B 1 390 ILE 390 390 390 ILE ILE B . n 
B 1 391 PHE 391 391 391 PHE PHE B . n 
B 1 392 GLY 392 392 392 GLY GLY B . n 
B 1 393 LEU 393 393 393 LEU LEU B . n 
B 1 394 SER 394 394 394 SER SER B . n 
B 1 395 ASN 395 395 395 ASN ASN B . n 
B 1 396 HIS 396 396 396 HIS HIS B . n 
B 1 397 LEU 397 397 397 LEU LEU B . n 
B 1 398 VAL 398 398 398 VAL VAL B . n 
B 1 399 TRP 399 399 399 TRP TRP B . n 
B 1 400 SER 400 400 400 SER SER B . n 
B 1 401 LYS 401 401 401 LYS LYS B . n 
B 1 402 LEU 402 402 402 LEU LEU B . n 
B 1 403 ARG 403 403 403 ARG ARG B . n 
B 1 404 ALA 404 404 404 ALA ALA B . n 
B 1 405 SER 405 405 405 SER SER B . n 
B 1 406 ILE 406 406 406 ILE ILE B . n 
B 1 407 LEU 407 407 407 LEU LEU B . n 
B 1 408 ASN 408 408 408 ASN ASN B . n 
B 1 409 THR 409 409 409 THR THR B . n 
B 1 410 TRP 410 410 410 TRP TRP B . n 
B 1 411 ILE 411 411 411 ILE ILE B . n 
B 1 412 SER 412 412 412 SER SER B . n 
B 1 413 LEU 413 413 413 LEU LEU B . n 
B 1 414 LYS 414 414 414 LYS LYS B . n 
B 1 415 GLN 415 415 415 GLN GLN B . n 
B 1 416 ALA 416 416 416 ALA ALA B . n 
B 1 417 ASP 417 417 417 ASP ASP B . n 
B 1 418 LYS 418 418 418 LYS LYS B . n 
B 1 419 LYS 419 419 419 LYS LYS B . n 
B 1 420 ILE 420 420 420 ILE ILE B . n 
B 1 421 ARG 421 421 421 ARG ARG B . n 
B 1 422 GLU 422 422 422 GLU GLU B . n 
B 1 423 CYS 423 423 423 CYS CYS B . n 
B 1 424 ASN 424 424 424 ASN ASN B . n 
B 1 425 LEU 425 425 425 LEU LEU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ANP 1   501 501  ANP ANP A . 
D 3 OK8 1   502 601  OK8 LIG A . 
E 4 EDO 1   503 801  EDO EDO A . 
F 4 EDO 1   504 901  EDO EDO A . 
G 4 EDO 1   505 1001 EDO EDO A . 
H 4 EDO 1   506 701  EDO EDO A . 
I 5 MG  1   507 1    MG  MG  A . 
J 5 MG  1   508 8    MG  MG  A . 
K 4 EDO 1   701 701  EDO EDO B . 
L 2 ANP 1   702 501  ANP ANP B . 
M 3 OK8 1   703 601  OK8 LIG B . 
N 4 EDO 1   704 801  EDO EDO B . 
O 5 MG  1   705 2    MG  MG  B . 
P 5 MG  1   706 6    MG  MG  B . 
Q 6 HOH 1   601 401  HOH HOH A . 
Q 6 HOH 2   602 392  HOH HOH A . 
Q 6 HOH 3   603 235  HOH HOH A . 
Q 6 HOH 4   604 199  HOH HOH A . 
Q 6 HOH 5   605 282  HOH HOH A . 
Q 6 HOH 6   606 396  HOH HOH A . 
Q 6 HOH 7   607 18   HOH HOH A . 
Q 6 HOH 8   608 249  HOH HOH A . 
Q 6 HOH 9   609 181  HOH HOH A . 
Q 6 HOH 10  610 333  HOH HOH A . 
Q 6 HOH 11  611 226  HOH HOH A . 
Q 6 HOH 12  612 148  HOH HOH A . 
Q 6 HOH 13  613 300  HOH HOH A . 
Q 6 HOH 14  614 145  HOH HOH A . 
Q 6 HOH 15  615 221  HOH HOH A . 
Q 6 HOH 16  616 142  HOH HOH A . 
Q 6 HOH 17  617 183  HOH HOH A . 
Q 6 HOH 18  618 203  HOH HOH A . 
Q 6 HOH 19  619 162  HOH HOH A . 
Q 6 HOH 20  620 63   HOH HOH A . 
Q 6 HOH 21  621 137  HOH HOH A . 
Q 6 HOH 22  622 136  HOH HOH A . 
Q 6 HOH 23  623 301  HOH HOH A . 
Q 6 HOH 24  624 192  HOH HOH A . 
Q 6 HOH 25  625 109  HOH HOH A . 
Q 6 HOH 26  626 147  HOH HOH A . 
Q 6 HOH 27  627 260  HOH HOH A . 
Q 6 HOH 28  628 108  HOH HOH A . 
Q 6 HOH 29  629 232  HOH HOH A . 
Q 6 HOH 30  630 139  HOH HOH A . 
Q 6 HOH 31  631 243  HOH HOH A . 
Q 6 HOH 32  632 251  HOH HOH A . 
Q 6 HOH 33  633 179  HOH HOH A . 
Q 6 HOH 34  634 141  HOH HOH A . 
Q 6 HOH 35  635 296  HOH HOH A . 
Q 6 HOH 36  636 152  HOH HOH A . 
Q 6 HOH 37  637 46   HOH HOH A . 
Q 6 HOH 38  638 89   HOH HOH A . 
Q 6 HOH 39  639 267  HOH HOH A . 
Q 6 HOH 40  640 83   HOH HOH A . 
Q 6 HOH 41  641 177  HOH HOH A . 
Q 6 HOH 42  642 284  HOH HOH A . 
Q 6 HOH 43  643 306  HOH HOH A . 
Q 6 HOH 44  644 315  HOH HOH A . 
Q 6 HOH 45  645 114  HOH HOH A . 
Q 6 HOH 46  646 50   HOH HOH A . 
Q 6 HOH 47  647 194  HOH HOH A . 
Q 6 HOH 48  648 144  HOH HOH A . 
Q 6 HOH 49  649 268  HOH HOH A . 
Q 6 HOH 50  650 229  HOH HOH A . 
Q 6 HOH 51  651 116  HOH HOH A . 
Q 6 HOH 52  652 143  HOH HOH A . 
Q 6 HOH 53  653 69   HOH HOH A . 
Q 6 HOH 54  654 250  HOH HOH A . 
Q 6 HOH 55  655 311  HOH HOH A . 
Q 6 HOH 56  656 259  HOH HOH A . 
Q 6 HOH 57  657 164  HOH HOH A . 
Q 6 HOH 58  658 389  HOH HOH A . 
Q 6 HOH 59  659 309  HOH HOH A . 
Q 6 HOH 60  660 234  HOH HOH A . 
Q 6 HOH 61  661 307  HOH HOH A . 
Q 6 HOH 62  662 187  HOH HOH A . 
Q 6 HOH 63  663 220  HOH HOH A . 
Q 6 HOH 64  664 279  HOH HOH A . 
Q 6 HOH 65  665 120  HOH HOH A . 
Q 6 HOH 66  666 242  HOH HOH A . 
Q 6 HOH 67  667 219  HOH HOH A . 
Q 6 HOH 68  668 105  HOH HOH A . 
Q 6 HOH 69  669 213  HOH HOH A . 
Q 6 HOH 70  670 97   HOH HOH A . 
Q 6 HOH 71  671 246  HOH HOH A . 
Q 6 HOH 72  672 193  HOH HOH A . 
Q 6 HOH 73  673 304  HOH HOH A . 
Q 6 HOH 74  674 138  HOH HOH A . 
Q 6 HOH 75  675 117  HOH HOH A . 
Q 6 HOH 76  676 322  HOH HOH A . 
Q 6 HOH 77  677 150  HOH HOH A . 
Q 6 HOH 78  678 230  HOH HOH A . 
Q 6 HOH 79  679 327  HOH HOH A . 
Q 6 HOH 80  680 323  HOH HOH A . 
Q 6 HOH 81  681 214  HOH HOH A . 
Q 6 HOH 82  682 215  HOH HOH A . 
Q 6 HOH 83  683 157  HOH HOH A . 
Q 6 HOH 84  684 24   HOH HOH A . 
Q 6 HOH 85  685 280  HOH HOH A . 
Q 6 HOH 86  686 44   HOH HOH A . 
Q 6 HOH 87  687 176  HOH HOH A . 
Q 6 HOH 88  688 237  HOH HOH A . 
Q 6 HOH 89  689 111  HOH HOH A . 
Q 6 HOH 90  690 146  HOH HOH A . 
Q 6 HOH 91  691 38   HOH HOH A . 
Q 6 HOH 92  692 312  HOH HOH A . 
Q 6 HOH 93  693 265  HOH HOH A . 
Q 6 HOH 94  694 118  HOH HOH A . 
Q 6 HOH 95  695 248  HOH HOH A . 
Q 6 HOH 96  696 236  HOH HOH A . 
Q 6 HOH 97  697 319  HOH HOH A . 
Q 6 HOH 98  698 397  HOH HOH A . 
Q 6 HOH 99  699 103  HOH HOH A . 
Q 6 HOH 100 700 245  HOH HOH A . 
Q 6 HOH 101 701 285  HOH HOH A . 
Q 6 HOH 102 702 321  HOH HOH A . 
Q 6 HOH 103 703 299  HOH HOH A . 
Q 6 HOH 104 704 32   HOH HOH A . 
Q 6 HOH 105 705 318  HOH HOH A . 
Q 6 HOH 106 706 10   HOH HOH A . 
Q 6 HOH 107 707 320  HOH HOH A . 
Q 6 HOH 108 708 217  HOH HOH A . 
Q 6 HOH 109 709 262  HOH HOH A . 
Q 6 HOH 110 710 275  HOH HOH A . 
Q 6 HOH 111 711 225  HOH HOH A . 
Q 6 HOH 112 712 208  HOH HOH A . 
Q 6 HOH 113 713 276  HOH HOH A . 
Q 6 HOH 114 714 100  HOH HOH A . 
Q 6 HOH 115 715 35   HOH HOH A . 
Q 6 HOH 116 716 228  HOH HOH A . 
Q 6 HOH 117 717 70   HOH HOH A . 
Q 6 HOH 118 718 387  HOH HOH A . 
Q 6 HOH 119 719 253  HOH HOH A . 
Q 6 HOH 120 720 313  HOH HOH A . 
Q 6 HOH 121 721 317  HOH HOH A . 
Q 6 HOH 122 722 324  HOH HOH A . 
Q 6 HOH 123 723 227  HOH HOH A . 
Q 6 HOH 124 724 209  HOH HOH A . 
Q 6 HOH 125 725 258  HOH HOH A . 
Q 6 HOH 126 726 281  HOH HOH A . 
Q 6 HOH 127 727 191  HOH HOH A . 
Q 6 HOH 128 728 189  HOH HOH A . 
Q 6 HOH 129 729 43   HOH HOH A . 
Q 6 HOH 130 730 196  HOH HOH A . 
Q 6 HOH 131 731 302  HOH HOH A . 
Q 6 HOH 132 732 218  HOH HOH A . 
Q 6 HOH 133 733 207  HOH HOH A . 
Q 6 HOH 134 734 378  HOH HOH A . 
Q 6 HOH 135 735 286  HOH HOH A . 
Q 6 HOH 136 736 40   HOH HOH A . 
Q 6 HOH 137 737 231  HOH HOH A . 
Q 6 HOH 138 738 398  HOH HOH A . 
Q 6 HOH 139 739 263  HOH HOH A . 
Q 6 HOH 140 740 153  HOH HOH A . 
Q 6 HOH 141 741 283  HOH HOH A . 
Q 6 HOH 142 742 211  HOH HOH A . 
Q 6 HOH 143 743 325  HOH HOH A . 
Q 6 HOH 144 744 332  HOH HOH A . 
Q 6 HOH 145 745 326  HOH HOH A . 
Q 6 HOH 146 746 190  HOH HOH A . 
Q 6 HOH 147 747 201  HOH HOH A . 
Q 6 HOH 148 748 188  HOH HOH A . 
Q 6 HOH 149 749 240  HOH HOH A . 
Q 6 HOH 150 750 119  HOH HOH A . 
Q 6 HOH 151 751 224  HOH HOH A . 
Q 6 HOH 152 752 316  HOH HOH A . 
Q 6 HOH 153 753 239  HOH HOH A . 
R 6 HOH 1   801 342  HOH HOH B . 
R 6 HOH 2   802 374  HOH HOH B . 
R 6 HOH 3   803 365  HOH HOH B . 
R 6 HOH 4   804 384  HOH HOH B . 
R 6 HOH 5   805 184  HOH HOH B . 
R 6 HOH 6   806 168  HOH HOH B . 
R 6 HOH 7   807 140  HOH HOH B . 
R 6 HOH 8   808 371  HOH HOH B . 
R 6 HOH 9   809 158  HOH HOH B . 
R 6 HOH 10  810 375  HOH HOH B . 
R 6 HOH 11  811 383  HOH HOH B . 
R 6 HOH 12  812 172  HOH HOH B . 
R 6 HOH 13  813 169  HOH HOH B . 
R 6 HOH 14  814 174  HOH HOH B . 
R 6 HOH 15  815 257  HOH HOH B . 
R 6 HOH 16  816 165  HOH HOH B . 
R 6 HOH 17  817 388  HOH HOH B . 
R 6 HOH 18  818 369  HOH HOH B . 
R 6 HOH 19  819 154  HOH HOH B . 
R 6 HOH 20  820 385  HOH HOH B . 
R 6 HOH 21  821 49   HOH HOH B . 
R 6 HOH 22  822 355  HOH HOH B . 
R 6 HOH 23  823 341  HOH HOH B . 
R 6 HOH 24  824 330  HOH HOH B . 
R 6 HOH 25  825 45   HOH HOH B . 
R 6 HOH 26  826 391  HOH HOH B . 
R 6 HOH 27  827 295  HOH HOH B . 
R 6 HOH 28  828 106  HOH HOH B . 
R 6 HOH 29  829 390  HOH HOH B . 
R 6 HOH 30  830 68   HOH HOH B . 
R 6 HOH 31  831 238  HOH HOH B . 
R 6 HOH 32  832 155  HOH HOH B . 
R 6 HOH 33  833 57   HOH HOH B . 
R 6 HOH 34  834 351  HOH HOH B . 
R 6 HOH 35  835 328  HOH HOH B . 
R 6 HOH 36  836 264  HOH HOH B . 
R 6 HOH 37  837 373  HOH HOH B . 
R 6 HOH 38  838 348  HOH HOH B . 
R 6 HOH 39  839 81   HOH HOH B . 
R 6 HOH 40  840 204  HOH HOH B . 
R 6 HOH 41  841 110  HOH HOH B . 
R 6 HOH 42  842 254  HOH HOH B . 
R 6 HOH 43  843 393  HOH HOH B . 
R 6 HOH 44  844 386  HOH HOH B . 
R 6 HOH 45  845 115  HOH HOH B . 
R 6 HOH 46  846 156  HOH HOH B . 
R 6 HOH 47  847 71   HOH HOH B . 
R 6 HOH 48  848 151  HOH HOH B . 
R 6 HOH 49  849 65   HOH HOH B . 
R 6 HOH 50  850 173  HOH HOH B . 
R 6 HOH 51  851 132  HOH HOH B . 
R 6 HOH 52  852 358  HOH HOH B . 
R 6 HOH 53  853 350  HOH HOH B . 
R 6 HOH 54  854 178  HOH HOH B . 
R 6 HOH 55  855 29   HOH HOH B . 
R 6 HOH 56  856 180  HOH HOH B . 
R 6 HOH 57  857 293  HOH HOH B . 
R 6 HOH 58  858 96   HOH HOH B . 
R 6 HOH 59  859 362  HOH HOH B . 
R 6 HOH 60  860 28   HOH HOH B . 
R 6 HOH 61  861 356  HOH HOH B . 
R 6 HOH 62  862 399  HOH HOH B . 
R 6 HOH 63  863 363  HOH HOH B . 
R 6 HOH 64  864 349  HOH HOH B . 
R 6 HOH 65  865 335  HOH HOH B . 
R 6 HOH 66  866 256  HOH HOH B . 
R 6 HOH 67  867 202  HOH HOH B . 
R 6 HOH 68  868 112  HOH HOH B . 
R 6 HOH 69  869 72   HOH HOH B . 
R 6 HOH 70  870 56   HOH HOH B . 
R 6 HOH 71  871 379  HOH HOH B . 
R 6 HOH 72  872 376  HOH HOH B . 
R 6 HOH 73  873 166  HOH HOH B . 
R 6 HOH 74  874 25   HOH HOH B . 
R 6 HOH 75  875 364  HOH HOH B . 
R 6 HOH 76  876 182  HOH HOH B . 
R 6 HOH 77  877 346  HOH HOH B . 
R 6 HOH 78  878 161  HOH HOH B . 
R 6 HOH 79  879 338  HOH HOH B . 
R 6 HOH 80  880 90   HOH HOH B . 
R 6 HOH 81  881 359  HOH HOH B . 
R 6 HOH 82  882 360  HOH HOH B . 
R 6 HOH 83  883 75   HOH HOH B . 
R 6 HOH 84  884 186  HOH HOH B . 
R 6 HOH 85  885 160  HOH HOH B . 
R 6 HOH 86  886 271  HOH HOH B . 
R 6 HOH 87  887 340  HOH HOH B . 
R 6 HOH 88  888 170  HOH HOH B . 
R 6 HOH 89  889 9    HOH HOH B . 
R 6 HOH 90  890 99   HOH HOH B . 
R 6 HOH 91  891 343  HOH HOH B . 
R 6 HOH 92  892 7    HOH HOH B . 
R 6 HOH 93  893 357  HOH HOH B . 
R 6 HOH 94  894 86   HOH HOH B . 
R 6 HOH 95  895 61   HOH HOH B . 
R 6 HOH 96  896 167  HOH HOH B . 
R 6 HOH 97  897 77   HOH HOH B . 
R 6 HOH 98  898 266  HOH HOH B . 
R 6 HOH 99  899 197  HOH HOH B . 
R 6 HOH 100 900 291  HOH HOH B . 
R 6 HOH 101 901 163  HOH HOH B . 
R 6 HOH 102 902 241  HOH HOH B . 
R 6 HOH 103 903 377  HOH HOH B . 
R 6 HOH 104 904 339  HOH HOH B . 
R 6 HOH 105 905 367  HOH HOH B . 
R 6 HOH 106 906 270  HOH HOH B . 
R 6 HOH 107 907 74   HOH HOH B . 
R 6 HOH 108 908 252  HOH HOH B . 
R 6 HOH 109 909 175  HOH HOH B . 
R 6 HOH 110 910 290  HOH HOH B . 
R 6 HOH 111 911 345  HOH HOH B . 
R 6 HOH 112 912 294  HOH HOH B . 
R 6 HOH 113 913 127  HOH HOH B . 
R 6 HOH 114 914 337  HOH HOH B . 
R 6 HOH 115 915 361  HOH HOH B . 
R 6 HOH 116 916 288  HOH HOH B . 
R 6 HOH 117 917 185  HOH HOH B . 
R 6 HOH 118 918 380  HOH HOH B . 
R 6 HOH 119 919 244  HOH HOH B . 
R 6 HOH 120 920 273  HOH HOH B . 
R 6 HOH 121 921 287  HOH HOH B . 
R 6 HOH 122 922 272  HOH HOH B . 
R 6 HOH 123 923 22   HOH HOH B . 
R 6 HOH 124 924 261  HOH HOH B . 
R 6 HOH 125 925 129  HOH HOH B . 
R 6 HOH 126 926 205  HOH HOH B . 
R 6 HOH 127 927 366  HOH HOH B . 
R 6 HOH 128 928 400  HOH HOH B . 
R 6 HOH 129 929 336  HOH HOH B . 
R 6 HOH 130 930 382  HOH HOH B . 
R 6 HOH 131 931 381  HOH HOH B . 
R 6 HOH 132 932 344  HOH HOH B . 
R 6 HOH 133 933 200  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 55070  ? 
1 MORE         -280   ? 
1 'SSA (A^2)'  118610 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000  
0.0000000000 0.0000000000    0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_445 -x-1,-y-1,z -1.0000000000 0.0000000000 0.0000000000 -61.2630000000 0.0000000000 -1.0000000000 
0.0000000000 -154.0190000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
3 'crystal symmetry operation' 3_455 -x-1,y,-z   -1.0000000000 0.0000000000 0.0000000000 -61.2630000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000    0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_545 x,-y-1,-z   1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 -1.0000000000 
0.0000000000 -154.0190000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 97  ? A GLU 97  ? 1_555 MG ? J MG . ? A MG 508 ? 1_555 OD2 ? A ASP 137 ? A ASP 137 ? 1_555 76.6  ? 
2  OE2 ? A GLU 97  ? A GLU 97  ? 1_555 MG ? J MG . ? A MG 508 ? 1_555 O11 ? D OK8 .   ? A OK8 502 ? 1_555 86.4  ? 
3  OD2 ? A ASP 137 ? A ASP 137 ? 1_555 MG ? J MG . ? A MG 508 ? 1_555 O11 ? D OK8 .   ? A OK8 502 ? 1_555 87.0  ? 
4  O2B ? C ANP .   ? A ANP 501 ? 1_555 MG ? I MG . ? A MG 507 ? 1_555 O2A ? C ANP .   ? A ANP 501 ? 1_555 70.4  ? 
5  OE2 ? B GLU 97  ? B GLU 97  ? 1_555 MG ? P MG . ? B MG 706 ? 1_555 OD2 ? B ASP 137 ? B ASP 137 ? 1_555 79.0  ? 
6  OE2 ? B GLU 97  ? B GLU 97  ? 1_555 MG ? P MG . ? B MG 706 ? 1_555 O11 ? M OK8 .   ? B OK8 703 ? 1_555 94.0  ? 
7  OD2 ? B ASP 137 ? B ASP 137 ? 1_555 MG ? P MG . ? B MG 706 ? 1_555 O11 ? M OK8 .   ? B OK8 703 ? 1_555 90.2  ? 
8  OE2 ? B GLU 97  ? B GLU 97  ? 1_555 MG ? P MG . ? B MG 706 ? 1_555 O   ? R HOH .   ? B HOH 925 ? 1_555 97.1  ? 
9  OD2 ? B ASP 137 ? B ASP 137 ? 1_555 MG ? P MG . ? B MG 706 ? 1_555 O   ? R HOH .   ? B HOH 925 ? 1_555 124.2 ? 
10 O11 ? M OK8 .   ? B OK8 703 ? 1_555 MG ? P MG . ? B MG 706 ? 1_555 O   ? R HOH .   ? B HOH 925 ? 1_555 145.2 ? 
11 O2B ? L ANP .   ? B ANP 702 ? 1_555 MG ? O MG . ? B MG 705 ? 1_555 O2A ? L ANP .   ? B ANP 702 ? 1_555 68.6  ? 
12 O2B ? L ANP .   ? B ANP 702 ? 1_555 MG ? O MG . ? B MG 705 ? 1_555 O   ? R HOH .   ? B HOH 826 ? 1_555 67.2  ? 
13 O2A ? L ANP .   ? B ANP 702 ? 1_555 MG ? O MG . ? B MG 705 ? 1_555 O   ? R HOH .   ? B HOH 826 ? 1_555 62.5  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-07-08 
2 'Structure model' 1 1 2020-09-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation               
2 2 'Structure model' citation_author        
3 2 'Structure model' pdbx_struct_conn_angle 
4 2 'Structure model' struct_conn            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_volume'                    
2  2 'Structure model' '_citation.page_first'                        
3  2 'Structure model' '_citation.page_last'                         
4  2 'Structure model' '_citation_author.identifier_ORCID'           
5  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
6  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
7  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
8  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
9  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id'  
13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
15 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
16 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
17 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
18 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
19 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
20 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
21 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
22 2 'Structure model' '_pdbx_struct_conn_angle.value'               
23 2 'Structure model' '_struct_conn.pdbx_dist_value'                
24 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
25 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
26 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
27 2 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
28 2 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
29 2 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
30 2 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
31 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
32 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
33 2 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ?                 ?                                       ?              ? ? ? ?          ? ? REFMAC      
? ? ?       5.8.0232 1 
? 'data reduction'  ? ? 'Wolfgang Kabsch' Wolfgang.Kabsch@mpimf-heidelberg.mpg.de ?              ? ? ? ?          
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/                             ? XDS         ? ? package .        2 
? 'data scaling'    ? ? 'Wolfgang Kabsch' ?                                       ?              ? ? ? ?          
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ? XSCALE      ? ? package .        3 
? phasing           ? ? 'Alexei Vaguine'  alexei@ysbl.york.ac.uk                  ?              ? ? ? Fortran_77 
http://www.ccp4.ac.uk/dist/html/molrep.html                                 ? MOLREP      ? ? program .        4 
? 'data extraction' ? ? PDB               deposit@deposit.rcsb.org                'Apr. 1, 2019' ? ? ? C++        
http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   ? PDB_EXTRACT ? ? package 3.25     5 
# 
_pdbx_entry_details.entry_id                 6YB9 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.has_ligand_of_interest   Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ALA A 44  ? ? -114.00 -150.43 
2  1 THR A 78  ? ? -103.97 -64.87  
3  1 ASP A 132 ? ? -171.83 104.08  
4  1 ASP A 137 ? ? 67.65   74.72   
5  1 ALA A 206 ? ? -149.48 -158.98 
6  1 ASP A 207 ? ? 53.17   -134.23 
7  1 ARG A 331 ? ? 56.32   -137.35 
8  1 CYS A 423 ? ? -79.64  29.71   
9  1 ALA B 44  ? ? -102.75 -155.15 
10 1 THR B 78  ? ? -103.22 -63.14  
11 1 ASP B 132 ? ? -173.68 108.41  
12 1 ASP B 137 ? ? 66.90   74.92   
13 1 ALA B 206 ? ? -151.50 -156.77 
14 1 ASP B 207 ? ? 50.74   -132.87 
15 1 ARG B 331 ? ? 55.70   -137.69 
16 1 CYS B 350 ? ? -119.77 78.80   
17 1 CYS B 423 ? ? -77.35  26.79   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1 ? A MET 1 
2  1 Y 1 A ALA 2 ? A ALA 2 
3  1 Y 1 A THR 3 ? A THR 3 
4  1 Y 1 A ALA 4 ? A ALA 4 
5  1 Y 1 A GLU 5 ? A GLU 5 
6  1 Y 1 A VAL 6 ? A VAL 6 
7  1 Y 1 B MET 1 ? B MET 1 
8  1 Y 1 B ALA 2 ? B ALA 2 
9  1 Y 1 B THR 3 ? B THR 3 
10 1 Y 1 B ALA 4 ? B ALA 4 
11 1 Y 1 B GLU 5 ? B GLU 5 
12 1 Y 1 B VAL 6 ? B VAL 6 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Swedish Research Council'                    Sweden           ?                                 1 
'European Research Council (ERC)'             'European Union' 695376                            2 
'Ministry of Education (MoE, Czech Republic)' 'Czech Republic' CZ.02.2.69/0.0/0.0/16_027/0008477 3 
# 
loop_
_pdbx_entity_instance_feature.ordinal 
_pdbx_entity_instance_feature.comp_id 
_pdbx_entity_instance_feature.asym_id 
_pdbx_entity_instance_feature.seq_num 
_pdbx_entity_instance_feature.auth_comp_id 
_pdbx_entity_instance_feature.auth_asym_id 
_pdbx_entity_instance_feature.auth_seq_num 
_pdbx_entity_instance_feature.feature_type 
_pdbx_entity_instance_feature.details 
1 ANP ? ? ANP ? ? 'SUBJECT OF INVESTIGATION' ? 
2 OK8 ? ? OK8 ? ? 'SUBJECT OF INVESTIGATION' ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
3 
;(2~{S})-2-[[5-azanyl-1-[(2~{R},3~{R},4~{S},5~{R})-3,4-bis(oxidanyl)-5-(phosphonooxymethyl)oxolan-2-yl]imidazol-4-yl]car bonylamino]butanedioic acid
;
OK8 
4 1,2-ETHANEDIOL EDO 
5 'MAGNESIUM ION' MG  
6 water HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#