data_7ACN
# 
_entry.id   7ACN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   7ACN         
WWPDB D_1000179878 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        7ACN 
_pdbx_database_status.recvd_initial_deposition_date   1991-05-15 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lauble, H.'    1 
'Kennedy, M.C.' 2 
'Beinert, H.'   3 
'Stout, C.D.'   4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structures of aconitase with isocitrate and nitroisocitrate bound.'          Biochemistry           31  2735 2748 
1992 BICHAW US 0006-2960 0033 ? 1547214 10.1021/bi00125a014 
1       'Structure of Activated Aconitase. Formation of the (4Fe-4S) Cluster in the Crystal'  Proc.Natl.Acad.Sci.USA 86  3639 ?    
1989 PNASA6 US 0027-8424 0040 ? ?       ?                   
2       'The Structure of Aconitase'                                                          Proteins               5   289  ?    
1989 PSFGEY US 0887-3585 0867 ? ?       ?                   
3       'Iron-Sulfur Cluster in Aconitase. Crystallographic Evidence for a Three-Iron Center' J.Biol.Chem.           260 2328 ?    
1985 JBCHA3 US 0021-9258 0071 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lauble, H.'    1  
primary 'Kennedy, M.C.' 2  
primary 'Beinert, H.'   3  
primary 'Stout, C.D.'   4  
1       'Robbins, A.H.' 5  
1       'Stout, C.D.'   6  
2       'Robbins, A.H.' 7  
2       'Stout, C.D.'   8  
3       'Robbins, A.H.' 9  
3       'Stout, C.D.'   10 
# 
_cell.entry_id           7ACN 
_cell.length_a           185.500 
_cell.length_b           72.000 
_cell.length_c           73.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        77.70 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         7ACN 
_symmetry.space_group_name_H-M             'B 1 1 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACONITASE             82789.047 1   4.2.1.3 ? ? ? 
2 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640   1   ?       ? ? ? 
3 non-polymer syn 'ISOCITRIC ACID'      192.124   1   ?       ? ? ? 
4 water       nat water                 18.015    338 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(PCA)RAKVAMSHFEPHEYIRYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATA
QMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAY
PGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGA
IVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHYDQVIEINLS
ELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQI
RATIERDGYAQVLRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAG
TLKFNPETDFLTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQ
ILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVVIGDE
NYGEGSSREHSALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFAPGKPLKCIIK
HPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ERAKVAMSHFEPHEYIRYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAM
LQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVL
LIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEY
HGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHYDQVIEINLSELKP
HINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATI
ERDGYAQVLRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKF
NPETDFLTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIK
VKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENRKANSVRNAVTQEFGPVPDTARYYKQHGIRWVVIGDENYGE
GSSREHSALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKDFAPGKPLKCIIKHPNG
TQETILLNHTFNETQIEWFRAGSALNRMKELQQK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PCA n 
1 2   ARG n 
1 3   ALA n 
1 4   LYS n 
1 5   VAL n 
1 6   ALA n 
1 7   MET n 
1 8   SER n 
1 9   HIS n 
1 10  PHE n 
1 11  GLU n 
1 12  PRO n 
1 13  HIS n 
1 14  GLU n 
1 15  TYR n 
1 16  ILE n 
1 17  ARG n 
1 18  TYR n 
1 19  ASP n 
1 20  LEU n 
1 21  LEU n 
1 22  GLU n 
1 23  LYS n 
1 24  ASN n 
1 25  ILE n 
1 26  ASP n 
1 27  ILE n 
1 28  VAL n 
1 29  ARG n 
1 30  LYS n 
1 31  ARG n 
1 32  LEU n 
1 33  ASN n 
1 34  ARG n 
1 35  PRO n 
1 36  LEU n 
1 37  THR n 
1 38  LEU n 
1 39  SER n 
1 40  GLU n 
1 41  LYS n 
1 42  ILE n 
1 43  VAL n 
1 44  TYR n 
1 45  GLY n 
1 46  HIS n 
1 47  LEU n 
1 48  ASP n 
1 49  ASP n 
1 50  PRO n 
1 51  ALA n 
1 52  ASN n 
1 53  GLN n 
1 54  GLU n 
1 55  ILE n 
1 56  GLU n 
1 57  ARG n 
1 58  GLY n 
1 59  LYS n 
1 60  THR n 
1 61  TYR n 
1 62  LEU n 
1 63  ARG n 
1 64  LEU n 
1 65  ARG n 
1 66  PRO n 
1 67  ASP n 
1 68  ARG n 
1 69  VAL n 
1 70  ALA n 
1 71  MET n 
1 72  GLN n 
1 73  ASP n 
1 74  ALA n 
1 75  THR n 
1 76  ALA n 
1 77  GLN n 
1 78  MET n 
1 79  ALA n 
1 80  MET n 
1 81  LEU n 
1 82  GLN n 
1 83  PHE n 
1 84  ILE n 
1 85  SER n 
1 86  SER n 
1 87  GLY n 
1 88  LEU n 
1 89  PRO n 
1 90  LYS n 
1 91  VAL n 
1 92  ALA n 
1 93  VAL n 
1 94  PRO n 
1 95  SER n 
1 96  THR n 
1 97  ILE n 
1 98  HIS n 
1 99  CYS n 
1 100 ASP n 
1 101 HIS n 
1 102 LEU n 
1 103 ILE n 
1 104 GLU n 
1 105 ALA n 
1 106 GLN n 
1 107 LEU n 
1 108 GLY n 
1 109 GLY n 
1 110 GLU n 
1 111 LYS n 
1 112 ASP n 
1 113 LEU n 
1 114 ARG n 
1 115 ARG n 
1 116 ALA n 
1 117 LYS n 
1 118 ASP n 
1 119 ILE n 
1 120 ASN n 
1 121 GLN n 
1 122 GLU n 
1 123 VAL n 
1 124 TYR n 
1 125 ASN n 
1 126 PHE n 
1 127 LEU n 
1 128 ALA n 
1 129 THR n 
1 130 ALA n 
1 131 GLY n 
1 132 ALA n 
1 133 LYS n 
1 134 TYR n 
1 135 GLY n 
1 136 VAL n 
1 137 GLY n 
1 138 PHE n 
1 139 TRP n 
1 140 ARG n 
1 141 PRO n 
1 142 GLY n 
1 143 SER n 
1 144 GLY n 
1 145 ILE n 
1 146 ILE n 
1 147 HIS n 
1 148 GLN n 
1 149 ILE n 
1 150 ILE n 
1 151 LEU n 
1 152 GLU n 
1 153 ASN n 
1 154 TYR n 
1 155 ALA n 
1 156 TYR n 
1 157 PRO n 
1 158 GLY n 
1 159 VAL n 
1 160 LEU n 
1 161 LEU n 
1 162 ILE n 
1 163 GLY n 
1 164 THR n 
1 165 ASP n 
1 166 SER n 
1 167 HIS n 
1 168 THR n 
1 169 PRO n 
1 170 ASN n 
1 171 GLY n 
1 172 GLY n 
1 173 GLY n 
1 174 LEU n 
1 175 GLY n 
1 176 GLY n 
1 177 ILE n 
1 178 CYS n 
1 179 ILE n 
1 180 GLY n 
1 181 VAL n 
1 182 GLY n 
1 183 GLY n 
1 184 ALA n 
1 185 ASP n 
1 186 ALA n 
1 187 VAL n 
1 188 ASP n 
1 189 VAL n 
1 190 MET n 
1 191 ALA n 
1 192 GLY n 
1 193 ILE n 
1 194 PRO n 
1 195 TRP n 
1 196 GLU n 
1 197 LEU n 
1 198 LYS n 
1 199 CYS n 
1 200 PRO n 
1 201 LYS n 
1 202 VAL n 
1 203 ILE n 
1 204 GLY n 
1 205 VAL n 
1 206 LYS n 
1 207 LEU n 
1 208 THR n 
1 209 GLY n 
1 210 SER n 
1 211 LEU n 
1 212 SER n 
1 213 GLY n 
1 214 TRP n 
1 215 THR n 
1 216 SER n 
1 217 PRO n 
1 218 LYS n 
1 219 ASP n 
1 220 VAL n 
1 221 ILE n 
1 222 LEU n 
1 223 LYS n 
1 224 VAL n 
1 225 ALA n 
1 226 GLY n 
1 227 ILE n 
1 228 LEU n 
1 229 THR n 
1 230 VAL n 
1 231 LYS n 
1 232 GLY n 
1 233 GLY n 
1 234 THR n 
1 235 GLY n 
1 236 ALA n 
1 237 ILE n 
1 238 VAL n 
1 239 GLU n 
1 240 TYR n 
1 241 HIS n 
1 242 GLY n 
1 243 PRO n 
1 244 GLY n 
1 245 VAL n 
1 246 ASP n 
1 247 SER n 
1 248 ILE n 
1 249 SER n 
1 250 CYS n 
1 251 THR n 
1 252 GLY n 
1 253 MET n 
1 254 ALA n 
1 255 THR n 
1 256 ILE n 
1 257 CYS n 
1 258 ASN n 
1 259 MET n 
1 260 GLY n 
1 261 ALA n 
1 262 GLU n 
1 263 ILE n 
1 264 GLY n 
1 265 ALA n 
1 266 THR n 
1 267 THR n 
1 268 SER n 
1 269 VAL n 
1 270 PHE n 
1 271 PRO n 
1 272 TYR n 
1 273 ASN n 
1 274 HIS n 
1 275 ARG n 
1 276 MET n 
1 277 LYS n 
1 278 LYS n 
1 279 TYR n 
1 280 LEU n 
1 281 SER n 
1 282 LYS n 
1 283 THR n 
1 284 GLY n 
1 285 ARG n 
1 286 ALA n 
1 287 ASP n 
1 288 ILE n 
1 289 ALA n 
1 290 ASN n 
1 291 LEU n 
1 292 ALA n 
1 293 ASP n 
1 294 GLU n 
1 295 PHE n 
1 296 LYS n 
1 297 ASP n 
1 298 HIS n 
1 299 LEU n 
1 300 VAL n 
1 301 PRO n 
1 302 ASP n 
1 303 PRO n 
1 304 GLY n 
1 305 CYS n 
1 306 HIS n 
1 307 TYR n 
1 308 ASP n 
1 309 GLN n 
1 310 VAL n 
1 311 ILE n 
1 312 GLU n 
1 313 ILE n 
1 314 ASN n 
1 315 LEU n 
1 316 SER n 
1 317 GLU n 
1 318 LEU n 
1 319 LYS n 
1 320 PRO n 
1 321 HIS n 
1 322 ILE n 
1 323 ASN n 
1 324 GLY n 
1 325 PRO n 
1 326 PHE n 
1 327 THR n 
1 328 PRO n 
1 329 ASP n 
1 330 LEU n 
1 331 ALA n 
1 332 HIS n 
1 333 PRO n 
1 334 VAL n 
1 335 ALA n 
1 336 GLU n 
1 337 VAL n 
1 338 GLY n 
1 339 SER n 
1 340 VAL n 
1 341 ALA n 
1 342 GLU n 
1 343 LYS n 
1 344 GLU n 
1 345 GLY n 
1 346 TRP n 
1 347 PRO n 
1 348 LEU n 
1 349 ASP n 
1 350 ILE n 
1 351 ARG n 
1 352 VAL n 
1 353 GLY n 
1 354 LEU n 
1 355 ILE n 
1 356 GLY n 
1 357 SER n 
1 358 CYS n 
1 359 THR n 
1 360 ASN n 
1 361 SER n 
1 362 SER n 
1 363 TYR n 
1 364 GLU n 
1 365 ASP n 
1 366 MET n 
1 367 GLY n 
1 368 ARG n 
1 369 SER n 
1 370 ALA n 
1 371 ALA n 
1 372 VAL n 
1 373 ALA n 
1 374 LYS n 
1 375 GLN n 
1 376 ALA n 
1 377 LEU n 
1 378 ALA n 
1 379 HIS n 
1 380 GLY n 
1 381 LEU n 
1 382 LYS n 
1 383 CYS n 
1 384 LYS n 
1 385 SER n 
1 386 GLN n 
1 387 PHE n 
1 388 THR n 
1 389 ILE n 
1 390 THR n 
1 391 PRO n 
1 392 GLY n 
1 393 SER n 
1 394 GLU n 
1 395 GLN n 
1 396 ILE n 
1 397 ARG n 
1 398 ALA n 
1 399 THR n 
1 400 ILE n 
1 401 GLU n 
1 402 ARG n 
1 403 ASP n 
1 404 GLY n 
1 405 TYR n 
1 406 ALA n 
1 407 GLN n 
1 408 VAL n 
1 409 LEU n 
1 410 ARG n 
1 411 ASP n 
1 412 VAL n 
1 413 GLY n 
1 414 GLY n 
1 415 ILE n 
1 416 VAL n 
1 417 LEU n 
1 418 ALA n 
1 419 ASN n 
1 420 ALA n 
1 421 CYS n 
1 422 GLY n 
1 423 PRO n 
1 424 CYS n 
1 425 ILE n 
1 426 GLY n 
1 427 GLN n 
1 428 TRP n 
1 429 ASP n 
1 430 ARG n 
1 431 LYS n 
1 432 ASP n 
1 433 ILE n 
1 434 LYS n 
1 435 LYS n 
1 436 GLY n 
1 437 GLU n 
1 438 LYS n 
1 439 ASN n 
1 440 THR n 
1 441 ILE n 
1 442 VAL n 
1 443 THR n 
1 444 SER n 
1 445 TYR n 
1 446 ASN n 
1 447 ARG n 
1 448 ASN n 
1 449 PHE n 
1 450 THR n 
1 451 GLY n 
1 452 ARG n 
1 453 ASN n 
1 454 ASP n 
1 455 ALA n 
1 456 ASN n 
1 457 PRO n 
1 458 GLU n 
1 459 THR n 
1 460 HIS n 
1 461 ALA n 
1 462 PHE n 
1 463 VAL n 
1 464 THR n 
1 465 SER n 
1 466 PRO n 
1 467 GLU n 
1 468 ILE n 
1 469 VAL n 
1 470 THR n 
1 471 ALA n 
1 472 LEU n 
1 473 ALA n 
1 474 ILE n 
1 475 ALA n 
1 476 GLY n 
1 477 THR n 
1 478 LEU n 
1 479 LYS n 
1 480 PHE n 
1 481 ASN n 
1 482 PRO n 
1 483 GLU n 
1 484 THR n 
1 485 ASP n 
1 486 PHE n 
1 487 LEU n 
1 488 THR n 
1 489 GLY n 
1 490 LYS n 
1 491 ASP n 
1 492 GLY n 
1 493 LYS n 
1 494 LYS n 
1 495 PHE n 
1 496 LYS n 
1 497 LEU n 
1 498 GLU n 
1 499 ALA n 
1 500 PRO n 
1 501 ASP n 
1 502 ALA n 
1 503 ASP n 
1 504 GLU n 
1 505 LEU n 
1 506 PRO n 
1 507 ARG n 
1 508 ALA n 
1 509 GLU n 
1 510 PHE n 
1 511 ASP n 
1 512 PRO n 
1 513 GLY n 
1 514 GLN n 
1 515 ASP n 
1 516 THR n 
1 517 TYR n 
1 518 GLN n 
1 519 HIS n 
1 520 PRO n 
1 521 PRO n 
1 522 LYS n 
1 523 ASP n 
1 524 SER n 
1 525 SER n 
1 526 GLY n 
1 527 GLN n 
1 528 ARG n 
1 529 VAL n 
1 530 ASP n 
1 531 VAL n 
1 532 SER n 
1 533 PRO n 
1 534 THR n 
1 535 SER n 
1 536 GLN n 
1 537 ARG n 
1 538 LEU n 
1 539 GLN n 
1 540 LEU n 
1 541 LEU n 
1 542 GLU n 
1 543 PRO n 
1 544 PHE n 
1 545 ASP n 
1 546 LYS n 
1 547 TRP n 
1 548 ASP n 
1 549 GLY n 
1 550 LYS n 
1 551 ASP n 
1 552 LEU n 
1 553 GLU n 
1 554 ASP n 
1 555 LEU n 
1 556 GLN n 
1 557 ILE n 
1 558 LEU n 
1 559 ILE n 
1 560 LYS n 
1 561 VAL n 
1 562 LYS n 
1 563 GLY n 
1 564 LYS n 
1 565 CYS n 
1 566 THR n 
1 567 THR n 
1 568 ASP n 
1 569 HIS n 
1 570 ILE n 
1 571 SER n 
1 572 ALA n 
1 573 ALA n 
1 574 GLY n 
1 575 PRO n 
1 576 TRP n 
1 577 LEU n 
1 578 LYS n 
1 579 PHE n 
1 580 ARG n 
1 581 GLY n 
1 582 HIS n 
1 583 LEU n 
1 584 ASP n 
1 585 ASN n 
1 586 ILE n 
1 587 SER n 
1 588 ASN n 
1 589 ASN n 
1 590 LEU n 
1 591 LEU n 
1 592 ILE n 
1 593 GLY n 
1 594 ALA n 
1 595 ILE n 
1 596 ASN n 
1 597 ILE n 
1 598 GLU n 
1 599 ASN n 
1 600 ARG n 
1 601 LYS n 
1 602 ALA n 
1 603 ASN n 
1 604 SER n 
1 605 VAL n 
1 606 ARG n 
1 607 ASN n 
1 608 ALA n 
1 609 VAL n 
1 610 THR n 
1 611 GLN n 
1 612 GLU n 
1 613 PHE n 
1 614 GLY n 
1 615 PRO n 
1 616 VAL n 
1 617 PRO n 
1 618 ASP n 
1 619 THR n 
1 620 ALA n 
1 621 ARG n 
1 622 TYR n 
1 623 TYR n 
1 624 LYS n 
1 625 GLN n 
1 626 HIS n 
1 627 GLY n 
1 628 ILE n 
1 629 ARG n 
1 630 TRP n 
1 631 VAL n 
1 632 VAL n 
1 633 ILE n 
1 634 GLY n 
1 635 ASP n 
1 636 GLU n 
1 637 ASN n 
1 638 TYR n 
1 639 GLY n 
1 640 GLU n 
1 641 GLY n 
1 642 SER n 
1 643 SER n 
1 644 ARG n 
1 645 GLU n 
1 646 HIS n 
1 647 SER n 
1 648 ALA n 
1 649 LEU n 
1 650 GLU n 
1 651 PRO n 
1 652 ARG n 
1 653 HIS n 
1 654 LEU n 
1 655 GLY n 
1 656 GLY n 
1 657 ARG n 
1 658 ALA n 
1 659 ILE n 
1 660 ILE n 
1 661 THR n 
1 662 LYS n 
1 663 SER n 
1 664 PHE n 
1 665 ALA n 
1 666 ARG n 
1 667 ILE n 
1 668 HIS n 
1 669 GLU n 
1 670 THR n 
1 671 ASN n 
1 672 LEU n 
1 673 LYS n 
1 674 LYS n 
1 675 GLN n 
1 676 GLY n 
1 677 LEU n 
1 678 LEU n 
1 679 PRO n 
1 680 LEU n 
1 681 THR n 
1 682 PHE n 
1 683 ALA n 
1 684 ASP n 
1 685 PRO n 
1 686 ALA n 
1 687 ASP n 
1 688 TYR n 
1 689 ASN n 
1 690 LYS n 
1 691 ILE n 
1 692 HIS n 
1 693 PRO n 
1 694 VAL n 
1 695 ASP n 
1 696 LYS n 
1 697 LEU n 
1 698 THR n 
1 699 ILE n 
1 700 GLN n 
1 701 GLY n 
1 702 LEU n 
1 703 LYS n 
1 704 ASP n 
1 705 PHE n 
1 706 ALA n 
1 707 PRO n 
1 708 GLY n 
1 709 LYS n 
1 710 PRO n 
1 711 LEU n 
1 712 LYS n 
1 713 CYS n 
1 714 ILE n 
1 715 ILE n 
1 716 LYS n 
1 717 HIS n 
1 718 PRO n 
1 719 ASN n 
1 720 GLY n 
1 721 THR n 
1 722 GLN n 
1 723 GLU n 
1 724 THR n 
1 725 ILE n 
1 726 LEU n 
1 727 LEU n 
1 728 ASN n 
1 729 HIS n 
1 730 THR n 
1 731 PHE n 
1 732 ASN n 
1 733 GLU n 
1 734 THR n 
1 735 GLN n 
1 736 ILE n 
1 737 GLU n 
1 738 TRP n 
1 739 PHE n 
1 740 ARG n 
1 741 ALA n 
1 742 GLY n 
1 743 SER n 
1 744 ALA n 
1 745 LEU n 
1 746 ASN n 
1 747 ARG n 
1 748 MET n 
1 749 LYS n 
1 750 GLU n 
1 751 LEU n 
1 752 GLN n 
1 753 GLN n 
1 754 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               pig 
_entity_src_gen.gene_src_genus                     Sus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sus scrofa' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9823 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACON_PIG 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P16276 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPHEYIRYDLLEKNIDIVRKRLNRPLTLSEKIVYGHLDDPANQ
EIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAK
YGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTGRADIANLAD
EFKDHLVPDPGCHYDQVIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVA
KQALAHGLKCKSQFTITPGSEQIRATIERDGYAQVLRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDSSGQRVDVSP
TSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENRKANSVRNAVTQEF
GPVPDTARYYKQHGIRWVVIGDENYGEGSSREHRALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHP
VDKLTIQGLKDFAPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQK
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              7ACN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 754 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16276 
_struct_ref_seq.db_align_beg                  29 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  781 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       754 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             7ACN 
_struct_ref_seq_dif.mon_id                       SER 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      647 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P16276 
_struct_ref_seq_dif.db_mon_id                    ARG 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          674 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            647 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE              ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                 ? 'H2 O'           18.015  
ICT non-polymer         . 'ISOCITRIC ACID'      ? 'C6 H8 O7'       192.124 
ILE 'L-peptide linking' y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID'   ? 'C5 H7 N O3'     129.114 
PHE 'L-peptide linking' y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                ? 'C3 H7 N O3'     105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER' ? 'Fe4 S4'         351.640 
THR 'L-peptide linking' y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          7ACN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.88 
_exptl_crystal.density_percent_sol   57.22 
_exptl_crystal.description           ? 
# 
_refine.entry_id                                 7ACN 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.179 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.179 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;RESIDUE 647 IS ARG FROM THE DNA SEQUENCE, (H. ZALKIN,
PRIVATE COMMUNICATION) BUT CANNOT BE ACCOMMODATED AS SUCH
IN THE STRUCTURE.  IT HAS BEEN MODELED AS SER, BASED ON
THE EXTENT OF THE SIDE CHAIN DENSITY.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5815 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         21 
_refine_hist.number_atoms_solvent             338 
_refine_hist.number_atoms_total               6174 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.09  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  7ACN 
_struct.title                     'CRYSTAL STRUCTURES OF ACONITASE WITH ISOCITRATE AND NITROISOCITRATE BOUND' 
_struct.pdbx_descriptor           'ACONITASE (E.C.4.2.1.3) COMPLEX WITH ISOCITRATE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        7ACN 
_struct_keywords.pdbx_keywords   'LYASE(CARBON-OXYGEN)' 
_struct_keywords.text            'LYASE(CARBON-OXYGEN)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  TYR A 18  ? ASN A 33  ? TYR A 18  ASN A 33  1 '3(10) AT C-TERMINUS'         16 
HELX_P HELX_P2  H2  LEU A 38  ? GLY A 45  ? LEU A 38  GLY A 45  1 ?                             8  
HELX_P HELX_P3  H3  PRO A 50  ? GLN A 53  ? PRO A 50  GLN A 53  1 ?                             4  
HELX_P HELX_P4  H4  ALA A 76  ? SER A 86  ? ALA A 76  SER A 86  1 ?                             11 
HELX_P HELX_P5  H5  GLU A 110 ? ILE A 119 ? GLU A 110 ILE A 119 1 ?                             10 
HELX_P HELX_P6  H6  GLN A 121 ? TYR A 134 ? GLN A 121 TYR A 134 1 ?                             14 
HELX_P HELX_P7  H7  HIS A 147 ? GLU A 152 ? HIS A 147 GLU A 152 1 ?                             6  
HELX_P HELX_P8  H8  SER A 166 ? LEU A 174 ? SER A 166 LEU A 174 5 '3 TURN 3(10) AT ACTIVE SITE' 9  
HELX_P HELX_P9  H9  GLY A 183 ? ALA A 191 ? GLY A 183 ALA A 191 1 ?                             9  
HELX_P HELX_P10 H10 PRO A 217 ? LEU A 228 ? PRO A 217 LEU A 228 1 ?                             12 
HELX_P HELX_P11 H11 VAL A 230 ? THR A 234 ? VAL A 230 THR A 234 5 DISTORTED                     5  
HELX_P HELX_P12 H12 PRO A 243 ? SER A 247 ? PRO A 243 SER A 247 5 ?                             5  
HELX_P HELX_P13 H13 CYS A 250 ? ILE A 263 ? CYS A 250 ILE A 263 1 '3(10) TURN AT C-TERMINUS'    14 
HELX_P HELX_P14 H14 HIS A 274 ? LYS A 282 ? HIS A 274 LYS A 282 1 ?                             9  
HELX_P HELX_P15 H15 ALA A 286 ? HIS A 298 ? ALA A 286 HIS A 298 1 '3(10) TURN AT C-TERMINUS'    13 
HELX_P HELX_P16 H16 GLU A 336 ? GLU A 344 ? GLU A 336 GLU A 344 1 ?                             9  
HELX_P HELX_P17 H17 TYR A 363 ? ALA A 378 ? TYR A 363 ALA A 378 1 'BENT, 3(10) H-BOND AT 372N'  16 
HELX_P HELX_P18 H18 GLU A 394 ? ASP A 403 ? GLU A 394 ASP A 403 1 ?                             10 
HELX_P HELX_P19 H19 TYR A 405 ? VAL A 412 ? TYR A 405 VAL A 412 1 ?                             8  
HELX_P HELX_P20 H20 PRO A 423 ? ILE A 425 ? PRO A 423 ILE A 425 5 'CONTAINS 424 CYS LIGAND'     3  
HELX_P HELX_P21 H21 PRO A 466 ? ALA A 475 ? PRO A 466 ALA A 475 1 ?                             10 
HELX_P HELX_P22 H22 THR A 567 ? ILE A 570 ? THR A 567 ILE A 570 1 ?                             4  
HELX_P HELX_P23 H23 PRO A 575 ? PHE A 579 ? PRO A 575 PHE A 579 5 ?                             5  
HELX_P HELX_P24 H24 LEU A 583 ? ASN A 589 ? LEU A 583 ASN A 589 1 '3(10) TURN AT C-TERMINUS'    7  
HELX_P HELX_P25 H25 VAL A 616 ? GLN A 625 ? VAL A 616 GLN A 625 1 ?                             10 
HELX_P HELX_P26 H26 GLU A 645 ? LEU A 654 ? GLU A 645 LEU A 654 1 ?                             10 
HELX_P HELX_P27 H27 ARG A 666 ? GLN A 675 ? ARG A 666 GLN A 675 1 ?                             10 
HELX_P HELX_P28 H28 ALA A 686 ? ILE A 691 ? ALA A 686 ILE A 691 1 '3(10) H-BONDS AT N-TERMINUS' 6  
HELX_P HELX_P29 H29 GLU A 733 ? ALA A 741 ? GLU A 733 ALA A 741 1 ?                             9  
HELX_P HELX_P30 H30 ALA A 744 ? LEU A 751 ? ALA A 744 LEU A 751 1 ?                             8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 358 SG  ? ? ? 1_555 B SF4 . FE1 ? ? A CYS 358 A SF4 999  1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc2 metalc ? ? A CYS 421 SG  ? ? ? 1_555 B SF4 . FE3 ? ? A CYS 421 A SF4 999  1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc3 metalc ? ? A CYS 424 SG  ? ? ? 1_555 B SF4 . FE2 ? ? A CYS 424 A SF4 999  1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc4 metalc ? ? B SF4 .   FE4 ? ? ? 1_555 C ICT . O7  ? ? A SF4 999 A ICT 755  1_555 ? ? ? ? ? ? ? 2.154 ? 
metalc5 metalc ? ? B SF4 .   FE4 ? ? ? 1_555 D HOH . O   ? ? A SF4 999 A HOH 1000 1_555 ? ? ? ? ? ? ? 2.209 ? 
metalc6 metalc ? ? B SF4 .   FE4 ? ? ? 1_555 C ICT . O2  ? ? A SF4 999 A ICT 755  1_555 ? ? ? ? ? ? ? 2.492 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           324 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            324 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    325 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     325 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       21.06 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 2 ? 
S2 ? 6 ? 
S3 ? 4 ? 
S4 ? 7 ? 
S5 ? 4 ? 
S6 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? anti-parallel 
S2 1 2 ? parallel      
S2 2 3 ? parallel      
S2 3 4 ? parallel      
S2 4 5 ? parallel      
S2 5 6 ? anti-parallel 
S3 1 2 ? parallel      
S3 2 3 ? parallel      
S3 3 4 ? parallel      
S4 1 2 ? anti-parallel 
S4 2 3 ? parallel      
S4 3 4 ? parallel      
S4 4 5 ? parallel      
S4 5 6 ? parallel      
S4 6 7 ? parallel      
S5 1 2 ? anti-parallel 
S5 2 3 ? anti-parallel 
S5 3 4 ? anti-parallel 
S6 1 2 ? parallel      
S6 2 3 ? parallel      
S6 3 4 ? parallel      
S6 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 THR A 60  ? LEU A 64  ? THR A 60  LEU A 64  
S1 2 PRO A 194 ? CYS A 199 ? PRO A 194 CYS A 199 
S2 1 GLY A 176 ? VAL A 181 ? GLY A 176 VAL A 181 
S2 2 VAL A 159 ? GLY A 163 ? VAL A 159 GLY A 163 
S2 3 ASP A 67  ? ASP A 73  ? ASP A 67  ASP A 73  
S2 4 PRO A 94  ? HIS A 98  ? PRO A 94  HIS A 98  
S2 5 VAL A 136 ? TRP A 139 ? VAL A 136 TRP A 139 
S2 6 THR A 516 ? GLN A 518 ? THR A 516 GLN A 518 
S3 1 THR A 266 ? PHE A 270 ? THR A 266 PHE A 270 
S3 2 GLY A 235 ? PRO A 243 ? GLY A 235 PRO A 243 
S3 3 LYS A 201 ? GLY A 209 ? LYS A 201 GLY A 209 
S3 4 GLN A 309 ? LEU A 315 ? GLN A 309 LEU A 315 
S4 1 LEU A 330 ? PRO A 333 ? LEU A 330 PRO A 333 
S4 2 PRO A 320 ? ASN A 323 ? PRO A 320 ASN A 323 
S4 3 THR A 459 ? THR A 464 ? THR A 459 THR A 464 
S4 4 ASN A 439 ? SER A 444 ? ASN A 439 SER A 444 
S4 5 ARG A 351 ? SER A 357 ? ARG A 351 SER A 357 
S4 6 GLN A 386 ? THR A 390 ? GLN A 386 THR A 390 
S4 7 ILE A 415 ? LEU A 417 ? ILE A 415 LEU A 417 
S5 1 LEU A 552 ? LEU A 555 ? LEU A 552 LEU A 555 
S5 2 ASP A 695 ? GLN A 700 ? ASP A 695 GLN A 700 
S5 3 PRO A 710 ? HIS A 717 ? PRO A 710 HIS A 717 
S5 4 THR A 721 ? ASN A 728 ? THR A 721 ASN A 728 
S6 1 GLN A 556 ? VAL A 561 ? GLN A 556 VAL A 561 
S6 2 TRP A 630 ? ASP A 635 ? TRP A 630 ASP A 635 
S6 3 ARG A 657 ? LYS A 662 ? ARG A 657 LYS A 662 
S6 4 LEU A 677 ? PHE A 682 ? LEU A 677 PHE A 682 
S6 5 LEU A 727 ? ASN A 728 ? LEU A 727 ASN A 728 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1 1 2 N LEU A 64  ? N LEU A 64  O TRP A 195 ? O TRP A 195 
S2 1 2 O ILE A 177 ? O ILE A 177 N LEU A 161 ? N LEU A 161 
S2 2 3 N ILE A 162 ? N ILE A 162 O ARG A 68  ? O ARG A 68  
S2 3 4 N MET A 71  ? N MET A 71  O THR A 96  ? O THR A 96  
S2 4 5 O ILE A 97  ? O ILE A 97  N TRP A 139 ? N TRP A 139 
S2 5 6 N PHE A 138 ? N PHE A 138 O GLN A 518 ? O GLN A 518 
S3 1 2 O VAL A 269 ? O VAL A 269 N TYR A 240 ? N TYR A 240 
S3 2 3 O ILE A 237 ? O ILE A 237 N ILE A 203 ? N ILE A 203 
S3 3 4 O LYS A 206 ? O LYS A 206 N ILE A 313 ? N ILE A 313 
S4 1 2 O HIS A 332 ? O HIS A 332 N ILE A 322 ? N ILE A 322 
S4 2 3 O ASN A 323 ? O ASN A 323 N PHE A 462 ? N PHE A 462 
S4 3 4 O PHE A 462 ? O PHE A 462 N THR A 443 ? N THR A 443 
S4 4 5 O SER A 444 ? O SER A 444 N LEU A 354 ? N LEU A 354 
S4 5 6 O ILE A 355 ? O ILE A 355 N THR A 388 ? N THR A 388 
S4 6 7 N ILE A 389 ? N ILE A 389 O ILE A 415 ? O ILE A 415 
S5 1 2 O LEU A 552 ? O LEU A 552 N ILE A 699 ? N ILE A 699 
S5 2 3 O LYS A 696 ? O LYS A 696 N HIS A 717 ? N HIS A 717 
S5 3 4 N ILE A 715 ? N ILE A 715 O GLU A 723 ? O GLU A 723 
S6 1 2 N VAL A 561 ? N VAL A 561 O ILE A 633 ? O ILE A 633 
S6 2 3 N VAL A 632 ? N VAL A 632 O ALA A 658 ? O ALA A 658 
S6 3 4 N THR A 661 ? N THR A 661 O LEU A 680 ? O LEU A 680 
S6 4 5 O THR A 681 ? O THR A 681 N ASN A 728 ? N ASN A 728 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
ACT Unknown  ? ? ? ? 18 ?                                    
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE SF4 A 999' 
AC2 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ICT A 755' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  ACT 18 GLN A 72  ? GLN A 72   . ? 1_555 ? 
2  ACT 18 ASP A 100 ? ASP A 100  . ? 1_555 ? 
3  ACT 18 HIS A 101 ? HIS A 101  . ? 1_555 ? 
4  ACT 18 HIS A 147 ? HIS A 147  . ? 1_555 ? 
5  ACT 18 ASP A 165 ? ASP A 165  . ? 1_555 ? 
6  ACT 18 SER A 166 ? SER A 166  . ? 1_555 ? 
7  ACT 18 HIS A 167 ? HIS A 167  . ? 1_555 ? 
8  ACT 18 ASN A 170 ? ASN A 170  . ? 1_555 ? 
9  ACT 18 ASN A 258 ? ASN A 258  . ? 1_555 ? 
10 ACT 18 GLU A 262 ? GLU A 262  . ? 1_555 ? 
11 ACT 18 ASN A 446 ? ASN A 446  . ? 1_555 ? 
12 ACT 18 ARG A 447 ? ARG A 447  . ? 1_555 ? 
13 ACT 18 ARG A 452 ? ARG A 452  . ? 1_555 ? 
14 ACT 18 ARG A 580 ? ARG A 580  . ? 1_555 ? 
15 ACT 18 SER A 642 ? SER A 642  . ? 1_555 ? 
16 ACT 18 SER A 643 ? SER A 643  . ? 1_555 ? 
17 ACT 18 ARG A 644 ? ARG A 644  . ? 1_555 ? 
18 ACT 18 SF4 B .   ? SF4 A 999  . ? 1_555 ? 
19 AC1 11 HIS A 101 ? HIS A 101  . ? 1_555 ? 
20 AC1 11 ASP A 165 ? ASP A 165  . ? 1_555 ? 
21 AC1 11 HIS A 167 ? HIS A 167  . ? 1_555 ? 
22 AC1 11 SER A 357 ? SER A 357  . ? 1_555 ? 
23 AC1 11 CYS A 358 ? CYS A 358  . ? 1_555 ? 
24 AC1 11 CYS A 421 ? CYS A 421  . ? 1_555 ? 
25 AC1 11 CYS A 424 ? CYS A 424  . ? 1_555 ? 
26 AC1 11 ILE A 425 ? ILE A 425  . ? 1_555 ? 
27 AC1 11 ASN A 446 ? ASN A 446  . ? 1_555 ? 
28 AC1 11 ICT C .   ? ICT A 755  . ? 1_555 ? 
29 AC1 11 HOH D .   ? HOH A 1000 . ? 1_555 ? 
30 AC2 13 GLN A 72  ? GLN A 72   . ? 1_555 ? 
31 AC2 13 ALA A 74  ? ALA A 74   . ? 1_555 ? 
32 AC2 13 HIS A 101 ? HIS A 101  . ? 1_555 ? 
33 AC2 13 ASP A 165 ? ASP A 165  . ? 1_555 ? 
34 AC2 13 SER A 166 ? SER A 166  . ? 1_555 ? 
35 AC2 13 ARG A 447 ? ARG A 447  . ? 1_555 ? 
36 AC2 13 ARG A 452 ? ARG A 452  . ? 1_555 ? 
37 AC2 13 ARG A 580 ? ARG A 580  . ? 1_555 ? 
38 AC2 13 SER A 642 ? SER A 642  . ? 1_555 ? 
39 AC2 13 SER A 643 ? SER A 643  . ? 1_555 ? 
40 AC2 13 ARG A 644 ? ARG A 644  . ? 1_555 ? 
41 AC2 13 SF4 B .   ? SF4 A 999  . ? 1_555 ? 
42 AC2 13 HOH D .   ? HOH A 1000 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          7ACN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    7ACN 
_atom_sites.fract_transf_matrix[1][1]   0.005391 
_atom_sites.fract_transf_matrix[1][2]   -0.001175 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014215 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013699 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'RESIDUE 325 IS A CIS PROLINE.' 
2 'SEE REMARK 5.'                 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 2   ? 25.157 1.717  88.878  1.00 46.89 ? 2    ARG A N   1 
ATOM   2    C  CA  . ARG A 1 2   ? 24.212 1.606  87.781  1.00 48.74 ? 2    ARG A CA  1 
ATOM   3    C  C   . ARG A 1 2   ? 25.166 0.933  86.777  1.00 43.06 ? 2    ARG A C   1 
ATOM   4    O  O   . ARG A 1 2   ? 25.913 0.019  87.149  1.00 41.23 ? 2    ARG A O   1 
ATOM   5    C  CB  . ARG A 1 2   ? 23.738 3.075  87.323  1.00 54.39 ? 2    ARG A CB  1 
ATOM   6    C  CG  . ARG A 1 2   ? 22.337 3.332  86.669  1.00 58.50 ? 2    ARG A CG  1 
ATOM   7    C  CD  . ARG A 1 2   ? 21.198 3.374  87.773  1.00 63.41 ? 2    ARG A CD  1 
ATOM   8    N  NE  . ARG A 1 2   ? 19.793 3.356  87.289  1.00 67.41 ? 2    ARG A NE  1 
ATOM   9    C  CZ  . ARG A 1 2   ? 18.821 4.247  87.612  1.00 68.68 ? 2    ARG A CZ  1 
ATOM   10   N  NH1 . ARG A 1 2   ? 19.032 5.283  88.455  1.00 68.41 ? 2    ARG A NH1 1 
ATOM   11   N  NH2 . ARG A 1 2   ? 17.590 4.109  87.080  1.00 68.22 ? 2    ARG A NH2 1 
ATOM   12   N  N   . ALA A 1 3   ? 25.135 1.453  85.546  1.00 37.50 ? 3    ALA A N   1 
ATOM   13   C  CA  . ALA A 1 3   ? 26.081 1.184  84.497  1.00 32.63 ? 3    ALA A CA  1 
ATOM   14   C  C   . ALA A 1 3   ? 27.374 1.951  84.820  1.00 28.50 ? 3    ALA A C   1 
ATOM   15   O  O   . ALA A 1 3   ? 27.316 2.976  85.524  1.00 25.98 ? 3    ALA A O   1 
ATOM   16   C  CB  . ALA A 1 3   ? 25.515 1.702  83.189  1.00 30.89 ? 3    ALA A CB  1 
ATOM   17   N  N   . LYS A 1 4   ? 28.530 1.489  84.375  1.00 23.03 ? 4    LYS A N   1 
ATOM   18   C  CA  . LYS A 1 4   ? 29.763 2.205  84.533  1.00 21.55 ? 4    LYS A CA  1 
ATOM   19   C  C   . LYS A 1 4   ? 30.212 2.548  83.131  1.00 17.63 ? 4    LYS A C   1 
ATOM   20   O  O   . LYS A 1 4   ? 31.015 1.841  82.558  1.00 15.52 ? 4    LYS A O   1 
ATOM   21   C  CB  . LYS A 1 4   ? 30.668 1.276  85.298  1.00 26.33 ? 4    LYS A CB  1 
ATOM   22   C  CG  . LYS A 1 4   ? 30.187 1.347  86.754  1.00 33.40 ? 4    LYS A CG  1 
ATOM   23   C  CD  . LYS A 1 4   ? 30.724 0.311  87.730  1.00 40.45 ? 4    LYS A CD  1 
ATOM   24   C  CE  . LYS A 1 4   ? 32.197 0.467  88.158  1.00 47.35 ? 4    LYS A CE  1 
ATOM   25   N  NZ  . LYS A 1 4   ? 33.171 0.190  87.099  1.00 51.10 ? 4    LYS A NZ  1 
ATOM   26   N  N   . VAL A 1 5   ? 29.665 3.594  82.508  1.00 17.18 ? 5    VAL A N   1 
ATOM   27   C  CA  . VAL A 1 5   ? 30.049 4.010  81.173  1.00 15.45 ? 5    VAL A CA  1 
ATOM   28   C  C   . VAL A 1 5   ? 30.831 5.324  81.361  1.00 17.41 ? 5    VAL A C   1 
ATOM   29   O  O   . VAL A 1 5   ? 30.390 6.293  81.990  1.00 16.51 ? 5    VAL A O   1 
ATOM   30   C  CB  . VAL A 1 5   ? 28.762 4.181  80.318  1.00 16.75 ? 5    VAL A CB  1 
ATOM   31   C  CG1 . VAL A 1 5   ? 29.125 4.769  78.961  1.00 13.07 ? 5    VAL A CG1 1 
ATOM   32   C  CG2 . VAL A 1 5   ? 28.075 2.823  80.125  1.00 10.49 ? 5    VAL A CG2 1 
ATOM   33   N  N   . ALA A 1 6   ? 32.061 5.375  80.877  1.00 16.92 ? 6    ALA A N   1 
ATOM   34   C  CA  . ALA A 1 6   ? 32.935 6.516  81.060  1.00 13.97 ? 6    ALA A CA  1 
ATOM   35   C  C   . ALA A 1 6   ? 32.476 7.716  80.255  1.00 12.92 ? 6    ALA A C   1 
ATOM   36   O  O   . ALA A 1 6   ? 31.910 7.574  79.168  1.00 12.54 ? 6    ALA A O   1 
ATOM   37   C  CB  . ALA A 1 6   ? 34.334 6.130  80.624  1.00 12.35 ? 6    ALA A CB  1 
ATOM   38   N  N   . MET A 1 7   ? 32.770 8.918  80.743  1.00 15.75 ? 7    MET A N   1 
ATOM   39   C  CA  . MET A 1 7   ? 32.416 10.194 80.104  1.00 14.54 ? 7    MET A CA  1 
ATOM   40   C  C   . MET A 1 7   ? 33.140 10.384 78.790  1.00 15.27 ? 7    MET A C   1 
ATOM   41   O  O   . MET A 1 7   ? 32.657 11.096 77.906  1.00 17.62 ? 7    MET A O   1 
ATOM   42   C  CB  . MET A 1 7   ? 32.777 11.354 80.998  1.00 15.30 ? 7    MET A CB  1 
ATOM   43   C  CG  . MET A 1 7   ? 31.917 11.368 82.214  1.00 15.46 ? 7    MET A CG  1 
ATOM   44   S  SD  . MET A 1 7   ? 32.472 12.710 83.267  1.00 21.71 ? 7    MET A SD  1 
ATOM   45   C  CE  . MET A 1 7   ? 31.989 14.156 82.359  1.00 18.90 ? 7    MET A CE  1 
ATOM   46   N  N   . SER A 1 8   ? 34.314 9.802  78.630  1.00 12.50 ? 8    SER A N   1 
ATOM   47   C  CA  . SER A 1 8   ? 34.997 9.886  77.378  1.00 14.65 ? 8    SER A CA  1 
ATOM   48   C  C   . SER A 1 8   ? 36.054 8.787  77.311  1.00 16.97 ? 8    SER A C   1 
ATOM   49   O  O   . SER A 1 8   ? 36.342 8.107  78.304  1.00 14.72 ? 8    SER A O   1 
ATOM   50   C  CB  . SER A 1 8   ? 35.669 11.251 77.256  1.00 19.14 ? 8    SER A CB  1 
ATOM   51   O  OG  . SER A 1 8   ? 36.774 11.409 78.151  1.00 19.13 ? 8    SER A OG  1 
ATOM   52   N  N   . HIS A 1 9   ? 36.736 8.646  76.171  1.00 18.35 ? 9    HIS A N   1 
ATOM   53   C  CA  . HIS A 1 9   ? 37.842 7.721  76.035  1.00 24.39 ? 9    HIS A CA  1 
ATOM   54   C  C   . HIS A 1 9   ? 39.056 8.108  76.846  1.00 24.21 ? 9    HIS A C   1 
ATOM   55   O  O   . HIS A 1 9   ? 39.905 7.253  77.063  1.00 28.60 ? 9    HIS A O   1 
ATOM   56   C  CB  . HIS A 1 9   ? 38.257 7.619  74.587  1.00 27.57 ? 9    HIS A CB  1 
ATOM   57   C  CG  . HIS A 1 9   ? 37.119 6.972  73.840  1.00 36.39 ? 9    HIS A CG  1 
ATOM   58   N  ND1 . HIS A 1 9   ? 35.988 6.435  74.356  1.00 39.65 ? 9    HIS A ND1 1 
ATOM   59   C  CD2 . HIS A 1 9   ? 37.055 6.894  72.469  1.00 39.48 ? 9    HIS A CD2 1 
ATOM   60   C  CE1 . HIS A 1 9   ? 35.260 6.058  73.340  1.00 41.92 ? 9    HIS A CE1 1 
ATOM   61   N  NE2 . HIS A 1 9   ? 35.902 6.334  72.221  1.00 42.13 ? 9    HIS A NE2 1 
ATOM   62   N  N   . PHE A 1 10  ? 39.194 9.356  77.287  1.00 21.74 ? 10   PHE A N   1 
ATOM   63   C  CA  . PHE A 1 10  ? 40.380 9.833  77.975  1.00 20.12 ? 10   PHE A CA  1 
ATOM   64   C  C   . PHE A 1 10  ? 40.185 9.759  79.473  1.00 20.71 ? 10   PHE A C   1 
ATOM   65   O  O   . PHE A 1 10  ? 41.171 9.906  80.228  1.00 21.72 ? 10   PHE A O   1 
ATOM   66   C  CB  . PHE A 1 10  ? 40.672 11.279 77.533  1.00 18.18 ? 10   PHE A CB  1 
ATOM   67   C  CG  . PHE A 1 10  ? 40.645 11.386 76.019  1.00 17.00 ? 10   PHE A CG  1 
ATOM   68   C  CD1 . PHE A 1 10  ? 41.685 10.930 75.263  1.00 17.88 ? 10   PHE A CD1 1 
ATOM   69   C  CD2 . PHE A 1 10  ? 39.523 11.895 75.400  1.00 18.10 ? 10   PHE A CD2 1 
ATOM   70   C  CE1 . PHE A 1 10  ? 41.569 10.961 73.883  1.00 19.05 ? 10   PHE A CE1 1 
ATOM   71   C  CE2 . PHE A 1 10  ? 39.412 11.917 74.033  1.00 17.62 ? 10   PHE A CE2 1 
ATOM   72   C  CZ  . PHE A 1 10  ? 40.445 11.458 73.272  1.00 17.00 ? 10   PHE A CZ  1 
ATOM   73   N  N   . GLU A 1 11  ? 38.952 9.539  79.961  1.00 19.87 ? 11   GLU A N   1 
ATOM   74   C  CA  . GLU A 1 11  ? 38.738 9.494  81.397  1.00 18.60 ? 11   GLU A CA  1 
ATOM   75   C  C   . GLU A 1 11  ? 37.940 8.248  81.697  1.00 22.25 ? 11   GLU A C   1 
ATOM   76   O  O   . GLU A 1 11  ? 36.754 8.283  82.055  1.00 22.37 ? 11   GLU A O   1 
ATOM   77   C  CB  . GLU A 1 11  ? 37.987 10.750 81.867  1.00 21.41 ? 11   GLU A CB  1 
ATOM   78   C  CG  . GLU A 1 11  ? 38.676 12.108 81.662  1.00 19.69 ? 11   GLU A CG  1 
ATOM   79   C  CD  . GLU A 1 11  ? 37.954 13.144 80.814  1.00 20.82 ? 11   GLU A CD  1 
ATOM   80   O  OE1 . GLU A 1 11  ? 36.831 12.901 80.412  1.00 20.34 ? 11   GLU A OE1 1 
ATOM   81   O  OE2 . GLU A 1 11  ? 38.471 14.226 80.541  1.00 19.31 ? 11   GLU A OE2 1 
ATOM   82   N  N   . PRO A 1 12  ? 38.594 7.076  81.703  1.00 23.47 ? 12   PRO A N   1 
ATOM   83   C  CA  . PRO A 1 12  ? 37.924 5.774  81.733  1.00 23.99 ? 12   PRO A CA  1 
ATOM   84   C  C   . PRO A 1 12  ? 37.202 5.431  83.014  1.00 23.26 ? 12   PRO A C   1 
ATOM   85   O  O   . PRO A 1 12  ? 36.384 4.531  83.058  1.00 25.25 ? 12   PRO A O   1 
ATOM   86   C  CB  . PRO A 1 12  ? 39.011 4.769  81.431  1.00 26.36 ? 12   PRO A CB  1 
ATOM   87   C  CG  . PRO A 1 12  ? 40.245 5.437  81.973  1.00 26.66 ? 12   PRO A CG  1 
ATOM   88   C  CD  . PRO A 1 12  ? 40.030 6.879  81.518  1.00 23.91 ? 12   PRO A CD  1 
ATOM   89   N  N   . HIS A 1 13  ? 37.488 6.240  84.005  1.00 23.69 ? 13   HIS A N   1 
ATOM   90   C  CA  . HIS A 1 13  ? 37.108 6.128  85.402  1.00 29.14 ? 13   HIS A CA  1 
ATOM   91   C  C   . HIS A 1 13  ? 36.065 7.158  85.807  1.00 28.40 ? 13   HIS A C   1 
ATOM   92   O  O   . HIS A 1 13  ? 35.664 7.161  86.976  1.00 30.00 ? 13   HIS A O   1 
ATOM   93   C  CB  . HIS A 1 13  ? 38.317 6.363  86.313  1.00 38.85 ? 13   HIS A CB  1 
ATOM   94   C  CG  . HIS A 1 13  ? 39.063 7.664  85.919  1.00 47.32 ? 13   HIS A CG  1 
ATOM   95   N  ND1 . HIS A 1 13  ? 38.977 8.909  86.437  1.00 49.65 ? 13   HIS A ND1 1 
ATOM   96   C  CD2 . HIS A 1 13  ? 39.932 7.755  84.840  1.00 46.85 ? 13   HIS A CD2 1 
ATOM   97   C  CE1 . HIS A 1 13  ? 39.736 9.685  85.705  1.00 50.63 ? 13   HIS A CE1 1 
ATOM   98   N  NE2 . HIS A 1 13  ? 40.307 8.996  84.745  1.00 48.67 ? 13   HIS A NE2 1 
ATOM   99   N  N   . GLU A 1 14  ? 35.744 8.120  84.926  1.00 25.61 ? 14   GLU A N   1 
ATOM   100  C  CA  . GLU A 1 14  ? 34.789 9.150  85.254  1.00 23.22 ? 14   GLU A CA  1 
ATOM   101  C  C   . GLU A 1 14  ? 33.519 8.637  84.624  1.00 19.41 ? 14   GLU A C   1 
ATOM   102  O  O   . GLU A 1 14  ? 33.417 8.526  83.399  1.00 19.97 ? 14   GLU A O   1 
ATOM   103  C  CB  . GLU A 1 14  ? 35.189 10.457 84.610  1.00 27.19 ? 14   GLU A CB  1 
ATOM   104  C  CG  . GLU A 1 14  ? 36.473 11.058 85.147  1.00 34.03 ? 14   GLU A CG  1 
ATOM   105  C  CD  . GLU A 1 14  ? 36.459 11.419 86.632  1.00 37.05 ? 14   GLU A CD  1 
ATOM   106  O  OE1 . GLU A 1 14  ? 35.461 11.918 87.152  1.00 39.04 ? 14   GLU A OE1 1 
ATOM   107  O  OE2 . GLU A 1 14  ? 37.482 11.164 87.270  1.00 41.56 ? 14   GLU A OE2 1 
ATOM   108  N  N   . TYR A 1 15  ? 32.524 8.292  85.403  1.00 18.53 ? 15   TYR A N   1 
ATOM   109  C  CA  . TYR A 1 15  ? 31.314 7.714  84.827  1.00 18.40 ? 15   TYR A CA  1 
ATOM   110  C  C   . TYR A 1 15  ? 30.176 8.700  84.663  1.00 16.22 ? 15   TYR A C   1 
ATOM   111  O  O   . TYR A 1 15  ? 30.056 9.596  85.480  1.00 16.36 ? 15   TYR A O   1 
ATOM   112  C  CB  . TYR A 1 15  ? 30.840 6.548  85.690  1.00 16.20 ? 15   TYR A CB  1 
ATOM   113  C  CG  . TYR A 1 15  ? 31.918 5.492  85.757  1.00 17.73 ? 15   TYR A CG  1 
ATOM   114  C  CD1 . TYR A 1 15  ? 32.424 4.928  84.604  1.00 18.53 ? 15   TYR A CD1 1 
ATOM   115  C  CD2 . TYR A 1 15  ? 32.346 5.086  86.999  1.00 20.63 ? 15   TYR A CD2 1 
ATOM   116  C  CE1 . TYR A 1 15  ? 33.373 3.930  84.694  1.00 21.87 ? 15   TYR A CE1 1 
ATOM   117  C  CE2 . TYR A 1 15  ? 33.297 4.098  87.098  1.00 23.18 ? 15   TYR A CE2 1 
ATOM   118  C  CZ  . TYR A 1 15  ? 33.795 3.506  85.955  1.00 24.25 ? 15   TYR A CZ  1 
ATOM   119  O  OH  . TYR A 1 15  ? 34.639 2.416  86.162  1.00 27.57 ? 15   TYR A OH  1 
ATOM   120  N  N   . ILE A 1 16  ? 29.378 8.535  83.607  1.00 16.18 ? 16   ILE A N   1 
ATOM   121  C  CA  . ILE A 1 16  ? 28.145 9.268  83.379  1.00 13.52 ? 16   ILE A CA  1 
ATOM   122  C  C   . ILE A 1 16  ? 27.174 8.859  84.478  1.00 14.95 ? 16   ILE A C   1 
ATOM   123  O  O   . ILE A 1 16  ? 26.987 7.675  84.806  1.00 15.84 ? 16   ILE A O   1 
ATOM   124  C  CB  . ILE A 1 16  ? 27.602 8.902  81.994  1.00 14.09 ? 16   ILE A CB  1 
ATOM   125  C  CG1 . ILE A 1 16  ? 28.627 9.357  80.962  1.00 11.88 ? 16   ILE A CG1 1 
ATOM   126  C  CG2 . ILE A 1 16  ? 26.207 9.523  81.766  1.00 12.37 ? 16   ILE A CG2 1 
ATOM   127  C  CD1 . ILE A 1 16  ? 28.234 9.047  79.517  1.00 10.89 ? 16   ILE A CD1 1 
ATOM   128  N  N   . ARG A 1 17  ? 26.640 9.884  85.116  1.00 15.83 ? 17   ARG A N   1 
ATOM   129  C  CA  . ARG A 1 17  ? 25.713 9.739  86.200  1.00 17.28 ? 17   ARG A CA  1 
ATOM   130  C  C   . ARG A 1 17  ? 24.298 10.037 85.748  1.00 15.32 ? 17   ARG A C   1 
ATOM   131  O  O   . ARG A 1 17  ? 23.711 11.034 86.194  1.00 15.83 ? 17   ARG A O   1 
ATOM   132  C  CB  . ARG A 1 17  ? 26.095 10.703 87.337  1.00 19.28 ? 17   ARG A CB  1 
ATOM   133  C  CG  . ARG A 1 17  ? 27.466 10.541 87.948  1.00 22.20 ? 17   ARG A CG  1 
ATOM   134  C  CD  . ARG A 1 17  ? 27.768 9.070  88.172  1.00 25.48 ? 17   ARG A CD  1 
ATOM   135  N  NE  . ARG A 1 17  ? 26.789 8.443  89.038  1.00 29.83 ? 17   ARG A NE  1 
ATOM   136  C  CZ  . ARG A 1 17  ? 26.859 8.543  90.376  1.00 32.71 ? 17   ARG A CZ  1 
ATOM   137  N  NH1 . ARG A 1 17  ? 27.855 9.229  90.957  1.00 34.96 ? 17   ARG A NH1 1 
ATOM   138  N  NH2 . ARG A 1 17  ? 25.909 7.952  91.098  1.00 33.32 ? 17   ARG A NH2 1 
ATOM   139  N  N   . TYR A 1 18  ? 23.692 9.239  84.877  1.00 14.99 ? 18   TYR A N   1 
ATOM   140  C  CA  . TYR A 1 18  ? 22.284 9.500  84.530  1.00 16.70 ? 18   TYR A CA  1 
ATOM   141  C  C   . TYR A 1 18  ? 21.375 9.129  85.692  1.00 17.37 ? 18   TYR A C   1 
ATOM   142  O  O   . TYR A 1 18  ? 20.300 9.690  85.816  1.00 17.19 ? 18   TYR A O   1 
ATOM   143  C  CB  . TYR A 1 18  ? 21.820 8.717  83.331  1.00 12.01 ? 18   TYR A CB  1 
ATOM   144  C  CG  . TYR A 1 18  ? 22.296 9.231  81.986  1.00 12.17 ? 18   TYR A CG  1 
ATOM   145  C  CD1 . TYR A 1 18  ? 22.594 10.566 81.738  1.00 11.64 ? 18   TYR A CD1 1 
ATOM   146  C  CD2 . TYR A 1 18  ? 22.403 8.314  80.968  1.00 12.74 ? 18   TYR A CD2 1 
ATOM   147  C  CE1 . TYR A 1 18  ? 23.002 10.967 80.470  1.00 11.38 ? 18   TYR A CE1 1 
ATOM   148  C  CE2 . TYR A 1 18  ? 22.806 8.702  79.709  1.00 12.75 ? 18   TYR A CE2 1 
ATOM   149  C  CZ  . TYR A 1 18  ? 23.101 10.030 79.464  1.00 11.99 ? 18   TYR A CZ  1 
ATOM   150  O  OH  . TYR A 1 18  ? 23.512 10.386 78.196  1.00 10.50 ? 18   TYR A OH  1 
ATOM   151  N  N   . ASP A 1 19  ? 21.802 8.255  86.601  1.00 21.20 ? 19   ASP A N   1 
ATOM   152  C  CA  . ASP A 1 19  ? 21.072 7.894  87.811  1.00 22.38 ? 19   ASP A CA  1 
ATOM   153  C  C   . ASP A 1 19  ? 20.833 9.100  88.734  1.00 21.94 ? 19   ASP A C   1 
ATOM   154  O  O   . ASP A 1 19  ? 19.776 9.305  89.337  1.00 21.80 ? 19   ASP A O   1 
ATOM   155  C  CB  . ASP A 1 19  ? 21.879 6.815  88.542  1.00 24.19 ? 19   ASP A CB  1 
ATOM   156  C  CG  . ASP A 1 19  ? 23.248 7.233  89.090  1.00 26.67 ? 19   ASP A CG  1 
ATOM   157  O  OD1 . ASP A 1 19  ? 24.066 7.825  88.381  1.00 25.24 ? 19   ASP A OD1 1 
ATOM   158  O  OD2 . ASP A 1 19  ? 23.505 7.022  90.265  1.00 28.63 ? 19   ASP A OD2 1 
ATOM   159  N  N   . LEU A 1 20  ? 21.882 9.900  88.852  1.00 18.71 ? 20   LEU A N   1 
ATOM   160  C  CA  . LEU A 1 20  ? 21.898 11.157 89.574  1.00 19.47 ? 20   LEU A CA  1 
ATOM   161  C  C   . LEU A 1 20  ? 20.954 12.171 88.935  1.00 17.90 ? 20   LEU A C   1 
ATOM   162  O  O   . LEU A 1 20  ? 20.184 12.855 89.626  1.00 16.47 ? 20   LEU A O   1 
ATOM   163  C  CB  . LEU A 1 20  ? 23.294 11.719 89.554  1.00 25.16 ? 20   LEU A CB  1 
ATOM   164  C  CG  . LEU A 1 20  ? 23.934 11.952 90.876  1.00 31.88 ? 20   LEU A CG  1 
ATOM   165  C  CD1 . LEU A 1 20  ? 23.075 12.966 91.644  1.00 35.34 ? 20   LEU A CD1 1 
ATOM   166  C  CD2 . LEU A 1 20  ? 24.052 10.637 91.642  1.00 32.19 ? 20   LEU A CD2 1 
ATOM   167  N  N   . LEU A 1 21  ? 21.043 12.287 87.609  1.00 14.29 ? 21   LEU A N   1 
ATOM   168  C  CA  . LEU A 1 21  ? 20.152 13.149 86.846  1.00 18.22 ? 21   LEU A CA  1 
ATOM   169  C  C   . LEU A 1 21  ? 18.673 12.798 87.103  1.00 19.82 ? 21   LEU A C   1 
ATOM   170  O  O   . LEU A 1 21  ? 17.876 13.681 87.435  1.00 18.47 ? 21   LEU A O   1 
ATOM   171  C  CB  . LEU A 1 21  ? 20.451 13.008 85.350  1.00 15.12 ? 21   LEU A CB  1 
ATOM   172  C  CG  . LEU A 1 21  ? 19.659 13.890 84.387  1.00 15.97 ? 21   LEU A CG  1 
ATOM   173  C  CD1 . LEU A 1 21  ? 20.181 15.320 84.492  1.00 15.22 ? 21   LEU A CD1 1 
ATOM   174  C  CD2 . LEU A 1 21  ? 19.782 13.361 82.961  1.00 12.88 ? 21   LEU A CD2 1 
ATOM   175  N  N   . GLU A 1 22  ? 18.336 11.508 86.957  1.00 19.23 ? 22   GLU A N   1 
ATOM   176  C  CA  . GLU A 1 22  ? 17.010 10.967 87.165  1.00 20.82 ? 22   GLU A CA  1 
ATOM   177  C  C   . GLU A 1 22  ? 16.534 11.307 88.560  1.00 21.19 ? 22   GLU A C   1 
ATOM   178  O  O   . GLU A 1 22  ? 15.467 11.898 88.744  1.00 21.30 ? 22   GLU A O   1 
ATOM   179  C  CB  . GLU A 1 22  ? 17.060 9.458  86.981  1.00 24.97 ? 22   GLU A CB  1 
ATOM   180  C  CG  . GLU A 1 22  ? 15.723 8.760  87.208  1.00 31.96 ? 22   GLU A CG  1 
ATOM   181  C  CD  . GLU A 1 22  ? 15.739 7.322  86.752  1.00 36.00 ? 22   GLU A CD  1 
ATOM   182  O  OE1 . GLU A 1 22  ? 16.456 6.522  87.359  1.00 41.19 ? 22   GLU A OE1 1 
ATOM   183  O  OE2 . GLU A 1 22  ? 15.041 7.010  85.781  1.00 39.37 ? 22   GLU A OE2 1 
ATOM   184  N  N   . LYS A 1 23  ? 17.361 11.020 89.544  1.00 19.33 ? 23   LYS A N   1 
ATOM   185  C  CA  . LYS A 1 23  ? 17.052 11.303 90.921  1.00 21.02 ? 23   LYS A CA  1 
ATOM   186  C  C   . LYS A 1 23  ? 16.717 12.758 91.188  1.00 23.65 ? 23   LYS A C   1 
ATOM   187  O  O   . LYS A 1 23  ? 15.850 13.083 92.005  1.00 24.37 ? 23   LYS A O   1 
ATOM   188  C  CB  . LYS A 1 23  ? 18.230 10.908 91.758  1.00 25.39 ? 23   LYS A CB  1 
ATOM   189  C  CG  . LYS A 1 23  ? 17.892 10.837 93.207  1.00 33.05 ? 23   LYS A CG  1 
ATOM   190  C  CD  . LYS A 1 23  ? 19.189 10.867 94.003  1.00 40.57 ? 23   LYS A CD  1 
ATOM   191  C  CE  . LYS A 1 23  ? 19.086 12.049 94.973  1.00 45.16 ? 23   LYS A CE  1 
ATOM   192  N  NZ  . LYS A 1 23  ? 18.764 13.288 94.262  1.00 49.13 ? 23   LYS A NZ  1 
ATOM   193  N  N   . ASN A 1 24  ? 17.485 13.673 90.599  1.00 22.20 ? 24   ASN A N   1 
ATOM   194  C  CA  . ASN A 1 24  ? 17.266 15.086 90.828  1.00 19.40 ? 24   ASN A CA  1 
ATOM   195  C  C   . ASN A 1 24  ? 16.059 15.585 90.085  1.00 14.63 ? 24   ASN A C   1 
ATOM   196  O  O   . ASN A 1 24  ? 15.340 16.338 90.704  1.00 13.36 ? 24   ASN A O   1 
ATOM   197  C  CB  . ASN A 1 24  ? 18.490 15.890 90.422  1.00 18.37 ? 24   ASN A CB  1 
ATOM   198  C  CG  . ASN A 1 24  ? 19.614 15.679 91.427  1.00 19.57 ? 24   ASN A CG  1 
ATOM   199  O  OD1 . ASN A 1 24  ? 19.438 15.113 92.522  1.00 20.18 ? 24   ASN A OD1 1 
ATOM   200  N  ND2 . ASN A 1 24  ? 20.816 16.122 91.066  1.00 18.43 ? 24   ASN A ND2 1 
ATOM   201  N  N   . ILE A 1 25  ? 15.792 15.175 88.851  1.00 15.14 ? 25   ILE A N   1 
ATOM   202  C  CA  . ILE A 1 25  ? 14.605 15.530 88.083  1.00 19.76 ? 25   ILE A CA  1 
ATOM   203  C  C   . ILE A 1 25  ? 13.360 15.115 88.868  1.00 21.59 ? 25   ILE A C   1 
ATOM   204  O  O   . ILE A 1 25  ? 12.392 15.878 88.960  1.00 22.27 ? 25   ILE A O   1 
ATOM   205  C  CB  . ILE A 1 25  ? 14.612 14.798 86.704  1.00 17.83 ? 25   ILE A CB  1 
ATOM   206  C  CG1 . ILE A 1 25  ? 15.707 15.423 85.828  1.00 15.37 ? 25   ILE A CG1 1 
ATOM   207  C  CG2 . ILE A 1 25  ? 13.202 14.832 86.046  1.00 17.60 ? 25   ILE A CG2 1 
ATOM   208  C  CD1 . ILE A 1 25  ? 15.965 14.679 84.478  1.00 7.04  ? 25   ILE A CD1 1 
ATOM   209  N  N   . ASP A 1 26  ? 13.387 13.921 89.432  1.00 21.04 ? 26   ASP A N   1 
ATOM   210  C  CA  . ASP A 1 26  ? 12.262 13.455 90.167  1.00 26.51 ? 26   ASP A CA  1 
ATOM   211  C  C   . ASP A 1 26  ? 12.040 14.262 91.437  1.00 24.46 ? 26   ASP A C   1 
ATOM   212  O  O   . ASP A 1 26  ? 10.885 14.589 91.741  1.00 25.15 ? 26   ASP A O   1 
ATOM   213  C  CB  . ASP A 1 26  ? 12.456 11.972 90.459  1.00 33.68 ? 26   ASP A CB  1 
ATOM   214  C  CG  . ASP A 1 26  ? 11.210 11.463 91.162  1.00 42.55 ? 26   ASP A CG  1 
ATOM   215  O  OD1 . ASP A 1 26  ? 10.136 11.349 90.552  1.00 46.78 ? 26   ASP A OD1 1 
ATOM   216  O  OD2 . ASP A 1 26  ? 11.226 11.225 92.373  1.00 46.26 ? 26   ASP A OD2 1 
ATOM   217  N  N   . ILE A 1 27  ? 13.064 14.683 92.171  1.00 22.07 ? 27   ILE A N   1 
ATOM   218  C  CA  . ILE A 1 27  ? 12.860 15.546 93.329  1.00 21.25 ? 27   ILE A CA  1 
ATOM   219  C  C   . ILE A 1 27  ? 12.215 16.877 92.924  1.00 22.23 ? 27   ILE A C   1 
ATOM   220  O  O   . ILE A 1 27  ? 11.219 17.312 93.516  1.00 22.71 ? 27   ILE A O   1 
ATOM   221  C  CB  . ILE A 1 27  ? 14.187 15.838 94.041  1.00 20.16 ? 27   ILE A CB  1 
ATOM   222  C  CG1 . ILE A 1 27  ? 14.727 14.531 94.559  1.00 19.47 ? 27   ILE A CG1 1 
ATOM   223  C  CG2 . ILE A 1 27  ? 13.987 16.846 95.195  1.00 18.48 ? 27   ILE A CG2 1 
ATOM   224  C  CD1 . ILE A 1 27  ? 16.074 14.719 95.245  1.00 16.76 ? 27   ILE A CD1 1 
ATOM   225  N  N   . VAL A 1 28  ? 12.726 17.501 91.863  1.00 21.73 ? 28   VAL A N   1 
ATOM   226  C  CA  . VAL A 1 28  ? 12.240 18.791 91.372  1.00 23.06 ? 28   VAL A CA  1 
ATOM   227  C  C   . VAL A 1 28  ? 10.817 18.704 90.786  1.00 25.32 ? 28   VAL A C   1 
ATOM   228  O  O   . VAL A 1 28  ? 9.988  19.571 91.103  1.00 19.58 ? 28   VAL A O   1 
ATOM   229  C  CB  . VAL A 1 28  ? 13.284 19.315 90.321  1.00 22.15 ? 28   VAL A CB  1 
ATOM   230  C  CG1 . VAL A 1 28  ? 12.733 20.446 89.495  1.00 22.56 ? 28   VAL A CG1 1 
ATOM   231  C  CG2 . VAL A 1 28  ? 14.522 19.823 91.079  1.00 19.16 ? 28   VAL A CG2 1 
ATOM   232  N  N   . ARG A 1 29  ? 10.476 17.702 89.958  1.00 25.78 ? 29   ARG A N   1 
ATOM   233  C  CA  . ARG A 1 29  ? 9.150  17.653 89.392  1.00 28.33 ? 29   ARG A CA  1 
ATOM   234  C  C   . ARG A 1 29  ? 8.159  17.365 90.505  1.00 27.13 ? 29   ARG A C   1 
ATOM   235  O  O   . ARG A 1 29  ? 7.072  17.908 90.426  1.00 28.69 ? 29   ARG A O   1 
ATOM   236  C  CB  . ARG A 1 29  ? 9.023  16.608 88.265  1.00 27.85 ? 29   ARG A CB  1 
ATOM   237  C  CG  . ARG A 1 29  ? 9.233  15.156 88.603  1.00 29.88 ? 29   ARG A CG  1 
ATOM   238  C  CD  . ARG A 1 29  ? 8.755  14.187 87.522  1.00 30.83 ? 29   ARG A CD  1 
ATOM   239  N  NE  . ARG A 1 29  ? 9.482  14.045 86.233  1.00 28.66 ? 29   ARG A NE  1 
ATOM   240  C  CZ  . ARG A 1 29  ? 9.211  14.760 85.144  1.00 26.79 ? 29   ARG A CZ  1 
ATOM   241  N  NH1 . ARG A 1 29  ? 8.385  15.823 85.217  1.00 29.33 ? 29   ARG A NH1 1 
ATOM   242  N  NH2 . ARG A 1 29  ? 9.786  14.464 83.976  1.00 25.73 ? 29   ARG A NH2 1 
ATOM   243  N  N   . LYS A 1 30  ? 8.479  16.669 91.587  1.00 28.29 ? 30   LYS A N   1 
ATOM   244  C  CA  . LYS A 1 30  ? 7.615  16.564 92.761  1.00 30.62 ? 30   LYS A CA  1 
ATOM   245  C  C   . LYS A 1 30  ? 7.310  17.918 93.413  1.00 31.22 ? 30   LYS A C   1 
ATOM   246  O  O   . LYS A 1 30  ? 6.291  18.126 94.078  1.00 30.55 ? 30   LYS A O   1 
ATOM   247  C  CB  . LYS A 1 30  ? 8.244  15.737 93.865  1.00 34.80 ? 30   LYS A CB  1 
ATOM   248  C  CG  . LYS A 1 30  ? 7.704  14.351 94.115  1.00 42.03 ? 30   LYS A CG  1 
ATOM   249  C  CD  . LYS A 1 30  ? 8.138  13.387 93.017  1.00 47.63 ? 30   LYS A CD  1 
ATOM   250  C  CE  . LYS A 1 30  ? 7.806  11.948 93.435  1.00 51.36 ? 30   LYS A CE  1 
ATOM   251  N  NZ  . LYS A 1 30  ? 8.446  10.983 92.549  1.00 54.04 ? 30   LYS A NZ  1 
ATOM   252  N  N   . ARG A 1 31  ? 8.230  18.858 93.309  1.00 27.29 ? 31   ARG A N   1 
ATOM   253  C  CA  . ARG A 1 31  ? 8.029  20.148 93.920  1.00 25.36 ? 31   ARG A CA  1 
ATOM   254  C  C   . ARG A 1 31  ? 7.212  21.019 92.987  1.00 24.30 ? 31   ARG A C   1 
ATOM   255  O  O   . ARG A 1 31  ? 6.361  21.801 93.415  1.00 26.42 ? 31   ARG A O   1 
ATOM   256  C  CB  . ARG A 1 31  ? 9.403  20.807 94.218  1.00 24.78 ? 31   ARG A CB  1 
ATOM   257  C  CG  . ARG A 1 31  ? 10.174 20.092 95.323  1.00 24.46 ? 31   ARG A CG  1 
ATOM   258  C  CD  . ARG A 1 31  ? 11.552 20.687 95.631  1.00 25.00 ? 31   ARG A CD  1 
ATOM   259  N  NE  . ARG A 1 31  ? 11.415 22.092 95.986  1.00 25.94 ? 31   ARG A NE  1 
ATOM   260  C  CZ  . ARG A 1 31  ? 12.232 23.052 95.523  1.00 27.12 ? 31   ARG A CZ  1 
ATOM   261  N  NH1 . ARG A 1 31  ? 13.331 22.795 94.782  1.00 24.05 ? 31   ARG A NH1 1 
ATOM   262  N  NH2 . ARG A 1 31  ? 11.930 24.310 95.826  1.00 26.97 ? 31   ARG A NH2 1 
ATOM   263  N  N   . LEU A 1 32  ? 7.445  20.918 91.687  1.00 22.45 ? 32   LEU A N   1 
ATOM   264  C  CA  . LEU A 1 32  ? 6.826  21.837 90.760  1.00 21.56 ? 32   LEU A CA  1 
ATOM   265  C  C   . LEU A 1 32  ? 5.513  21.335 90.218  1.00 22.22 ? 32   LEU A C   1 
ATOM   266  O  O   . LEU A 1 32  ? 4.711  22.183 89.849  1.00 22.55 ? 32   LEU A O   1 
ATOM   267  C  CB  . LEU A 1 32  ? 7.757  22.156 89.568  1.00 18.45 ? 32   LEU A CB  1 
ATOM   268  C  CG  . LEU A 1 32  ? 9.132  22.711 89.897  1.00 18.65 ? 32   LEU A CG  1 
ATOM   269  C  CD1 . LEU A 1 32  ? 9.850  23.063 88.633  1.00 16.38 ? 32   LEU A CD1 1 
ATOM   270  C  CD2 . LEU A 1 32  ? 8.998  23.942 90.766  1.00 21.37 ? 32   LEU A CD2 1 
ATOM   271  N  N   . ASN A 1 33  ? 5.264  20.028 90.128  1.00 20.64 ? 33   ASN A N   1 
ATOM   272  C  CA  . ASN A 1 33  ? 3.997  19.457 89.666  1.00 22.05 ? 33   ASN A CA  1 
ATOM   273  C  C   . ASN A 1 33  ? 3.573  20.017 88.346  1.00 19.74 ? 33   ASN A C   1 
ATOM   274  O  O   . ASN A 1 33  ? 2.469  20.531 88.170  1.00 19.91 ? 33   ASN A O   1 
ATOM   275  C  CB  . ASN A 1 33  ? 2.882  19.715 90.676  1.00 23.83 ? 33   ASN A CB  1 
ATOM   276  C  CG  . ASN A 1 33  ? 3.130  18.936 91.932  1.00 26.96 ? 33   ASN A CG  1 
ATOM   277  O  OD1 . ASN A 1 33  ? 3.220  17.703 91.899  1.00 30.43 ? 33   ASN A OD1 1 
ATOM   278  N  ND2 . ASN A 1 33  ? 3.295  19.610 93.068  1.00 29.69 ? 33   ASN A ND2 1 
ATOM   279  N  N   . ARG A 1 34  ? 4.494  19.979 87.385  1.00 19.58 ? 34   ARG A N   1 
ATOM   280  C  CA  . ARG A 1 34  ? 4.180  20.459 86.059  1.00 16.13 ? 34   ARG A CA  1 
ATOM   281  C  C   . ARG A 1 34  ? 5.183  19.841 85.111  1.00 16.31 ? 34   ARG A C   1 
ATOM   282  O  O   . ARG A 1 34  ? 6.238  19.372 85.582  1.00 17.34 ? 34   ARG A O   1 
ATOM   283  C  CB  . ARG A 1 34  ? 4.241  22.012 86.048  1.00 15.73 ? 34   ARG A CB  1 
ATOM   284  C  CG  . ARG A 1 34  ? 5.557  22.639 86.514  1.00 19.41 ? 34   ARG A CG  1 
ATOM   285  C  CD  . ARG A 1 34  ? 5.799  23.827 85.621  1.00 17.20 ? 34   ARG A CD  1 
ATOM   286  N  NE  . ARG A 1 34  ? 6.969  24.627 85.978  1.00 18.17 ? 34   ARG A NE  1 
ATOM   287  C  CZ  . ARG A 1 34  ? 8.124  24.604 85.326  1.00 16.50 ? 34   ARG A CZ  1 
ATOM   288  N  NH1 . ARG A 1 34  ? 8.298  23.777 84.275  1.00 16.78 ? 34   ARG A NH1 1 
ATOM   289  N  NH2 . ARG A 1 34  ? 9.102  25.409 85.736  1.00 16.52 ? 34   ARG A NH2 1 
ATOM   290  N  N   . PRO A 1 35  ? 4.894  19.784 83.797  1.00 15.81 ? 35   PRO A N   1 
ATOM   291  C  CA  . PRO A 1 35  ? 5.830  19.368 82.769  1.00 15.91 ? 35   PRO A CA  1 
ATOM   292  C  C   . PRO A 1 35  ? 7.060  20.269 82.746  1.00 16.03 ? 35   PRO A C   1 
ATOM   293  O  O   . PRO A 1 35  ? 7.000  21.508 82.905  1.00 15.82 ? 35   PRO A O   1 
ATOM   294  C  CB  . PRO A 1 35  ? 5.040  19.416 81.467  1.00 15.45 ? 35   PRO A CB  1 
ATOM   295  C  CG  . PRO A 1 35  ? 3.607  19.259 81.911  1.00 16.15 ? 35   PRO A CG  1 
ATOM   296  C  CD  . PRO A 1 35  ? 3.607  20.100 83.167  1.00 14.43 ? 35   PRO A CD  1 
ATOM   297  N  N   . LEU A 1 36  ? 8.184  19.604 82.519  1.00 13.84 ? 36   LEU A N   1 
ATOM   298  C  CA  . LEU A 1 36  ? 9.484  20.260 82.448  1.00 11.37 ? 36   LEU A CA  1 
ATOM   299  C  C   . LEU A 1 36  ? 9.968  20.288 81.033  1.00 9.72  ? 36   LEU A C   1 
ATOM   300  O  O   . LEU A 1 36  ? 9.837  19.294 80.314  1.00 9.92  ? 36   LEU A O   1 
ATOM   301  C  CB  . LEU A 1 36  ? 10.480 19.505 83.281  1.00 10.55 ? 36   LEU A CB  1 
ATOM   302  C  CG  . LEU A 1 36  ? 10.262 19.464 84.785  1.00 11.68 ? 36   LEU A CG  1 
ATOM   303  C  CD1 . LEU A 1 36  ? 11.354 18.566 85.353  1.00 13.41 ? 36   LEU A CD1 1 
ATOM   304  C  CD2 . LEU A 1 36  ? 10.300 20.857 85.421  1.00 11.47 ? 36   LEU A CD2 1 
ATOM   305  N  N   . THR A 1 37  ? 10.525 21.381 80.536  1.00 10.70 ? 37   THR A N   1 
ATOM   306  C  CA  . THR A 1 37  ? 11.105 21.334 79.197  1.00 10.42 ? 37   THR A CA  1 
ATOM   307  C  C   . THR A 1 37  ? 12.378 20.454 79.265  1.00 8.59  ? 37   THR A C   1 
ATOM   308  O  O   . THR A 1 37  ? 12.851 20.105 80.367  1.00 7.96  ? 37   THR A O   1 
ATOM   309  C  CB  . THR A 1 37  ? 11.461 22.780 78.744  1.00 10.73 ? 37   THR A CB  1 
ATOM   310  O  OG1 . THR A 1 37  ? 12.519 23.278 79.583  1.00 12.60 ? 37   THR A OG1 1 
ATOM   311  C  CG2 . THR A 1 37  ? 10.267 23.715 78.852  1.00 4.13  ? 37   THR A CG2 1 
ATOM   312  N  N   . LEU A 1 38  ? 12.990 20.116 78.131  1.00 10.91 ? 38   LEU A N   1 
ATOM   313  C  CA  . LEU A 1 38  ? 14.274 19.397 78.137  1.00 12.31 ? 38   LEU A CA  1 
ATOM   314  C  C   . LEU A 1 38  ? 15.381 20.208 78.848  1.00 11.96 ? 38   LEU A C   1 
ATOM   315  O  O   . LEU A 1 38  ? 16.130 19.650 79.649  1.00 13.01 ? 38   LEU A O   1 
ATOM   316  C  CB  . LEU A 1 38  ? 14.749 19.115 76.708  1.00 11.35 ? 38   LEU A CB  1 
ATOM   317  C  CG  . LEU A 1 38  ? 16.145 18.473 76.578  1.00 9.83  ? 38   LEU A CG  1 
ATOM   318  C  CD1 . LEU A 1 38  ? 16.273 17.172 77.394  1.00 9.64  ? 38   LEU A CD1 1 
ATOM   319  C  CD2 . LEU A 1 38  ? 16.375 18.293 75.135  1.00 7.31  ? 38   LEU A CD2 1 
ATOM   320  N  N   . SER A 1 39  ? 15.510 21.527 78.627  1.00 11.56 ? 39   SER A N   1 
ATOM   321  C  CA  . SER A 1 39  ? 16.559 22.307 79.246  1.00 13.33 ? 39   SER A CA  1 
ATOM   322  C  C   . SER A 1 39  ? 16.341 22.325 80.730  1.00 13.01 ? 39   SER A C   1 
ATOM   323  O  O   . SER A 1 39  ? 17.323 22.193 81.447  1.00 12.47 ? 39   SER A O   1 
ATOM   324  C  CB  . SER A 1 39  ? 16.585 23.736 78.668  1.00 12.63 ? 39   SER A CB  1 
ATOM   325  O  OG  . SER A 1 39  ? 15.387 24.462 78.906  1.00 16.58 ? 39   SER A OG  1 
ATOM   326  N  N   . GLU A 1 40  ? 15.087 22.372 81.209  1.00 12.94 ? 40   GLU A N   1 
ATOM   327  C  CA  . GLU A 1 40  ? 14.799 22.325 82.629  1.00 9.61  ? 40   GLU A CA  1 
ATOM   328  C  C   . GLU A 1 40  ? 15.181 20.986 83.189  1.00 9.51  ? 40   GLU A C   1 
ATOM   329  O  O   . GLU A 1 40  ? 15.690 20.910 84.293  1.00 12.99 ? 40   GLU A O   1 
ATOM   330  C  CB  . GLU A 1 40  ? 13.325 22.525 82.901  1.00 10.58 ? 40   GLU A CB  1 
ATOM   331  C  CG  . GLU A 1 40  ? 12.880 23.952 82.597  1.00 14.47 ? 40   GLU A CG  1 
ATOM   332  C  CD  . GLU A 1 40  ? 11.448 24.275 83.038  1.00 15.30 ? 40   GLU A CD  1 
ATOM   333  O  OE1 . GLU A 1 40  ? 10.519 23.627 82.581  1.00 14.25 ? 40   GLU A OE1 1 
ATOM   334  O  OE2 . GLU A 1 40  ? 11.200 25.206 83.811  1.00 20.63 ? 40   GLU A OE2 1 
ATOM   335  N  N   . LYS A 1 41  ? 14.958 19.893 82.493  1.00 12.32 ? 41   LYS A N   1 
ATOM   336  C  CA  . LYS A 1 41  ? 15.357 18.600 83.018  1.00 13.17 ? 41   LYS A CA  1 
ATOM   337  C  C   . LYS A 1 41  ? 16.868 18.518 83.238  1.00 13.06 ? 41   LYS A C   1 
ATOM   338  O  O   . LYS A 1 41  ? 17.322 18.121 84.323  1.00 13.01 ? 41   LYS A O   1 
ATOM   339  C  CB  . LYS A 1 41  ? 14.932 17.487 82.065  1.00 10.87 ? 41   LYS A CB  1 
ATOM   340  C  CG  . LYS A 1 41  ? 13.455 17.081 82.134  1.00 12.24 ? 41   LYS A CG  1 
ATOM   341  C  CD  . LYS A 1 41  ? 13.243 16.036 81.062  1.00 12.86 ? 41   LYS A CD  1 
ATOM   342  C  CE  . LYS A 1 41  ? 11.821 15.621 81.114  1.00 14.46 ? 41   LYS A CE  1 
ATOM   343  N  NZ  . LYS A 1 41  ? 11.467 14.612 80.134  1.00 10.65 ? 41   LYS A NZ  1 
ATOM   344  N  N   . ILE A 1 42  ? 17.661 18.940 82.248  1.00 11.91 ? 42   ILE A N   1 
ATOM   345  C  CA  . ILE A 1 42  ? 19.121 18.794 82.358  1.00 12.54 ? 42   ILE A CA  1 
ATOM   346  C  C   . ILE A 1 42  ? 19.699 19.796 83.342  1.00 10.42 ? 42   ILE A C   1 
ATOM   347  O  O   . ILE A 1 42  ? 20.491 19.443 84.218  1.00 16.23 ? 42   ILE A O   1 
ATOM   348  C  CB  . ILE A 1 42  ? 19.751 18.937 80.941  1.00 10.73 ? 42   ILE A CB  1 
ATOM   349  C  CG1 . ILE A 1 42  ? 19.246 17.831 80.023  1.00 6.30  ? 42   ILE A CG1 1 
ATOM   350  C  CG2 . ILE A 1 42  ? 21.286 18.799 81.031  1.00 10.40 ? 42   ILE A CG2 1 
ATOM   351  C  CD1 . ILE A 1 42  ? 19.588 18.083 78.528  1.00 7.75  ? 42   ILE A CD1 1 
ATOM   352  N  N   . VAL A 1 43  ? 19.227 21.022 83.300  1.00 11.58 ? 43   VAL A N   1 
ATOM   353  C  CA  . VAL A 1 43  ? 19.702 22.043 84.195  1.00 10.97 ? 43   VAL A CA  1 
ATOM   354  C  C   . VAL A 1 43  ? 19.238 21.722 85.621  1.00 15.06 ? 43   VAL A C   1 
ATOM   355  O  O   . VAL A 1 43  ? 20.082 21.608 86.531  1.00 11.34 ? 43   VAL A O   1 
ATOM   356  C  CB  . VAL A 1 43  ? 19.190 23.474 83.707  1.00 8.84  ? 43   VAL A CB  1 
ATOM   357  C  CG1 . VAL A 1 43  ? 19.542 24.527 84.701  1.00 6.21  ? 43   VAL A CG1 1 
ATOM   358  C  CG2 . VAL A 1 43  ? 19.841 23.871 82.388  1.00 5.06  ? 43   VAL A CG2 1 
ATOM   359  N  N   . TYR A 1 44  ? 17.927 21.532 85.887  1.00 12.29 ? 44   TYR A N   1 
ATOM   360  C  CA  . TYR A 1 44  ? 17.522 21.287 87.266  1.00 13.63 ? 44   TYR A CA  1 
ATOM   361  C  C   . TYR A 1 44  ? 18.033 19.917 87.688  1.00 7.84  ? 44   TYR A C   1 
ATOM   362  O  O   . TYR A 1 44  ? 18.295 19.699 88.860  1.00 10.11 ? 44   TYR A O   1 
ATOM   363  C  CB  . TYR A 1 44  ? 15.980 21.330 87.438  1.00 13.43 ? 44   TYR A CB  1 
ATOM   364  C  CG  . TYR A 1 44  ? 15.316 22.614 86.960  1.00 15.87 ? 44   TYR A CG  1 
ATOM   365  C  CD1 . TYR A 1 44  ? 16.055 23.789 86.763  1.00 12.64 ? 44   TYR A CD1 1 
ATOM   366  C  CD2 . TYR A 1 44  ? 13.949 22.561 86.710  1.00 13.58 ? 44   TYR A CD2 1 
ATOM   367  C  CE1 . TYR A 1 44  ? 15.414 24.920 86.306  1.00 12.81 ? 44   TYR A CE1 1 
ATOM   368  C  CE2 . TYR A 1 44  ? 13.318 23.691 86.261  1.00 11.73 ? 44   TYR A CE2 1 
ATOM   369  C  CZ  . TYR A 1 44  ? 14.051 24.851 86.065  1.00 11.46 ? 44   TYR A CZ  1 
ATOM   370  O  OH  . TYR A 1 44  ? 13.392 25.975 85.641  1.00 16.03 ? 44   TYR A OH  1 
ATOM   371  N  N   . GLY A 1 45  ? 18.274 18.973 86.785  1.00 8.11  ? 45   GLY A N   1 
ATOM   372  C  CA  . GLY A 1 45  ? 18.842 17.678 87.179  1.00 8.86  ? 45   GLY A CA  1 
ATOM   373  C  C   . GLY A 1 45  ? 20.297 17.827 87.648  1.00 10.73 ? 45   GLY A C   1 
ATOM   374  O  O   . GLY A 1 45  ? 20.858 16.878 88.189  1.00 11.27 ? 45   GLY A O   1 
ATOM   375  N  N   . HIS A 1 46  ? 20.969 18.972 87.452  1.00 11.01 ? 46   HIS A N   1 
ATOM   376  C  CA  . HIS A 1 46  ? 22.354 19.196 87.897  1.00 10.79 ? 46   HIS A CA  1 
ATOM   377  C  C   . HIS A 1 46  ? 22.398 20.139 89.065  1.00 13.55 ? 46   HIS A C   1 
ATOM   378  O  O   . HIS A 1 46  ? 23.445 20.727 89.332  1.00 12.15 ? 46   HIS A O   1 
ATOM   379  C  CB  . HIS A 1 46  ? 23.179 19.787 86.766  1.00 11.86 ? 46   HIS A CB  1 
ATOM   380  C  CG  . HIS A 1 46  ? 23.570 18.752 85.701  1.00 12.05 ? 46   HIS A CG  1 
ATOM   381  N  ND1 . HIS A 1 46  ? 22.944 18.300 84.608  1.00 12.31 ? 46   HIS A ND1 1 
ATOM   382  C  CD2 . HIS A 1 46  ? 24.769 18.084 85.758  1.00 11.46 ? 46   HIS A CD2 1 
ATOM   383  C  CE1 . HIS A 1 46  ? 23.707 17.406 84.020  1.00 10.86 ? 46   HIS A CE1 1 
ATOM   384  N  NE2 . HIS A 1 46  ? 24.797 17.292 84.728  1.00 10.40 ? 46   HIS A NE2 1 
ATOM   385  N  N   . LEU A 1 47  ? 21.286 20.359 89.781  1.00 14.79 ? 47   LEU A N   1 
ATOM   386  C  CA  . LEU A 1 47  ? 21.263 21.280 90.910  1.00 15.66 ? 47   LEU A CA  1 
ATOM   387  C  C   . LEU A 1 47  ? 22.015 20.735 92.114  1.00 15.48 ? 47   LEU A C   1 
ATOM   388  O  O   . LEU A 1 47  ? 21.992 19.545 92.408  1.00 15.42 ? 47   LEU A O   1 
ATOM   389  C  CB  . LEU A 1 47  ? 19.819 21.588 91.351  1.00 17.14 ? 47   LEU A CB  1 
ATOM   390  C  CG  . LEU A 1 47  ? 18.944 22.540 90.479  1.00 18.39 ? 47   LEU A CG  1 
ATOM   391  C  CD1 . LEU A 1 47  ? 17.478 22.480 90.949  1.00 17.40 ? 47   LEU A CD1 1 
ATOM   392  C  CD2 . LEU A 1 47  ? 19.523 23.957 90.531  1.00 13.83 ? 47   LEU A CD2 1 
ATOM   393  N  N   . ASP A 1 48  ? 22.670 21.618 92.839  1.00 16.04 ? 48   ASP A N   1 
ATOM   394  C  CA  . ASP A 1 48  ? 23.424 21.239 93.995  1.00 17.73 ? 48   ASP A CA  1 
ATOM   395  C  C   . ASP A 1 48  ? 22.479 20.828 95.110  1.00 17.69 ? 48   ASP A C   1 
ATOM   396  O  O   . ASP A 1 48  ? 22.729 19.906 95.884  1.00 16.23 ? 48   ASP A O   1 
ATOM   397  C  CB  . ASP A 1 48  ? 24.300 22.428 94.426  1.00 20.18 ? 48   ASP A CB  1 
ATOM   398  C  CG  . ASP A 1 48  ? 25.073 22.162 95.714  1.00 22.70 ? 48   ASP A CG  1 
ATOM   399  O  OD1 . ASP A 1 48  ? 25.840 21.206 95.855  1.00 24.55 ? 48   ASP A OD1 1 
ATOM   400  O  OD2 . ASP A 1 48  ? 24.967 22.946 96.644  1.00 25.99 ? 48   ASP A OD2 1 
ATOM   401  N  N   . ASP A 1 49  ? 21.368 21.523 95.207  1.00 18.38 ? 49   ASP A N   1 
ATOM   402  C  CA  . ASP A 1 49  ? 20.383 21.205 96.219  1.00 20.10 ? 49   ASP A CA  1 
ATOM   403  C  C   . ASP A 1 49  ? 18.964 21.165 95.629  1.00 17.76 ? 49   ASP A C   1 
ATOM   404  O  O   . ASP A 1 49  ? 18.195 22.128 95.765  1.00 14.98 ? 49   ASP A O   1 
ATOM   405  C  CB  . ASP A 1 49  ? 20.493 22.238 97.340  1.00 24.26 ? 49   ASP A CB  1 
ATOM   406  C  CG  . ASP A 1 49  ? 19.718 21.875 98.596  1.00 29.27 ? 49   ASP A CG  1 
ATOM   407  O  OD1 . ASP A 1 49  ? 19.071 20.806 98.677  1.00 32.51 ? 49   ASP A OD1 1 
ATOM   408  O  OD2 . ASP A 1 49  ? 19.739 22.697 99.502  1.00 34.78 ? 49   ASP A OD2 1 
ATOM   409  N  N   . PRO A 1 50  ? 18.561 20.101 94.900  1.00 17.30 ? 50   PRO A N   1 
ATOM   410  C  CA  . PRO A 1 50  ? 17.278 20.039 94.210  1.00 19.14 ? 50   PRO A CA  1 
ATOM   411  C  C   . PRO A 1 50  ? 16.078 20.212 95.159  1.00 20.57 ? 50   PRO A C   1 
ATOM   412  O  O   . PRO A 1 50  ? 15.080 20.849 94.803  1.00 22.90 ? 50   PRO A O   1 
ATOM   413  C  CB  . PRO A 1 50  ? 17.336 18.702 93.489  1.00 17.05 ? 50   PRO A CB  1 
ATOM   414  C  CG  . PRO A 1 50  ? 18.278 17.861 94.300  1.00 17.27 ? 50   PRO A CG  1 
ATOM   415  C  CD  . PRO A 1 50  ? 19.344 18.892 94.622  1.00 16.82 ? 50   PRO A CD  1 
ATOM   416  N  N   . ALA A 1 51  ? 16.191 19.759 96.403  1.00 16.71 ? 51   ALA A N   1 
ATOM   417  C  CA  . ALA A 1 51  ? 15.159 19.891 97.380  1.00 16.39 ? 51   ALA A CA  1 
ATOM   418  C  C   . ALA A 1 51  ? 14.961 21.291 97.873  1.00 19.82 ? 51   ALA A C   1 
ATOM   419  O  O   . ALA A 1 51  ? 13.832 21.622 98.223  1.00 24.13 ? 51   ALA A O   1 
ATOM   420  C  CB  . ALA A 1 51  ? 15.464 19.072 98.587  1.00 16.39 ? 51   ALA A CB  1 
ATOM   421  N  N   . ASN A 1 52  ? 15.964 22.157 97.918  1.00 22.03 ? 52   ASN A N   1 
ATOM   422  C  CA  . ASN A 1 52  ? 15.722 23.447 98.514  1.00 23.34 ? 52   ASN A CA  1 
ATOM   423  C  C   . ASN A 1 52  ? 15.845 24.610 97.581  1.00 22.78 ? 52   ASN A C   1 
ATOM   424  O  O   . ASN A 1 52  ? 15.350 25.692 97.882  1.00 23.10 ? 52   ASN A O   1 
ATOM   425  C  CB  . ASN A 1 52  ? 16.659 23.673 99.681  1.00 27.65 ? 52   ASN A CB  1 
ATOM   426  C  CG  . ASN A 1 52  ? 16.348 22.690 100.792 1.00 31.00 ? 52   ASN A CG  1 
ATOM   427  O  OD1 . ASN A 1 52  ? 15.255 22.652 101.337 1.00 33.38 ? 52   ASN A OD1 1 
ATOM   428  N  ND2 . ASN A 1 52  ? 17.233 21.778 101.132 1.00 33.54 ? 52   ASN A ND2 1 
ATOM   429  N  N   . GLN A 1 53  ? 16.450 24.396 96.421  1.00 20.53 ? 53   GLN A N   1 
ATOM   430  C  CA  . GLN A 1 53  ? 16.577 25.435 95.438  1.00 20.79 ? 53   GLN A CA  1 
ATOM   431  C  C   . GLN A 1 53  ? 15.243 26.080 95.045  1.00 21.73 ? 53   GLN A C   1 
ATOM   432  O  O   . GLN A 1 53  ? 14.317 25.357 94.632  1.00 23.97 ? 53   GLN A O   1 
ATOM   433  C  CB  . GLN A 1 53  ? 17.240 24.850 94.197  1.00 18.32 ? 53   GLN A CB  1 
ATOM   434  C  CG  . GLN A 1 53  ? 17.409 25.834 93.025  1.00 17.65 ? 53   GLN A CG  1 
ATOM   435  C  CD  . GLN A 1 53  ? 18.465 26.922 93.259  1.00 17.76 ? 53   GLN A CD  1 
ATOM   436  O  OE1 . GLN A 1 53  ? 19.648 26.616 93.465  1.00 12.43 ? 53   GLN A OE1 1 
ATOM   437  N  NE2 . GLN A 1 53  ? 18.121 28.208 93.252  1.00 16.97 ? 53   GLN A NE2 1 
ATOM   438  N  N   . GLU A 1 54  ? 15.186 27.420 95.107  1.00 21.43 ? 54   GLU A N   1 
ATOM   439  C  CA  . GLU A 1 54  ? 14.069 28.212 94.606  1.00 22.49 ? 54   GLU A CA  1 
ATOM   440  C  C   . GLU A 1 54  ? 14.258 28.302 93.109  1.00 18.60 ? 54   GLU A C   1 
ATOM   441  O  O   . GLU A 1 54  ? 15.294 28.810 92.661  1.00 15.65 ? 54   GLU A O   1 
ATOM   442  C  CB  . GLU A 1 54  ? 14.074 29.629 95.100  1.00 30.71 ? 54   GLU A CB  1 
ATOM   443  C  CG  . GLU A 1 54  ? 13.865 29.755 96.596  1.00 43.53 ? 54   GLU A CG  1 
ATOM   444  C  CD  . GLU A 1 54  ? 14.268 31.123 97.149  1.00 51.65 ? 54   GLU A CD  1 
ATOM   445  O  OE1 . GLU A 1 54  ? 15.165 31.772 96.567  1.00 56.95 ? 54   GLU A OE1 1 
ATOM   446  O  OE2 . GLU A 1 54  ? 13.679 31.516 98.170  1.00 55.03 ? 54   GLU A OE2 1 
ATOM   447  N  N   . ILE A 1 55  ? 13.231 27.978 92.336  1.00 16.44 ? 55   ILE A N   1 
ATOM   448  C  CA  . ILE A 1 55  ? 13.312 27.809 90.909  1.00 16.71 ? 55   ILE A CA  1 
ATOM   449  C  C   . ILE A 1 55  ? 12.253 28.753 90.371  1.00 18.99 ? 55   ILE A C   1 
ATOM   450  O  O   . ILE A 1 55  ? 11.077 28.428 90.575  1.00 22.43 ? 55   ILE A O   1 
ATOM   451  C  CB  . ILE A 1 55  ? 12.967 26.324 90.493  1.00 13.27 ? 55   ILE A CB  1 
ATOM   452  C  CG1 . ILE A 1 55  ? 14.039 25.369 91.017  1.00 12.73 ? 55   ILE A CG1 1 
ATOM   453  C  CG2 . ILE A 1 55  ? 12.828 26.239 88.967  1.00 11.23 ? 55   ILE A CG2 1 
ATOM   454  C  CD1 . ILE A 1 55  ? 13.799 23.889 90.705  1.00 14.36 ? 55   ILE A CD1 1 
ATOM   455  N  N   . GLU A 1 56  ? 12.585 29.916 89.792  1.00 18.09 ? 56   GLU A N   1 
ATOM   456  C  CA  . GLU A 1 56  ? 11.603 30.758 89.105  1.00 22.16 ? 56   GLU A CA  1 
ATOM   457  C  C   . GLU A 1 56  ? 12.268 31.195 87.816  1.00 15.96 ? 56   GLU A C   1 
ATOM   458  O  O   . GLU A 1 56  ? 13.313 31.851 87.918  1.00 15.23 ? 56   GLU A O   1 
ATOM   459  C  CB  . GLU A 1 56  ? 11.255 32.048 89.836  1.00 27.49 ? 56   GLU A CB  1 
ATOM   460  C  CG  . GLU A 1 56  ? 10.236 31.917 90.940  1.00 39.75 ? 56   GLU A CG  1 
ATOM   461  C  CD  . GLU A 1 56  ? 9.069  32.881 90.769  1.00 45.87 ? 56   GLU A CD  1 
ATOM   462  O  OE1 . GLU A 1 56  ? 8.335  32.816 89.770  1.00 47.24 ? 56   GLU A OE1 1 
ATOM   463  O  OE2 . GLU A 1 56  ? 8.840  33.709 91.656  1.00 50.30 ? 56   GLU A OE2 1 
ATOM   464  N  N   . ARG A 1 57  ? 11.731 30.890 86.625  1.00 13.77 ? 57   ARG A N   1 
ATOM   465  C  CA  . ARG A 1 57  ? 12.382 31.260 85.366  1.00 14.02 ? 57   ARG A CA  1 
ATOM   466  C  C   . ARG A 1 57  ? 12.535 32.766 85.319  1.00 16.01 ? 57   ARG A C   1 
ATOM   467  O  O   . ARG A 1 57  ? 11.630 33.511 85.696  1.00 17.92 ? 57   ARG A O   1 
ATOM   468  C  CB  . ARG A 1 57  ? 11.611 30.867 84.117  1.00 12.69 ? 57   ARG A CB  1 
ATOM   469  C  CG  . ARG A 1 57  ? 11.405 29.368 84.020  1.00 11.43 ? 57   ARG A CG  1 
ATOM   470  C  CD  . ARG A 1 57  ? 10.903 29.073 82.623  1.00 11.32 ? 57   ARG A CD  1 
ATOM   471  N  NE  . ARG A 1 57  ? 10.371 27.736 82.483  1.00 12.56 ? 57   ARG A NE  1 
ATOM   472  C  CZ  . ARG A 1 57  ? 9.537  27.364 81.486  1.00 13.52 ? 57   ARG A CZ  1 
ATOM   473  N  NH1 . ARG A 1 57  ? 9.156  28.187 80.485  1.00 13.22 ? 57   ARG A NH1 1 
ATOM   474  N  NH2 . ARG A 1 57  ? 9.134  26.090 81.462  1.00 11.63 ? 57   ARG A NH2 1 
ATOM   475  N  N   . GLY A 1 58  ? 13.726 33.202 84.947  1.00 13.61 ? 58   GLY A N   1 
ATOM   476  C  CA  . GLY A 1 58  ? 14.088 34.599 84.861  1.00 13.77 ? 58   GLY A CA  1 
ATOM   477  C  C   . GLY A 1 58  ? 14.345 35.226 86.206  1.00 16.56 ? 58   GLY A C   1 
ATOM   478  O  O   . GLY A 1 58  ? 14.723 36.404 86.248  1.00 17.66 ? 58   GLY A O   1 
ATOM   479  N  N   . LYS A 1 59  ? 14.261 34.517 87.327  1.00 17.33 ? 59   LYS A N   1 
ATOM   480  C  CA  . LYS A 1 59  ? 14.327 35.209 88.585  1.00 19.74 ? 59   LYS A CA  1 
ATOM   481  C  C   . LYS A 1 59  ? 15.256 34.669 89.604  1.00 19.89 ? 59   LYS A C   1 
ATOM   482  O  O   . LYS A 1 59  ? 15.925 35.494 90.206  1.00 21.89 ? 59   LYS A O   1 
ATOM   483  C  CB  . LYS A 1 59  ? 12.966 35.299 89.271  1.00 26.72 ? 59   LYS A CB  1 
ATOM   484  C  CG  . LYS A 1 59  ? 11.991 36.208 88.537  1.00 32.47 ? 59   LYS A CG  1 
ATOM   485  C  CD  . LYS A 1 59  ? 11.171 36.872 89.595  1.00 40.77 ? 59   LYS A CD  1 
ATOM   486  C  CE  . LYS A 1 59  ? 9.788  36.249 89.704  1.00 45.82 ? 59   LYS A CE  1 
ATOM   487  N  NZ  . LYS A 1 59  ? 9.230  36.565 91.020  1.00 46.44 ? 59   LYS A NZ  1 
ATOM   488  N  N   . THR A 1 60  ? 15.376 33.379 89.824  1.00 19.49 ? 60   THR A N   1 
ATOM   489  C  CA  . THR A 1 60  ? 16.256 32.931 90.869  1.00 17.89 ? 60   THR A CA  1 
ATOM   490  C  C   . THR A 1 60  ? 17.621 32.574 90.306  1.00 16.23 ? 60   THR A C   1 
ATOM   491  O  O   . THR A 1 60  ? 17.766 32.384 89.101  1.00 16.20 ? 60   THR A O   1 
ATOM   492  C  CB  . THR A 1 60  ? 15.549 31.752 91.554  1.00 19.59 ? 60   THR A CB  1 
ATOM   493  O  OG1 . THR A 1 60  ? 15.233 30.762 90.560  1.00 23.00 ? 60   THR A OG1 1 
ATOM   494  C  CG2 . THR A 1 60  ? 14.259 32.213 92.247  1.00 16.77 ? 60   THR A CG2 1 
ATOM   495  N  N   . TYR A 1 61  ? 18.672 32.576 91.108  1.00 16.91 ? 61   TYR A N   1 
ATOM   496  C  CA  . TYR A 1 61  ? 19.996 32.123 90.708  1.00 16.20 ? 61   TYR A CA  1 
ATOM   497  C  C   . TYR A 1 61  ? 20.105 30.665 91.151  1.00 13.75 ? 61   TYR A C   1 
ATOM   498  O  O   . TYR A 1 61  ? 19.900 30.322 92.322  1.00 14.40 ? 61   TYR A O   1 
ATOM   499  C  CB  . TYR A 1 61  ? 21.124 32.969 91.371  1.00 16.01 ? 61   TYR A CB  1 
ATOM   500  C  CG  . TYR A 1 61  ? 21.387 34.303 90.661  1.00 16.23 ? 61   TYR A CG  1 
ATOM   501  C  CD1 . TYR A 1 61  ? 22.056 34.340 89.447  1.00 16.64 ? 61   TYR A CD1 1 
ATOM   502  C  CD2 . TYR A 1 61  ? 20.948 35.502 91.223  1.00 17.38 ? 61   TYR A CD2 1 
ATOM   503  C  CE1 . TYR A 1 61  ? 22.245 35.549 88.799  1.00 16.09 ? 61   TYR A CE1 1 
ATOM   504  C  CE2 . TYR A 1 61  ? 21.138 36.721 90.576  1.00 17.52 ? 61   TYR A CE2 1 
ATOM   505  C  CZ  . TYR A 1 61  ? 21.798 36.733 89.374  1.00 16.50 ? 61   TYR A CZ  1 
ATOM   506  O  OH  . TYR A 1 61  ? 21.978 37.930 88.704  1.00 17.83 ? 61   TYR A OH  1 
ATOM   507  N  N   . LEU A 1 62  ? 20.314 29.782 90.189  1.00 11.87 ? 62   LEU A N   1 
ATOM   508  C  CA  . LEU A 1 62  ? 20.511 28.348 90.416  1.00 12.75 ? 62   LEU A CA  1 
ATOM   509  C  C   . LEU A 1 62  ? 21.954 28.011 90.813  1.00 14.49 ? 62   LEU A C   1 
ATOM   510  O  O   . LEU A 1 62  ? 22.859 28.620 90.233  1.00 13.93 ? 62   LEU A O   1 
ATOM   511  C  CB  . LEU A 1 62  ? 20.116 27.582 89.130  1.00 11.46 ? 62   LEU A CB  1 
ATOM   512  C  CG  . LEU A 1 62  ? 18.712 27.871 88.512  1.00 13.16 ? 62   LEU A CG  1 
ATOM   513  C  CD1 . LEU A 1 62  ? 18.614 27.191 87.156  1.00 11.35 ? 62   LEU A CD1 1 
ATOM   514  C  CD2 . LEU A 1 62  ? 17.616 27.469 89.482  1.00 8.52  ? 62   LEU A CD2 1 
ATOM   515  N  N   . ARG A 1 63  ? 22.188 27.126 91.803  1.00 16.20 ? 63   ARG A N   1 
ATOM   516  C  CA  . ARG A 1 63  ? 23.529 26.704 92.198  1.00 19.00 ? 63   ARG A CA  1 
ATOM   517  C  C   . ARG A 1 63  ? 23.661 25.306 91.608  1.00 16.77 ? 63   ARG A C   1 
ATOM   518  O  O   . ARG A 1 63  ? 22.973 24.353 91.983  1.00 18.29 ? 63   ARG A O   1 
ATOM   519  C  CB  . ARG A 1 63  ? 23.676 26.657 93.717  1.00 20.43 ? 63   ARG A CB  1 
ATOM   520  C  CG  . ARG A 1 63  ? 23.276 27.988 94.300  1.00 27.79 ? 63   ARG A CG  1 
ATOM   521  C  CD  . ARG A 1 63  ? 23.845 28.267 95.670  1.00 36.83 ? 63   ARG A CD  1 
ATOM   522  N  NE  . ARG A 1 63  ? 24.895 29.263 95.429  1.00 48.09 ? 63   ARG A NE  1 
ATOM   523  C  CZ  . ARG A 1 63  ? 26.159 29.277 95.956  1.00 50.22 ? 63   ARG A CZ  1 
ATOM   524  N  NH1 . ARG A 1 63  ? 26.572 28.431 96.936  1.00 50.99 ? 63   ARG A NH1 1 
ATOM   525  N  NH2 . ARG A 1 63  ? 26.970 30.239 95.497  1.00 50.76 ? 63   ARG A NH2 1 
ATOM   526  N  N   . LEU A 1 64  ? 24.497 25.213 90.586  1.00 13.59 ? 64   LEU A N   1 
ATOM   527  C  CA  . LEU A 1 64  ? 24.657 24.064 89.731  1.00 10.81 ? 64   LEU A CA  1 
ATOM   528  C  C   . LEU A 1 64  ? 26.002 23.407 89.923  1.00 11.10 ? 64   LEU A C   1 
ATOM   529  O  O   . LEU A 1 64  ? 26.972 24.050 90.323  1.00 11.21 ? 64   LEU A O   1 
ATOM   530  C  CB  . LEU A 1 64  ? 24.534 24.502 88.272  1.00 8.11  ? 64   LEU A CB  1 
ATOM   531  C  CG  . LEU A 1 64  ? 23.174 25.042 87.892  1.00 12.94 ? 64   LEU A CG  1 
ATOM   532  C  CD1 . LEU A 1 64  ? 23.256 25.897 86.653  1.00 10.83 ? 64   LEU A CD1 1 
ATOM   533  C  CD2 . LEU A 1 64  ? 22.230 23.839 87.750  1.00 11.08 ? 64   LEU A CD2 1 
ATOM   534  N  N   . ARG A 1 65  ? 26.035 22.118 89.573  1.00 12.27 ? 65   ARG A N   1 
ATOM   535  C  CA  . ARG A 1 65  ? 27.233 21.290 89.509  1.00 13.00 ? 65   ARG A CA  1 
ATOM   536  C  C   . ARG A 1 65  ? 27.583 20.863 88.086  1.00 10.70 ? 65   ARG A C   1 
ATOM   537  O  O   . ARG A 1 65  ? 27.064 19.845 87.620  1.00 11.95 ? 65   ARG A O   1 
ATOM   538  C  CB  . ARG A 1 65  ? 27.032 20.068 90.364  1.00 12.27 ? 65   ARG A CB  1 
ATOM   539  C  CG  . ARG A 1 65  ? 26.842 20.396 91.833  1.00 15.00 ? 65   ARG A CG  1 
ATOM   540  C  CD  . ARG A 1 65  ? 28.128 21.041 92.361  1.00 21.60 ? 65   ARG A CD  1 
ATOM   541  N  NE  . ARG A 1 65  ? 28.022 21.379 93.773  1.00 26.65 ? 65   ARG A NE  1 
ATOM   542  C  CZ  . ARG A 1 65  ? 29.090 21.690 94.556  1.00 28.56 ? 65   ARG A CZ  1 
ATOM   543  N  NH1 . ARG A 1 65  ? 30.325 21.791 94.067  1.00 26.39 ? 65   ARG A NH1 1 
ATOM   544  N  NH2 . ARG A 1 65  ? 28.885 21.954 95.846  1.00 29.20 ? 65   ARG A NH2 1 
ATOM   545  N  N   . PRO A 1 66  ? 28.371 21.601 87.279  1.00 11.21 ? 66   PRO A N   1 
ATOM   546  C  CA  . PRO A 1 66  ? 28.740 21.133 85.929  1.00 11.94 ? 66   PRO A CA  1 
ATOM   547  C  C   . PRO A 1 66  ? 29.533 19.810 85.989  1.00 13.93 ? 66   PRO A C   1 
ATOM   548  O  O   . PRO A 1 66  ? 30.175 19.501 87.007  1.00 14.38 ? 66   PRO A O   1 
ATOM   549  C  CB  . PRO A 1 66  ? 29.523 22.301 85.335  1.00 10.77 ? 66   PRO A CB  1 
ATOM   550  C  CG  . PRO A 1 66  ? 29.010 23.511 86.116  1.00 9.87  ? 66   PRO A CG  1 
ATOM   551  C  CD  . PRO A 1 66  ? 28.815 22.976 87.527  1.00 8.43  ? 66   PRO A CD  1 
ATOM   552  N  N   . ASP A 1 67  ? 29.448 19.041 84.912  1.00 12.78 ? 67   ASP A N   1 
ATOM   553  C  CA  . ASP A 1 67  ? 30.179 17.806 84.753  1.00 13.21 ? 67   ASP A CA  1 
ATOM   554  C  C   . ASP A 1 67  ? 31.613 18.029 84.266  1.00 13.46 ? 67   ASP A C   1 
ATOM   555  O  O   . ASP A 1 67  ? 32.499 17.201 84.497  1.00 12.93 ? 67   ASP A O   1 
ATOM   556  C  CB  . ASP A 1 67  ? 29.439 16.914 83.746  1.00 12.65 ? 67   ASP A CB  1 
ATOM   557  C  CG  . ASP A 1 67  ? 27.992 16.571 84.135  1.00 13.06 ? 67   ASP A CG  1 
ATOM   558  O  OD1 . ASP A 1 67  ? 27.721 16.295 85.287  1.00 14.56 ? 67   ASP A OD1 1 
ATOM   559  O  OD2 . ASP A 1 67  ? 27.095 16.665 83.301  1.00 12.15 ? 67   ASP A OD2 1 
ATOM   560  N  N   . ARG A 1 68  ? 31.886 19.047 83.466  1.00 13.33 ? 68   ARG A N   1 
ATOM   561  C  CA  . ARG A 1 68  ? 33.248 19.230 82.975  1.00 13.79 ? 68   ARG A CA  1 
ATOM   562  C  C   . ARG A 1 68  ? 33.426 20.658 82.526  1.00 14.10 ? 68   ARG A C   1 
ATOM   563  O  O   . ARG A 1 68  ? 32.410 21.367 82.398  1.00 12.48 ? 68   ARG A O   1 
ATOM   564  C  CB  . ARG A 1 68  ? 33.478 18.236 81.858  1.00 11.90 ? 68   ARG A CB  1 
ATOM   565  C  CG  . ARG A 1 68  ? 32.822 18.322 80.513  1.00 9.53  ? 68   ARG A CG  1 
ATOM   566  C  CD  . ARG A 1 68  ? 33.228 17.118 79.641  1.00 8.44  ? 68   ARG A CD  1 
ATOM   567  N  NE  . ARG A 1 68  ? 34.668 17.155 79.516  1.00 12.03 ? 68   ARG A NE  1 
ATOM   568  C  CZ  . ARG A 1 68  ? 35.505 16.137 79.848  1.00 13.74 ? 68   ARG A CZ  1 
ATOM   569  N  NH1 . ARG A 1 68  ? 35.060 14.887 80.095  1.00 9.94  ? 68   ARG A NH1 1 
ATOM   570  N  NH2 . ARG A 1 68  ? 36.825 16.375 79.880  1.00 11.46 ? 68   ARG A NH2 1 
ATOM   571  N  N   . VAL A 1 69  ? 34.698 21.088 82.392  1.00 14.39 ? 69   VAL A N   1 
ATOM   572  C  CA  . VAL A 1 69  ? 35.117 22.445 82.034  1.00 10.68 ? 69   VAL A CA  1 
ATOM   573  C  C   . VAL A 1 69  ? 35.999 22.349 80.782  1.00 12.33 ? 69   VAL A C   1 
ATOM   574  O  O   . VAL A 1 69  ? 36.830 21.442 80.656  1.00 14.39 ? 69   VAL A O   1 
ATOM   575  C  CB  . VAL A 1 69  ? 35.924 23.085 83.189  1.00 13.59 ? 69   VAL A CB  1 
ATOM   576  C  CG1 . VAL A 1 69  ? 36.436 24.480 82.819  1.00 10.09 ? 69   VAL A CG1 1 
ATOM   577  C  CG2 . VAL A 1 69  ? 35.029 23.295 84.369  1.00 11.43 ? 69   VAL A CG2 1 
ATOM   578  N  N   . ALA A 1 70  ? 35.847 23.175 79.764  1.00 9.04  ? 70   ALA A N   1 
ATOM   579  C  CA  . ALA A 1 70  ? 36.687 23.181 78.591  1.00 9.59  ? 70   ALA A CA  1 
ATOM   580  C  C   . ALA A 1 70  ? 37.185 24.613 78.397  1.00 11.20 ? 70   ALA A C   1 
ATOM   581  O  O   . ALA A 1 70  ? 36.424 25.591 78.561  1.00 12.26 ? 70   ALA A O   1 
ATOM   582  C  CB  . ALA A 1 70  ? 35.893 22.776 77.372  1.00 5.50  ? 70   ALA A CB  1 
ATOM   583  N  N   . MET A 1 71  ? 38.463 24.827 78.076  1.00 11.28 ? 71   MET A N   1 
ATOM   584  C  CA  . MET A 1 71  ? 39.015 26.162 77.904  1.00 8.27  ? 71   MET A CA  1 
ATOM   585  C  C   . MET A 1 71  ? 39.725 26.208 76.580  1.00 9.30  ? 71   MET A C   1 
ATOM   586  O  O   . MET A 1 71  ? 40.242 25.191 76.147  1.00 10.57 ? 71   MET A O   1 
ATOM   587  C  CB  . MET A 1 71  ? 40.005 26.449 78.983  1.00 10.82 ? 71   MET A CB  1 
ATOM   588  C  CG  . MET A 1 71  ? 39.329 26.523 80.315  1.00 12.06 ? 71   MET A CG  1 
ATOM   589  S  SD  . MET A 1 71  ? 40.460 26.765 81.681  1.00 16.73 ? 71   MET A SD  1 
ATOM   590  C  CE  . MET A 1 71  ? 40.928 25.080 81.886  1.00 13.06 ? 71   MET A CE  1 
ATOM   591  N  N   . GLN A 1 72  ? 39.748 27.286 75.836  1.00 10.32 ? 72   GLN A N   1 
ATOM   592  C  CA  . GLN A 1 72  ? 40.566 27.339 74.626  1.00 12.05 ? 72   GLN A CA  1 
ATOM   593  C  C   . GLN A 1 72  ? 41.783 28.229 74.948  1.00 12.54 ? 72   GLN A C   1 
ATOM   594  O  O   . GLN A 1 72  ? 41.723 28.935 75.964  1.00 13.80 ? 72   GLN A O   1 
ATOM   595  C  CB  . GLN A 1 72  ? 39.747 27.877 73.443  1.00 9.38  ? 72   GLN A CB  1 
ATOM   596  C  CG  . GLN A 1 72  ? 38.756 28.992 73.658  1.00 10.75 ? 72   GLN A CG  1 
ATOM   597  C  CD  . GLN A 1 72  ? 39.331 30.400 73.636  1.00 14.24 ? 72   GLN A CD  1 
ATOM   598  O  OE1 . GLN A 1 72  ? 40.551 30.628 73.705  1.00 13.00 ? 72   GLN A OE1 1 
ATOM   599  N  NE2 . GLN A 1 72  ? 38.468 31.407 73.527  1.00 9.77  ? 72   GLN A NE2 1 
ATOM   600  N  N   . ASP A 1 73  ? 42.908 28.233 74.221  1.00 12.18 ? 73   ASP A N   1 
ATOM   601  C  CA  . ASP A 1 73  ? 44.120 28.928 74.678  1.00 13.39 ? 73   ASP A CA  1 
ATOM   602  C  C   . ASP A 1 73  ? 44.067 30.449 74.743  1.00 11.38 ? 73   ASP A C   1 
ATOM   603  O  O   . ASP A 1 73  ? 44.840 30.992 75.522  1.00 13.90 ? 73   ASP A O   1 
ATOM   604  C  CB  . ASP A 1 73  ? 45.318 28.471 73.808  1.00 10.71 ? 73   ASP A CB  1 
ATOM   605  C  CG  . ASP A 1 73  ? 45.154 28.669 72.338  1.00 11.33 ? 73   ASP A CG  1 
ATOM   606  O  OD1 . ASP A 1 73  ? 44.094 29.095 71.865  1.00 12.62 ? 73   ASP A OD1 1 
ATOM   607  O  OD2 . ASP A 1 73  ? 46.076 28.315 71.606  1.00 11.56 ? 73   ASP A OD2 1 
ATOM   608  N  N   . ALA A 1 74  ? 43.184 31.206 74.079  1.00 10.64 ? 74   ALA A N   1 
ATOM   609  C  CA  . ALA A 1 74  ? 43.112 32.649 74.262  1.00 9.09  ? 74   ALA A CA  1 
ATOM   610  C  C   . ALA A 1 74  ? 42.437 32.994 75.560  1.00 8.68  ? 74   ALA A C   1 
ATOM   611  O  O   . ALA A 1 74  ? 42.605 34.116 76.053  1.00 11.01 ? 74   ALA A O   1 
ATOM   612  C  CB  . ALA A 1 74  ? 42.344 33.314 73.136  1.00 10.87 ? 74   ALA A CB  1 
ATOM   613  N  N   . THR A 1 75  ? 41.663 32.089 76.185  1.00 10.16 ? 75   THR A N   1 
ATOM   614  C  CA  . THR A 1 75  ? 41.035 32.432 77.461  1.00 8.46  ? 75   THR A CA  1 
ATOM   615  C  C   . THR A 1 75  ? 41.588 31.592 78.585  1.00 6.97  ? 75   THR A C   1 
ATOM   616  O  O   . THR A 1 75  ? 41.528 32.002 79.743  1.00 9.54  ? 75   THR A O   1 
ATOM   617  C  CB  . THR A 1 75  ? 39.436 32.289 77.395  1.00 10.46 ? 75   THR A CB  1 
ATOM   618  O  OG1 . THR A 1 75  ? 39.152 30.977 76.916  1.00 13.44 ? 75   THR A OG1 1 
ATOM   619  C  CG2 . THR A 1 75  ? 38.763 33.406 76.541  1.00 7.10  ? 75   THR A CG2 1 
ATOM   620  N  N   . ALA A 1 76  ? 42.210 30.446 78.290  1.00 8.08  ? 76   ALA A N   1 
ATOM   621  C  CA  . ALA A 1 76  ? 42.747 29.582 79.317  1.00 7.66  ? 76   ALA A CA  1 
ATOM   622  C  C   . ALA A 1 76  ? 43.890 30.210 80.062  1.00 9.83  ? 76   ALA A C   1 
ATOM   623  O  O   . ALA A 1 76  ? 44.119 29.884 81.231  1.00 12.60 ? 76   ALA A O   1 
ATOM   624  C  CB  . ALA A 1 76  ? 43.303 28.288 78.751  1.00 5.89  ? 76   ALA A CB  1 
ATOM   625  N  N   . GLN A 1 77  ? 44.611 31.145 79.452  1.00 9.86  ? 77   GLN A N   1 
ATOM   626  C  CA  . GLN A 1 77  ? 45.764 31.748 80.151  1.00 10.02 ? 77   GLN A CA  1 
ATOM   627  C  C   . GLN A 1 77  ? 45.387 32.512 81.410  1.00 10.23 ? 77   GLN A C   1 
ATOM   628  O  O   . GLN A 1 77  ? 45.828 32.221 82.529  1.00 9.94  ? 77   GLN A O   1 
ATOM   629  C  CB  . GLN A 1 77  ? 46.495 32.655 79.162  1.00 9.53  ? 77   GLN A CB  1 
ATOM   630  C  CG  . GLN A 1 77  ? 47.114 31.866 78.035  1.00 8.51  ? 77   GLN A CG  1 
ATOM   631  C  CD  . GLN A 1 77  ? 47.698 32.809 77.005  1.00 9.74  ? 77   GLN A CD  1 
ATOM   632  O  OE1 . GLN A 1 77  ? 48.568 33.604 77.346  1.00 13.58 ? 77   GLN A OE1 1 
ATOM   633  N  NE2 . GLN A 1 77  ? 47.315 32.837 75.741  1.00 8.45  ? 77   GLN A NE2 1 
ATOM   634  N  N   . MET A 1 78  ? 44.427 33.436 81.260  1.00 14.02 ? 78   MET A N   1 
ATOM   635  C  CA  . MET A 1 78  ? 43.958 34.231 82.374  1.00 12.87 ? 78   MET A CA  1 
ATOM   636  C  C   . MET A 1 78  ? 43.103 33.386 83.315  1.00 11.80 ? 78   MET A C   1 
ATOM   637  O  O   . MET A 1 78  ? 43.117 33.632 84.535  1.00 14.87 ? 78   MET A O   1 
ATOM   638  C  CB  . MET A 1 78  ? 43.199 35.426 81.782  1.00 14.22 ? 78   MET A CB  1 
ATOM   639  C  CG  . MET A 1 78  ? 42.865 36.449 82.825  1.00 14.26 ? 78   MET A CG  1 
ATOM   640  S  SD  . MET A 1 78  ? 44.318 37.125 83.648  1.00 19.39 ? 78   MET A SD  1 
ATOM   641  C  CE  . MET A 1 78  ? 44.890 38.133 82.315  1.00 12.63 ? 78   MET A CE  1 
ATOM   642  N  N   . ALA A 1 79  ? 42.377 32.353 82.836  1.00 12.82 ? 79   ALA A N   1 
ATOM   643  C  CA  . ALA A 1 79  ? 41.656 31.474 83.764  1.00 13.52 ? 79   ALA A CA  1 
ATOM   644  C  C   . ALA A 1 79  ? 42.677 30.697 84.618  1.00 12.56 ? 79   ALA A C   1 
ATOM   645  O  O   . ALA A 1 79  ? 42.532 30.633 85.845  1.00 12.16 ? 79   ALA A O   1 
ATOM   646  C  CB  . ALA A 1 79  ? 40.773 30.460 83.007  1.00 12.26 ? 79   ALA A CB  1 
ATOM   647  N  N   . MET A 1 80  ? 43.747 30.132 84.035  1.00 12.34 ? 80   MET A N   1 
ATOM   648  C  CA  . MET A 1 80  ? 44.764 29.445 84.792  1.00 12.42 ? 80   MET A CA  1 
ATOM   649  C  C   . MET A 1 80  ? 45.580 30.381 85.663  1.00 13.17 ? 80   MET A C   1 
ATOM   650  O  O   . MET A 1 80  ? 45.907 29.984 86.780  1.00 13.20 ? 80   MET A O   1 
ATOM   651  C  CB  . MET A 1 80  ? 45.703 28.661 83.849  1.00 17.26 ? 80   MET A CB  1 
ATOM   652  C  CG  . MET A 1 80  ? 45.027 27.419 83.210  1.00 20.64 ? 80   MET A CG  1 
ATOM   653  S  SD  . MET A 1 80  ? 44.123 26.391 84.419  1.00 24.25 ? 80   MET A SD  1 
ATOM   654  C  CE  . MET A 1 80  ? 45.474 25.558 85.210  1.00 23.62 ? 80   MET A CE  1 
ATOM   655  N  N   . LEU A 1 81  ? 45.906 31.622 85.292  1.00 13.10 ? 81   LEU A N   1 
ATOM   656  C  CA  . LEU A 1 81  ? 46.570 32.552 86.209  1.00 12.27 ? 81   LEU A CA  1 
ATOM   657  C  C   . LEU A 1 81  ? 45.669 32.842 87.401  1.00 14.58 ? 81   LEU A C   1 
ATOM   658  O  O   . LEU A 1 81  ? 46.142 32.923 88.544  1.00 14.99 ? 81   LEU A O   1 
ATOM   659  C  CB  . LEU A 1 81  ? 46.922 33.877 85.485  1.00 11.87 ? 81   LEU A CB  1 
ATOM   660  C  CG  . LEU A 1 81  ? 48.042 33.811 84.421  1.00 13.64 ? 81   LEU A CG  1 
ATOM   661  C  CD1 . LEU A 1 81  ? 47.880 34.984 83.468  1.00 9.85  ? 81   LEU A CD1 1 
ATOM   662  C  CD2 . LEU A 1 81  ? 49.455 33.806 85.097  1.00 13.83 ? 81   LEU A CD2 1 
ATOM   663  N  N   . GLN A 1 82  ? 44.341 32.962 87.234  1.00 13.79 ? 82   GLN A N   1 
ATOM   664  C  CA  . GLN A 1 82  ? 43.479 33.127 88.398  1.00 12.12 ? 82   GLN A CA  1 
ATOM   665  C  C   . GLN A 1 82  ? 43.413 31.819 89.193  1.00 14.00 ? 82   GLN A C   1 
ATOM   666  O  O   . GLN A 1 82  ? 43.292 31.827 90.431  1.00 14.02 ? 82   GLN A O   1 
ATOM   667  C  CB  . GLN A 1 82  ? 42.061 33.510 87.971  1.00 14.41 ? 82   GLN A CB  1 
ATOM   668  C  CG  . GLN A 1 82  ? 41.999 34.880 87.362  1.00 13.31 ? 82   GLN A CG  1 
ATOM   669  C  CD  . GLN A 1 82  ? 40.615 35.281 86.903  1.00 14.14 ? 82   GLN A CD  1 
ATOM   670  O  OE1 . GLN A 1 82  ? 39.859 35.849 87.692  1.00 12.98 ? 82   GLN A OE1 1 
ATOM   671  N  NE2 . GLN A 1 82  ? 40.221 35.011 85.666  1.00 12.28 ? 82   GLN A NE2 1 
ATOM   672  N  N   . PHE A 1 83  ? 43.460 30.644 88.538  1.00 15.24 ? 83   PHE A N   1 
ATOM   673  C  CA  . PHE A 1 83  ? 43.467 29.393 89.287  1.00 15.00 ? 83   PHE A CA  1 
ATOM   674  C  C   . PHE A 1 83  ? 44.746 29.269 90.122  1.00 17.17 ? 83   PHE A C   1 
ATOM   675  O  O   . PHE A 1 83  ? 44.703 28.826 91.283  1.00 17.68 ? 83   PHE A O   1 
ATOM   676  C  CB  . PHE A 1 83  ? 43.381 28.170 88.372  1.00 17.60 ? 83   PHE A CB  1 
ATOM   677  C  CG  . PHE A 1 83  ? 43.160 26.878 89.191  1.00 22.03 ? 83   PHE A CG  1 
ATOM   678  C  CD1 . PHE A 1 83  ? 41.897 26.572 89.694  1.00 21.86 ? 83   PHE A CD1 1 
ATOM   679  C  CD2 . PHE A 1 83  ? 44.212 26.016 89.463  1.00 20.48 ? 83   PHE A CD2 1 
ATOM   680  C  CE1 . PHE A 1 83  ? 41.710 25.430 90.450  1.00 21.67 ? 83   PHE A CE1 1 
ATOM   681  C  CE2 . PHE A 1 83  ? 44.007 24.875 90.227  1.00 20.78 ? 83   PHE A CE2 1 
ATOM   682  C  CZ  . PHE A 1 83  ? 42.760 24.581 90.719  1.00 22.18 ? 83   PHE A CZ  1 
ATOM   683  N  N   . ILE A 1 84  ? 45.892 29.657 89.551  1.00 17.10 ? 84   ILE A N   1 
ATOM   684  C  CA  . ILE A 1 84  ? 47.152 29.706 90.270  1.00 19.68 ? 84   ILE A CA  1 
ATOM   685  C  C   . ILE A 1 84  ? 46.972 30.655 91.454  1.00 20.32 ? 84   ILE A C   1 
ATOM   686  O  O   . ILE A 1 84  ? 47.337 30.184 92.534  1.00 23.12 ? 84   ILE A O   1 
ATOM   687  C  CB  . ILE A 1 84  ? 48.284 30.174 89.290  1.00 19.70 ? 84   ILE A CB  1 
ATOM   688  C  CG1 . ILE A 1 84  ? 48.597 29.014 88.350  1.00 20.36 ? 84   ILE A CG1 1 
ATOM   689  C  CG2 . ILE A 1 84  ? 49.523 30.639 90.030  1.00 21.66 ? 84   ILE A CG2 1 
ATOM   690  C  CD1 . ILE A 1 84  ? 49.530 29.363 87.189  1.00 20.18 ? 84   ILE A CD1 1 
ATOM   691  N  N   . SER A 1 85  ? 46.424 31.893 91.427  1.00 18.65 ? 85   SER A N   1 
ATOM   692  C  CA  . SER A 1 85  ? 46.223 32.655 92.662  1.00 19.43 ? 85   SER A CA  1 
ATOM   693  C  C   . SER A 1 85  ? 45.382 31.941 93.689  1.00 20.16 ? 85   SER A C   1 
ATOM   694  O  O   . SER A 1 85  ? 45.563 32.207 94.884  1.00 25.50 ? 85   SER A O   1 
ATOM   695  C  CB  . SER A 1 85  ? 45.475 33.972 92.522  1.00 20.49 ? 85   SER A CB  1 
ATOM   696  O  OG  . SER A 1 85  ? 45.882 34.716 91.406  1.00 31.43 ? 85   SER A OG  1 
ATOM   697  N  N   . SER A 1 86  ? 44.443 31.057 93.326  1.00 22.62 ? 86   SER A N   1 
ATOM   698  C  CA  . SER A 1 86  ? 43.559 30.449 94.308  1.00 21.56 ? 86   SER A CA  1 
ATOM   699  C  C   . SER A 1 86  ? 44.404 29.635 95.255  1.00 23.84 ? 86   SER A C   1 
ATOM   700  O  O   . SER A 1 86  ? 44.118 29.574 96.444  1.00 25.97 ? 86   SER A O   1 
ATOM   701  C  CB  . SER A 1 86  ? 42.534 29.551 93.622  1.00 20.50 ? 86   SER A CB  1 
ATOM   702  O  OG  . SER A 1 86  ? 43.006 28.260 93.250  1.00 18.66 ? 86   SER A OG  1 
ATOM   703  N  N   . GLY A 1 87  ? 45.480 29.057 94.740  1.00 26.02 ? 87   GLY A N   1 
ATOM   704  C  CA  . GLY A 1 87  ? 46.385 28.286 95.540  1.00 26.09 ? 87   GLY A CA  1 
ATOM   705  C  C   . GLY A 1 87  ? 45.915 26.857 95.607  1.00 29.18 ? 87   GLY A C   1 
ATOM   706  O  O   . GLY A 1 87  ? 46.592 26.047 96.245  1.00 30.93 ? 87   GLY A O   1 
ATOM   707  N  N   . LEU A 1 88  ? 44.811 26.477 94.950  1.00 27.26 ? 88   LEU A N   1 
ATOM   708  C  CA  . LEU A 1 88  ? 44.345 25.098 94.976  1.00 24.48 ? 88   LEU A CA  1 
ATOM   709  C  C   . LEU A 1 88  ? 45.202 24.127 94.153  1.00 23.34 ? 88   LEU A C   1 
ATOM   710  O  O   . LEU A 1 88  ? 45.710 24.455 93.086  1.00 24.61 ? 88   LEU A O   1 
ATOM   711  C  CB  . LEU A 1 88  ? 42.896 25.072 94.501  1.00 26.07 ? 88   LEU A CB  1 
ATOM   712  C  CG  . LEU A 1 88  ? 41.913 25.718 95.489  1.00 26.51 ? 88   LEU A CG  1 
ATOM   713  C  CD1 . LEU A 1 88  ? 40.543 25.823 94.901  1.00 27.93 ? 88   LEU A CD1 1 
ATOM   714  C  CD2 . LEU A 1 88  ? 41.759 24.846 96.703  1.00 28.30 ? 88   LEU A CD2 1 
ATOM   715  N  N   . PRO A 1 89  ? 45.430 22.893 94.597  1.00 23.33 ? 89   PRO A N   1 
ATOM   716  C  CA  . PRO A 1 89  ? 46.387 21.989 94.000  1.00 21.06 ? 89   PRO A CA  1 
ATOM   717  C  C   . PRO A 1 89  ? 46.004 21.274 92.742  1.00 22.72 ? 89   PRO A C   1 
ATOM   718  O  O   . PRO A 1 89  ? 46.891 20.861 92.001  1.00 23.24 ? 89   PRO A O   1 
ATOM   719  C  CB  . PRO A 1 89  ? 46.698 21.037 95.104  1.00 20.58 ? 89   PRO A CB  1 
ATOM   720  C  CG  . PRO A 1 89  ? 45.362 20.891 95.781  1.00 20.94 ? 89   PRO A CG  1 
ATOM   721  C  CD  . PRO A 1 89  ? 44.979 22.354 95.878  1.00 21.59 ? 89   PRO A CD  1 
ATOM   722  N  N   . LYS A 1 90  ? 44.701 21.111 92.498  1.00 24.31 ? 90   LYS A N   1 
ATOM   723  C  CA  . LYS A 1 90  ? 44.216 20.230 91.451  1.00 24.66 ? 90   LYS A CA  1 
ATOM   724  C  C   . LYS A 1 90  ? 42.810 20.690 91.074  1.00 21.68 ? 90   LYS A C   1 
ATOM   725  O  O   . LYS A 1 90  ? 42.128 21.217 91.953  1.00 18.63 ? 90   LYS A O   1 
ATOM   726  C  CB  . LYS A 1 90  ? 44.263 18.842 92.081  1.00 29.99 ? 90   LYS A CB  1 
ATOM   727  C  CG  . LYS A 1 90  ? 43.570 17.668 91.452  1.00 38.47 ? 90   LYS A CG  1 
ATOM   728  C  CD  . LYS A 1 90  ? 44.199 17.267 90.122  1.00 46.22 ? 90   LYS A CD  1 
ATOM   729  C  CE  . LYS A 1 90  ? 43.260 16.282 89.397  1.00 51.62 ? 90   LYS A CE  1 
ATOM   730  N  NZ  . LYS A 1 90  ? 42.098 16.896 88.728  1.00 55.12 ? 90   LYS A NZ  1 
ATOM   731  N  N   . VAL A 1 91  ? 42.394 20.539 89.806  1.00 19.43 ? 91   VAL A N   1 
ATOM   732  C  CA  . VAL A 1 91  ? 41.022 20.836 89.384  1.00 19.06 ? 91   VAL A CA  1 
ATOM   733  C  C   . VAL A 1 91  ? 40.086 19.747 89.900  1.00 19.20 ? 91   VAL A C   1 
ATOM   734  O  O   . VAL A 1 91  ? 40.471 18.573 90.007  1.00 19.33 ? 91   VAL A O   1 
ATOM   735  C  CB  . VAL A 1 91  ? 40.898 20.947 87.833  1.00 17.40 ? 91   VAL A CB  1 
ATOM   736  C  CG1 . VAL A 1 91  ? 41.806 22.094 87.396  1.00 17.31 ? 91   VAL A CG1 1 
ATOM   737  C  CG2 . VAL A 1 91  ? 41.249 19.668 87.125  1.00 16.93 ? 91   VAL A CG2 1 
ATOM   738  N  N   . ALA A 1 92  ? 38.867 20.090 90.275  1.00 22.29 ? 92   ALA A N   1 
ATOM   739  C  CA  . ALA A 1 92  ? 37.926 19.153 90.878  1.00 21.74 ? 92   ALA A CA  1 
ATOM   740  C  C   . ALA A 1 92  ? 37.076 18.393 89.862  1.00 21.73 ? 92   ALA A C   1 
ATOM   741  O  O   . ALA A 1 92  ? 36.540 17.337 90.199  1.00 24.16 ? 92   ALA A O   1 
ATOM   742  C  CB  . ALA A 1 92  ? 36.995 19.912 91.817  1.00 22.61 ? 92   ALA A CB  1 
ATOM   743  N  N   . VAL A 1 93  ? 36.946 18.815 88.595  1.00 18.07 ? 93   VAL A N   1 
ATOM   744  C  CA  . VAL A 1 93  ? 36.111 18.128 87.606  1.00 17.85 ? 93   VAL A CA  1 
ATOM   745  C  C   . VAL A 1 93  ? 36.966 17.926 86.359  1.00 14.79 ? 93   VAL A C   1 
ATOM   746  O  O   . VAL A 1 93  ? 37.968 18.645 86.225  1.00 15.58 ? 93   VAL A O   1 
ATOM   747  C  CB  . VAL A 1 93  ? 34.822 18.977 87.233  1.00 16.54 ? 93   VAL A CB  1 
ATOM   748  C  CG1 . VAL A 1 93  ? 33.939 19.044 88.465  1.00 15.76 ? 93   VAL A CG1 1 
ATOM   749  C  CG2 . VAL A 1 93  ? 35.177 20.378 86.748  1.00 17.50 ? 93   VAL A CG2 1 
ATOM   750  N  N   . PRO A 1 94  ? 36.678 16.998 85.440  1.00 14.00 ? 94   PRO A N   1 
ATOM   751  C  CA  . PRO A 1 94  ? 37.340 16.900 84.123  1.00 13.33 ? 94   PRO A CA  1 
ATOM   752  C  C   . PRO A 1 94  ? 37.419 18.257 83.402  1.00 15.45 ? 94   PRO A C   1 
ATOM   753  O  O   . PRO A 1 94  ? 36.393 18.925 83.198  1.00 11.46 ? 94   PRO A O   1 
ATOM   754  C  CB  . PRO A 1 94  ? 36.525 15.901 83.365  1.00 14.00 ? 94   PRO A CB  1 
ATOM   755  C  CG  . PRO A 1 94  ? 35.901 15.068 84.455  1.00 12.22 ? 94   PRO A CG  1 
ATOM   756  C  CD  . PRO A 1 94  ? 35.618 15.997 85.601  1.00 11.64 ? 94   PRO A CD  1 
ATOM   757  N  N   . SER A 1 95  ? 38.631 18.721 83.026  1.00 15.48 ? 95   SER A N   1 
ATOM   758  C  CA  . SER A 1 95  ? 38.883 20.010 82.403  1.00 11.04 ? 95   SER A CA  1 
ATOM   759  C  C   . SER A 1 95  ? 39.821 19.823 81.235  1.00 11.07 ? 95   SER A C   1 
ATOM   760  O  O   . SER A 1 95  ? 40.679 18.941 81.331  1.00 16.33 ? 95   SER A O   1 
ATOM   761  C  CB  . SER A 1 95  ? 39.518 20.948 83.393  1.00 8.97  ? 95   SER A CB  1 
ATOM   762  O  OG  . SER A 1 95  ? 38.836 21.061 84.620  1.00 12.90 ? 95   SER A OG  1 
ATOM   763  N  N   . THR A 1 96  ? 39.706 20.543 80.123  1.00 12.23 ? 96   THR A N   1 
ATOM   764  C  CA  . THR A 1 96  ? 40.637 20.426 79.010  1.00 12.72 ? 96   THR A CA  1 
ATOM   765  C  C   . THR A 1 96  ? 41.027 21.831 78.545  1.00 13.22 ? 96   THR A C   1 
ATOM   766  O  O   . THR A 1 96  ? 40.263 22.792 78.765  1.00 11.91 ? 96   THR A O   1 
ATOM   767  C  CB  . THR A 1 96  ? 40.005 19.626 77.784  1.00 13.11 ? 96   THR A CB  1 
ATOM   768  O  OG1 . THR A 1 96  ? 38.735 20.204 77.455  1.00 12.47 ? 96   THR A OG1 1 
ATOM   769  C  CG2 . THR A 1 96  ? 39.778 18.150 78.092  1.00 12.44 ? 96   THR A CG2 1 
ATOM   770  N  N   . ILE A 1 97  ? 42.192 21.936 77.898  1.00 11.15 ? 97   ILE A N   1 
ATOM   771  C  CA  . ILE A 1 97  ? 42.631 23.129 77.215  1.00 8.52  ? 97   ILE A CA  1 
ATOM   772  C  C   . ILE A 1 97  ? 42.791 22.768 75.764  1.00 7.04  ? 97   ILE A C   1 
ATOM   773  O  O   . ILE A 1 97  ? 43.243 21.676 75.439  1.00 10.05 ? 97   ILE A O   1 
ATOM   774  C  CB  . ILE A 1 97  ? 43.958 23.634 77.785  1.00 8.65  ? 97   ILE A CB  1 
ATOM   775  C  CG1 . ILE A 1 97  ? 43.648 24.134 79.183  1.00 7.47  ? 97   ILE A CG1 1 
ATOM   776  C  CG2 . ILE A 1 97  ? 44.586 24.701 76.857  1.00 8.14  ? 97   ILE A CG2 1 
ATOM   777  C  CD1 . ILE A 1 97  ? 44.793 24.313 80.206  1.00 10.40 ? 97   ILE A CD1 1 
ATOM   778  N  N   . HIS A 1 98  ? 42.356 23.639 74.870  1.00 6.56  ? 98   HIS A N   1 
ATOM   779  C  CA  . HIS A 1 98  ? 42.364 23.407 73.444  1.00 9.31  ? 98   HIS A CA  1 
ATOM   780  C  C   . HIS A 1 98  ? 43.171 24.509 72.818  1.00 9.39  ? 98   HIS A C   1 
ATOM   781  O  O   . HIS A 1 98  ? 42.813 25.662 73.024  1.00 9.97  ? 98   HIS A O   1 
ATOM   782  C  CB  . HIS A 1 98  ? 40.934 23.460 72.879  1.00 6.68  ? 98   HIS A CB  1 
ATOM   783  C  CG  . HIS A 1 98  ? 40.168 22.274 73.415  1.00 8.27  ? 98   HIS A CG  1 
ATOM   784  N  ND1 . HIS A 1 98  ? 40.020 21.095 72.826  1.00 10.40 ? 98   HIS A ND1 1 
ATOM   785  C  CD2 . HIS A 1 98  ? 39.572 22.216 74.658  1.00 9.54  ? 98   HIS A CD2 1 
ATOM   786  C  CE1 . HIS A 1 98  ? 39.367 20.324 73.663  1.00 11.19 ? 98   HIS A CE1 1 
ATOM   787  N  NE2 . HIS A 1 98  ? 39.098 20.991 74.755  1.00 11.92 ? 98   HIS A NE2 1 
ATOM   788  N  N   . CYS A 1 99  ? 44.226 24.226 72.071  1.00 11.08 ? 99   CYS A N   1 
ATOM   789  C  CA  . CYS A 1 99  ? 45.057 25.276 71.513  1.00 8.76  ? 99   CYS A CA  1 
ATOM   790  C  C   . CYS A 1 99  ? 44.649 25.516 70.099  1.00 7.34  ? 99   CYS A C   1 
ATOM   791  O  O   . CYS A 1 99  ? 45.160 24.863 69.197  1.00 11.06 ? 99   CYS A O   1 
ATOM   792  C  CB  . CYS A 1 99  ? 46.543 24.872 71.557  1.00 6.67  ? 99   CYS A CB  1 
ATOM   793  S  SG  . CYS A 1 99  ? 47.101 24.596 73.252  1.00 10.55 ? 99   CYS A SG  1 
ATOM   794  N  N   . ASP A 1 100 ? 43.763 26.470 69.893  1.00 6.64  ? 100  ASP A N   1 
ATOM   795  C  CA  . ASP A 1 100 ? 43.160 26.716 68.595  1.00 8.42  ? 100  ASP A CA  1 
ATOM   796  C  C   . ASP A 1 100 ? 43.105 28.192 68.198  1.00 6.25  ? 100  ASP A C   1 
ATOM   797  O  O   . ASP A 1 100 ? 42.888 28.539 67.034  1.00 8.91  ? 100  ASP A O   1 
ATOM   798  C  CB  . ASP A 1 100 ? 41.727 26.151 68.622  1.00 9.35  ? 100  ASP A CB  1 
ATOM   799  C  CG  . ASP A 1 100 ? 40.817 26.715 69.713  1.00 12.44 ? 100  ASP A CG  1 
ATOM   800  O  OD1 . ASP A 1 100 ? 41.225 27.448 70.632  1.00 12.79 ? 100  ASP A OD1 1 
ATOM   801  O  OD2 . ASP A 1 100 ? 39.633 26.452 69.648  1.00 12.33 ? 100  ASP A OD2 1 
ATOM   802  N  N   . HIS A 1 101 ? 43.333 29.130 69.115  1.00 9.53  ? 101  HIS A N   1 
ATOM   803  C  CA  . HIS A 1 101 ? 43.146 30.550 68.794  1.00 10.81 ? 101  HIS A CA  1 
ATOM   804  C  C   . HIS A 1 101 ? 44.366 31.332 68.333  1.00 14.45 ? 101  HIS A C   1 
ATOM   805  O  O   . HIS A 1 101 ? 44.256 32.483 67.906  1.00 15.06 ? 101  HIS A O   1 
ATOM   806  C  CB  . HIS A 1 101 ? 42.545 31.256 70.013  1.00 9.53  ? 101  HIS A CB  1 
ATOM   807  C  CG  . HIS A 1 101 ? 41.033 31.125 70.124  1.00 11.62 ? 101  HIS A CG  1 
ATOM   808  N  ND1 . HIS A 1 101 ? 40.261 30.057 70.336  1.00 12.66 ? 101  HIS A ND1 1 
ATOM   809  C  CD2 . HIS A 1 101 ? 40.198 32.207 69.961  1.00 12.25 ? 101  HIS A CD2 1 
ATOM   810  C  CE1 . HIS A 1 101 ? 39.014 30.439 70.313  1.00 12.30 ? 101  HIS A CE1 1 
ATOM   811  N  NE2 . HIS A 1 101 ? 38.999 31.752 70.083  1.00 10.80 ? 101  HIS A NE2 1 
ATOM   812  N  N   . LEU A 1 102 ? 45.562 30.752 68.426  1.00 13.90 ? 102  LEU A N   1 
ATOM   813  C  CA  . LEU A 1 102 ? 46.759 31.540 68.233  1.00 13.17 ? 102  LEU A CA  1 
ATOM   814  C  C   . LEU A 1 102 ? 47.493 31.153 66.974  1.00 13.33 ? 102  LEU A C   1 
ATOM   815  O  O   . LEU A 1 102 ? 48.660 31.480 66.809  1.00 16.33 ? 102  LEU A O   1 
ATOM   816  C  CB  . LEU A 1 102 ? 47.633 31.366 69.484  1.00 9.13  ? 102  LEU A CB  1 
ATOM   817  C  CG  . LEU A 1 102 ? 47.067 31.783 70.864  1.00 11.57 ? 102  LEU A CG  1 
ATOM   818  C  CD1 . LEU A 1 102 ? 48.133 31.629 71.926  1.00 9.97  ? 102  LEU A CD1 1 
ATOM   819  C  CD2 . LEU A 1 102 ? 46.621 33.245 70.855  1.00 11.88 ? 102  LEU A CD2 1 
ATOM   820  N  N   . ILE A 1 103 ? 46.859 30.421 66.063  1.00 12.25 ? 103  ILE A N   1 
ATOM   821  C  CA  . ILE A 1 103 ? 47.475 30.030 64.813  1.00 12.76 ? 103  ILE A CA  1 
ATOM   822  C  C   . ILE A 1 103 ? 46.956 30.966 63.722  1.00 16.22 ? 103  ILE A C   1 
ATOM   823  O  O   . ILE A 1 103 ? 45.795 30.968 63.289  1.00 16.46 ? 103  ILE A O   1 
ATOM   824  C  CB  . ILE A 1 103 ? 47.160 28.515 64.504  1.00 11.82 ? 103  ILE A CB  1 
ATOM   825  C  CG1 . ILE A 1 103 ? 47.664 27.646 65.657  1.00 11.19 ? 103  ILE A CG1 1 
ATOM   826  C  CG2 . ILE A 1 103 ? 47.804 28.117 63.155  1.00 9.05  ? 103  ILE A CG2 1 
ATOM   827  C  CD1 . ILE A 1 103 ? 46.930 26.317 65.911  1.00 12.14 ? 103  ILE A CD1 1 
ATOM   828  N  N   . GLU A 1 104 ? 47.888 31.813 63.300  1.00 15.31 ? 104  GLU A N   1 
ATOM   829  C  CA  . GLU A 1 104 ? 47.689 32.812 62.283  1.00 16.93 ? 104  GLU A CA  1 
ATOM   830  C  C   . GLU A 1 104 ? 47.691 32.230 60.880  1.00 17.33 ? 104  GLU A C   1 
ATOM   831  O  O   . GLU A 1 104 ? 48.560 31.434 60.524  1.00 17.23 ? 104  GLU A O   1 
ATOM   832  C  CB  . GLU A 1 104 ? 48.785 33.867 62.422  1.00 17.92 ? 104  GLU A CB  1 
ATOM   833  C  CG  . GLU A 1 104 ? 48.454 34.971 61.446  1.00 21.56 ? 104  GLU A CG  1 
ATOM   834  C  CD  . GLU A 1 104 ? 49.611 35.855 61.133  1.00 25.45 ? 104  GLU A CD  1 
ATOM   835  O  OE1 . GLU A 1 104 ? 50.478 35.420 60.393  1.00 32.21 ? 104  GLU A OE1 1 
ATOM   836  O  OE2 . GLU A 1 104 ? 49.654 36.953 61.624  1.00 26.88 ? 104  GLU A OE2 1 
ATOM   837  N  N   . ALA A 1 105 ? 46.707 32.601 60.076  1.00 12.09 ? 105  ALA A N   1 
ATOM   838  C  CA  . ALA A 1 105 ? 46.683 32.158 58.702  1.00 14.27 ? 105  ALA A CA  1 
ATOM   839  C  C   . ALA A 1 105 ? 47.522 33.059 57.835  1.00 15.74 ? 105  ALA A C   1 
ATOM   840  O  O   . ALA A 1 105 ? 47.385 34.293 57.842  1.00 14.82 ? 105  ALA A O   1 
ATOM   841  C  CB  . ALA A 1 105 ? 45.289 32.195 58.108  1.00 16.94 ? 105  ALA A CB  1 
ATOM   842  N  N   . GLN A 1 106 ? 48.356 32.428 57.030  1.00 17.47 ? 106  GLN A N   1 
ATOM   843  C  CA  . GLN A 1 106 ? 49.240 33.170 56.183  1.00 17.93 ? 106  GLN A CA  1 
ATOM   844  C  C   . GLN A 1 106 ? 49.642 32.302 55.002  1.00 20.34 ? 106  GLN A C   1 
ATOM   845  O  O   . GLN A 1 106 ? 49.252 32.572 53.865  1.00 22.40 ? 106  GLN A O   1 
ATOM   846  C  CB  . GLN A 1 106 ? 50.413 33.593 57.044  1.00 17.19 ? 106  GLN A CB  1 
ATOM   847  C  CG  . GLN A 1 106 ? 51.370 34.444 56.260  1.00 21.00 ? 106  GLN A CG  1 
ATOM   848  C  CD  . GLN A 1 106 ? 52.622 34.551 57.090  1.00 27.79 ? 106  GLN A CD  1 
ATOM   849  O  OE1 . GLN A 1 106 ? 53.312 33.569 57.381  1.00 28.19 ? 106  GLN A OE1 1 
ATOM   850  N  NE2 . GLN A 1 106 ? 52.931 35.725 57.600  1.00 31.98 ? 106  GLN A NE2 1 
ATOM   851  N  N   . LEU A 1 107 ? 50.337 31.209 55.258  1.00 23.46 ? 107  LEU A N   1 
ATOM   852  C  CA  . LEU A 1 107 ? 50.884 30.298 54.272  1.00 26.30 ? 107  LEU A CA  1 
ATOM   853  C  C   . LEU A 1 107 ? 49.993 29.078 54.011  1.00 28.49 ? 107  LEU A C   1 
ATOM   854  O  O   . LEU A 1 107 ? 50.138 28.389 52.994  1.00 30.61 ? 107  LEU A O   1 
ATOM   855  C  CB  . LEU A 1 107 ? 52.256 29.876 54.790  1.00 26.70 ? 107  LEU A CB  1 
ATOM   856  C  CG  . LEU A 1 107 ? 53.560 30.484 54.303  1.00 29.45 ? 107  LEU A CG  1 
ATOM   857  C  CD1 . LEU A 1 107 ? 53.347 31.827 53.656  1.00 30.09 ? 107  LEU A CD1 1 
ATOM   858  C  CD2 . LEU A 1 107 ? 54.493 30.516 55.490  1.00 30.36 ? 107  LEU A CD2 1 
ATOM   859  N  N   . GLY A 1 108 ? 49.066 28.775 54.924  1.00 27.02 ? 108  GLY A N   1 
ATOM   860  C  CA  . GLY A 1 108 ? 48.238 27.594 54.845  1.00 24.91 ? 108  GLY A CA  1 
ATOM   861  C  C   . GLY A 1 108 ? 48.836 26.484 55.728  1.00 26.01 ? 108  GLY A C   1 
ATOM   862  O  O   . GLY A 1 108 ? 50.018 26.450 56.118  1.00 24.37 ? 108  GLY A O   1 
ATOM   863  N  N   . GLY A 1 109 ? 47.953 25.532 56.005  1.00 23.12 ? 109  GLY A N   1 
ATOM   864  C  CA  . GLY A 1 109 ? 48.189 24.307 56.767  1.00 24.82 ? 109  GLY A CA  1 
ATOM   865  C  C   . GLY A 1 109 ? 49.378 24.101 57.708  1.00 21.83 ? 109  GLY A C   1 
ATOM   866  O  O   . GLY A 1 109 ? 49.434 24.639 58.816  1.00 21.97 ? 109  GLY A O   1 
ATOM   867  N  N   . GLU A 1 110 ? 50.258 23.173 57.287  1.00 25.03 ? 110  GLU A N   1 
ATOM   868  C  CA  . GLU A 1 110 ? 51.458 22.723 58.018  1.00 26.83 ? 110  GLU A CA  1 
ATOM   869  C  C   . GLU A 1 110 ? 52.437 23.857 58.288  1.00 18.92 ? 110  GLU A C   1 
ATOM   870  O  O   . GLU A 1 110 ? 52.976 23.968 59.374  1.00 17.67 ? 110  GLU A O   1 
ATOM   871  C  CB  . GLU A 1 110 ? 52.200 21.594 57.221  1.00 35.15 ? 110  GLU A CB  1 
ATOM   872  C  CG  . GLU A 1 110 ? 52.544 21.849 55.699  1.00 49.50 ? 110  GLU A CG  1 
ATOM   873  C  CD  . GLU A 1 110 ? 53.980 21.559 55.155  1.00 56.64 ? 110  GLU A CD  1 
ATOM   874  O  OE1 . GLU A 1 110 ? 54.614 20.562 55.535  1.00 60.88 ? 110  GLU A OE1 1 
ATOM   875  O  OE2 . GLU A 1 110 ? 54.535 22.375 54.393  1.00 58.68 ? 110  GLU A OE2 1 
ATOM   876  N  N   . LYS A 1 111 ? 52.661 24.713 57.310  1.00 15.87 ? 111  LYS A N   1 
ATOM   877  C  CA  . LYS A 1 111 ? 53.560 25.841 57.428  1.00 17.76 ? 111  LYS A CA  1 
ATOM   878  C  C   . LYS A 1 111 ? 53.043 26.767 58.504  1.00 18.04 ? 111  LYS A C   1 
ATOM   879  O  O   . LYS A 1 111 ? 53.811 27.114 59.406  1.00 15.59 ? 111  LYS A O   1 
ATOM   880  C  CB  . LYS A 1 111 ? 53.610 26.578 56.137  1.00 18.19 ? 111  LYS A CB  1 
ATOM   881  C  CG  . LYS A 1 111 ? 54.172 25.705 55.080  1.00 22.80 ? 111  LYS A CG  1 
ATOM   882  C  CD  . LYS A 1 111 ? 54.007 26.417 53.740  1.00 27.68 ? 111  LYS A CD  1 
ATOM   883  C  CE  . LYS A 1 111 ? 54.601 25.500 52.672  1.00 31.28 ? 111  LYS A CE  1 
ATOM   884  N  NZ  . LYS A 1 111 ? 56.014 25.629 53.039  1.00 33.63 ? 111  LYS A NZ  1 
ATOM   885  N  N   . ASP A 1 112 ? 51.728 27.088 58.502  1.00 16.80 ? 112  ASP A N   1 
ATOM   886  C  CA  . ASP A 1 112 ? 51.211 27.968 59.538  1.00 15.76 ? 112  ASP A CA  1 
ATOM   887  C  C   . ASP A 1 112 ? 51.274 27.398 60.923  1.00 13.61 ? 112  ASP A C   1 
ATOM   888  O  O   . ASP A 1 112 ? 51.594 28.093 61.897  1.00 17.60 ? 112  ASP A O   1 
ATOM   889  C  CB  . ASP A 1 112 ? 49.775 28.357 59.262  1.00 16.59 ? 112  ASP A CB  1 
ATOM   890  C  CG  . ASP A 1 112 ? 49.688 29.397 58.168  1.00 19.71 ? 112  ASP A CG  1 
ATOM   891  O  OD1 . ASP A 1 112 ? 50.681 30.063 57.841  1.00 19.25 ? 112  ASP A OD1 1 
ATOM   892  O  OD2 . ASP A 1 112 ? 48.612 29.549 57.584  1.00 18.71 ? 112  ASP A OD2 1 
ATOM   893  N  N   . LEU A 1 113 ? 51.081 26.084 61.009  1.00 14.88 ? 113  LEU A N   1 
ATOM   894  C  CA  . LEU A 1 113 ? 51.165 25.427 62.289  1.00 14.85 ? 113  LEU A CA  1 
ATOM   895  C  C   . LEU A 1 113 ? 52.568 25.420 62.868  1.00 12.86 ? 113  LEU A C   1 
ATOM   896  O  O   . LEU A 1 113 ? 52.748 25.621 64.076  1.00 12.63 ? 113  LEU A O   1 
ATOM   897  C  CB  . LEU A 1 113 ? 50.663 23.999 62.170  1.00 16.29 ? 113  LEU A CB  1 
ATOM   898  C  CG  . LEU A 1 113 ? 50.591 23.239 63.493  1.00 18.10 ? 113  LEU A CG  1 
ATOM   899  C  CD1 . LEU A 1 113 ? 49.683 23.955 64.463  1.00 17.55 ? 113  LEU A CD1 1 
ATOM   900  C  CD2 . LEU A 1 113 ? 50.082 21.844 63.238  1.00 17.05 ? 113  LEU A CD2 1 
ATOM   901  N  N   . ARG A 1 114 ? 53.548 25.141 62.028  1.00 12.30 ? 114  ARG A N   1 
ATOM   902  C  CA  . ARG A 1 114 ? 54.958 25.137 62.444  1.00 16.67 ? 114  ARG A CA  1 
ATOM   903  C  C   . ARG A 1 114 ? 55.390 26.494 62.986  1.00 14.74 ? 114  ARG A C   1 
ATOM   904  O  O   . ARG A 1 114 ? 55.944 26.638 64.076  1.00 15.54 ? 114  ARG A O   1 
ATOM   905  C  CB  . ARG A 1 114 ? 55.844 24.783 61.266  1.00 18.31 ? 114  ARG A CB  1 
ATOM   906  C  CG  . ARG A 1 114 ? 55.642 23.339 60.835  1.00 24.93 ? 114  ARG A CG  1 
ATOM   907  C  CD  . ARG A 1 114 ? 56.861 22.813 60.030  1.00 27.20 ? 114  ARG A CD  1 
ATOM   908  N  NE  . ARG A 1 114 ? 56.881 23.274 58.649  1.00 24.22 ? 114  ARG A NE  1 
ATOM   909  C  CZ  . ARG A 1 114 ? 56.344 22.566 57.656  1.00 26.97 ? 114  ARG A CZ  1 
ATOM   910  N  NH1 . ARG A 1 114 ? 55.825 21.346 57.882  1.00 26.09 ? 114  ARG A NH1 1 
ATOM   911  N  NH2 . ARG A 1 114 ? 56.378 23.068 56.409  1.00 24.98 ? 114  ARG A NH2 1 
ATOM   912  N  N   . ARG A 1 115 ? 55.054 27.540 62.236  1.00 16.72 ? 115  ARG A N   1 
ATOM   913  C  CA  . ARG A 1 115 ? 55.314 28.920 62.654  1.00 17.11 ? 115  ARG A CA  1 
ATOM   914  C  C   . ARG A 1 115 ? 54.612 29.295 63.964  1.00 19.88 ? 115  ARG A C   1 
ATOM   915  O  O   . ARG A 1 115 ? 55.224 29.921 64.847  1.00 15.42 ? 115  ARG A O   1 
ATOM   916  C  CB  . ARG A 1 115 ? 54.867 29.785 61.505  1.00 19.93 ? 115  ARG A CB  1 
ATOM   917  C  CG  . ARG A 1 115 ? 55.025 31.232 61.704  1.00 25.92 ? 115  ARG A CG  1 
ATOM   918  C  CD  . ARG A 1 115 ? 54.507 31.855 60.441  1.00 32.79 ? 115  ARG A CD  1 
ATOM   919  N  NE  . ARG A 1 115 ? 54.329 33.261 60.767  1.00 39.68 ? 115  ARG A NE  1 
ATOM   920  C  CZ  . ARG A 1 115 ? 53.136 33.848 60.688  1.00 41.19 ? 115  ARG A CZ  1 
ATOM   921  N  NH1 . ARG A 1 115 ? 52.028 33.222 60.189  1.00 42.82 ? 115  ARG A NH1 1 
ATOM   922  N  NH2 . ARG A 1 115 ? 53.075 35.121 61.077  1.00 43.37 ? 115  ARG A NH2 1 
ATOM   923  N  N   . ALA A 1 116 ? 53.321 28.923 64.142  1.00 14.61 ? 116  ALA A N   1 
ATOM   924  C  CA  . ALA A 1 116 ? 52.649 29.247 65.388  1.00 11.27 ? 116  ALA A CA  1 
ATOM   925  C  C   . ALA A 1 116 ? 53.329 28.531 66.533  1.00 11.42 ? 116  ALA A C   1 
ATOM   926  O  O   . ALA A 1 116 ? 53.430 29.080 67.640  1.00 13.38 ? 116  ALA A O   1 
ATOM   927  C  CB  . ALA A 1 116 ? 51.196 28.792 65.364  1.00 13.24 ? 116  ALA A CB  1 
ATOM   928  N  N   . LYS A 1 117 ? 53.804 27.288 66.351  1.00 12.46 ? 117  LYS A N   1 
ATOM   929  C  CA  . LYS A 1 117 ? 54.495 26.594 67.429  1.00 14.91 ? 117  LYS A CA  1 
ATOM   930  C  C   . LYS A 1 117 ? 55.799 27.285 67.858  1.00 21.08 ? 117  LYS A C   1 
ATOM   931  O  O   . LYS A 1 117 ? 56.202 27.278 69.036  1.00 20.10 ? 117  LYS A O   1 
ATOM   932  C  CB  . LYS A 1 117 ? 54.776 25.191 66.989  1.00 15.20 ? 117  LYS A CB  1 
ATOM   933  C  CG  . LYS A 1 117 ? 53.482 24.409 66.968  1.00 17.64 ? 117  LYS A CG  1 
ATOM   934  C  CD  . LYS A 1 117 ? 53.882 23.014 66.596  1.00 21.49 ? 117  LYS A CD  1 
ATOM   935  C  CE  . LYS A 1 117 ? 52.650 22.148 66.708  1.00 25.96 ? 117  LYS A CE  1 
ATOM   936  N  NZ  . LYS A 1 117 ? 52.870 20.822 66.161  1.00 28.71 ? 117  LYS A NZ  1 
ATOM   937  N  N   . ASP A 1 118 ? 56.443 27.930 66.882  1.00 22.95 ? 118  ASP A N   1 
ATOM   938  C  CA  . ASP A 1 118 ? 57.647 28.683 67.160  1.00 26.39 ? 118  ASP A CA  1 
ATOM   939  C  C   . ASP A 1 118 ? 57.302 30.008 67.840  1.00 22.15 ? 118  ASP A C   1 
ATOM   940  O  O   . ASP A 1 118 ? 57.648 30.247 69.004  1.00 23.91 ? 118  ASP A O   1 
ATOM   941  C  CB  . ASP A 1 118 ? 58.393 28.874 65.822  1.00 31.83 ? 118  ASP A CB  1 
ATOM   942  C  CG  . ASP A 1 118 ? 59.679 29.668 65.987  1.00 38.54 ? 118  ASP A CG  1 
ATOM   943  O  OD1 . ASP A 1 118 ? 60.425 29.440 66.948  1.00 41.05 ? 118  ASP A OD1 1 
ATOM   944  O  OD2 . ASP A 1 118 ? 59.944 30.500 65.121  1.00 42.24 ? 118  ASP A OD2 1 
ATOM   945  N  N   . ILE A 1 119 ? 56.519 30.850 67.177  1.00 20.19 ? 119  ILE A N   1 
ATOM   946  C  CA  . ILE A 1 119 ? 56.051 32.122 67.720  1.00 19.66 ? 119  ILE A CA  1 
ATOM   947  C  C   . ILE A 1 119 ? 55.389 32.027 69.110  1.00 19.46 ? 119  ILE A C   1 
ATOM   948  O  O   . ILE A 1 119 ? 55.595 32.892 69.984  1.00 16.49 ? 119  ILE A O   1 
ATOM   949  C  CB  . ILE A 1 119 ? 55.079 32.706 66.669  1.00 22.17 ? 119  ILE A CB  1 
ATOM   950  C  CG1 . ILE A 1 119 ? 55.887 33.145 65.473  1.00 24.16 ? 119  ILE A CG1 1 
ATOM   951  C  CG2 . ILE A 1 119 ? 54.260 33.874 67.228  1.00 24.33 ? 119  ILE A CG2 1 
ATOM   952  C  CD1 . ILE A 1 119 ? 54.931 33.543 64.314  1.00 24.05 ? 119  ILE A CD1 1 
ATOM   953  N  N   . ASN A 1 120 ? 54.542 31.005 69.361  1.00 17.46 ? 120  ASN A N   1 
ATOM   954  C  CA  . ASN A 1 120 ? 53.751 30.970 70.593  1.00 14.83 ? 120  ASN A CA  1 
ATOM   955  C  C   . ASN A 1 120 ? 54.285 30.014 71.609  1.00 16.01 ? 120  ASN A C   1 
ATOM   956  O  O   . ASN A 1 120 ? 53.600 29.728 72.584  1.00 16.54 ? 120  ASN A O   1 
ATOM   957  C  CB  . ASN A 1 120 ? 52.278 30.604 70.306  1.00 14.13 ? 120  ASN A CB  1 
ATOM   958  C  CG  . ASN A 1 120 ? 51.611 31.682 69.470  1.00 12.68 ? 120  ASN A CG  1 
ATOM   959  O  OD1 . ASN A 1 120 ? 51.586 32.868 69.840  1.00 15.58 ? 120  ASN A OD1 1 
ATOM   960  N  ND2 . ASN A 1 120 ? 51.112 31.328 68.307  1.00 9.53  ? 120  ASN A ND2 1 
ATOM   961  N  N   . GLN A 1 121 ? 55.553 29.589 71.479  1.00 19.11 ? 121  GLN A N   1 
ATOM   962  C  CA  . GLN A 1 121 ? 56.144 28.584 72.345  1.00 21.30 ? 121  GLN A CA  1 
ATOM   963  C  C   . GLN A 1 121 ? 55.989 28.821 73.834  1.00 16.29 ? 121  GLN A C   1 
ATOM   964  O  O   . GLN A 1 121 ? 55.671 27.930 74.617  1.00 16.50 ? 121  GLN A O   1 
ATOM   965  C  CB  . GLN A 1 121 ? 57.632 28.449 72.054  1.00 29.38 ? 121  GLN A CB  1 
ATOM   966  C  CG  . GLN A 1 121 ? 57.991 27.023 72.457  1.00 42.43 ? 121  GLN A CG  1 
ATOM   967  C  CD  . GLN A 1 121 ? 59.299 26.911 73.228  1.00 50.49 ? 121  GLN A CD  1 
ATOM   968  O  OE1 . GLN A 1 121 ? 60.261 27.660 73.005  1.00 55.08 ? 121  GLN A OE1 1 
ATOM   969  N  NE2 . GLN A 1 121 ? 59.386 26.023 74.215  1.00 53.84 ? 121  GLN A NE2 1 
ATOM   970  N  N   . GLU A 1 122 ? 56.187 30.069 74.223  1.00 14.94 ? 122  GLU A N   1 
ATOM   971  C  CA  . GLU A 1 122 ? 56.090 30.496 75.616  1.00 14.01 ? 122  GLU A CA  1 
ATOM   972  C  C   . GLU A 1 122 ? 54.710 30.214 76.206  1.00 14.04 ? 122  GLU A C   1 
ATOM   973  O  O   . GLU A 1 122 ? 54.551 29.696 77.318  1.00 18.23 ? 122  GLU A O   1 
ATOM   974  C  CB  . GLU A 1 122 ? 56.394 32.008 75.711  1.00 11.64 ? 122  GLU A CB  1 
ATOM   975  C  CG  . GLU A 1 122 ? 56.532 32.473 77.159  1.00 11.10 ? 122  GLU A CG  1 
ATOM   976  C  CD  . GLU A 1 122 ? 56.567 33.969 77.407  1.00 15.42 ? 122  GLU A CD  1 
ATOM   977  O  OE1 . GLU A 1 122 ? 56.544 34.739 76.454  1.00 16.92 ? 122  GLU A OE1 1 
ATOM   978  O  OE2 . GLU A 1 122 ? 56.627 34.372 78.569  1.00 18.55 ? 122  GLU A OE2 1 
ATOM   979  N  N   . VAL A 1 123 ? 53.697 30.507 75.403  1.00 14.87 ? 123  VAL A N   1 
ATOM   980  C  CA  . VAL A 1 123 ? 52.312 30.326 75.816  1.00 16.56 ? 123  VAL A CA  1 
ATOM   981  C  C   . VAL A 1 123 ? 51.895 28.854 75.839  1.00 14.29 ? 123  VAL A C   1 
ATOM   982  O  O   . VAL A 1 123 ? 51.326 28.361 76.829  1.00 14.90 ? 123  VAL A O   1 
ATOM   983  C  CB  . VAL A 1 123 ? 51.479 31.185 74.850  1.00 16.62 ? 123  VAL A CB  1 
ATOM   984  C  CG1 . VAL A 1 123 ? 50.021 30.834 74.987  1.00 18.79 ? 123  VAL A CG1 1 
ATOM   985  C  CG2 . VAL A 1 123 ? 51.654 32.660 75.202  1.00 16.32 ? 123  VAL A CG2 1 
ATOM   986  N  N   . TYR A 1 124 ? 52.196 28.139 74.749  1.00 13.13 ? 124  TYR A N   1 
ATOM   987  C  CA  . TYR A 1 124 ? 51.853 26.733 74.681  1.00 12.32 ? 124  TYR A CA  1 
ATOM   988  C  C   . TYR A 1 124 ? 52.578 25.999 75.777  1.00 14.62 ? 124  TYR A C   1 
ATOM   989  O  O   . TYR A 1 124 ? 52.007 25.089 76.378  1.00 15.96 ? 124  TYR A O   1 
ATOM   990  C  CB  . TYR A 1 124 ? 52.248 26.136 73.362  1.00 11.82 ? 124  TYR A CB  1 
ATOM   991  C  CG  . TYR A 1 124 ? 51.496 26.700 72.174  1.00 15.19 ? 124  TYR A CG  1 
ATOM   992  C  CD1 . TYR A 1 124 ? 50.186 27.189 72.299  1.00 14.87 ? 124  TYR A CD1 1 
ATOM   993  C  CD2 . TYR A 1 124 ? 52.137 26.677 70.942  1.00 13.28 ? 124  TYR A CD2 1 
ATOM   994  C  CE1 . TYR A 1 124 ? 49.530 27.646 71.174  1.00 13.48 ? 124  TYR A CE1 1 
ATOM   995  C  CE2 . TYR A 1 124 ? 51.485 27.133 69.815  1.00 15.48 ? 124  TYR A CE2 1 
ATOM   996  C  CZ  . TYR A 1 124 ? 50.181 27.611 69.952  1.00 15.14 ? 124  TYR A CZ  1 
ATOM   997  O  OH  . TYR A 1 124 ? 49.518 28.032 68.830  1.00 15.22 ? 124  TYR A OH  1 
ATOM   998  N  N   . ASN A 1 125 ? 53.800 26.425 76.111  1.00 15.20 ? 125  ASN A N   1 
ATOM   999  C  CA  . ASN A 1 125 ? 54.560 25.827 77.190  1.00 16.12 ? 125  ASN A CA  1 
ATOM   1000 C  C   . ASN A 1 125 ? 53.930 26.073 78.526  1.00 13.20 ? 125  ASN A C   1 
ATOM   1001 O  O   . ASN A 1 125 ? 53.857 25.198 79.376  1.00 13.45 ? 125  ASN A O   1 
ATOM   1002 C  CB  . ASN A 1 125 ? 55.951 26.394 77.285  1.00 25.31 ? 125  ASN A CB  1 
ATOM   1003 C  CG  . ASN A 1 125 ? 56.921 25.269 77.109  1.00 32.24 ? 125  ASN A CG  1 
ATOM   1004 O  OD1 . ASN A 1 125 ? 57.384 25.020 75.982  1.00 35.79 ? 125  ASN A OD1 1 
ATOM   1005 N  ND2 . ASN A 1 125 ? 57.184 24.562 78.213  1.00 33.58 ? 125  ASN A ND2 1 
ATOM   1006 N  N   . PHE A 1 126 ? 53.492 27.309 78.748  1.00 13.55 ? 126  PHE A N   1 
ATOM   1007 C  CA  . PHE A 1 126 ? 52.799 27.656 79.965  1.00 13.07 ? 126  PHE A CA  1 
ATOM   1008 C  C   . PHE A 1 126 ? 51.521 26.799 80.080  1.00 12.19 ? 126  PHE A C   1 
ATOM   1009 O  O   . PHE A 1 126 ? 51.243 26.189 81.123  1.00 14.14 ? 126  PHE A O   1 
ATOM   1010 C  CB  . PHE A 1 126 ? 52.486 29.164 79.911  1.00 12.15 ? 126  PHE A CB  1 
ATOM   1011 C  CG  . PHE A 1 126 ? 51.571 29.574 81.058  1.00 12.42 ? 126  PHE A CG  1 
ATOM   1012 C  CD1 . PHE A 1 126 ? 52.066 29.744 82.319  1.00 11.31 ? 126  PHE A CD1 1 
ATOM   1013 C  CD2 . PHE A 1 126 ? 50.220 29.721 80.824  1.00 14.74 ? 126  PHE A CD2 1 
ATOM   1014 C  CE1 . PHE A 1 126 ? 51.207 30.063 83.351  1.00 15.99 ? 126  PHE A CE1 1 
ATOM   1015 C  CE2 . PHE A 1 126 ? 49.362 30.039 81.865  1.00 16.81 ? 126  PHE A CE2 1 
ATOM   1016 C  CZ  . PHE A 1 126 ? 49.854 30.209 83.132  1.00 16.37 ? 126  PHE A CZ  1 
ATOM   1017 N  N   . LEU A 1 127 ? 50.717 26.694 79.031  1.00 10.20 ? 127  LEU A N   1 
ATOM   1018 C  CA  . LEU A 1 127 ? 49.480 25.930 79.174  1.00 12.81 ? 127  LEU A CA  1 
ATOM   1019 C  C   . LEU A 1 127 ? 49.711 24.425 79.351  1.00 12.91 ? 127  LEU A C   1 
ATOM   1020 O  O   . LEU A 1 127 ? 49.078 23.828 80.232  1.00 13.27 ? 127  LEU A O   1 
ATOM   1021 C  CB  . LEU A 1 127 ? 48.606 26.223 77.964  1.00 10.21 ? 127  LEU A CB  1 
ATOM   1022 C  CG  . LEU A 1 127 ? 48.009 27.623 77.898  1.00 9.48  ? 127  LEU A CG  1 
ATOM   1023 C  CD1 . LEU A 1 127 ? 47.485 27.818 76.478  1.00 8.72  ? 127  LEU A CD1 1 
ATOM   1024 C  CD2 . LEU A 1 127 ? 47.013 27.848 79.007  1.00 7.36  ? 127  LEU A CD2 1 
ATOM   1025 N  N   . ALA A 1 128 ? 50.656 23.790 78.642  1.00 12.26 ? 128  ALA A N   1 
ATOM   1026 C  CA  . ALA A 1 128 ? 50.963 22.371 78.845  1.00 12.15 ? 128  ALA A CA  1 
ATOM   1027 C  C   . ALA A 1 128 ? 51.473 22.091 80.245  1.00 13.82 ? 128  ALA A C   1 
ATOM   1028 O  O   . ALA A 1 128 ? 51.086 21.117 80.905  1.00 15.62 ? 128  ALA A O   1 
ATOM   1029 C  CB  . ALA A 1 128 ? 52.010 21.922 77.815  1.00 10.96 ? 128  ALA A CB  1 
ATOM   1030 N  N   . THR A 1 129 ? 52.260 23.001 80.807  1.00 14.57 ? 129  THR A N   1 
ATOM   1031 C  CA  . THR A 1 129 ? 52.810 22.801 82.133  1.00 16.80 ? 129  THR A CA  1 
ATOM   1032 C  C   . THR A 1 129 ? 51.785 23.010 83.227  1.00 16.03 ? 129  THR A C   1 
ATOM   1033 O  O   . THR A 1 129 ? 51.776 22.290 84.231  1.00 16.99 ? 129  THR A O   1 
ATOM   1034 C  CB  . THR A 1 129 ? 54.003 23.782 82.346  1.00 19.21 ? 129  THR A CB  1 
ATOM   1035 O  OG1 . THR A 1 129 ? 54.933 23.491 81.319  1.00 22.81 ? 129  THR A OG1 1 
ATOM   1036 C  CG2 . THR A 1 129 ? 54.695 23.615 83.662  1.00 20.43 ? 129  THR A CG2 1 
ATOM   1037 N  N   . ALA A 1 130 ? 50.981 24.069 83.094  1.00 15.16 ? 130  ALA A N   1 
ATOM   1038 C  CA  . ALA A 1 130 ? 49.952 24.313 84.078  1.00 16.66 ? 130  ALA A CA  1 
ATOM   1039 C  C   . ALA A 1 130 ? 48.939 23.167 83.963  1.00 15.22 ? 130  ALA A C   1 
ATOM   1040 O  O   . ALA A 1 130 ? 48.439 22.690 84.979  1.00 15.19 ? 130  ALA A O   1 
ATOM   1041 C  CB  . ALA A 1 130 ? 49.305 25.696 83.795  1.00 17.15 ? 130  ALA A CB  1 
ATOM   1042 N  N   . GLY A 1 131 ? 48.726 22.635 82.756  1.00 15.95 ? 131  GLY A N   1 
ATOM   1043 C  CA  . GLY A 1 131 ? 47.851 21.494 82.519  1.00 16.85 ? 131  GLY A CA  1 
ATOM   1044 C  C   . GLY A 1 131 ? 48.346 20.251 83.245  1.00 18.86 ? 131  GLY A C   1 
ATOM   1045 O  O   . GLY A 1 131 ? 47.610 19.667 84.057  1.00 20.81 ? 131  GLY A O   1 
ATOM   1046 N  N   . ALA A 1 132 ? 49.619 19.870 83.035  1.00 17.01 ? 132  ALA A N   1 
ATOM   1047 C  CA  . ALA A 1 132 ? 50.229 18.731 83.721  1.00 17.39 ? 132  ALA A CA  1 
ATOM   1048 C  C   . ALA A 1 132 ? 50.170 18.819 85.255  1.00 18.05 ? 132  ALA A C   1 
ATOM   1049 O  O   . ALA A 1 132 ? 49.825 17.842 85.946  1.00 22.31 ? 132  ALA A O   1 
ATOM   1050 C  CB  . ALA A 1 132 ? 51.715 18.570 83.290  1.00 12.57 ? 132  ALA A CB  1 
ATOM   1051 N  N   . LYS A 1 133 ? 50.407 20.016 85.786  1.00 17.40 ? 133  LYS A N   1 
ATOM   1052 C  CA  . LYS A 1 133 ? 50.441 20.231 87.214  1.00 14.38 ? 133  LYS A CA  1 
ATOM   1053 C  C   . LYS A 1 133 ? 49.078 20.147 87.863  1.00 14.93 ? 133  LYS A C   1 
ATOM   1054 O  O   . LYS A 1 133 ? 48.952 19.542 88.914  1.00 15.90 ? 133  LYS A O   1 
ATOM   1055 C  CB  . LYS A 1 133 ? 51.045 21.593 87.491  1.00 16.88 ? 133  LYS A CB  1 
ATOM   1056 C  CG  . LYS A 1 133 ? 51.052 21.916 88.966  1.00 20.88 ? 133  LYS A CG  1 
ATOM   1057 C  CD  . LYS A 1 133 ? 51.647 23.269 89.198  1.00 25.04 ? 133  LYS A CD  1 
ATOM   1058 C  CE  . LYS A 1 133 ? 52.077 23.422 90.647  1.00 26.49 ? 133  LYS A CE  1 
ATOM   1059 N  NZ  . LYS A 1 133 ? 53.056 22.375 90.941  1.00 34.25 ? 133  LYS A NZ  1 
ATOM   1060 N  N   . TYR A 1 134 ? 48.030 20.754 87.292  1.00 17.29 ? 134  TYR A N   1 
ATOM   1061 C  CA  . TYR A 1 134 ? 46.699 20.825 87.931  1.00 15.56 ? 134  TYR A CA  1 
ATOM   1062 C  C   . TYR A 1 134 ? 45.690 19.762 87.486  1.00 16.03 ? 134  TYR A C   1 
ATOM   1063 O  O   . TYR A 1 134 ? 44.531 19.650 87.922  1.00 17.63 ? 134  TYR A O   1 
ATOM   1064 C  CB  . TYR A 1 134 ? 46.176 22.233 87.679  1.00 16.72 ? 134  TYR A CB  1 
ATOM   1065 C  CG  . TYR A 1 134 ? 47.034 23.295 88.336  1.00 16.21 ? 134  TYR A CG  1 
ATOM   1066 C  CD1 . TYR A 1 134 ? 47.032 23.355 89.716  1.00 16.50 ? 134  TYR A CD1 1 
ATOM   1067 C  CD2 . TYR A 1 134 ? 47.788 24.177 87.567  1.00 16.43 ? 134  TYR A CD2 1 
ATOM   1068 C  CE1 . TYR A 1 134 ? 47.796 24.325 90.349  1.00 19.83 ? 134  TYR A CE1 1 
ATOM   1069 C  CE2 . TYR A 1 134 ? 48.550 25.141 88.193  1.00 16.47 ? 134  TYR A CE2 1 
ATOM   1070 C  CZ  . TYR A 1 134 ? 48.541 25.204 89.576  1.00 20.39 ? 134  TYR A CZ  1 
ATOM   1071 O  OH  . TYR A 1 134 ? 49.285 26.187 90.210  1.00 21.46 ? 134  TYR A OH  1 
ATOM   1072 N  N   . GLY A 1 135 ? 46.169 18.940 86.562  1.00 16.20 ? 135  GLY A N   1 
ATOM   1073 C  CA  . GLY A 1 135 ? 45.452 17.780 86.114  1.00 15.80 ? 135  GLY A CA  1 
ATOM   1074 C  C   . GLY A 1 135 ? 44.471 18.149 85.034  1.00 19.37 ? 135  GLY A C   1 
ATOM   1075 O  O   . GLY A 1 135 ? 43.376 17.590 85.076  1.00 20.41 ? 135  GLY A O   1 
ATOM   1076 N  N   . VAL A 1 136 ? 44.840 19.007 84.073  1.00 16.11 ? 136  VAL A N   1 
ATOM   1077 C  CA  . VAL A 1 136 ? 43.957 19.403 83.006  1.00 13.85 ? 136  VAL A CA  1 
ATOM   1078 C  C   . VAL A 1 136 ? 44.442 18.749 81.724  1.00 12.43 ? 136  VAL A C   1 
ATOM   1079 O  O   . VAL A 1 136 ? 45.625 18.829 81.447  1.00 14.60 ? 136  VAL A O   1 
ATOM   1080 C  CB  . VAL A 1 136 ? 43.980 20.953 82.931  1.00 14.13 ? 136  VAL A CB  1 
ATOM   1081 C  CG1 . VAL A 1 136 ? 43.146 21.413 81.755  1.00 9.82  ? 136  VAL A CG1 1 
ATOM   1082 C  CG2 . VAL A 1 136 ? 43.508 21.556 84.248  1.00 11.98 ? 136  VAL A CG2 1 
ATOM   1083 N  N   . GLY A 1 137 ? 43.606 18.067 80.941  1.00 12.42 ? 137  GLY A N   1 
ATOM   1084 C  CA  . GLY A 1 137 ? 43.991 17.482 79.663  1.00 12.79 ? 137  GLY A CA  1 
ATOM   1085 C  C   . GLY A 1 137 ? 44.359 18.579 78.669  1.00 12.75 ? 137  GLY A C   1 
ATOM   1086 O  O   . GLY A 1 137 ? 43.761 19.665 78.681  1.00 12.54 ? 137  GLY A O   1 
ATOM   1087 N  N   . PHE A 1 138 ? 45.262 18.312 77.726  1.00 11.94 ? 138  PHE A N   1 
ATOM   1088 C  CA  . PHE A 1 138 ? 45.781 19.345 76.845  1.00 11.71 ? 138  PHE A CA  1 
ATOM   1089 C  C   . PHE A 1 138 ? 45.714 18.848 75.421  1.00 12.04 ? 138  PHE A C   1 
ATOM   1090 O  O   . PHE A 1 138 ? 46.297 17.807 75.084  1.00 14.95 ? 138  PHE A O   1 
ATOM   1091 C  CB  . PHE A 1 138 ? 47.263 19.675 77.299  1.00 14.13 ? 138  PHE A CB  1 
ATOM   1092 C  CG  . PHE A 1 138 ? 48.016 20.746 76.509  1.00 13.52 ? 138  PHE A CG  1 
ATOM   1093 C  CD1 . PHE A 1 138 ? 47.781 22.084 76.769  1.00 14.20 ? 138  PHE A CD1 1 
ATOM   1094 C  CD2 . PHE A 1 138 ? 48.884 20.388 75.499  1.00 13.94 ? 138  PHE A CD2 1 
ATOM   1095 C  CE1 . PHE A 1 138 ? 48.416 23.051 76.007  1.00 15.55 ? 138  PHE A CE1 1 
ATOM   1096 C  CE2 . PHE A 1 138 ? 49.508 21.367 74.746  1.00 12.29 ? 138  PHE A CE2 1 
ATOM   1097 C  CZ  . PHE A 1 138 ? 49.273 22.697 74.998  1.00 11.55 ? 138  PHE A CZ  1 
ATOM   1098 N  N   . TRP A 1 139 ? 45.016 19.588 74.564  1.00 10.42 ? 139  TRP A N   1 
ATOM   1099 C  CA  . TRP A 1 139 ? 44.936 19.261 73.174  1.00 11.88 ? 139  TRP A CA  1 
ATOM   1100 C  C   . TRP A 1 139 ? 45.870 20.273 72.528  1.00 14.29 ? 139  TRP A C   1 
ATOM   1101 O  O   . TRP A 1 139 ? 45.662 21.484 72.591  1.00 12.94 ? 139  TRP A O   1 
ATOM   1102 C  CB  . TRP A 1 139 ? 43.496 19.414 72.667  1.00 10.13 ? 139  TRP A CB  1 
ATOM   1103 C  CG  . TRP A 1 139 ? 42.614 18.260 73.123  1.00 10.39 ? 139  TRP A CG  1 
ATOM   1104 C  CD1 . TRP A 1 139 ? 42.044 18.297 74.373  1.00 7.10  ? 139  TRP A CD1 1 
ATOM   1105 C  CD2 . TRP A 1 139 ? 42.269 17.123 72.386  1.00 10.24 ? 139  TRP A CD2 1 
ATOM   1106 N  NE1 . TRP A 1 139 ? 41.330 17.193 74.449  1.00 9.62  ? 139  TRP A NE1 1 
ATOM   1107 C  CE2 . TRP A 1 139 ? 41.441 16.447 73.286  1.00 10.81 ? 139  TRP A CE2 1 
ATOM   1108 C  CE3 . TRP A 1 139 ? 42.545 16.581 71.138  1.00 7.58  ? 139  TRP A CE3 1 
ATOM   1109 C  CZ2 . TRP A 1 139 ? 40.845 15.236 72.922  1.00 6.80  ? 139  TRP A CZ2 1 
ATOM   1110 C  CZ3 . TRP A 1 139 ? 41.940 15.381 70.785  1.00 8.29  ? 139  TRP A CZ3 1 
ATOM   1111 C  CH2 . TRP A 1 139 ? 41.118 14.703 71.678  1.00 8.14  ? 139  TRP A CH2 1 
ATOM   1112 N  N   . ARG A 1 140 ? 46.936 19.728 71.946  1.00 17.35 ? 140  ARG A N   1 
ATOM   1113 C  CA  . ARG A 1 140 ? 48.045 20.455 71.335  1.00 16.94 ? 140  ARG A CA  1 
ATOM   1114 C  C   . ARG A 1 140 ? 47.630 21.275 70.129  1.00 16.63 ? 140  ARG A C   1 
ATOM   1115 O  O   . ARG A 1 140 ? 46.624 20.927 69.493  1.00 15.79 ? 140  ARG A O   1 
ATOM   1116 C  CB  . ARG A 1 140 ? 49.152 19.447 70.922  1.00 16.83 ? 140  ARG A CB  1 
ATOM   1117 C  CG  . ARG A 1 140 ? 49.668 18.795 72.191  1.00 24.07 ? 140  ARG A CG  1 
ATOM   1118 C  CD  . ARG A 1 140 ? 50.891 17.884 72.069  1.00 31.30 ? 140  ARG A CD  1 
ATOM   1119 N  NE  . ARG A 1 140 ? 50.565 16.665 71.321  1.00 39.65 ? 140  ARG A NE  1 
ATOM   1120 C  CZ  . ARG A 1 140 ? 50.736 15.400 71.802  1.00 42.37 ? 140  ARG A CZ  1 
ATOM   1121 N  NH1 . ARG A 1 140 ? 51.198 15.211 73.060  1.00 42.67 ? 140  ARG A NH1 1 
ATOM   1122 N  NH2 . ARG A 1 140 ? 50.462 14.334 70.995  1.00 40.50 ? 140  ARG A NH2 1 
ATOM   1123 N  N   . PRO A 1 141 ? 48.361 22.329 69.703  1.00 15.80 ? 141  PRO A N   1 
ATOM   1124 C  CA  . PRO A 1 141 ? 48.051 23.074 68.494  1.00 14.29 ? 141  PRO A CA  1 
ATOM   1125 C  C   . PRO A 1 141 ? 47.978 22.165 67.306  1.00 12.49 ? 141  PRO A C   1 
ATOM   1126 O  O   . PRO A 1 141 ? 48.801 21.256 67.152  1.00 12.34 ? 141  PRO A O   1 
ATOM   1127 C  CB  . PRO A 1 141 ? 49.137 24.136 68.389  1.00 14.77 ? 141  PRO A CB  1 
ATOM   1128 C  CG  . PRO A 1 141 ? 50.193 23.729 69.361  1.00 14.15 ? 141  PRO A CG  1 
ATOM   1129 C  CD  . PRO A 1 141 ? 49.435 22.990 70.441  1.00 15.18 ? 141  PRO A CD  1 
ATOM   1130 N  N   . GLY A 1 142 ? 47.002 22.432 66.453  1.00 10.29 ? 142  GLY A N   1 
ATOM   1131 C  CA  . GLY A 1 142 ? 46.746 21.562 65.314  1.00 11.77 ? 142  GLY A CA  1 
ATOM   1132 C  C   . GLY A 1 142 ? 45.597 20.586 65.583  1.00 10.34 ? 142  GLY A C   1 
ATOM   1133 O  O   . GLY A 1 142 ? 44.981 20.135 64.623  1.00 11.88 ? 142  GLY A O   1 
ATOM   1134 N  N   . SER A 1 143 ? 45.237 20.289 66.838  1.00 10.32 ? 143  SER A N   1 
ATOM   1135 C  CA  . SER A 1 143 ? 44.170 19.341 67.127  1.00 12.29 ? 143  SER A CA  1 
ATOM   1136 C  C   . SER A 1 143 ? 42.813 19.723 66.589  1.00 11.08 ? 143  SER A C   1 
ATOM   1137 O  O   . SER A 1 143 ? 42.099 18.839 66.121  1.00 14.34 ? 143  SER A O   1 
ATOM   1138 C  CB  . SER A 1 143 ? 44.109 19.136 68.657  1.00 7.72  ? 143  SER A CB  1 
ATOM   1139 O  OG  . SER A 1 143 ? 43.936 20.376 69.312  1.00 15.30 ? 143  SER A OG  1 
ATOM   1140 N  N   . GLY A 1 144 ? 42.428 21.010 66.651  1.00 13.70 ? 144  GLY A N   1 
ATOM   1141 C  CA  . GLY A 1 144 ? 41.184 21.479 66.095  1.00 12.48 ? 144  GLY A CA  1 
ATOM   1142 C  C   . GLY A 1 144 ? 40.581 22.556 66.976  1.00 12.46 ? 144  GLY A C   1 
ATOM   1143 O  O   . GLY A 1 144 ? 41.054 22.768 68.104  1.00 10.97 ? 144  GLY A O   1 
ATOM   1144 N  N   . ILE A 1 145 ? 39.490 23.124 66.430  1.00 13.74 ? 145  ILE A N   1 
ATOM   1145 C  CA  . ILE A 1 145 ? 38.718 24.173 67.111  1.00 12.14 ? 145  ILE A CA  1 
ATOM   1146 C  C   . ILE A 1 145 ? 38.033 23.535 68.303  1.00 9.01  ? 145  ILE A C   1 
ATOM   1147 O  O   . ILE A 1 145 ? 37.506 22.441 68.182  1.00 11.24 ? 145  ILE A O   1 
ATOM   1148 C  CB  . ILE A 1 145 ? 37.684 24.811 66.150  1.00 12.65 ? 145  ILE A CB  1 
ATOM   1149 C  CG1 . ILE A 1 145 ? 38.449 25.444 64.998  1.00 10.87 ? 145  ILE A CG1 1 
ATOM   1150 C  CG2 . ILE A 1 145 ? 36.853 25.898 66.848  1.00 7.21  ? 145  ILE A CG2 1 
ATOM   1151 C  CD1 . ILE A 1 145 ? 37.548 25.809 63.823  1.00 12.38 ? 145  ILE A CD1 1 
ATOM   1152 N  N   . ILE A 1 146 ? 38.014 24.185 69.457  1.00 7.34  ? 146  ILE A N   1 
ATOM   1153 C  CA  . ILE A 1 146 ? 37.534 23.635 70.681  1.00 7.98  ? 146  ILE A CA  1 
ATOM   1154 C  C   . ILE A 1 146 ? 36.172 22.947 70.554  1.00 11.57 ? 146  ILE A C   1 
ATOM   1155 O  O   . ILE A 1 146 ? 36.009 21.840 71.051  1.00 11.34 ? 146  ILE A O   1 
ATOM   1156 C  CB  . ILE A 1 146 ? 37.523 24.783 71.735  1.00 6.12  ? 146  ILE A CB  1 
ATOM   1157 C  CG1 . ILE A 1 146 ? 36.958 24.171 73.003  1.00 4.46  ? 146  ILE A CG1 1 
ATOM   1158 C  CG2 . ILE A 1 146 ? 36.747 26.026 71.322  1.00 3.57  ? 146  ILE A CG2 1 
ATOM   1159 C  CD1 . ILE A 1 146 ? 36.821 25.112 74.175  1.00 4.09  ? 146  ILE A CD1 1 
ATOM   1160 N  N   . HIS A 1 147 ? 35.214 23.522 69.825  1.00 10.38 ? 147  HIS A N   1 
ATOM   1161 C  CA  . HIS A 1 147 ? 33.885 22.977 69.856  1.00 9.57  ? 147  HIS A CA  1 
ATOM   1162 C  C   . HIS A 1 147 ? 33.740 21.709 69.056  1.00 9.44  ? 147  HIS A C   1 
ATOM   1163 O  O   . HIS A 1 147 ? 32.955 20.844 69.450  1.00 10.92 ? 147  HIS A O   1 
ATOM   1164 C  CB  . HIS A 1 147 ? 32.897 24.123 69.396  1.00 8.75  ? 147  HIS A CB  1 
ATOM   1165 C  CG  . HIS A 1 147 ? 32.973 25.290 70.357  1.00 5.84  ? 147  HIS A CG  1 
ATOM   1166 N  ND1 . HIS A 1 147 ? 32.968 25.269 71.715  1.00 6.81  ? 147  HIS A ND1 1 
ATOM   1167 C  CD2 . HIS A 1 147 ? 33.214 26.573 69.941  1.00 6.24  ? 147  HIS A CD2 1 
ATOM   1168 C  CE1 . HIS A 1 147 ? 33.217 26.483 72.115  1.00 3.16  ? 147  HIS A CE1 1 
ATOM   1169 N  NE2 . HIS A 1 147 ? 33.354 27.227 71.059  1.00 5.97  ? 147  HIS A NE2 1 
ATOM   1170 N  N   . GLN A 1 148 ? 34.534 21.542 67.989  1.00 9.20  ? 148  GLN A N   1 
ATOM   1171 C  CA  . GLN A 1 148 ? 34.531 20.372 67.152  1.00 9.12  ? 148  GLN A CA  1 
ATOM   1172 C  C   . GLN A 1 148 ? 35.177 19.243 67.930  1.00 10.01 ? 148  GLN A C   1 
ATOM   1173 O  O   . GLN A 1 148 ? 34.642 18.151 67.922  1.00 11.73 ? 148  GLN A O   1 
ATOM   1174 C  CB  . GLN A 1 148 ? 35.288 20.717 65.923  1.00 9.79  ? 148  GLN A CB  1 
ATOM   1175 C  CG  . GLN A 1 148 ? 34.841 19.845 64.789  1.00 14.39 ? 148  GLN A CG  1 
ATOM   1176 C  CD  . GLN A 1 148 ? 33.438 20.079 64.236  1.00 14.89 ? 148  GLN A CD  1 
ATOM   1177 O  OE1 . GLN A 1 148 ? 33.173 20.939 63.381  1.00 16.62 ? 148  GLN A OE1 1 
ATOM   1178 N  NE2 . GLN A 1 148 ? 32.493 19.225 64.543  1.00 15.54 ? 148  GLN A NE2 1 
ATOM   1179 N  N   . ILE A 1 149 ? 36.244 19.481 68.695  1.00 9.17  ? 149  ILE A N   1 
ATOM   1180 C  CA  . ILE A 1 149 ? 36.863 18.473 69.550  1.00 9.91  ? 149  ILE A CA  1 
ATOM   1181 C  C   . ILE A 1 149 ? 35.875 18.095 70.652  1.00 11.42 ? 149  ILE A C   1 
ATOM   1182 O  O   . ILE A 1 149 ? 35.802 16.920 71.014  1.00 10.04 ? 149  ILE A O   1 
ATOM   1183 C  CB  . ILE A 1 149 ? 38.197 19.021 70.188  1.00 11.96 ? 149  ILE A CB  1 
ATOM   1184 C  CG1 . ILE A 1 149 ? 39.242 19.249 69.071  1.00 9.49  ? 149  ILE A CG1 1 
ATOM   1185 C  CG2 . ILE A 1 149 ? 38.708 18.073 71.286  1.00 8.72  ? 149  ILE A CG2 1 
ATOM   1186 C  CD1 . ILE A 1 149 ? 39.629 18.007 68.276  1.00 10.19 ? 149  ILE A CD1 1 
ATOM   1187 N  N   . ILE A 1 150 ? 35.122 19.028 71.243  1.00 10.00 ? 150  ILE A N   1 
ATOM   1188 C  CA  . ILE A 1 150 ? 34.144 18.680 72.261  1.00 10.38 ? 150  ILE A CA  1 
ATOM   1189 C  C   . ILE A 1 150 ? 33.044 17.807 71.661  1.00 8.90  ? 150  ILE A C   1 
ATOM   1190 O  O   . ILE A 1 150 ? 32.742 16.787 72.247  1.00 10.18 ? 150  ILE A O   1 
ATOM   1191 C  CB  . ILE A 1 150 ? 33.543 19.974 72.867  1.00 11.64 ? 150  ILE A CB  1 
ATOM   1192 C  CG1 . ILE A 1 150 ? 34.604 20.565 73.794  1.00 11.44 ? 150  ILE A CG1 1 
ATOM   1193 C  CG2 . ILE A 1 150 ? 32.250 19.696 73.675  1.00 9.57  ? 150  ILE A CG2 1 
ATOM   1194 C  CD1 . ILE A 1 150 ? 34.299 21.994 74.253  1.00 12.39 ? 150  ILE A CD1 1 
ATOM   1195 N  N   . LEU A 1 151 ? 32.493 18.096 70.490  1.00 9.61  ? 151  LEU A N   1 
ATOM   1196 C  CA  . LEU A 1 151 ? 31.387 17.320 69.980  1.00 10.30 ? 151  LEU A CA  1 
ATOM   1197 C  C   . LEU A 1 151 ? 31.851 15.918 69.691  1.00 11.32 ? 151  LEU A C   1 
ATOM   1198 O  O   . LEU A 1 151 ? 31.129 14.941 69.970  1.00 12.65 ? 151  LEU A O   1 
ATOM   1199 C  CB  . LEU A 1 151 ? 30.789 17.947 68.685  1.00 8.96  ? 151  LEU A CB  1 
ATOM   1200 C  CG  . LEU A 1 151 ? 29.343 17.554 68.331  1.00 7.21  ? 151  LEU A CG  1 
ATOM   1201 C  CD1 . LEU A 1 151 ? 28.392 18.402 69.134  1.00 3.78  ? 151  LEU A CD1 1 
ATOM   1202 C  CD2 . LEU A 1 151 ? 29.034 17.821 66.880  1.00 7.00  ? 151  LEU A CD2 1 
ATOM   1203 N  N   . GLU A 1 152 ? 33.082 15.834 69.191  1.00 10.54 ? 152  GLU A N   1 
ATOM   1204 C  CA  . GLU A 1 152 ? 33.655 14.552 68.835  1.00 10.86 ? 152  GLU A CA  1 
ATOM   1205 C  C   . GLU A 1 152 ? 34.052 13.702 70.001  1.00 10.42 ? 152  GLU A C   1 
ATOM   1206 O  O   . GLU A 1 152 ? 34.021 12.479 69.883  1.00 11.17 ? 152  GLU A O   1 
ATOM   1207 C  CB  . GLU A 1 152 ? 34.897 14.728 67.957  1.00 12.54 ? 152  GLU A CB  1 
ATOM   1208 C  CG  . GLU A 1 152 ? 34.554 15.262 66.592  1.00 15.43 ? 152  GLU A CG  1 
ATOM   1209 C  CD  . GLU A 1 152 ? 35.694 15.571 65.656  1.00 18.44 ? 152  GLU A CD  1 
ATOM   1210 O  OE1 . GLU A 1 152 ? 36.871 15.517 66.007  1.00 21.39 ? 152  GLU A OE1 1 
ATOM   1211 O  OE2 . GLU A 1 152 ? 35.361 15.889 64.521  1.00 20.96 ? 152  GLU A OE2 1 
ATOM   1212 N  N   . ASN A 1 153 ? 34.295 14.265 71.173  1.00 9.97  ? 153  ASN A N   1 
ATOM   1213 C  CA  . ASN A 1 153 ? 34.916 13.483 72.230  1.00 11.11 ? 153  ASN A CA  1 
ATOM   1214 C  C   . ASN A 1 153 ? 34.297 13.598 73.583  1.00 10.89 ? 153  ASN A C   1 
ATOM   1215 O  O   . ASN A 1 153 ? 34.409 12.663 74.364  1.00 10.15 ? 153  ASN A O   1 
ATOM   1216 C  CB  . ASN A 1 153 ? 36.374 13.875 72.465  1.00 10.76 ? 153  ASN A CB  1 
ATOM   1217 C  CG  . ASN A 1 153 ? 37.283 13.613 71.287  1.00 13.57 ? 153  ASN A CG  1 
ATOM   1218 O  OD1 . ASN A 1 153 ? 37.807 12.515 71.147  1.00 18.83 ? 153  ASN A OD1 1 
ATOM   1219 N  ND2 . ASN A 1 153 ? 37.482 14.546 70.361  1.00 13.15 ? 153  ASN A ND2 1 
ATOM   1220 N  N   . TYR A 1 154 ? 33.694 14.762 73.865  1.00 10.29 ? 154  TYR A N   1 
ATOM   1221 C  CA  . TYR A 1 154 ? 33.234 15.082 75.205  1.00 11.32 ? 154  TYR A CA  1 
ATOM   1222 C  C   . TYR A 1 154 ? 31.754 15.405 75.461  1.00 10.23 ? 154  TYR A C   1 
ATOM   1223 O  O   . TYR A 1 154 ? 31.285 15.354 76.605  1.00 10.44 ? 154  TYR A O   1 
ATOM   1224 C  CB  . TYR A 1 154 ? 34.092 16.236 75.696  1.00 11.98 ? 154  TYR A CB  1 
ATOM   1225 C  CG  . TYR A 1 154 ? 35.579 15.933 75.720  1.00 13.71 ? 154  TYR A CG  1 
ATOM   1226 C  CD1 . TYR A 1 154 ? 36.053 15.036 76.674  1.00 13.10 ? 154  TYR A CD1 1 
ATOM   1227 C  CD2 . TYR A 1 154 ? 36.458 16.608 74.868  1.00 14.85 ? 154  TYR A CD2 1 
ATOM   1228 C  CE1 . TYR A 1 154 ? 37.411 14.790 76.767  1.00 14.96 ? 154  TYR A CE1 1 
ATOM   1229 C  CE2 . TYR A 1 154 ? 37.832 16.354 74.963  1.00 16.25 ? 154  TYR A CE2 1 
ATOM   1230 C  CZ  . TYR A 1 154 ? 38.295 15.470 75.926  1.00 15.29 ? 154  TYR A CZ  1 
ATOM   1231 O  OH  . TYR A 1 154 ? 39.646 15.241 76.105  1.00 14.56 ? 154  TYR A OH  1 
ATOM   1232 N  N   . ALA A 1 155 ? 31.021 15.831 74.441  1.00 8.44  ? 155  ALA A N   1 
ATOM   1233 C  CA  . ALA A 1 155 ? 29.611 16.180 74.589  1.00 10.47 ? 155  ALA A CA  1 
ATOM   1234 C  C   . ALA A 1 155 ? 28.814 14.888 74.467  1.00 8.31  ? 155  ALA A C   1 
ATOM   1235 O  O   . ALA A 1 155 ? 29.124 14.026 73.626  1.00 12.19 ? 155  ALA A O   1 
ATOM   1236 C  CB  . ALA A 1 155 ? 29.207 17.150 73.467  1.00 5.55  ? 155  ALA A CB  1 
ATOM   1237 N  N   . TYR A 1 156 ? 27.893 14.665 75.382  1.00 10.39 ? 156  TYR A N   1 
ATOM   1238 C  CA  . TYR A 1 156 ? 26.947 13.556 75.247  1.00 12.69 ? 156  TYR A CA  1 
ATOM   1239 C  C   . TYR A 1 156 ? 25.552 14.013 75.720  1.00 13.64 ? 156  TYR A C   1 
ATOM   1240 O  O   . TYR A 1 156 ? 25.486 15.054 76.397  1.00 13.43 ? 156  TYR A O   1 
ATOM   1241 C  CB  . TYR A 1 156 ? 27.429 12.363 76.064  1.00 8.37  ? 156  TYR A CB  1 
ATOM   1242 C  CG  . TYR A 1 156 ? 27.677 12.659 77.524  1.00 8.40  ? 156  TYR A CG  1 
ATOM   1243 C  CD1 . TYR A 1 156 ? 26.660 12.550 78.454  1.00 7.63  ? 156  TYR A CD1 1 
ATOM   1244 C  CD2 . TYR A 1 156 ? 28.952 13.000 77.927  1.00 9.60  ? 156  TYR A CD2 1 
ATOM   1245 C  CE1 . TYR A 1 156 ? 26.906 12.778 79.796  1.00 7.69  ? 156  TYR A CE1 1 
ATOM   1246 C  CE2 . TYR A 1 156 ? 29.219 13.222 79.266  1.00 9.02  ? 156  TYR A CE2 1 
ATOM   1247 C  CZ  . TYR A 1 156 ? 28.202 13.102 80.182  1.00 10.40 ? 156  TYR A CZ  1 
ATOM   1248 O  OH  . TYR A 1 156 ? 28.516 13.234 81.527  1.00 12.07 ? 156  TYR A OH  1 
ATOM   1249 N  N   . PRO A 1 157 ? 24.419 13.329 75.446  1.00 13.87 ? 157  PRO A N   1 
ATOM   1250 C  CA  . PRO A 1 157 ? 23.107 13.680 75.998  1.00 10.82 ? 157  PRO A CA  1 
ATOM   1251 C  C   . PRO A 1 157 ? 23.027 13.935 77.510  1.00 9.12  ? 157  PRO A C   1 
ATOM   1252 O  O   . PRO A 1 157 ? 23.446 13.093 78.312  1.00 10.99 ? 157  PRO A O   1 
ATOM   1253 C  CB  . PRO A 1 157 ? 22.205 12.509 75.506  1.00 10.00 ? 157  PRO A CB  1 
ATOM   1254 C  CG  . PRO A 1 157 ? 22.814 12.114 74.185  1.00 13.48 ? 157  PRO A CG  1 
ATOM   1255 C  CD  . PRO A 1 157 ? 24.311 12.163 74.550  1.00 12.53 ? 157  PRO A CD  1 
ATOM   1256 N  N   . GLY A 1 158 ? 22.527 15.081 77.988  1.00 6.65  ? 158  GLY A N   1 
ATOM   1257 C  CA  . GLY A 1 158 ? 22.380 15.270 79.431  1.00 7.59  ? 158  GLY A CA  1 
ATOM   1258 C  C   . GLY A 1 158 ? 23.597 15.805 80.182  1.00 10.04 ? 158  GLY A C   1 
ATOM   1259 O  O   . GLY A 1 158 ? 23.509 16.009 81.412  1.00 11.84 ? 158  GLY A O   1 
ATOM   1260 N  N   . VAL A 1 159 ? 24.693 16.124 79.481  1.00 11.35 ? 159  VAL A N   1 
ATOM   1261 C  CA  . VAL A 1 159 ? 25.859 16.701 80.148  1.00 11.65 ? 159  VAL A CA  1 
ATOM   1262 C  C   . VAL A 1 159 ? 25.558 18.168 80.434  1.00 10.65 ? 159  VAL A C   1 
ATOM   1263 O  O   . VAL A 1 159 ? 24.748 18.775 79.740  1.00 14.06 ? 159  VAL A O   1 
ATOM   1264 C  CB  . VAL A 1 159 ? 27.196 16.570 79.249  1.00 11.61 ? 159  VAL A CB  1 
ATOM   1265 C  CG1 . VAL A 1 159 ? 27.191 17.504 78.062  1.00 10.26 ? 159  VAL A CG1 1 
ATOM   1266 C  CG2 . VAL A 1 159 ? 28.453 16.897 80.092  1.00 9.82  ? 159  VAL A CG2 1 
ATOM   1267 N  N   . LEU A 1 160 ? 26.103 18.694 81.524  1.00 10.79 ? 160  LEU A N   1 
ATOM   1268 C  CA  . LEU A 1 160 ? 26.123 20.114 81.767  1.00 11.72 ? 160  LEU A CA  1 
ATOM   1269 C  C   . LEU A 1 160 ? 27.606 20.464 81.647  1.00 13.43 ? 160  LEU A C   1 
ATOM   1270 O  O   . LEU A 1 160 ? 28.422 20.132 82.513  1.00 14.67 ? 160  LEU A O   1 
ATOM   1271 C  CB  . LEU A 1 160 ? 25.648 20.464 83.165  1.00 12.02 ? 160  LEU A CB  1 
ATOM   1272 C  CG  . LEU A 1 160 ? 25.690 21.933 83.574  1.00 13.93 ? 160  LEU A CG  1 
ATOM   1273 C  CD1 . LEU A 1 160 ? 24.949 22.758 82.553  1.00 12.88 ? 160  LEU A CD1 1 
ATOM   1274 C  CD2 . LEU A 1 160 ? 25.102 22.085 84.982  1.00 12.63 ? 160  LEU A CD2 1 
ATOM   1275 N  N   . LEU A 1 161 ? 27.992 21.168 80.608  1.00 13.86 ? 161  LEU A N   1 
ATOM   1276 C  CA  . LEU A 1 161 ? 29.389 21.514 80.396  1.00 15.70 ? 161  LEU A CA  1 
ATOM   1277 C  C   . LEU A 1 161 ? 29.551 23.046 80.371  1.00 15.22 ? 161  LEU A C   1 
ATOM   1278 O  O   . LEU A 1 161 ? 28.720 23.730 79.749  1.00 15.28 ? 161  LEU A O   1 
ATOM   1279 C  CB  . LEU A 1 161 ? 29.748 20.804 79.076  1.00 14.74 ? 161  LEU A CB  1 
ATOM   1280 C  CG  . LEU A 1 161 ? 31.089 20.838 78.420  1.00 16.19 ? 161  LEU A CG  1 
ATOM   1281 C  CD1 . LEU A 1 161 ? 31.135 19.739 77.394  1.00 17.47 ? 161  LEU A CD1 1 
ATOM   1282 C  CD2 . LEU A 1 161 ? 31.313 22.150 77.729  1.00 16.99 ? 161  LEU A CD2 1 
ATOM   1283 N  N   . ILE A 1 162 ? 30.559 23.651 81.012  1.00 11.13 ? 162  ILE A N   1 
ATOM   1284 C  CA  . ILE A 1 162 ? 30.798 25.064 80.800  1.00 12.03 ? 162  ILE A CA  1 
ATOM   1285 C  C   . ILE A 1 162 ? 32.133 25.275 80.077  1.00 12.93 ? 162  ILE A C   1 
ATOM   1286 O  O   . ILE A 1 162 ? 33.071 24.474 80.223  1.00 12.87 ? 162  ILE A O   1 
ATOM   1287 C  CB  . ILE A 1 162 ? 30.769 25.819 82.137  1.00 12.87 ? 162  ILE A CB  1 
ATOM   1288 C  CG1 . ILE A 1 162 ? 31.771 25.246 83.114  1.00 11.77 ? 162  ILE A CG1 1 
ATOM   1289 C  CG2 . ILE A 1 162 ? 29.314 25.797 82.648  1.00 8.64  ? 162  ILE A CG2 1 
ATOM   1290 C  CD1 . ILE A 1 162 ? 32.318 26.349 84.040  1.00 13.96 ? 162  ILE A CD1 1 
ATOM   1291 N  N   . GLY A 1 163 ? 32.278 26.308 79.266  1.00 9.96  ? 163  GLY A N   1 
ATOM   1292 C  CA  . GLY A 1 163 ? 33.482 26.484 78.464  1.00 10.52 ? 163  GLY A CA  1 
ATOM   1293 C  C   . GLY A 1 163 ? 33.815 27.957 78.427  1.00 12.05 ? 163  GLY A C   1 
ATOM   1294 O  O   . GLY A 1 163 ? 32.900 28.786 78.418  1.00 8.96  ? 163  GLY A O   1 
ATOM   1295 N  N   . THR A 1 164 ? 35.082 28.374 78.429  1.00 10.74 ? 164  THR A N   1 
ATOM   1296 C  CA  . THR A 1 164 ? 35.411 29.791 78.377  1.00 10.59 ? 164  THR A CA  1 
ATOM   1297 C  C   . THR A 1 164 ? 35.386 30.253 76.930  1.00 13.79 ? 164  THR A C   1 
ATOM   1298 O  O   . THR A 1 164 ? 36.405 30.591 76.320  1.00 14.18 ? 164  THR A O   1 
ATOM   1299 C  CB  . THR A 1 164 ? 36.792 29.979 79.082  1.00 11.92 ? 164  THR A CB  1 
ATOM   1300 O  OG1 . THR A 1 164 ? 37.734 29.021 78.617  1.00 9.47  ? 164  THR A OG1 1 
ATOM   1301 C  CG2 . THR A 1 164 ? 36.633 29.746 80.595  1.00 10.14 ? 164  THR A CG2 1 
ATOM   1302 N  N   . ASP A 1 165 ? 34.190 30.250 76.357  1.00 8.37  ? 165  ASP A N   1 
ATOM   1303 C  CA  . ASP A 1 165 ? 34.057 30.679 74.991  1.00 9.72  ? 165  ASP A CA  1 
ATOM   1304 C  C   . ASP A 1 165 ? 32.555 30.776 74.750  1.00 12.53 ? 165  ASP A C   1 
ATOM   1305 O  O   . ASP A 1 165 ? 31.792 29.859 75.072  1.00 12.90 ? 165  ASP A O   1 
ATOM   1306 C  CB  . ASP A 1 165 ? 34.686 29.631 74.062  1.00 7.50  ? 165  ASP A CB  1 
ATOM   1307 C  CG  . ASP A 1 165 ? 34.761 30.104 72.630  1.00 13.16 ? 165  ASP A CG  1 
ATOM   1308 O  OD1 . ASP A 1 165 ? 35.696 30.823 72.328  1.00 12.89 ? 165  ASP A OD1 1 
ATOM   1309 O  OD2 . ASP A 1 165 ? 33.869 29.935 71.761  1.00 12.52 ? 165  ASP A OD2 1 
ATOM   1310 N  N   . SER A 1 166 ? 32.064 31.843 74.160  1.00 11.37 ? 166  SER A N   1 
ATOM   1311 C  CA  . SER A 1 166 ? 30.654 32.065 73.999  1.00 12.72 ? 166  SER A CA  1 
ATOM   1312 C  C   . SER A 1 166 ? 30.060 31.090 73.001  1.00 11.59 ? 166  SER A C   1 
ATOM   1313 O  O   . SER A 1 166 ? 28.857 30.988 72.982  1.00 14.33 ? 166  SER A O   1 
ATOM   1314 C  CB  . SER A 1 166 ? 30.449 33.532 73.589  1.00 9.34  ? 166  SER A CB  1 
ATOM   1315 O  OG  . SER A 1 166 ? 30.858 33.691 72.252  1.00 11.32 ? 166  SER A OG  1 
ATOM   1316 N  N   . HIS A 1 167 ? 30.786 30.320 72.159  1.00 14.03 ? 167  HIS A N   1 
ATOM   1317 C  CA  . HIS A 1 167 ? 30.161 29.351 71.253  1.00 11.19 ? 167  HIS A CA  1 
ATOM   1318 C  C   . HIS A 1 167 ? 30.140 27.910 71.797  1.00 9.89  ? 167  HIS A C   1 
ATOM   1319 O  O   . HIS A 1 167 ? 29.892 26.949 71.081  1.00 9.81  ? 167  HIS A O   1 
ATOM   1320 C  CB  . HIS A 1 167 ? 30.854 29.432 69.875  1.00 9.49  ? 167  HIS A CB  1 
ATOM   1321 C  CG  . HIS A 1 167 ? 30.406 30.704 69.136  1.00 12.18 ? 167  HIS A CG  1 
ATOM   1322 N  ND1 . HIS A 1 167 ? 30.998 31.873 68.875  1.00 14.39 ? 167  HIS A ND1 1 
ATOM   1323 C  CD2 . HIS A 1 167 ? 29.157 30.843 68.602  1.00 12.04 ? 167  HIS A CD2 1 
ATOM   1324 C  CE1 . HIS A 1 167 ? 30.192 32.671 68.233  1.00 13.13 ? 167  HIS A CE1 1 
ATOM   1325 N  NE2 . HIS A 1 167 ? 29.100 32.031 68.087  1.00 12.06 ? 167  HIS A NE2 1 
ATOM   1326 N  N   . THR A 1 168 ? 30.376 27.690 73.105  1.00 6.03  ? 168  THR A N   1 
ATOM   1327 C  CA  . THR A 1 168 ? 30.218 26.427 73.785  1.00 8.20  ? 168  THR A CA  1 
ATOM   1328 C  C   . THR A 1 168 ? 28.825 25.785 73.618  1.00 10.03 ? 168  THR A C   1 
ATOM   1329 O  O   . THR A 1 168 ? 28.758 24.540 73.588  1.00 9.42  ? 168  THR A O   1 
ATOM   1330 C  CB  . THR A 1 168 ? 30.562 26.653 75.280  1.00 5.96  ? 168  THR A CB  1 
ATOM   1331 O  OG1 . THR A 1 168 ? 31.923 27.136 75.342  1.00 12.21 ? 168  THR A OG1 1 
ATOM   1332 C  CG2 . THR A 1 168 ? 30.457 25.378 76.097  1.00 6.05  ? 168  THR A CG2 1 
ATOM   1333 N  N   . PRO A 1 169 ? 27.706 26.527 73.424  1.00 11.59 ? 169  PRO A N   1 
ATOM   1334 C  CA  . PRO A 1 169 ? 26.385 26.002 72.976  1.00 10.96 ? 169  PRO A CA  1 
ATOM   1335 C  C   . PRO A 1 169 ? 26.354 25.045 71.800  1.00 11.84 ? 169  PRO A C   1 
ATOM   1336 O  O   . PRO A 1 169 ? 25.349 24.370 71.543  1.00 12.62 ? 169  PRO A O   1 
ATOM   1337 C  CB  . PRO A 1 169 ? 25.578 27.232 72.684  1.00 10.42 ? 169  PRO A CB  1 
ATOM   1338 C  CG  . PRO A 1 169 ? 25.995 28.176 73.748  1.00 10.12 ? 169  PRO A CG  1 
ATOM   1339 C  CD  . PRO A 1 169 ? 27.513 27.940 73.789  1.00 9.57  ? 169  PRO A CD  1 
ATOM   1340 N  N   . ASN A 1 170 ? 27.437 25.011 71.018  1.00 8.77  ? 170  ASN A N   1 
ATOM   1341 C  CA  . ASN A 1 170 ? 27.617 24.093 69.932  1.00 8.22  ? 170  ASN A CA  1 
ATOM   1342 C  C   . ASN A 1 170 ? 27.272 22.671 70.364  1.00 7.08  ? 170  ASN A C   1 
ATOM   1343 O  O   . ASN A 1 170 ? 26.686 21.897 69.615  1.00 8.54  ? 170  ASN A O   1 
ATOM   1344 C  CB  . ASN A 1 170 ? 29.084 24.225 69.512  1.00 5.55  ? 170  ASN A CB  1 
ATOM   1345 C  CG  . ASN A 1 170 ? 29.368 23.524 68.223  1.00 4.84  ? 170  ASN A CG  1 
ATOM   1346 O  OD1 . ASN A 1 170 ? 29.264 24.140 67.157  1.00 9.49  ? 170  ASN A OD1 1 
ATOM   1347 N  ND2 . ASN A 1 170 ? 29.760 22.252 68.204  1.00 6.52  ? 170  ASN A ND2 1 
ATOM   1348 N  N   . GLY A 1 171 ? 27.628 22.313 71.601  1.00 8.28  ? 171  GLY A N   1 
ATOM   1349 C  CA  . GLY A 1 171 ? 27.439 20.974 72.136  1.00 9.46  ? 171  GLY A CA  1 
ATOM   1350 C  C   . GLY A 1 171 ? 25.982 20.586 72.375  1.00 9.84  ? 171  GLY A C   1 
ATOM   1351 O  O   . GLY A 1 171 ? 25.710 19.428 72.723  1.00 5.30  ? 171  GLY A O   1 
ATOM   1352 N  N   . GLY A 1 172 ? 25.043 21.536 72.215  1.00 10.96 ? 172  GLY A N   1 
ATOM   1353 C  CA  . GLY A 1 172 ? 23.607 21.299 72.292  1.00 8.52  ? 172  GLY A CA  1 
ATOM   1354 C  C   . GLY A 1 172 ? 23.107 20.439 71.138  1.00 9.19  ? 172  GLY A C   1 
ATOM   1355 O  O   . GLY A 1 172 ? 22.054 19.797 71.242  1.00 11.04 ? 172  GLY A O   1 
ATOM   1356 N  N   . GLY A 1 173 ? 23.916 20.367 70.073  1.00 6.14  ? 173  GLY A N   1 
ATOM   1357 C  CA  . GLY A 1 173 ? 23.737 19.489 68.938  1.00 4.62  ? 173  GLY A CA  1 
ATOM   1358 C  C   . GLY A 1 173 ? 23.855 18.006 69.325  1.00 9.20  ? 173  GLY A C   1 
ATOM   1359 O  O   . GLY A 1 173 ? 23.445 17.127 68.566  1.00 10.10 ? 173  GLY A O   1 
ATOM   1360 N  N   . LEU A 1 174 ? 24.363 17.670 70.520  1.00 9.10  ? 174  LEU A N   1 
ATOM   1361 C  CA  . LEU A 1 174 ? 24.366 16.302 71.013  1.00 8.75  ? 174  LEU A CA  1 
ATOM   1362 C  C   . LEU A 1 174 ? 23.587 16.198 72.331  1.00 8.83  ? 174  LEU A C   1 
ATOM   1363 O  O   . LEU A 1 174 ? 23.802 15.298 73.154  1.00 9.57  ? 174  LEU A O   1 
ATOM   1364 C  CB  . LEU A 1 174 ? 25.832 15.871 71.144  1.00 10.15 ? 174  LEU A CB  1 
ATOM   1365 C  CG  . LEU A 1 174 ? 26.315 14.448 70.907  1.00 12.61 ? 174  LEU A CG  1 
ATOM   1366 C  CD1 . LEU A 1 174 ? 25.496 13.725 69.890  1.00 13.47 ? 174  LEU A CD1 1 
ATOM   1367 C  CD2 . LEU A 1 174 ? 27.763 14.519 70.433  1.00 12.20 ? 174  LEU A CD2 1 
ATOM   1368 N  N   . GLY A 1 175 ? 22.663 17.140 72.573  1.00 7.43  ? 175  GLY A N   1 
ATOM   1369 C  CA  . GLY A 1 175 ? 21.671 16.951 73.622  1.00 5.61  ? 175  GLY A CA  1 
ATOM   1370 C  C   . GLY A 1 175 ? 22.094 17.368 74.972  1.00 5.95  ? 175  GLY A C   1 
ATOM   1371 O  O   . GLY A 1 175 ? 21.463 16.997 75.962  1.00 8.06  ? 175  GLY A O   1 
ATOM   1372 N  N   . GLY A 1 176 ? 23.182 18.132 75.075  1.00 8.69  ? 176  GLY A N   1 
ATOM   1373 C  CA  . GLY A 1 176 ? 23.628 18.554 76.387  1.00 10.14 ? 176  GLY A CA  1 
ATOM   1374 C  C   . GLY A 1 176 ? 23.392 20.025 76.539  1.00 8.63  ? 176  GLY A C   1 
ATOM   1375 O  O   . GLY A 1 176 ? 23.097 20.714 75.562  1.00 8.76  ? 176  GLY A O   1 
ATOM   1376 N  N   . ILE A 1 177 ? 23.470 20.481 77.778  1.00 10.13 ? 177  ILE A N   1 
ATOM   1377 C  CA  . ILE A 1 177 ? 23.433 21.908 78.076  1.00 12.22 ? 177  ILE A CA  1 
ATOM   1378 C  C   . ILE A 1 177 ? 24.905 22.400 78.239  1.00 11.89 ? 177  ILE A C   1 
ATOM   1379 O  O   . ILE A 1 177 ? 25.594 22.082 79.214  1.00 9.73  ? 177  ILE A O   1 
ATOM   1380 C  CB  . ILE A 1 177 ? 22.529 22.101 79.369  1.00 10.93 ? 177  ILE A CB  1 
ATOM   1381 C  CG1 . ILE A 1 177 ? 21.028 21.845 78.999  1.00 10.93 ? 177  ILE A CG1 1 
ATOM   1382 C  CG2 . ILE A 1 177 ? 22.686 23.517 79.936  1.00 8.17  ? 177  ILE A CG2 1 
ATOM   1383 C  CD1 . ILE A 1 177 ? 20.443 22.785 77.903  1.00 10.65 ? 177  ILE A CD1 1 
ATOM   1384 N  N   . CYS A 1 178 ? 25.384 23.189 77.269  1.00 13.30 ? 178  CYS A N   1 
ATOM   1385 C  CA  . CYS A 1 178 ? 26.762 23.638 77.166  1.00 11.21 ? 178  CYS A CA  1 
ATOM   1386 C  C   . CYS A 1 178 ? 26.715 25.151 77.175  1.00 11.12 ? 178  CYS A C   1 
ATOM   1387 O  O   . CYS A 1 178 ? 26.162 25.754 76.248  1.00 11.00 ? 178  CYS A O   1 
ATOM   1388 C  CB  . CYS A 1 178 ? 27.319 23.070 75.866  1.00 7.54  ? 178  CYS A CB  1 
ATOM   1389 S  SG  . CYS A 1 178 ? 27.281 21.257 75.898  1.00 11.39 ? 178  CYS A SG  1 
ATOM   1390 N  N   . ILE A 1 179 ? 27.305 25.774 78.206  1.00 11.28 ? 179  ILE A N   1 
ATOM   1391 C  CA  . ILE A 1 179 ? 27.138 27.191 78.463  1.00 9.37  ? 179  ILE A CA  1 
ATOM   1392 C  C   . ILE A 1 179 ? 28.467 27.916 78.502  1.00 10.43 ? 179  ILE A C   1 
ATOM   1393 O  O   . ILE A 1 179 ? 29.391 27.441 79.151  1.00 10.65 ? 179  ILE A O   1 
ATOM   1394 C  CB  . ILE A 1 179 ? 26.376 27.399 79.825  1.00 7.10  ? 179  ILE A CB  1 
ATOM   1395 C  CG1 . ILE A 1 179 ? 24.947 26.821 79.695  1.00 6.10  ? 179  ILE A CG1 1 
ATOM   1396 C  CG2 . ILE A 1 179 ? 26.266 28.901 80.185  1.00 4.81  ? 179  ILE A CG2 1 
ATOM   1397 C  CD1 . ILE A 1 179 ? 24.143 26.923 81.001  1.00 3.23  ? 179  ILE A CD1 1 
ATOM   1398 N  N   . GLY A 1 180 ? 28.527 29.052 77.809  1.00 10.28 ? 180  GLY A N   1 
ATOM   1399 C  CA  . GLY A 1 180 ? 29.659 29.968 77.766  1.00 11.80 ? 180  GLY A CA  1 
ATOM   1400 C  C   . GLY A 1 180 ? 29.812 30.763 79.053  1.00 11.92 ? 180  GLY A C   1 
ATOM   1401 O  O   . GLY A 1 180 ? 28.822 31.329 79.558  1.00 12.19 ? 180  GLY A O   1 
ATOM   1402 N  N   . VAL A 1 181 ? 31.018 30.802 79.638  1.00 8.89  ? 181  VAL A N   1 
ATOM   1403 C  CA  . VAL A 1 181 ? 31.299 31.532 80.880  1.00 11.39 ? 181  VAL A CA  1 
ATOM   1404 C  C   . VAL A 1 181 ? 32.664 32.242 80.720  1.00 13.82 ? 181  VAL A C   1 
ATOM   1405 O  O   . VAL A 1 181 ? 33.426 31.954 79.780  1.00 12.27 ? 181  VAL A O   1 
ATOM   1406 C  CB  . VAL A 1 181 ? 31.420 30.612 82.162  1.00 11.53 ? 181  VAL A CB  1 
ATOM   1407 C  CG1 . VAL A 1 181 ? 30.086 29.926 82.358  1.00 12.31 ? 181  VAL A CG1 1 
ATOM   1408 C  CG2 . VAL A 1 181 ? 32.549 29.550 82.064  1.00 7.40  ? 181  VAL A CG2 1 
ATOM   1409 N  N   . GLY A 1 182 ? 32.989 33.206 81.590  1.00 15.95 ? 182  GLY A N   1 
ATOM   1410 C  CA  . GLY A 1 182 ? 34.287 33.876 81.678  1.00 13.10 ? 182  GLY A CA  1 
ATOM   1411 C  C   . GLY A 1 182 ? 35.207 32.979 82.522  1.00 12.11 ? 182  GLY A C   1 
ATOM   1412 O  O   . GLY A 1 182 ? 34.769 32.066 83.252  1.00 8.73  ? 182  GLY A O   1 
ATOM   1413 N  N   . GLY A 1 183 ? 36.525 33.204 82.461  1.00 12.58 ? 183  GLY A N   1 
ATOM   1414 C  CA  . GLY A 1 183 ? 37.503 32.380 83.164  1.00 9.24  ? 183  GLY A CA  1 
ATOM   1415 C  C   . GLY A 1 183 ? 37.255 32.320 84.667  1.00 9.03  ? 183  GLY A C   1 
ATOM   1416 O  O   . GLY A 1 183 ? 37.466 31.262 85.260  1.00 15.42 ? 183  GLY A O   1 
ATOM   1417 N  N   . ALA A 1 184 ? 36.766 33.360 85.343  1.00 11.27 ? 184  ALA A N   1 
ATOM   1418 C  CA  . ALA A 1 184 ? 36.532 33.276 86.783  1.00 9.40  ? 184  ALA A CA  1 
ATOM   1419 C  C   . ALA A 1 184 ? 35.404 32.317 87.174  1.00 12.25 ? 184  ALA A C   1 
ATOM   1420 O  O   . ALA A 1 184 ? 35.411 31.721 88.263  1.00 14.14 ? 184  ALA A O   1 
ATOM   1421 C  CB  . ALA A 1 184 ? 36.214 34.663 87.316  1.00 8.71  ? 184  ALA A CB  1 
ATOM   1422 N  N   . ASP A 1 185 ? 34.425 32.107 86.290  1.00 14.19 ? 185  ASP A N   1 
ATOM   1423 C  CA  . ASP A 1 185 ? 33.371 31.129 86.558  1.00 17.59 ? 185  ASP A CA  1 
ATOM   1424 C  C   . ASP A 1 185 ? 33.931 29.723 86.407  1.00 14.61 ? 185  ASP A C   1 
ATOM   1425 O  O   . ASP A 1 185 ? 33.561 28.838 87.171  1.00 16.21 ? 185  ASP A O   1 
ATOM   1426 C  CB  . ASP A 1 185 ? 32.180 31.229 85.587  1.00 21.31 ? 185  ASP A CB  1 
ATOM   1427 C  CG  . ASP A 1 185 ? 31.152 32.322 85.829  1.00 23.70 ? 185  ASP A CG  1 
ATOM   1428 O  OD1 . ASP A 1 185 ? 31.492 33.338 86.401  1.00 29.73 ? 185  ASP A OD1 1 
ATOM   1429 O  OD2 . ASP A 1 185 ? 30.040 32.234 85.347  1.00 25.57 ? 185  ASP A OD2 1 
ATOM   1430 N  N   . ALA A 1 186 ? 34.793 29.468 85.409  1.00 12.91 ? 186  ALA A N   1 
ATOM   1431 C  CA  . ALA A 1 186 ? 35.449 28.177 85.232  1.00 11.66 ? 186  ALA A CA  1 
ATOM   1432 C  C   . ALA A 1 186 ? 36.286 27.829 86.457  1.00 12.80 ? 186  ALA A C   1 
ATOM   1433 O  O   . ALA A 1 186 ? 36.317 26.674 86.882  1.00 13.60 ? 186  ALA A O   1 
ATOM   1434 C  CB  . ALA A 1 186 ? 36.341 28.229 83.991  1.00 12.98 ? 186  ALA A CB  1 
ATOM   1435 N  N   . VAL A 1 187 ? 36.950 28.831 87.053  1.00 13.81 ? 187  VAL A N   1 
ATOM   1436 C  CA  . VAL A 1 187 ? 37.738 28.712 88.284  1.00 14.32 ? 187  VAL A CA  1 
ATOM   1437 C  C   . VAL A 1 187 ? 36.877 28.230 89.434  1.00 14.95 ? 187  VAL A C   1 
ATOM   1438 O  O   . VAL A 1 187 ? 37.305 27.314 90.150  1.00 15.39 ? 187  VAL A O   1 
ATOM   1439 C  CB  . VAL A 1 187 ? 38.398 30.078 88.671  1.00 10.15 ? 187  VAL A CB  1 
ATOM   1440 C  CG1 . VAL A 1 187 ? 39.092 30.091 90.013  1.00 9.22  ? 187  VAL A CG1 1 
ATOM   1441 C  CG2 . VAL A 1 187 ? 39.479 30.312 87.649  1.00 12.87 ? 187  VAL A CG2 1 
ATOM   1442 N  N   . ASP A 1 188 ? 35.684 28.801 89.644  1.00 14.90 ? 188  ASP A N   1 
ATOM   1443 C  CA  . ASP A 1 188 ? 34.782 28.274 90.647  1.00 15.81 ? 188  ASP A CA  1 
ATOM   1444 C  C   . ASP A 1 188 ? 34.541 26.780 90.516  1.00 11.43 ? 188  ASP A C   1 
ATOM   1445 O  O   . ASP A 1 188 ? 34.614 26.023 91.475  1.00 12.48 ? 188  ASP A O   1 
ATOM   1446 C  CB  . ASP A 1 188 ? 33.398 28.859 90.577  1.00 21.53 ? 188  ASP A CB  1 
ATOM   1447 C  CG  . ASP A 1 188 ? 33.234 30.316 90.954  1.00 24.04 ? 188  ASP A CG  1 
ATOM   1448 O  OD1 . ASP A 1 188 ? 34.069 30.918 91.639  1.00 24.82 ? 188  ASP A OD1 1 
ATOM   1449 O  OD2 . ASP A 1 188 ? 32.229 30.897 90.530  1.00 26.85 ? 188  ASP A OD2 1 
ATOM   1450 N  N   . VAL A 1 189 ? 34.275 26.312 89.318  1.00 9.03  ? 189  VAL A N   1 
ATOM   1451 C  CA  . VAL A 1 189 ? 33.962 24.907 89.137  1.00 14.03 ? 189  VAL A CA  1 
ATOM   1452 C  C   . VAL A 1 189 ? 35.208 24.015 89.253  1.00 15.39 ? 189  VAL A C   1 
ATOM   1453 O  O   . VAL A 1 189 ? 35.177 22.911 89.837  1.00 16.45 ? 189  VAL A O   1 
ATOM   1454 C  CB  . VAL A 1 189 ? 33.258 24.846 87.778  1.00 13.04 ? 189  VAL A CB  1 
ATOM   1455 C  CG1 . VAL A 1 189 ? 32.977 23.420 87.323  1.00 12.29 ? 189  VAL A CG1 1 
ATOM   1456 C  CG2 . VAL A 1 189 ? 31.954 25.614 87.935  1.00 13.73 ? 189  VAL A CG2 1 
ATOM   1457 N  N   . MET A 1 190 ? 36.344 24.470 88.703  1.00 15.21 ? 190  MET A N   1 
ATOM   1458 C  CA  . MET A 1 190 ? 37.586 23.730 88.850  1.00 13.07 ? 190  MET A CA  1 
ATOM   1459 C  C   . MET A 1 190 ? 37.976 23.714 90.299  1.00 11.67 ? 190  MET A C   1 
ATOM   1460 O  O   . MET A 1 190 ? 38.616 22.776 90.744  1.00 14.45 ? 190  MET A O   1 
ATOM   1461 C  CB  . MET A 1 190 ? 38.685 24.361 88.063  1.00 12.37 ? 190  MET A CB  1 
ATOM   1462 C  CG  . MET A 1 190 ? 38.504 24.050 86.601  1.00 13.78 ? 190  MET A CG  1 
ATOM   1463 S  SD  . MET A 1 190 ? 39.800 24.729 85.524  1.00 19.30 ? 190  MET A SD  1 
ATOM   1464 C  CE  . MET A 1 190 ? 39.899 26.452 85.930  1.00 13.16 ? 190  MET A CE  1 
ATOM   1465 N  N   . ALA A 1 191 ? 37.576 24.711 91.055  1.00 14.60 ? 191  ALA A N   1 
ATOM   1466 C  CA  . ALA A 1 191 ? 37.840 24.746 92.467  1.00 17.98 ? 191  ALA A CA  1 
ATOM   1467 C  C   . ALA A 1 191 ? 36.837 23.897 93.241  1.00 20.26 ? 191  ALA A C   1 
ATOM   1468 O  O   . ALA A 1 191 ? 37.030 23.718 94.443  1.00 22.02 ? 191  ALA A O   1 
ATOM   1469 C  CB  . ALA A 1 191 ? 37.764 26.205 92.993  1.00 18.02 ? 191  ALA A CB  1 
ATOM   1470 N  N   . GLY A 1 192 ? 35.725 23.397 92.688  1.00 23.28 ? 192  GLY A N   1 
ATOM   1471 C  CA  . GLY A 1 192 ? 34.784 22.590 93.453  1.00 21.66 ? 192  GLY A CA  1 
ATOM   1472 C  C   . GLY A 1 192 ? 33.685 23.390 94.150  1.00 24.22 ? 192  GLY A C   1 
ATOM   1473 O  O   . GLY A 1 192 ? 32.883 22.821 94.919  1.00 25.33 ? 192  GLY A O   1 
ATOM   1474 N  N   . ILE A 1 193 ? 33.517 24.685 93.875  1.00 23.58 ? 193  ILE A N   1 
ATOM   1475 C  CA  . ILE A 1 193 ? 32.428 25.361 94.532  1.00 25.42 ? 193  ILE A CA  1 
ATOM   1476 C  C   . ILE A 1 193 ? 31.221 25.491 93.579  1.00 25.01 ? 193  ILE A C   1 
ATOM   1477 O  O   . ILE A 1 193 ? 31.438 25.460 92.355  1.00 24.11 ? 193  ILE A O   1 
ATOM   1478 C  CB  . ILE A 1 193 ? 32.931 26.733 95.054  1.00 27.12 ? 193  ILE A CB  1 
ATOM   1479 C  CG1 . ILE A 1 193 ? 33.171 27.693 93.966  1.00 29.74 ? 193  ILE A CG1 1 
ATOM   1480 C  CG2 . ILE A 1 193 ? 34.244 26.548 95.803  1.00 24.59 ? 193  ILE A CG2 1 
ATOM   1481 C  CD1 . ILE A 1 193 ? 32.930 29.085 94.573  1.00 30.44 ? 193  ILE A CD1 1 
ATOM   1482 N  N   . PRO A 1 194 ? 29.943 25.529 94.037  1.00 23.52 ? 194  PRO A N   1 
ATOM   1483 C  CA  . PRO A 1 194 ? 28.768 25.604 93.150  1.00 20.57 ? 194  PRO A CA  1 
ATOM   1484 C  C   . PRO A 1 194 ? 28.806 26.748 92.140  1.00 18.24 ? 194  PRO A C   1 
ATOM   1485 O  O   . PRO A 1 194 ? 29.174 27.863 92.500  1.00 19.64 ? 194  PRO A O   1 
ATOM   1486 C  CB  . PRO A 1 194 ? 27.589 25.686 94.123  1.00 21.87 ? 194  PRO A CB  1 
ATOM   1487 C  CG  . PRO A 1 194 ? 28.086 25.067 95.408  1.00 22.54 ? 194  PRO A CG  1 
ATOM   1488 C  CD  . PRO A 1 194 ? 29.535 25.552 95.448  1.00 21.04 ? 194  PRO A CD  1 
ATOM   1489 N  N   . TRP A 1 195 ? 28.470 26.515 90.875  1.00 16.56 ? 195  TRP A N   1 
ATOM   1490 C  CA  . TRP A 1 195 ? 28.402 27.567 89.879  1.00 13.89 ? 195  TRP A CA  1 
ATOM   1491 C  C   . TRP A 1 195 ? 27.006 28.202 89.894  1.00 16.12 ? 195  TRP A C   1 
ATOM   1492 O  O   . TRP A 1 195 ? 26.014 27.478 89.852  1.00 16.56 ? 195  TRP A O   1 
ATOM   1493 C  CB  . TRP A 1 195 ? 28.683 26.960 88.531  1.00 11.65 ? 195  TRP A CB  1 
ATOM   1494 C  CG  . TRP A 1 195 ? 28.536 27.886 87.343  1.00 11.31 ? 195  TRP A CG  1 
ATOM   1495 C  CD1 . TRP A 1 195 ? 29.238 29.059 87.278  1.00 10.26 ? 195  TRP A CD1 1 
ATOM   1496 C  CD2 . TRP A 1 195 ? 27.721 27.662 86.247  1.00 10.61 ? 195  TRP A CD2 1 
ATOM   1497 N  NE1 . TRP A 1 195 ? 28.864 29.574 86.141  1.00 9.99  ? 195  TRP A NE1 1 
ATOM   1498 C  CE2 . TRP A 1 195 ? 27.972 28.789 85.498  1.00 9.24  ? 195  TRP A CE2 1 
ATOM   1499 C  CE3 . TRP A 1 195 ? 26.832 26.695 85.785  1.00 12.08 ? 195  TRP A CE3 1 
ATOM   1500 C  CZ2 . TRP A 1 195 ? 27.340 28.991 84.285  1.00 10.76 ? 195  TRP A CZ2 1 
ATOM   1501 C  CZ3 . TRP A 1 195 ? 26.198 26.891 84.565  1.00 9.32  ? 195  TRP A CZ3 1 
ATOM   1502 C  CH2 . TRP A 1 195 ? 26.453 28.037 83.826  1.00 13.61 ? 195  TRP A CH2 1 
ATOM   1503 N  N   . GLU A 1 196 ? 26.831 29.516 89.863  1.00 14.95 ? 196  GLU A N   1 
ATOM   1504 C  CA  . GLU A 1 196 ? 25.512 30.141 89.864  1.00 14.68 ? 196  GLU A CA  1 
ATOM   1505 C  C   . GLU A 1 196 ? 25.070 30.597 88.493  1.00 14.38 ? 196  GLU A C   1 
ATOM   1506 O  O   . GLU A 1 196 ? 25.856 31.228 87.786  1.00 13.53 ? 196  GLU A O   1 
ATOM   1507 C  CB  . GLU A 1 196 ? 25.464 31.360 90.761  1.00 16.36 ? 196  GLU A CB  1 
ATOM   1508 C  CG  . GLU A 1 196 ? 25.412 31.040 92.256  1.00 21.12 ? 196  GLU A CG  1 
ATOM   1509 C  CD  . GLU A 1 196 ? 25.174 32.234 93.188  1.00 25.27 ? 196  GLU A CD  1 
ATOM   1510 O  OE1 . GLU A 1 196 ? 25.319 33.388 92.774  1.00 23.94 ? 196  GLU A OE1 1 
ATOM   1511 O  OE2 . GLU A 1 196 ? 24.923 32.000 94.375  1.00 28.56 ? 196  GLU A OE2 1 
ATOM   1512 N  N   . LEU A 1 197 ? 23.819 30.328 88.089  1.00 12.99 ? 197  LEU A N   1 
ATOM   1513 C  CA  . LEU A 1 197 ? 23.281 30.786 86.816  1.00 12.50 ? 197  LEU A CA  1 
ATOM   1514 C  C   . LEU A 1 197 ? 21.858 31.282 87.065  1.00 13.09 ? 197  LEU A C   1 
ATOM   1515 O  O   . LEU A 1 197 ? 21.093 30.606 87.744  1.00 14.12 ? 197  LEU A O   1 
ATOM   1516 C  CB  . LEU A 1 197 ? 23.191 29.668 85.761  1.00 9.56  ? 197  LEU A CB  1 
ATOM   1517 C  CG  . LEU A 1 197 ? 22.633 30.056 84.372  1.00 13.28 ? 197  LEU A CG  1 
ATOM   1518 C  CD1 . LEU A 1 197 ? 23.671 30.823 83.567  1.00 11.89 ? 197  LEU A CD1 1 
ATOM   1519 C  CD2 . LEU A 1 197 ? 22.198 28.801 83.646  1.00 11.23 ? 197  LEU A CD2 1 
ATOM   1520 N  N   . LYS A 1 198 ? 21.471 32.456 86.573  1.00 12.49 ? 198  LYS A N   1 
ATOM   1521 C  CA  . LYS A 1 198 ? 20.112 32.968 86.653  1.00 14.85 ? 198  LYS A CA  1 
ATOM   1522 C  C   . LYS A 1 198 ? 19.286 31.977 85.862  1.00 13.20 ? 198  LYS A C   1 
ATOM   1523 O  O   . LYS A 1 198 ? 19.611 31.636 84.703  1.00 14.24 ? 198  LYS A O   1 
ATOM   1524 C  CB  . LYS A 1 198 ? 20.001 34.334 85.999  1.00 14.73 ? 198  LYS A CB  1 
ATOM   1525 C  CG  . LYS A 1 198 ? 18.616 34.980 86.018  1.00 16.39 ? 198  LYS A CG  1 
ATOM   1526 C  CD  . LYS A 1 198 ? 18.274 35.449 87.407  1.00 21.01 ? 198  LYS A CD  1 
ATOM   1527 C  CE  . LYS A 1 198 ? 18.531 36.930 87.561  1.00 24.77 ? 198  LYS A CE  1 
ATOM   1528 N  NZ  . LYS A 1 198 ? 17.703 37.719 86.667  1.00 30.36 ? 198  LYS A NZ  1 
ATOM   1529 N  N   . CYS A 1 199 ? 18.231 31.528 86.544  1.00 14.30 ? 199  CYS A N   1 
ATOM   1530 C  CA  . CYS A 1 199 ? 17.296 30.554 86.001  1.00 12.66 ? 199  CYS A CA  1 
ATOM   1531 C  C   . CYS A 1 199 ? 16.776 31.032 84.651  1.00 10.69 ? 199  CYS A C   1 
ATOM   1532 O  O   . CYS A 1 199 ? 16.174 32.120 84.595  1.00 10.17 ? 199  CYS A O   1 
ATOM   1533 C  CB  . CYS A 1 199 ? 16.121 30.356 86.971  1.00 13.76 ? 199  CYS A CB  1 
ATOM   1534 S  SG  . CYS A 1 199 ? 15.078 28.914 86.562  1.00 15.19 ? 199  CYS A SG  1 
ATOM   1535 N  N   . PRO A 1 200 ? 17.013 30.339 83.536  1.00 9.39  ? 200  PRO A N   1 
ATOM   1536 C  CA  . PRO A 1 200 ? 16.597 30.848 82.254  1.00 10.29 ? 200  PRO A CA  1 
ATOM   1537 C  C   . PRO A 1 200 ? 15.109 30.728 81.897  1.00 12.11 ? 200  PRO A C   1 
ATOM   1538 O  O   . PRO A 1 200 ? 14.408 29.865 82.414  1.00 12.02 ? 200  PRO A O   1 
ATOM   1539 C  CB  . PRO A 1 200 ? 17.515 30.125 81.311  1.00 8.16  ? 200  PRO A CB  1 
ATOM   1540 C  CG  . PRO A 1 200 ? 17.825 28.831 81.990  1.00 11.30 ? 200  PRO A CG  1 
ATOM   1541 C  CD  . PRO A 1 200 ? 17.880 29.158 83.446  1.00 9.21  ? 200  PRO A CD  1 
ATOM   1542 N  N   . LYS A 1 201 ? 14.640 31.638 81.053  1.00 8.65  ? 201  LYS A N   1 
ATOM   1543 C  CA  . LYS A 1 201 ? 13.366 31.496 80.368  1.00 15.55 ? 201  LYS A CA  1 
ATOM   1544 C  C   . LYS A 1 201 ? 13.593 30.451 79.284  1.00 13.06 ? 201  LYS A C   1 
ATOM   1545 O  O   . LYS A 1 201 ? 14.757 30.136 79.026  1.00 16.03 ? 201  LYS A O   1 
ATOM   1546 C  CB  . LYS A 1 201 ? 12.953 32.753 79.661  1.00 18.46 ? 201  LYS A CB  1 
ATOM   1547 C  CG  . LYS A 1 201 ? 13.105 33.964 80.522  1.00 24.83 ? 201  LYS A CG  1 
ATOM   1548 C  CD  . LYS A 1 201 ? 12.321 33.844 81.794  1.00 30.75 ? 201  LYS A CD  1 
ATOM   1549 C  CE  . LYS A 1 201 ? 11.097 34.739 81.722  1.00 35.98 ? 201  LYS A CE  1 
ATOM   1550 N  NZ  . LYS A 1 201 ? 10.221 34.139 80.730  1.00 47.23 ? 201  LYS A NZ  1 
ATOM   1551 N  N   . VAL A 1 202 ? 12.611 29.909 78.573  1.00 9.22  ? 202  VAL A N   1 
ATOM   1552 C  CA  . VAL A 1 202 ? 12.850 28.903 77.555  1.00 9.01  ? 202  VAL A CA  1 
ATOM   1553 C  C   . VAL A 1 202 ? 12.086 29.332 76.342  1.00 10.99 ? 202  VAL A C   1 
ATOM   1554 O  O   . VAL A 1 202 ? 10.874 29.541 76.424  1.00 12.30 ? 202  VAL A O   1 
ATOM   1555 C  CB  . VAL A 1 202 ? 12.366 27.493 77.994  1.00 8.44  ? 202  VAL A CB  1 
ATOM   1556 C  CG1 . VAL A 1 202 ? 12.805 26.433 76.958  1.00 7.96  ? 202  VAL A CG1 1 
ATOM   1557 C  CG2 . VAL A 1 202 ? 12.961 27.137 79.355  1.00 7.37  ? 202  VAL A CG2 1 
ATOM   1558 N  N   . ILE A 1 203 ? 12.747 29.516 75.221  1.00 10.19 ? 203  ILE A N   1 
ATOM   1559 C  CA  . ILE A 1 203 ? 12.105 29.883 73.981  1.00 9.07  ? 203  ILE A CA  1 
ATOM   1560 C  C   . ILE A 1 203 ? 12.032 28.566 73.249  1.00 12.39 ? 203  ILE A C   1 
ATOM   1561 O  O   . ILE A 1 203 ? 13.049 27.892 73.084  1.00 12.30 ? 203  ILE A O   1 
ATOM   1562 C  CB  . ILE A 1 203 ? 12.985 30.924 73.229  1.00 11.18 ? 203  ILE A CB  1 
ATOM   1563 C  CG1 . ILE A 1 203 ? 12.962 32.226 74.001  1.00 8.89  ? 203  ILE A CG1 1 
ATOM   1564 C  CG2 . ILE A 1 203 ? 12.506 31.128 71.787  1.00 10.48 ? 203  ILE A CG2 1 
ATOM   1565 C  CD1 . ILE A 1 203 ? 13.891 33.254 73.328  1.00 11.00 ? 203  ILE A CD1 1 
ATOM   1566 N  N   . GLY A 1 204 ? 10.864 28.105 72.816  1.00 12.63 ? 204  GLY A N   1 
ATOM   1567 C  CA  . GLY A 1 204 ? 10.753 26.880 72.066  1.00 6.42  ? 204  GLY A CA  1 
ATOM   1568 C  C   . GLY A 1 204 ? 10.696 27.242 70.607  1.00 7.57  ? 204  GLY A C   1 
ATOM   1569 O  O   . GLY A 1 204 ? 10.003 28.182 70.227  1.00 12.94 ? 204  GLY A O   1 
ATOM   1570 N  N   . VAL A 1 205 ? 11.433 26.557 69.753  1.00 9.02  ? 205  VAL A N   1 
ATOM   1571 C  CA  . VAL A 1 205 ? 11.367 26.800 68.327  1.00 12.06 ? 205  VAL A CA  1 
ATOM   1572 C  C   . VAL A 1 205 ? 10.904 25.477 67.728  1.00 13.10 ? 205  VAL A C   1 
ATOM   1573 O  O   . VAL A 1 205 ? 11.546 24.424 67.885  1.00 14.33 ? 205  VAL A O   1 
ATOM   1574 C  CB  . VAL A 1 205 ? 12.772 27.233 67.787  1.00 10.77 ? 205  VAL A CB  1 
ATOM   1575 C  CG1 . VAL A 1 205 ? 12.707 27.430 66.266  1.00 8.84  ? 205  VAL A CG1 1 
ATOM   1576 C  CG2 . VAL A 1 205 ? 13.190 28.578 68.408  1.00 11.01 ? 205  VAL A CG2 1 
ATOM   1577 N  N   . LYS A 1 206 ? 9.721  25.458 67.126  1.00 13.83 ? 206  LYS A N   1 
ATOM   1578 C  CA  . LYS A 1 206 ? 9.191  24.259 66.509  1.00 13.95 ? 206  LYS A CA  1 
ATOM   1579 C  C   . LYS A 1 206 ? 9.557  24.250 65.050  1.00 12.77 ? 206  LYS A C   1 
ATOM   1580 O  O   . LYS A 1 206 ? 9.294  25.188 64.307  1.00 13.96 ? 206  LYS A O   1 
ATOM   1581 C  CB  . LYS A 1 206 ? 7.688  24.227 66.707  1.00 15.28 ? 206  LYS A CB  1 
ATOM   1582 C  CG  . LYS A 1 206 ? 7.050  23.041 66.038  1.00 24.06 ? 206  LYS A CG  1 
ATOM   1583 C  CD  . LYS A 1 206 ? 5.691  22.797 66.685  1.00 31.06 ? 206  LYS A CD  1 
ATOM   1584 C  CE  . LYS A 1 206 ? 4.710  22.102 65.733  1.00 37.15 ? 206  LYS A CE  1 
ATOM   1585 N  NZ  . LYS A 1 206 ? 4.360  23.000 64.614  1.00 46.15 ? 206  LYS A NZ  1 
ATOM   1586 N  N   . LEU A 1 207 ? 10.219 23.170 64.669  1.00 14.32 ? 207  LEU A N   1 
ATOM   1587 C  CA  . LEU A 1 207 ? 10.670 22.958 63.328  1.00 15.84 ? 207  LEU A CA  1 
ATOM   1588 C  C   . LEU A 1 207 ? 9.699  21.974 62.757  1.00 17.63 ? 207  LEU A C   1 
ATOM   1589 O  O   . LEU A 1 207 ? 9.369  20.930 63.335  1.00 16.78 ? 207  LEU A O   1 
ATOM   1590 C  CB  . LEU A 1 207 ? 12.091 22.358 63.282  1.00 17.39 ? 207  LEU A CB  1 
ATOM   1591 C  CG  . LEU A 1 207 ? 13.213 23.111 64.046  1.00 17.03 ? 207  LEU A CG  1 
ATOM   1592 C  CD1 . LEU A 1 207 ? 14.510 22.336 63.893  1.00 16.35 ? 207  LEU A CD1 1 
ATOM   1593 C  CD2 . LEU A 1 207 ? 13.354 24.529 63.527  1.00 14.06 ? 207  LEU A CD2 1 
ATOM   1594 N  N   . THR A 1 208 ? 9.319  22.333 61.551  1.00 19.64 ? 208  THR A N   1 
ATOM   1595 C  CA  . THR A 1 208 ? 8.340  21.597 60.803  1.00 23.16 ? 208  THR A CA  1 
ATOM   1596 C  C   . THR A 1 208 ? 8.922  21.334 59.418  1.00 24.82 ? 208  THR A C   1 
ATOM   1597 O  O   . THR A 1 208 ? 9.906  21.983 59.046  1.00 24.73 ? 208  THR A O   1 
ATOM   1598 C  CB  . THR A 1 208 ? 7.131  22.547 60.964  1.00 22.89 ? 208  THR A CB  1 
ATOM   1599 O  OG1 . THR A 1 208 ? 6.305  21.872 61.923  1.00 24.88 ? 208  THR A OG1 1 
ATOM   1600 C  CG2 . THR A 1 208 ? 6.514  22.983 59.689  1.00 19.08 ? 208  THR A CG2 1 
ATOM   1601 N  N   . GLY A 1 209 ? 8.398  20.363 58.652  1.00 26.10 ? 209  GLY A N   1 
ATOM   1602 C  CA  . GLY A 1 209 ? 8.868  20.070 57.296  1.00 24.76 ? 209  GLY A CA  1 
ATOM   1603 C  C   . GLY A 1 209 ? 10.246 19.435 57.299  1.00 24.74 ? 209  GLY A C   1 
ATOM   1604 O  O   . GLY A 1 209 ? 10.611 18.779 58.277  1.00 24.60 ? 209  GLY A O   1 
ATOM   1605 N  N   . SER A 1 210 ? 11.001 19.586 56.219  1.00 23.97 ? 210  SER A N   1 
ATOM   1606 C  CA  . SER A 1 210 ? 12.338 19.075 56.223  1.00 26.13 ? 210  SER A CA  1 
ATOM   1607 C  C   . SER A 1 210 ? 13.204 19.921 55.297  1.00 26.29 ? 210  SER A C   1 
ATOM   1608 O  O   . SER A 1 210 ? 12.676 20.586 54.405  1.00 26.65 ? 210  SER A O   1 
ATOM   1609 C  CB  . SER A 1 210 ? 12.327 17.603 55.779  1.00 27.50 ? 210  SER A CB  1 
ATOM   1610 O  OG  . SER A 1 210 ? 11.909 17.336 54.457  1.00 30.88 ? 210  SER A OG  1 
ATOM   1611 N  N   . LEU A 1 211 ? 14.521 19.962 55.506  1.00 28.02 ? 211  LEU A N   1 
ATOM   1612 C  CA  . LEU A 1 211 ? 15.369 20.776 54.647  1.00 27.36 ? 211  LEU A CA  1 
ATOM   1613 C  C   . LEU A 1 211 ? 15.469 20.178 53.259  1.00 27.16 ? 211  LEU A C   1 
ATOM   1614 O  O   . LEU A 1 211 ? 15.477 18.965 53.111  1.00 30.15 ? 211  LEU A O   1 
ATOM   1615 C  CB  . LEU A 1 211 ? 16.776 20.896 55.255  1.00 24.67 ? 211  LEU A CB  1 
ATOM   1616 C  CG  . LEU A 1 211 ? 16.860 21.670 56.543  1.00 21.86 ? 211  LEU A CG  1 
ATOM   1617 C  CD1 . LEU A 1 211 ? 18.157 21.338 57.213  1.00 22.63 ? 211  LEU A CD1 1 
ATOM   1618 C  CD2 . LEU A 1 211 ? 16.633 23.137 56.271  1.00 22.90 ? 211  LEU A CD2 1 
ATOM   1619 N  N   . SER A 1 212 ? 15.616 20.945 52.202  1.00 31.19 ? 212  SER A N   1 
ATOM   1620 C  CA  . SER A 1 212 ? 15.819 20.396 50.870  1.00 33.84 ? 212  SER A CA  1 
ATOM   1621 C  C   . SER A 1 212 ? 16.660 21.335 49.997  1.00 32.02 ? 212  SER A C   1 
ATOM   1622 O  O   . SER A 1 212 ? 16.608 22.575 50.101  1.00 31.65 ? 212  SER A O   1 
ATOM   1623 C  CB  . SER A 1 212 ? 14.450 20.134 50.172  1.00 35.20 ? 212  SER A CB  1 
ATOM   1624 O  OG  . SER A 1 212 ? 13.649 21.305 49.970  1.00 38.56 ? 212  SER A OG  1 
ATOM   1625 N  N   . GLY A 1 213 ? 17.457 20.731 49.117  1.00 31.25 ? 213  GLY A N   1 
ATOM   1626 C  CA  . GLY A 1 213 ? 18.216 21.483 48.146  1.00 30.32 ? 213  GLY A CA  1 
ATOM   1627 C  C   . GLY A 1 213 ? 19.334 22.252 48.805  1.00 25.85 ? 213  GLY A C   1 
ATOM   1628 O  O   . GLY A 1 213 ? 20.101 21.717 49.621  1.00 28.23 ? 213  GLY A O   1 
ATOM   1629 N  N   . TRP A 1 214 ? 19.353 23.528 48.440  1.00 25.81 ? 214  TRP A N   1 
ATOM   1630 C  CA  . TRP A 1 214 ? 20.394 24.410 48.929  1.00 26.41 ? 214  TRP A CA  1 
ATOM   1631 C  C   . TRP A 1 214 ? 20.228 24.830 50.370  1.00 25.48 ? 214  TRP A C   1 
ATOM   1632 O  O   . TRP A 1 214 ? 21.210 25.244 50.972  1.00 26.26 ? 214  TRP A O   1 
ATOM   1633 C  CB  . TRP A 1 214 ? 20.473 25.656 48.065  1.00 27.24 ? 214  TRP A CB  1 
ATOM   1634 C  CG  . TRP A 1 214 ? 21.137 25.452 46.703  1.00 29.63 ? 214  TRP A CG  1 
ATOM   1635 C  CD1 . TRP A 1 214 ? 20.402 25.168 45.582  1.00 30.57 ? 214  TRP A CD1 1 
ATOM   1636 C  CD2 . TRP A 1 214 ? 22.483 25.552 46.429  1.00 30.28 ? 214  TRP A CD2 1 
ATOM   1637 N  NE1 . TRP A 1 214 ? 21.274 25.091 44.602  1.00 30.05 ? 214  TRP A NE1 1 
ATOM   1638 C  CE2 . TRP A 1 214 ? 22.517 25.314 45.064  1.00 29.64 ? 214  TRP A CE2 1 
ATOM   1639 C  CE3 . TRP A 1 214 ? 23.649 25.816 47.122  1.00 30.54 ? 214  TRP A CE3 1 
ATOM   1640 C  CZ2 . TRP A 1 214 ? 23.707 25.334 44.365  1.00 27.60 ? 214  TRP A CZ2 1 
ATOM   1641 C  CZ3 . TRP A 1 214 ? 24.839 25.841 46.421  1.00 27.98 ? 214  TRP A CZ3 1 
ATOM   1642 C  CH2 . TRP A 1 214 ? 24.862 25.601 45.059  1.00 27.16 ? 214  TRP A CH2 1 
ATOM   1643 N  N   . THR A 1 215 ? 19.044 24.682 50.967  1.00 23.43 ? 215  THR A N   1 
ATOM   1644 C  CA  . THR A 1 215 ? 18.862 25.133 52.335  1.00 20.79 ? 215  THR A CA  1 
ATOM   1645 C  C   . THR A 1 215 ? 19.556 24.165 53.277  1.00 18.87 ? 215  THR A C   1 
ATOM   1646 O  O   . THR A 1 215 ? 19.517 22.946 53.082  1.00 18.82 ? 215  THR A O   1 
ATOM   1647 C  CB  . THR A 1 215 ? 17.353 25.239 52.579  1.00 19.31 ? 215  THR A CB  1 
ATOM   1648 O  OG1 . THR A 1 215 ? 16.864 25.982 51.455  1.00 23.93 ? 215  THR A OG1 1 
ATOM   1649 C  CG2 . THR A 1 215 ? 16.982 25.931 53.859  1.00 18.24 ? 215  THR A CG2 1 
ATOM   1650 N  N   . SER A 1 216 ? 20.192 24.694 54.312  1.00 16.41 ? 216  SER A N   1 
ATOM   1651 C  CA  . SER A 1 216 ? 20.997 23.855 55.132  1.00 14.87 ? 216  SER A CA  1 
ATOM   1652 C  C   . SER A 1 216 ? 20.733 24.210 56.563  1.00 14.04 ? 216  SER A C   1 
ATOM   1653 O  O   . SER A 1 216 ? 20.014 25.182 56.822  1.00 16.13 ? 216  SER A O   1 
ATOM   1654 C  CB  . SER A 1 216 ? 22.434 24.099 54.684  1.00 17.27 ? 216  SER A CB  1 
ATOM   1655 O  OG  . SER A 1 216 ? 23.050 25.286 55.164  1.00 19.03 ? 216  SER A OG  1 
ATOM   1656 N  N   . PRO A 1 217 ? 21.266 23.509 57.567  1.00 12.16 ? 217  PRO A N   1 
ATOM   1657 C  CA  . PRO A 1 217 ? 21.079 23.886 58.969  1.00 11.10 ? 217  PRO A CA  1 
ATOM   1658 C  C   . PRO A 1 217 ? 21.428 25.329 59.340  1.00 11.85 ? 217  PRO A C   1 
ATOM   1659 O  O   . PRO A 1 217 ? 20.770 25.924 60.188  1.00 15.70 ? 217  PRO A O   1 
ATOM   1660 C  CB  . PRO A 1 217 ? 21.907 22.866 59.702  1.00 10.41 ? 217  PRO A CB  1 
ATOM   1661 C  CG  . PRO A 1 217 ? 21.707 21.653 58.823  1.00 11.30 ? 217  PRO A CG  1 
ATOM   1662 C  CD  . PRO A 1 217 ? 21.891 22.200 57.437  1.00 8.79  ? 217  PRO A CD  1 
ATOM   1663 N  N   . LYS A 1 218 ? 22.439 25.945 58.705  1.00 11.53 ? 218  LYS A N   1 
ATOM   1664 C  CA  . LYS A 1 218 ? 22.853 27.310 58.983  1.00 14.10 ? 218  LYS A CA  1 
ATOM   1665 C  C   . LYS A 1 218 ? 21.709 28.308 58.708  1.00 12.23 ? 218  LYS A C   1 
ATOM   1666 O  O   . LYS A 1 218 ? 21.594 29.287 59.446  1.00 13.75 ? 218  LYS A O   1 
ATOM   1667 C  CB  . LYS A 1 218 ? 24.087 27.640 58.121  1.00 11.46 ? 218  LYS A CB  1 
ATOM   1668 C  CG  . LYS A 1 218 ? 24.714 29.032 58.282  1.00 11.72 ? 218  LYS A CG  1 
ATOM   1669 C  CD  . LYS A 1 218 ? 25.212 29.363 59.684  1.00 9.19  ? 218  LYS A CD  1 
ATOM   1670 C  CE  . LYS A 1 218 ? 26.289 30.461 59.694  1.00 9.16  ? 218  LYS A CE  1 
ATOM   1671 N  NZ  . LYS A 1 218 ? 27.560 29.959 59.175  1.00 9.99  ? 218  LYS A NZ  1 
ATOM   1672 N  N   . ASP A 1 219 ? 20.853 28.063 57.706  1.00 15.27 ? 219  ASP A N   1 
ATOM   1673 C  CA  . ASP A 1 219 ? 19.723 28.930 57.364  1.00 14.76 ? 219  ASP A CA  1 
ATOM   1674 C  C   . ASP A 1 219 ? 18.686 29.035 58.434  1.00 13.67 ? 219  ASP A C   1 
ATOM   1675 O  O   . ASP A 1 219 ? 18.117 30.102 58.640  1.00 17.73 ? 219  ASP A O   1 
ATOM   1676 C  CB  . ASP A 1 219 ? 19.070 28.441 56.106  1.00 12.32 ? 219  ASP A CB  1 
ATOM   1677 C  CG  . ASP A 1 219 ? 20.010 28.643 54.943  1.00 16.27 ? 219  ASP A CG  1 
ATOM   1678 O  OD1 . ASP A 1 219 ? 20.642 29.697 54.850  1.00 16.99 ? 219  ASP A OD1 1 
ATOM   1679 O  OD2 . ASP A 1 219 ? 20.133 27.736 54.123  1.00 18.45 ? 219  ASP A OD2 1 
ATOM   1680 N  N   . VAL A 1 220 ? 18.505 27.958 59.189  1.00 13.90 ? 220  VAL A N   1 
ATOM   1681 C  CA  . VAL A 1 220 ? 17.578 27.922 60.318  1.00 12.47 ? 220  VAL A CA  1 
ATOM   1682 C  C   . VAL A 1 220 ? 18.055 28.940 61.317  1.00 11.87 ? 220  VAL A C   1 
ATOM   1683 O  O   . VAL A 1 220 ? 17.281 29.799 61.707  1.00 14.81 ? 220  VAL A O   1 
ATOM   1684 C  CB  . VAL A 1 220 ? 17.557 26.524 60.976  1.00 10.57 ? 220  VAL A CB  1 
ATOM   1685 C  CG1 . VAL A 1 220 ? 16.645 26.495 62.222  1.00 10.67 ? 220  VAL A CG1 1 
ATOM   1686 C  CG2 . VAL A 1 220 ? 17.091 25.516 59.952  1.00 10.77 ? 220  VAL A CG2 1 
ATOM   1687 N  N   . ILE A 1 221 ? 19.324 28.955 61.710  1.00 11.64 ? 221  ILE A N   1 
ATOM   1688 C  CA  . ILE A 1 221 ? 19.726 29.910 62.729  1.00 12.22 ? 221  ILE A CA  1 
ATOM   1689 C  C   . ILE A 1 221 ? 19.957 31.295 62.091  1.00 8.64  ? 221  ILE A C   1 
ATOM   1690 O  O   . ILE A 1 221 ? 19.806 32.293 62.792  1.00 10.22 ? 221  ILE A O   1 
ATOM   1691 C  CB  . ILE A 1 221 ? 20.987 29.312 63.528  1.00 10.00 ? 221  ILE A CB  1 
ATOM   1692 C  CG1 . ILE A 1 221 ? 21.354 30.237 64.664  1.00 7.48  ? 221  ILE A CG1 1 
ATOM   1693 C  CG2 . ILE A 1 221 ? 22.195 29.123 62.630  1.00 9.16  ? 221  ILE A CG2 1 
ATOM   1694 C  CD1 . ILE A 1 221 ? 20.333 30.448 65.811  1.00 11.06 ? 221  ILE A CD1 1 
ATOM   1695 N  N   . LEU A 1 222 ? 20.244 31.466 60.801  1.00 7.18  ? 222  LEU A N   1 
ATOM   1696 C  CA  . LEU A 1 222 ? 20.316 32.789 60.203  1.00 8.39  ? 222  LEU A CA  1 
ATOM   1697 C  C   . LEU A 1 222 ? 18.922 33.442 60.188  1.00 12.03 ? 222  LEU A C   1 
ATOM   1698 O  O   . LEU A 1 222 ? 18.780 34.666 60.358  1.00 11.85 ? 222  LEU A O   1 
ATOM   1699 C  CB  . LEU A 1 222 ? 20.869 32.679 58.784  1.00 6.82  ? 222  LEU A CB  1 
ATOM   1700 C  CG  . LEU A 1 222 ? 22.379 32.356 58.585  1.00 9.38  ? 222  LEU A CG  1 
ATOM   1701 C  CD1 . LEU A 1 222 ? 22.639 32.263 57.108  1.00 8.00  ? 222  LEU A CD1 1 
ATOM   1702 C  CD2 . LEU A 1 222 ? 23.281 33.428 59.128  1.00 6.41  ? 222  LEU A CD2 1 
ATOM   1703 N  N   . LYS A 1 223 ? 17.863 32.638 59.994  1.00 13.73 ? 223  LYS A N   1 
ATOM   1704 C  CA  . LYS A 1 223 ? 16.484 33.098 60.044  1.00 14.66 ? 223  LYS A CA  1 
ATOM   1705 C  C   . LYS A 1 223 ? 16.048 33.433 61.458  1.00 15.08 ? 223  LYS A C   1 
ATOM   1706 O  O   . LYS A 1 223 ? 15.520 34.524 61.675  1.00 20.19 ? 223  LYS A O   1 
ATOM   1707 C  CB  . LYS A 1 223 ? 15.620 32.030 59.489  1.00 19.20 ? 223  LYS A CB  1 
ATOM   1708 C  CG  . LYS A 1 223 ? 14.132 32.338 59.482  1.00 27.70 ? 223  LYS A CG  1 
ATOM   1709 C  CD  . LYS A 1 223 ? 13.797 33.389 58.435  1.00 33.21 ? 223  LYS A CD  1 
ATOM   1710 C  CE  . LYS A 1 223 ? 12.296 33.586 58.359  1.00 37.88 ? 223  LYS A CE  1 
ATOM   1711 N  NZ  . LYS A 1 223 ? 11.692 32.318 57.990  1.00 40.63 ? 223  LYS A NZ  1 
ATOM   1712 N  N   . VAL A 1 224 ? 16.283 32.558 62.447  1.00 11.40 ? 224  VAL A N   1 
ATOM   1713 C  CA  . VAL A 1 224 ? 15.972 32.801 63.848  1.00 10.27 ? 224  VAL A CA  1 
ATOM   1714 C  C   . VAL A 1 224 ? 16.634 34.094 64.280  1.00 13.70 ? 224  VAL A C   1 
ATOM   1715 O  O   . VAL A 1 224 ? 15.962 34.927 64.884  1.00 16.45 ? 224  VAL A O   1 
ATOM   1716 C  CB  . VAL A 1 224 ? 16.465 31.588 64.702  1.00 9.16  ? 224  VAL A CB  1 
ATOM   1717 C  CG1 . VAL A 1 224 ? 16.308 31.828 66.196  1.00 12.76 ? 224  VAL A CG1 1 
ATOM   1718 C  CG2 . VAL A 1 224 ? 15.601 30.384 64.417  1.00 11.58 ? 224  VAL A CG2 1 
ATOM   1719 N  N   . ALA A 1 225 ? 17.935 34.351 64.015  1.00 17.21 ? 225  ALA A N   1 
ATOM   1720 C  CA  . ALA A 1 225 ? 18.609 35.598 64.401  1.00 15.35 ? 225  ALA A CA  1 
ATOM   1721 C  C   . ALA A 1 225 ? 17.948 36.840 63.775  1.00 13.62 ? 225  ALA A C   1 
ATOM   1722 O  O   . ALA A 1 225 ? 17.721 37.836 64.461  1.00 14.15 ? 225  ALA A O   1 
ATOM   1723 C  CB  . ALA A 1 225 ? 20.086 35.530 63.971  1.00 14.84 ? 225  ALA A CB  1 
ATOM   1724 N  N   . GLY A 1 226 ? 17.592 36.839 62.495  1.00 12.29 ? 226  GLY A N   1 
ATOM   1725 C  CA  . GLY A 1 226 ? 16.871 37.951 61.929  1.00 12.05 ? 226  GLY A CA  1 
ATOM   1726 C  C   . GLY A 1 226 ? 15.528 38.132 62.638  1.00 17.82 ? 226  GLY A C   1 
ATOM   1727 O  O   . GLY A 1 226 ? 15.110 39.269 62.785  1.00 18.93 ? 226  GLY A O   1 
ATOM   1728 N  N   . ILE A 1 227 ? 14.844 37.076 63.127  1.00 17.76 ? 227  ILE A N   1 
ATOM   1729 C  CA  . ILE A 1 227 ? 13.565 37.187 63.806  1.00 15.47 ? 227  ILE A CA  1 
ATOM   1730 C  C   . ILE A 1 227 ? 13.719 37.747 65.211  1.00 15.50 ? 227  ILE A C   1 
ATOM   1731 O  O   . ILE A 1 227 ? 13.108 38.752 65.551  1.00 16.13 ? 227  ILE A O   1 
ATOM   1732 C  CB  . ILE A 1 227 ? 12.885 35.778 63.846  1.00 14.73 ? 227  ILE A CB  1 
ATOM   1733 C  CG1 . ILE A 1 227 ? 12.456 35.380 62.470  1.00 13.12 ? 227  ILE A CG1 1 
ATOM   1734 C  CG2 . ILE A 1 227 ? 11.633 35.790 64.712  1.00 16.73 ? 227  ILE A CG2 1 
ATOM   1735 C  CD1 . ILE A 1 227 ? 12.134 33.862 62.422  1.00 17.92 ? 227  ILE A CD1 1 
ATOM   1736 N  N   . LEU A 1 228 ? 14.515 37.105 66.052  1.00 15.53 ? 228  LEU A N   1 
ATOM   1737 C  CA  . LEU A 1 228 ? 14.719 37.488 67.443  1.00 16.67 ? 228  LEU A CA  1 
ATOM   1738 C  C   . LEU A 1 228 ? 15.583 38.712 67.714  1.00 14.74 ? 228  LEU A C   1 
ATOM   1739 O  O   . LEU A 1 228 ? 15.453 39.345 68.765  1.00 14.92 ? 228  LEU A O   1 
ATOM   1740 C  CB  . LEU A 1 228 ? 15.314 36.292 68.176  1.00 17.39 ? 228  LEU A CB  1 
ATOM   1741 C  CG  . LEU A 1 228 ? 14.531 35.427 69.166  1.00 23.01 ? 228  LEU A CG  1 
ATOM   1742 C  CD1 . LEU A 1 228 ? 13.064 35.786 69.187  1.00 25.39 ? 228  LEU A CD1 1 
ATOM   1743 C  CD2 . LEU A 1 228 ? 14.715 33.975 68.781  1.00 21.24 ? 228  LEU A CD2 1 
ATOM   1744 N  N   . THR A 1 229 ? 16.476 39.014 66.772  1.00 13.95 ? 229  THR A N   1 
ATOM   1745 C  CA  . THR A 1 229 ? 17.496 40.054 66.785  1.00 14.85 ? 229  THR A CA  1 
ATOM   1746 C  C   . THR A 1 229 ? 18.623 39.647 67.758  1.00 13.47 ? 229  THR A C   1 
ATOM   1747 O  O   . THR A 1 229 ? 18.429 38.725 68.544  1.00 10.58 ? 229  THR A O   1 
ATOM   1748 C  CB  . THR A 1 229 ? 16.931 41.497 67.202  1.00 13.92 ? 229  THR A CB  1 
ATOM   1749 O  OG1 . THR A 1 229 ? 16.813 41.619 68.620  1.00 13.57 ? 229  THR A OG1 1 
ATOM   1750 C  CG2 . THR A 1 229 ? 15.564 41.736 66.573  1.00 17.79 ? 229  THR A CG2 1 
ATOM   1751 N  N   . VAL A 1 230 ? 19.772 40.362 67.827  1.00 12.72 ? 230  VAL A N   1 
ATOM   1752 C  CA  . VAL A 1 230 ? 20.886 40.037 68.690  1.00 12.13 ? 230  VAL A CA  1 
ATOM   1753 C  C   . VAL A 1 230 ? 20.574 40.164 70.169  1.00 15.68 ? 230  VAL A C   1 
ATOM   1754 O  O   . VAL A 1 230 ? 21.296 39.625 71.026  1.00 14.96 ? 230  VAL A O   1 
ATOM   1755 C  CB  . VAL A 1 230 ? 22.111 40.923 68.335  1.00 14.17 ? 230  VAL A CB  1 
ATOM   1756 C  CG1 . VAL A 1 230 ? 22.648 40.594 66.949  1.00 9.72  ? 230  VAL A CG1 1 
ATOM   1757 C  CG2 . VAL A 1 230 ? 21.712 42.376 68.406  1.00 13.14 ? 230  VAL A CG2 1 
ATOM   1758 N  N   . LYS A 1 231 ? 19.507 40.857 70.560  1.00 16.84 ? 231  LYS A N   1 
ATOM   1759 C  CA  . LYS A 1 231 ? 19.242 40.847 71.982  1.00 18.65 ? 231  LYS A CA  1 
ATOM   1760 C  C   . LYS A 1 231 ? 17.994 40.032 72.301  1.00 18.23 ? 231  LYS A C   1 
ATOM   1761 O  O   . LYS A 1 231 ? 17.643 39.893 73.467  1.00 20.12 ? 231  LYS A O   1 
ATOM   1762 C  CB  . LYS A 1 231 ? 19.139 42.308 72.495  1.00 24.48 ? 231  LYS A CB  1 
ATOM   1763 C  CG  . LYS A 1 231 ? 18.223 43.302 71.784  1.00 31.06 ? 231  LYS A CG  1 
ATOM   1764 C  CD  . LYS A 1 231 ? 18.085 44.659 72.511  1.00 40.42 ? 231  LYS A CD  1 
ATOM   1765 C  CE  . LYS A 1 231 ? 17.472 44.481 73.943  1.00 46.50 ? 231  LYS A CE  1 
ATOM   1766 N  NZ  . LYS A 1 231 ? 17.199 45.694 74.726  1.00 48.51 ? 231  LYS A NZ  1 
ATOM   1767 N  N   . GLY A 1 232 ? 17.369 39.347 71.340  1.00 18.08 ? 232  GLY A N   1 
ATOM   1768 C  CA  . GLY A 1 232 ? 16.112 38.681 71.607  1.00 17.54 ? 232  GLY A CA  1 
ATOM   1769 C  C   . GLY A 1 232 ? 16.250 37.436 72.441  1.00 20.23 ? 232  GLY A C   1 
ATOM   1770 O  O   . GLY A 1 232 ? 15.272 36.998 73.052  1.00 20.16 ? 232  GLY A O   1 
ATOM   1771 N  N   . GLY A 1 233 ? 17.420 36.808 72.540  1.00 19.26 ? 233  GLY A N   1 
ATOM   1772 C  CA  . GLY A 1 233 ? 17.528 35.567 73.287  1.00 14.52 ? 233  GLY A CA  1 
ATOM   1773 C  C   . GLY A 1 233 ? 18.052 35.770 74.674  1.00 14.63 ? 233  GLY A C   1 
ATOM   1774 O  O   . GLY A 1 233 ? 18.237 34.782 75.387  1.00 15.15 ? 233  GLY A O   1 
ATOM   1775 N  N   . THR A 1 234 ? 18.324 37.003 75.109  1.00 13.94 ? 234  THR A N   1 
ATOM   1776 C  CA  . THR A 1 234 ? 18.957 37.229 76.406  1.00 13.59 ? 234  THR A CA  1 
ATOM   1777 C  C   . THR A 1 234 ? 18.191 36.590 77.570  1.00 16.20 ? 234  THR A C   1 
ATOM   1778 O  O   . THR A 1 234 ? 16.977 36.762 77.651  1.00 18.29 ? 234  THR A O   1 
ATOM   1779 C  CB  . THR A 1 234 ? 19.073 38.733 76.687  1.00 14.60 ? 234  THR A CB  1 
ATOM   1780 O  OG1 . THR A 1 234 ? 19.593 39.346 75.529  1.00 17.04 ? 234  THR A OG1 1 
ATOM   1781 C  CG2 . THR A 1 234 ? 20.018 39.029 77.834  1.00 15.44 ? 234  THR A CG2 1 
ATOM   1782 N  N   . GLY A 1 235 ? 18.837 35.820 78.467  1.00 15.52 ? 235  GLY A N   1 
ATOM   1783 C  CA  . GLY A 1 235 ? 18.199 35.266 79.661  1.00 10.28 ? 235  GLY A CA  1 
ATOM   1784 C  C   . GLY A 1 235 ? 17.432 33.983 79.363  1.00 9.37  ? 235  GLY A C   1 
ATOM   1785 O  O   . GLY A 1 235 ? 16.835 33.401 80.260  1.00 15.66 ? 235  GLY A O   1 
ATOM   1786 N  N   . ALA A 1 236 ? 17.444 33.494 78.137  1.00 10.00 ? 236  ALA A N   1 
ATOM   1787 C  CA  . ALA A 1 236 ? 16.711 32.312 77.766  1.00 9.01  ? 236  ALA A CA  1 
ATOM   1788 C  C   . ALA A 1 236 ? 17.539 31.181 77.188  1.00 9.59  ? 236  ALA A C   1 
ATOM   1789 O  O   . ALA A 1 236 ? 18.603 31.409 76.606  1.00 10.57 ? 236  ALA A O   1 
ATOM   1790 C  CB  . ALA A 1 236 ? 15.688 32.718 76.733  1.00 6.44  ? 236  ALA A CB  1 
ATOM   1791 N  N   . ILE A 1 237 ? 17.094 29.933 77.307  1.00 11.92 ? 237  ILE A N   1 
ATOM   1792 C  CA  . ILE A 1 237 ? 17.659 28.824 76.543  1.00 8.26  ? 237  ILE A CA  1 
ATOM   1793 C  C   . ILE A 1 237 ? 16.733 28.582 75.364  1.00 10.64 ? 237  ILE A C   1 
ATOM   1794 O  O   . ILE A 1 237 ? 15.504 28.668 75.517  1.00 11.98 ? 237  ILE A O   1 
ATOM   1795 C  CB  . ILE A 1 237 ? 17.773 27.561 77.420  1.00 6.73  ? 237  ILE A CB  1 
ATOM   1796 C  CG1 . ILE A 1 237 ? 18.821 27.901 78.462  1.00 4.92  ? 237  ILE A CG1 1 
ATOM   1797 C  CG2 . ILE A 1 237 ? 18.140 26.278 76.616  1.00 8.18  ? 237  ILE A CG2 1 
ATOM   1798 C  CD1 . ILE A 1 237 ? 19.200 26.761 79.414  1.00 4.90  ? 237  ILE A CD1 1 
ATOM   1799 N  N   . VAL A 1 238 ? 17.276 28.353 74.168  1.00 7.88  ? 238  VAL A N   1 
ATOM   1800 C  CA  . VAL A 1 238 ? 16.477 28.055 72.996  1.00 8.63  ? 238  VAL A CA  1 
ATOM   1801 C  C   . VAL A 1 238 ? 16.388 26.542 72.873  1.00 11.77 ? 238  VAL A C   1 
ATOM   1802 O  O   . VAL A 1 238 ? 17.402 25.830 72.805  1.00 12.22 ? 238  VAL A O   1 
ATOM   1803 C  CB  . VAL A 1 238 ? 17.092 28.654 71.711  1.00 7.71  ? 238  VAL A CB  1 
ATOM   1804 C  CG1 . VAL A 1 238 ? 16.188 28.446 70.527  1.00 7.56  ? 238  VAL A CG1 1 
ATOM   1805 C  CG2 . VAL A 1 238 ? 17.227 30.166 71.882  1.00 10.74 ? 238  VAL A CG2 1 
ATOM   1806 N  N   . GLU A 1 239 ? 15.168 26.017 72.826  1.00 10.75 ? 239  GLU A N   1 
ATOM   1807 C  CA  . GLU A 1 239 ? 14.915 24.595 72.793  1.00 11.40 ? 239  GLU A CA  1 
ATOM   1808 C  C   . GLU A 1 239 ? 14.173 24.212 71.515  1.00 13.17 ? 239  GLU A C   1 
ATOM   1809 O  O   . GLU A 1 239 ? 12.996 24.568 71.269  1.00 17.00 ? 239  GLU A O   1 
ATOM   1810 C  CB  . GLU A 1 239 ? 14.148 24.307 74.065  1.00 9.41  ? 239  GLU A CB  1 
ATOM   1811 C  CG  . GLU A 1 239 ? 13.894 22.830 74.170  1.00 14.64 ? 239  GLU A CG  1 
ATOM   1812 C  CD  . GLU A 1 239 ? 13.418 22.426 75.537  1.00 16.09 ? 239  GLU A CD  1 
ATOM   1813 O  OE1 . GLU A 1 239 ? 14.012 22.864 76.520  1.00 17.47 ? 239  GLU A OE1 1 
ATOM   1814 O  OE2 . GLU A 1 239 ? 12.484 21.630 75.659  1.00 19.54 ? 239  GLU A OE2 1 
ATOM   1815 N  N   . TYR A 1 240 ? 14.872 23.492 70.638  1.00 12.78 ? 240  TYR A N   1 
ATOM   1816 C  CA  . TYR A 1 240 ? 14.333 23.093 69.366  1.00 11.12 ? 240  TYR A CA  1 
ATOM   1817 C  C   . TYR A 1 240 ? 13.538 21.823 69.524  1.00 14.40 ? 240  TYR A C   1 
ATOM   1818 O  O   . TYR A 1 240 ? 13.923 20.934 70.272  1.00 14.16 ? 240  TYR A O   1 
ATOM   1819 C  CB  . TYR A 1 240 ? 15.415 22.848 68.388  1.00 9.56  ? 240  TYR A CB  1 
ATOM   1820 C  CG  . TYR A 1 240 ? 16.125 24.150 68.091  1.00 11.37 ? 240  TYR A CG  1 
ATOM   1821 C  CD1 . TYR A 1 240 ? 17.115 24.650 68.925  1.00 7.93  ? 240  TYR A CD1 1 
ATOM   1822 C  CD2 . TYR A 1 240 ? 15.709 24.851 66.977  1.00 14.68 ? 240  TYR A CD2 1 
ATOM   1823 C  CE1 . TYR A 1 240 ? 17.684 25.872 68.642  1.00 10.76 ? 240  TYR A CE1 1 
ATOM   1824 C  CE2 . TYR A 1 240 ? 16.268 26.084 66.683  1.00 13.52 ? 240  TYR A CE2 1 
ATOM   1825 C  CZ  . TYR A 1 240 ? 17.240 26.576 67.529  1.00 13.80 ? 240  TYR A CZ  1 
ATOM   1826 O  OH  . TYR A 1 240 ? 17.714 27.835 67.267  1.00 12.55 ? 240  TYR A OH  1 
ATOM   1827 N  N   . HIS A 1 241 ? 12.389 21.729 68.848  1.00 16.91 ? 241  HIS A N   1 
ATOM   1828 C  CA  . HIS A 1 241 ? 11.537 20.541 68.948  1.00 15.62 ? 241  HIS A CA  1 
ATOM   1829 C  C   . HIS A 1 241 ? 10.674 20.471 67.699  1.00 16.85 ? 241  HIS A C   1 
ATOM   1830 O  O   . HIS A 1 241 ? 10.776 21.330 66.820  1.00 15.79 ? 241  HIS A O   1 
ATOM   1831 C  CB  . HIS A 1 241 ? 10.651 20.602 70.194  1.00 14.00 ? 241  HIS A CB  1 
ATOM   1832 C  CG  . HIS A 1 241 ? 9.763  21.840 70.250  1.00 15.60 ? 241  HIS A CG  1 
ATOM   1833 N  ND1 . HIS A 1 241 ? 10.131 23.090 70.534  1.00 17.15 ? 241  HIS A ND1 1 
ATOM   1834 C  CD2 . HIS A 1 241 ? 8.412  21.857 69.985  1.00 13.75 ? 241  HIS A CD2 1 
ATOM   1835 C  CE1 . HIS A 1 241 ? 9.056  23.848 70.445  1.00 16.55 ? 241  HIS A CE1 1 
ATOM   1836 N  NE2 . HIS A 1 241 ? 8.036  23.107 70.120  1.00 15.60 ? 241  HIS A NE2 1 
ATOM   1837 N  N   . GLY A 1 242 ? 9.826  19.461 67.543  1.00 19.86 ? 242  GLY A N   1 
ATOM   1838 C  CA  . GLY A 1 242 ? 8.975  19.381 66.381  1.00 20.59 ? 242  GLY A CA  1 
ATOM   1839 C  C   . GLY A 1 242 ? 9.409  18.250 65.452  1.00 22.81 ? 242  GLY A C   1 
ATOM   1840 O  O   . GLY A 1 242 ? 10.536 17.758 65.525  1.00 25.90 ? 242  GLY A O   1 
ATOM   1841 N  N   . PRO A 1 243 ? 8.548  17.802 64.532  1.00 24.42 ? 243  PRO A N   1 
ATOM   1842 C  CA  . PRO A 1 243 ? 8.843  16.764 63.544  1.00 23.84 ? 243  PRO A CA  1 
ATOM   1843 C  C   . PRO A 1 243 ? 9.998  17.070 62.609  1.00 23.61 ? 243  PRO A C   1 
ATOM   1844 O  O   . PRO A 1 243 ? 10.646 16.167 62.099  1.00 26.63 ? 243  PRO A O   1 
ATOM   1845 C  CB  . PRO A 1 243 ? 7.523  16.581 62.823  1.00 24.96 ? 243  PRO A CB  1 
ATOM   1846 C  CG  . PRO A 1 243 ? 6.929  17.973 62.888  1.00 23.06 ? 243  PRO A CG  1 
ATOM   1847 C  CD  . PRO A 1 243 ? 7.204  18.334 64.334  1.00 22.92 ? 243  PRO A CD  1 
ATOM   1848 N  N   . GLY A 1 244 ? 10.334 18.328 62.373  1.00 21.78 ? 244  GLY A N   1 
ATOM   1849 C  CA  . GLY A 1 244 ? 11.397 18.662 61.449  1.00 21.89 ? 244  GLY A CA  1 
ATOM   1850 C  C   . GLY A 1 244 ? 12.773 18.357 62.026  1.00 21.41 ? 244  GLY A C   1 
ATOM   1851 O  O   . GLY A 1 244 ? 13.728 18.212 61.259  1.00 22.91 ? 244  GLY A O   1 
ATOM   1852 N  N   . VAL A 1 245 ? 12.907 18.219 63.344  1.00 20.01 ? 245  VAL A N   1 
ATOM   1853 C  CA  . VAL A 1 245 ? 14.171 17.936 64.013  1.00 24.04 ? 245  VAL A CA  1 
ATOM   1854 C  C   . VAL A 1 245 ? 14.916 16.706 63.467  1.00 28.66 ? 245  VAL A C   1 
ATOM   1855 O  O   . VAL A 1 245 ? 16.138 16.712 63.285  1.00 30.55 ? 245  VAL A O   1 
ATOM   1856 C  CB  . VAL A 1 245 ? 13.851 17.795 65.518  1.00 20.44 ? 245  VAL A CB  1 
ATOM   1857 C  CG1 . VAL A 1 245 ? 14.957 17.113 66.291  1.00 24.01 ? 245  VAL A CG1 1 
ATOM   1858 C  CG2 . VAL A 1 245 ? 13.731 19.172 66.098  1.00 18.84 ? 245  VAL A CG2 1 
ATOM   1859 N  N   . ASP A 1 246 ? 14.196 15.652 63.105  1.00 31.50 ? 246  ASP A N   1 
ATOM   1860 C  CA  . ASP A 1 246 ? 14.817 14.446 62.615  1.00 34.46 ? 246  ASP A CA  1 
ATOM   1861 C  C   . ASP A 1 246 ? 15.327 14.564 61.202  1.00 30.82 ? 246  ASP A C   1 
ATOM   1862 O  O   . ASP A 1 246 ? 16.003 13.678 60.681  1.00 31.80 ? 246  ASP A O   1 
ATOM   1863 C  CB  . ASP A 1 246 ? 13.792 13.321 62.774  1.00 44.28 ? 246  ASP A CB  1 
ATOM   1864 C  CG  . ASP A 1 246 ? 13.816 12.912 64.246  1.00 51.55 ? 246  ASP A CG  1 
ATOM   1865 O  OD1 . ASP A 1 246 ? 14.750 12.184 64.633  1.00 56.61 ? 246  ASP A OD1 1 
ATOM   1866 O  OD2 . ASP A 1 246 ? 12.950 13.340 65.023  1.00 54.83 ? 246  ASP A OD2 1 
ATOM   1867 N  N   . SER A 1 247 ? 15.081 15.677 60.543  1.00 26.89 ? 247  SER A N   1 
ATOM   1868 C  CA  . SER A 1 247 ? 15.569 15.904 59.211  1.00 25.03 ? 247  SER A CA  1 
ATOM   1869 C  C   . SER A 1 247 ? 16.983 16.472 59.302  1.00 26.18 ? 247  SER A C   1 
ATOM   1870 O  O   . SER A 1 247 ? 17.645 16.541 58.265  1.00 28.25 ? 247  SER A O   1 
ATOM   1871 C  CB  . SER A 1 247 ? 14.579 16.861 58.550  1.00 26.82 ? 247  SER A CB  1 
ATOM   1872 O  OG  . SER A 1 247 ? 14.987 18.118 57.974  1.00 28.63 ? 247  SER A OG  1 
ATOM   1873 N  N   . ILE A 1 248 ? 17.530 16.825 60.480  1.00 21.95 ? 248  ILE A N   1 
ATOM   1874 C  CA  . ILE A 1 248 ? 18.809 17.520 60.565  1.00 21.16 ? 248  ILE A CA  1 
ATOM   1875 C  C   . ILE A 1 248 ? 19.897 16.584 61.097  1.00 18.45 ? 248  ILE A C   1 
ATOM   1876 O  O   . ILE A 1 248 ? 19.606 15.805 62.005  1.00 18.02 ? 248  ILE A O   1 
ATOM   1877 C  CB  . ILE A 1 248 ? 18.604 18.764 61.483  1.00 19.92 ? 248  ILE A CB  1 
ATOM   1878 C  CG1 . ILE A 1 248 ? 17.465 19.601 60.889  1.00 18.53 ? 248  ILE A CG1 1 
ATOM   1879 C  CG2 . ILE A 1 248 ? 19.874 19.597 61.583  1.00 15.99 ? 248  ILE A CG2 1 
ATOM   1880 C  CD1 . ILE A 1 248 ? 17.109 20.781 61.779  1.00 20.73 ? 248  ILE A CD1 1 
ATOM   1881 N  N   . SER A 1 249 ? 21.129 16.597 60.541  1.00 15.38 ? 249  SER A N   1 
ATOM   1882 C  CA  . SER A 1 249 ? 22.243 15.757 61.004  1.00 13.65 ? 249  SER A CA  1 
ATOM   1883 C  C   . SER A 1 249 ? 22.694 16.256 62.378  1.00 11.73 ? 249  SER A C   1 
ATOM   1884 O  O   . SER A 1 249 ? 22.443 17.416 62.715  1.00 10.75 ? 249  SER A O   1 
ATOM   1885 C  CB  . SER A 1 249 ? 23.401 15.881 60.067  1.00 11.64 ? 249  SER A CB  1 
ATOM   1886 O  OG  . SER A 1 249 ? 23.568 17.284 59.976  1.00 17.17 ? 249  SER A OG  1 
ATOM   1887 N  N   . CYS A 1 250 ? 23.376 15.451 63.184  1.00 10.71 ? 250  CYS A N   1 
ATOM   1888 C  CA  . CYS A 1 250 ? 23.947 15.897 64.440  1.00 12.02 ? 250  CYS A CA  1 
ATOM   1889 C  C   . CYS A 1 250 ? 24.855 17.136 64.316  1.00 12.15 ? 250  CYS A C   1 
ATOM   1890 O  O   . CYS A 1 250 ? 24.712 18.100 65.079  1.00 14.47 ? 250  CYS A O   1 
ATOM   1891 C  CB  . CYS A 1 250 ? 24.674 14.696 65.015  1.00 10.88 ? 250  CYS A CB  1 
ATOM   1892 S  SG  . CYS A 1 250 ? 25.355 15.051 66.635  1.00 12.20 ? 250  CYS A SG  1 
ATOM   1893 N  N   . THR A 1 251 ? 25.764 17.285 63.346  1.00 12.64 ? 251  THR A N   1 
ATOM   1894 C  CA  . THR A 1 251 ? 26.588 18.477 63.251  1.00 13.55 ? 251  THR A CA  1 
ATOM   1895 C  C   . THR A 1 251 ? 25.770 19.667 62.729  1.00 13.53 ? 251  THR A C   1 
ATOM   1896 O  O   . THR A 1 251 ? 26.065 20.829 63.022  1.00 13.86 ? 251  THR A O   1 
ATOM   1897 C  CB  . THR A 1 251 ? 27.757 18.144 62.361  1.00 14.52 ? 251  THR A CB  1 
ATOM   1898 O  OG1 . THR A 1 251 ? 27.248 17.421 61.281  1.00 13.26 ? 251  THR A OG1 1 
ATOM   1899 C  CG2 . THR A 1 251 ? 28.795 17.310 63.069  1.00 15.03 ? 251  THR A CG2 1 
ATOM   1900 N  N   . GLY A 1 252 ? 24.699 19.378 62.007  1.00 12.34 ? 252  GLY A N   1 
ATOM   1901 C  CA  . GLY A 1 252 ? 23.721 20.370 61.598  1.00 9.52  ? 252  GLY A CA  1 
ATOM   1902 C  C   . GLY A 1 252 ? 23.033 20.916 62.828  1.00 7.92  ? 252  GLY A C   1 
ATOM   1903 O  O   . GLY A 1 252 ? 22.838 22.114 62.936  1.00 13.21 ? 252  GLY A O   1 
ATOM   1904 N  N   . MET A 1 253 ? 22.684 20.095 63.806  1.00 10.96 ? 253  MET A N   1 
ATOM   1905 C  CA  . MET A 1 253 ? 22.070 20.556 65.024  1.00 9.16  ? 253  MET A CA  1 
ATOM   1906 C  C   . MET A 1 253 ? 23.055 21.375 65.808  1.00 12.89 ? 253  MET A C   1 
ATOM   1907 O  O   . MET A 1 253 ? 22.702 22.388 66.429  1.00 11.12 ? 253  MET A O   1 
ATOM   1908 C  CB  . MET A 1 253 ? 21.607 19.388 65.861  1.00 9.06  ? 253  MET A CB  1 
ATOM   1909 C  CG  . MET A 1 253 ? 20.393 18.678 65.192  1.00 12.53 ? 253  MET A CG  1 
ATOM   1910 S  SD  . MET A 1 253 ? 19.653 17.355 66.197  1.00 15.38 ? 253  MET A SD  1 
ATOM   1911 C  CE  . MET A 1 253 ? 20.668 15.936 65.974  1.00 9.41  ? 253  MET A CE  1 
ATOM   1912 N  N   . ALA A 1 254 ? 24.323 20.957 65.771  1.00 12.24 ? 254  ALA A N   1 
ATOM   1913 C  CA  . ALA A 1 254 ? 25.368 21.699 66.465  1.00 10.80 ? 254  ALA A CA  1 
ATOM   1914 C  C   . ALA A 1 254 ? 25.548 23.076 65.825  1.00 7.65  ? 254  ALA A C   1 
ATOM   1915 O  O   . ALA A 1 254 ? 25.690 24.059 66.570  1.00 5.92  ? 254  ALA A O   1 
ATOM   1916 C  CB  . ALA A 1 254 ? 26.670 20.875 66.416  1.00 9.41  ? 254  ALA A CB  1 
ATOM   1917 N  N   . THR A 1 255 ? 25.496 23.225 64.482  1.00 6.87  ? 255  THR A N   1 
ATOM   1918 C  CA  . THR A 1 255 ? 25.514 24.526 63.842  1.00 8.42  ? 255  THR A CA  1 
ATOM   1919 C  C   . THR A 1 255 ? 24.424 25.471 64.346  1.00 13.04 ? 255  THR A C   1 
ATOM   1920 O  O   . THR A 1 255 ? 24.676 26.655 64.641  1.00 16.14 ? 255  THR A O   1 
ATOM   1921 C  CB  . THR A 1 255 ? 25.333 24.402 62.327  1.00 9.73  ? 255  THR A CB  1 
ATOM   1922 O  OG1 . THR A 1 255 ? 26.479 23.696 61.873  1.00 11.09 ? 255  THR A OG1 1 
ATOM   1923 C  CG2 . THR A 1 255 ? 25.180 25.731 61.601  1.00 5.94  ? 255  THR A CG2 1 
ATOM   1924 N  N   . ILE A 1 256 ? 23.181 24.983 64.447  1.00 13.75 ? 256  ILE A N   1 
ATOM   1925 C  CA  . ILE A 1 256 ? 22.073 25.825 64.884  1.00 8.81  ? 256  ILE A CA  1 
ATOM   1926 C  C   . ILE A 1 256 ? 22.266 26.223 66.341  1.00 10.13 ? 256  ILE A C   1 
ATOM   1927 O  O   . ILE A 1 256 ? 22.088 27.397 66.685  1.00 13.64 ? 256  ILE A O   1 
ATOM   1928 C  CB  . ILE A 1 256 ? 20.775 25.016 64.651  1.00 9.99  ? 256  ILE A CB  1 
ATOM   1929 C  CG1 . ILE A 1 256 ? 20.517 24.877 63.167  1.00 4.33  ? 256  ILE A CG1 1 
ATOM   1930 C  CG2 . ILE A 1 256 ? 19.639 25.662 65.408  1.00 5.48  ? 256  ILE A CG2 1 
ATOM   1931 C  CD1 . ILE A 1 256 ? 19.531 23.723 62.948  1.00 7.18  ? 256  ILE A CD1 1 
ATOM   1932 N  N   . CYS A 1 257 ? 22.647 25.305 67.225  1.00 8.34  ? 257  CYS A N   1 
ATOM   1933 C  CA  . CYS A 1 257 ? 22.863 25.667 68.615  1.00 10.63 ? 257  CYS A CA  1 
ATOM   1934 C  C   . CYS A 1 257 ? 24.030 26.651 68.805  1.00 11.41 ? 257  CYS A C   1 
ATOM   1935 O  O   . CYS A 1 257 ? 23.990 27.575 69.632  1.00 12.29 ? 257  CYS A O   1 
ATOM   1936 C  CB  . CYS A 1 257 ? 23.146 24.418 69.445  1.00 10.81 ? 257  CYS A CB  1 
ATOM   1937 S  SG  . CYS A 1 257 ? 21.769 23.264 69.568  1.00 9.75  ? 257  CYS A SG  1 
ATOM   1938 N  N   . ASN A 1 258 ? 25.098 26.442 68.008  1.00 11.96 ? 258  ASN A N   1 
ATOM   1939 C  CA  . ASN A 1 258 ? 26.285 27.290 68.053  1.00 12.01 ? 258  ASN A CA  1 
ATOM   1940 C  C   . ASN A 1 258 ? 25.924 28.787 67.922  1.00 12.00 ? 258  ASN A C   1 
ATOM   1941 O  O   . ASN A 1 258 ? 26.093 29.567 68.876  1.00 10.30 ? 258  ASN A O   1 
ATOM   1942 C  CB  . ASN A 1 258 ? 27.212 26.852 66.919  1.00 10.94 ? 258  ASN A CB  1 
ATOM   1943 C  CG  . ASN A 1 258 ? 28.483 27.670 66.721  1.00 12.38 ? 258  ASN A CG  1 
ATOM   1944 O  OD1 . ASN A 1 258 ? 28.409 28.866 66.386  1.00 10.35 ? 258  ASN A OD1 1 
ATOM   1945 N  ND2 . ASN A 1 258 ? 29.660 27.055 66.840  1.00 8.27  ? 258  ASN A ND2 1 
ATOM   1946 N  N   . MET A 1 259 ? 25.288 29.144 66.795  1.00 8.90  ? 259  MET A N   1 
ATOM   1947 C  CA  . MET A 1 259 ? 25.025 30.528 66.500  1.00 9.96  ? 259  MET A CA  1 
ATOM   1948 C  C   . MET A 1 259 ? 23.889 31.185 67.287  1.00 12.45 ? 259  MET A C   1 
ATOM   1949 O  O   . MET A 1 259 ? 23.617 32.392 67.204  1.00 16.39 ? 259  MET A O   1 
ATOM   1950 C  CB  . MET A 1 259 ? 24.835 30.596 65.002  1.00 8.94  ? 259  MET A CB  1 
ATOM   1951 C  CG  . MET A 1 259 ? 25.013 32.039 64.619  1.00 10.16 ? 259  MET A CG  1 
ATOM   1952 S  SD  . MET A 1 259 ? 25.089 32.302 62.853  1.00 15.24 ? 259  MET A SD  1 
ATOM   1953 C  CE  . MET A 1 259 ? 24.827 34.046 62.967  1.00 16.03 ? 259  MET A CE  1 
ATOM   1954 N  N   . GLY A 1 260 ? 23.267 30.436 68.194  1.00 11.66 ? 260  GLY A N   1 
ATOM   1955 C  CA  . GLY A 1 260 ? 22.306 30.974 69.156  1.00 11.18 ? 260  GLY A CA  1 
ATOM   1956 C  C   . GLY A 1 260 ? 22.974 31.968 70.060  1.00 12.85 ? 260  GLY A C   1 
ATOM   1957 O  O   . GLY A 1 260 ? 22.351 32.819 70.719  1.00 11.73 ? 260  GLY A O   1 
ATOM   1958 N  N   . ALA A 1 261 ? 24.309 31.913 70.052  1.00 13.81 ? 261  ALA A N   1 
ATOM   1959 C  CA  . ALA A 1 261 ? 25.140 32.855 70.776  1.00 9.63  ? 261  ALA A CA  1 
ATOM   1960 C  C   . ALA A 1 261 ? 24.920 34.264 70.251  1.00 6.71  ? 261  ALA A C   1 
ATOM   1961 O  O   . ALA A 1 261 ? 24.960 35.197 71.060  1.00 7.63  ? 261  ALA A O   1 
ATOM   1962 C  CB  . ALA A 1 261 ? 26.637 32.525 70.610  1.00 8.21  ? 261  ALA A CB  1 
ATOM   1963 N  N   . GLU A 1 262 ? 24.656 34.432 68.956  1.00 6.30  ? 262  GLU A N   1 
ATOM   1964 C  CA  . GLU A 1 262 ? 24.456 35.730 68.387  1.00 9.43  ? 262  GLU A CA  1 
ATOM   1965 C  C   . GLU A 1 262 ? 23.118 36.423 68.690  1.00 12.40 ? 262  GLU A C   1 
ATOM   1966 O  O   . GLU A 1 262 ? 22.860 37.567 68.283  1.00 11.80 ? 262  GLU A O   1 
ATOM   1967 C  CB  . GLU A 1 262 ? 24.716 35.570 66.864  1.00 9.41  ? 262  GLU A CB  1 
ATOM   1968 C  CG  . GLU A 1 262 ? 26.228 35.762 66.549  1.00 9.95  ? 262  GLU A CG  1 
ATOM   1969 C  CD  . GLU A 1 262 ? 27.106 34.829 67.342  1.00 12.20 ? 262  GLU A CD  1 
ATOM   1970 O  OE1 . GLU A 1 262 ? 27.155 33.653 66.996  1.00 15.86 ? 262  GLU A OE1 1 
ATOM   1971 O  OE2 . GLU A 1 262 ? 27.671 35.196 68.384  1.00 14.03 ? 262  GLU A OE2 1 
ATOM   1972 N  N   . ILE A 1 263 ? 22.226 35.739 69.395  1.00 10.77 ? 263  ILE A N   1 
ATOM   1973 C  CA  . ILE A 1 263 ? 20.997 36.395 69.829  1.00 12.62 ? 263  ILE A CA  1 
ATOM   1974 C  C   . ILE A 1 263 ? 21.075 36.530 71.337  1.00 11.76 ? 263  ILE A C   1 
ATOM   1975 O  O   . ILE A 1 263 ? 20.096 36.946 71.945  1.00 12.78 ? 263  ILE A O   1 
ATOM   1976 C  CB  . ILE A 1 263 ? 19.688 35.614 69.438  1.00 12.92 ? 263  ILE A CB  1 
ATOM   1977 C  CG1 . ILE A 1 263 ? 19.651 34.217 70.020  1.00 12.95 ? 263  ILE A CG1 1 
ATOM   1978 C  CG2 . ILE A 1 263 ? 19.611 35.542 67.917  1.00 12.85 ? 263  ILE A CG2 1 
ATOM   1979 C  CD1 . ILE A 1 263 ? 18.364 33.461 69.791  1.00 18.10 ? 263  ILE A CD1 1 
ATOM   1980 N  N   . GLY A 1 264 ? 22.187 36.188 72.020  1.00 9.04  ? 264  GLY A N   1 
ATOM   1981 C  CA  . GLY A 1 264 ? 22.325 36.416 73.455  1.00 4.44  ? 264  GLY A CA  1 
ATOM   1982 C  C   . GLY A 1 264 ? 21.799 35.331 74.362  1.00 7.17  ? 264  GLY A C   1 
ATOM   1983 O  O   . GLY A 1 264 ? 21.761 35.528 75.597  1.00 10.66 ? 264  GLY A O   1 
ATOM   1984 N  N   . ALA A 1 265 ? 21.366 34.216 73.750  1.00 4.98  ? 265  ALA A N   1 
ATOM   1985 C  CA  . ALA A 1 265 ? 20.763 33.104 74.461  1.00 8.37  ? 265  ALA A CA  1 
ATOM   1986 C  C   . ALA A 1 265 ? 21.711 32.508 75.475  1.00 10.01 ? 265  ALA A C   1 
ATOM   1987 O  O   . ALA A 1 265 ? 22.914 32.510 75.181  1.00 13.00 ? 265  ALA A O   1 
ATOM   1988 C  CB  . ALA A 1 265 ? 20.386 31.984 73.499  1.00 5.28  ? 265  ALA A CB  1 
ATOM   1989 N  N   . THR A 1 266 ? 21.293 32.028 76.646  1.00 9.85  ? 266  THR A N   1 
ATOM   1990 C  CA  . THR A 1 266 ? 22.194 31.323 77.515  1.00 11.87 ? 266  THR A CA  1 
ATOM   1991 C  C   . THR A 1 266 ? 22.816 30.072 76.857  1.00 13.54 ? 266  THR A C   1 
ATOM   1992 O  O   . THR A 1 266 ? 23.997 29.779 77.070  1.00 11.50 ? 266  THR A O   1 
ATOM   1993 C  CB  . THR A 1 266 ? 21.391 31.026 78.789  1.00 10.72 ? 266  THR A CB  1 
ATOM   1994 O  OG1 . THR A 1 266 ? 21.146 32.309 79.347  1.00 11.10 ? 266  THR A OG1 1 
ATOM   1995 C  CG2 . THR A 1 266 ? 22.113 30.182 79.826  1.00 8.79  ? 266  THR A CG2 1 
ATOM   1996 N  N   . THR A 1 267 ? 22.038 29.330 76.057  1.00 10.78 ? 267  THR A N   1 
ATOM   1997 C  CA  . THR A 1 267 ? 22.485 28.201 75.256  1.00 12.42 ? 267  THR A CA  1 
ATOM   1998 C  C   . THR A 1 267 ? 21.260 27.736 74.465  1.00 15.20 ? 267  THR A C   1 
ATOM   1999 O  O   . THR A 1 267 ? 20.215 28.407 74.497  1.00 16.72 ? 267  THR A O   1 
ATOM   2000 C  CB  . THR A 1 267 ? 23.114 27.061 76.182  1.00 13.86 ? 267  THR A CB  1 
ATOM   2001 O  OG1 . THR A 1 267 ? 23.550 26.126 75.229  1.00 13.41 ? 267  THR A OG1 1 
ATOM   2002 C  CG2 . THR A 1 267 ? 22.247 26.334 77.200  1.00 11.02 ? 267  THR A CG2 1 
ATOM   2003 N  N   . SER A 1 268 ? 21.408 26.692 73.656  1.00 13.28 ? 268  SER A N   1 
ATOM   2004 C  CA  . SER A 1 268 ? 20.386 26.121 72.827  1.00 12.90 ? 268  SER A CA  1 
ATOM   2005 C  C   . SER A 1 268 ? 20.484 24.608 72.971  1.00 12.42 ? 268  SER A C   1 
ATOM   2006 O  O   . SER A 1 268 ? 21.553 24.089 73.344  1.00 14.28 ? 268  SER A O   1 
ATOM   2007 C  CB  . SER A 1 268 ? 20.602 26.516 71.386  1.00 9.40  ? 268  SER A CB  1 
ATOM   2008 O  OG  . SER A 1 268 ? 20.562 27.919 71.163  1.00 10.83 ? 268  SER A OG  1 
ATOM   2009 N  N   . VAL A 1 269 ? 19.430 23.816 72.775  1.00 11.00 ? 269  VAL A N   1 
ATOM   2010 C  CA  . VAL A 1 269 ? 19.545 22.361 72.896  1.00 9.60  ? 269  VAL A CA  1 
ATOM   2011 C  C   . VAL A 1 269 ? 18.509 21.705 71.990  1.00 13.06 ? 269  VAL A C   1 
ATOM   2012 O  O   . VAL A 1 269 ? 17.525 22.339 71.608  1.00 9.65  ? 269  VAL A O   1 
ATOM   2013 C  CB  . VAL A 1 269 ? 19.364 21.960 74.398  1.00 8.63  ? 269  VAL A CB  1 
ATOM   2014 C  CG1 . VAL A 1 269 ? 17.945 22.214 74.888  1.00 8.38  ? 269  VAL A CG1 1 
ATOM   2015 C  CG2 . VAL A 1 269 ? 19.749 20.491 74.553  1.00 4.88  ? 269  VAL A CG2 1 
ATOM   2016 N  N   . PHE A 1 270 ? 18.827 20.485 71.560  1.00 13.68 ? 270  PHE A N   1 
ATOM   2017 C  CA  . PHE A 1 270 ? 17.974 19.636 70.752  1.00 13.66 ? 270  PHE A CA  1 
ATOM   2018 C  C   . PHE A 1 270 ? 17.767 18.357 71.570  1.00 13.14 ? 270  PHE A C   1 
ATOM   2019 O  O   . PHE A 1 270 ? 18.649 18.009 72.374  1.00 14.63 ? 270  PHE A O   1 
ATOM   2020 C  CB  . PHE A 1 270 ? 18.624 19.241 69.438  1.00 10.35 ? 270  PHE A CB  1 
ATOM   2021 C  CG  . PHE A 1 270 ? 18.414 20.181 68.285  1.00 8.86  ? 270  PHE A CG  1 
ATOM   2022 C  CD1 . PHE A 1 270 ? 19.181 21.309 68.136  1.00 8.46  ? 270  PHE A CD1 1 
ATOM   2023 C  CD2 . PHE A 1 270 ? 17.461 19.892 67.325  1.00 12.16 ? 270  PHE A CD2 1 
ATOM   2024 C  CE1 . PHE A 1 270 ? 18.994 22.127 67.034  1.00 7.52  ? 270  PHE A CE1 1 
ATOM   2025 C  CE2 . PHE A 1 270 ? 17.287 20.724 66.225  1.00 10.34 ? 270  PHE A CE2 1 
ATOM   2026 C  CZ  . PHE A 1 270 ? 18.057 21.854 66.069  1.00 7.84  ? 270  PHE A CZ  1 
ATOM   2027 N  N   . PRO A 1 271 ? 16.643 17.626 71.439  1.00 14.28 ? 271  PRO A N   1 
ATOM   2028 C  CA  . PRO A 1 271 ? 16.372 16.389 72.191  1.00 13.07 ? 271  PRO A CA  1 
ATOM   2029 C  C   . PRO A 1 271 ? 17.102 15.196 71.605  1.00 9.70  ? 271  PRO A C   1 
ATOM   2030 O  O   . PRO A 1 271 ? 17.381 15.125 70.395  1.00 11.41 ? 271  PRO A O   1 
ATOM   2031 C  CB  . PRO A 1 271 ? 14.846 16.239 72.165  1.00 11.62 ? 271  PRO A CB  1 
ATOM   2032 C  CG  . PRO A 1 271 ? 14.481 16.835 70.813  1.00 15.22 ? 271  PRO A CG  1 
ATOM   2033 C  CD  . PRO A 1 271 ? 15.475 17.999 70.603  1.00 14.73 ? 271  PRO A CD  1 
ATOM   2034 N  N   . TYR A 1 272 ? 17.386 14.247 72.481  1.00 9.69  ? 272  TYR A N   1 
ATOM   2035 C  CA  . TYR A 1 272 ? 18.095 13.066 72.016  1.00 10.84 ? 272  TYR A CA  1 
ATOM   2036 C  C   . TYR A 1 272 ? 17.274 12.317 70.988  1.00 12.04 ? 272  TYR A C   1 
ATOM   2037 O  O   . TYR A 1 272 ? 16.100 11.984 71.208  1.00 17.14 ? 272  TYR A O   1 
ATOM   2038 C  CB  . TYR A 1 272 ? 18.426 12.210 73.237  1.00 10.60 ? 272  TYR A CB  1 
ATOM   2039 C  CG  . TYR A 1 272 ? 19.191 10.932 72.896  1.00 15.61 ? 272  TYR A CG  1 
ATOM   2040 C  CD1 . TYR A 1 272 ? 20.298 10.910 72.058  1.00 15.06 ? 272  TYR A CD1 1 
ATOM   2041 C  CD2 . TYR A 1 272 ? 18.702 9.733  73.381  1.00 15.73 ? 272  TYR A CD2 1 
ATOM   2042 C  CE1 . TYR A 1 272 ? 20.918 9.711  71.757  1.00 16.17 ? 272  TYR A CE1 1 
ATOM   2043 C  CE2 . TYR A 1 272 ? 19.316 8.540  73.076  1.00 17.76 ? 272  TYR A CE2 1 
ATOM   2044 C  CZ  . TYR A 1 272 ? 20.401 8.523  72.244  1.00 16.07 ? 272  TYR A CZ  1 
ATOM   2045 O  OH  . TYR A 1 272 ? 20.966 7.306  71.937  1.00 20.08 ? 272  TYR A OH  1 
ATOM   2046 N  N   . ASN A 1 273 ? 17.867 12.077 69.827  1.00 13.63 ? 273  ASN A N   1 
ATOM   2047 C  CA  . ASN A 1 273 ? 17.200 11.368 68.788  1.00 15.76 ? 273  ASN A CA  1 
ATOM   2048 C  C   . ASN A 1 273 ? 18.182 10.444 68.084  1.00 21.39 ? 273  ASN A C   1 
ATOM   2049 O  O   . ASN A 1 273 ? 19.338 10.266 68.511  1.00 19.09 ? 273  ASN A O   1 
ATOM   2050 C  CB  . ASN A 1 273 ? 16.543 12.341 67.787  1.00 18.63 ? 273  ASN A CB  1 
ATOM   2051 C  CG  . ASN A 1 273 ? 17.449 13.322 67.082  1.00 21.00 ? 273  ASN A CG  1 
ATOM   2052 O  OD1 . ASN A 1 273 ? 18.568 12.985 66.723  1.00 19.85 ? 273  ASN A OD1 1 
ATOM   2053 N  ND2 . ASN A 1 273 ? 17.009 14.538 66.841  1.00 24.67 ? 273  ASN A ND2 1 
ATOM   2054 N  N   . HIS A 1 274 ? 17.686 9.770  67.039  1.00 21.85 ? 274  HIS A N   1 
ATOM   2055 C  CA  . HIS A 1 274 ? 18.461 8.765  66.339  1.00 22.70 ? 274  HIS A CA  1 
ATOM   2056 C  C   . HIS A 1 274 ? 19.594 9.403  65.538  1.00 19.09 ? 274  HIS A C   1 
ATOM   2057 O  O   . HIS A 1 274 ? 20.555 8.683  65.283  1.00 20.43 ? 274  HIS A O   1 
ATOM   2058 C  CB  . HIS A 1 274 ? 17.533 7.930  65.413  1.00 29.68 ? 274  HIS A CB  1 
ATOM   2059 C  CG  . HIS A 1 274 ? 17.020 8.701  64.201  1.00 39.18 ? 274  HIS A CG  1 
ATOM   2060 N  ND1 . HIS A 1 274 ? 16.217 9.805  64.112  1.00 43.34 ? 274  HIS A ND1 1 
ATOM   2061 C  CD2 . HIS A 1 274 ? 17.416 8.379  62.912  1.00 42.14 ? 274  HIS A CD2 1 
ATOM   2062 C  CE1 . HIS A 1 274 ? 16.147 10.131 62.846  1.00 43.32 ? 274  HIS A CE1 1 
ATOM   2063 N  NE2 . HIS A 1 274 ? 16.858 9.283  62.131  1.00 45.48 ? 274  HIS A NE2 1 
ATOM   2064 N  N   . ARG A 1 275 ? 19.616 10.662 65.074  1.00 17.01 ? 275  ARG A N   1 
ATOM   2065 C  CA  . ARG A 1 275 ? 20.812 11.213 64.401  1.00 17.67 ? 275  ARG A CA  1 
ATOM   2066 C  C   . ARG A 1 275 ? 21.960 11.379 65.396  1.00 13.75 ? 275  ARG A C   1 
ATOM   2067 O  O   . ARG A 1 275 ? 23.118 11.213 65.042  1.00 17.09 ? 275  ARG A O   1 
ATOM   2068 C  CB  . ARG A 1 275 ? 20.543 12.593 63.774  1.00 19.52 ? 275  ARG A CB  1 
ATOM   2069 C  CG  . ARG A 1 275 ? 19.368 12.644 62.811  1.00 22.17 ? 275  ARG A CG  1 
ATOM   2070 C  CD  . ARG A 1 275 ? 19.570 11.646 61.735  1.00 23.78 ? 275  ARG A CD  1 
ATOM   2071 N  NE  . ARG A 1 275 ? 20.293 12.233 60.634  1.00 29.09 ? 275  ARG A NE  1 
ATOM   2072 C  CZ  . ARG A 1 275 ? 19.637 12.836 59.619  1.00 32.39 ? 275  ARG A CZ  1 
ATOM   2073 N  NH1 . ARG A 1 275 ? 18.322 13.054 59.602  1.00 33.19 ? 275  ARG A NH1 1 
ATOM   2074 N  NH2 . ARG A 1 275 ? 20.315 13.328 58.588  1.00 35.30 ? 275  ARG A NH2 1 
ATOM   2075 N  N   . MET A 1 276 ? 21.688 11.670 66.667  1.00 12.44 ? 276  MET A N   1 
ATOM   2076 C  CA  . MET A 1 276 ? 22.683 11.812 67.693  1.00 11.74 ? 276  MET A CA  1 
ATOM   2077 C  C   . MET A 1 276 ? 23.244 10.456 68.021  1.00 15.36 ? 276  MET A C   1 
ATOM   2078 O  O   . MET A 1 276 ? 24.444 10.278 68.185  1.00 13.77 ? 276  MET A O   1 
ATOM   2079 C  CB  . MET A 1 276 ? 22.113 12.383 68.972  1.00 6.89  ? 276  MET A CB  1 
ATOM   2080 C  CG  . MET A 1 276 ? 21.678 13.829 68.834  1.00 6.95  ? 276  MET A CG  1 
ATOM   2081 S  SD  . MET A 1 276 ? 21.150 14.412 70.445  1.00 10.92 ? 276  MET A SD  1 
ATOM   2082 C  CE  . MET A 1 276 ? 20.511 16.032 70.091  1.00 8.30  ? 276  MET A CE  1 
ATOM   2083 N  N   . LYS A 1 277 ? 22.380 9.460  68.109  1.00 17.27 ? 277  LYS A N   1 
ATOM   2084 C  CA  . LYS A 1 277 ? 22.792 8.104  68.414  1.00 21.36 ? 277  LYS A CA  1 
ATOM   2085 C  C   . LYS A 1 277 ? 23.807 7.616  67.389  1.00 22.67 ? 277  LYS A C   1 
ATOM   2086 O  O   . LYS A 1 277 ? 24.855 7.038  67.713  1.00 22.97 ? 277  LYS A O   1 
ATOM   2087 C  CB  . LYS A 1 277 ? 21.546 7.206  68.429  1.00 25.85 ? 277  LYS A CB  1 
ATOM   2088 C  CG  . LYS A 1 277 ? 21.855 5.760  68.765  1.00 32.42 ? 277  LYS A CG  1 
ATOM   2089 C  CD  . LYS A 1 277 ? 20.554 4.982  68.786  1.00 37.41 ? 277  LYS A CD  1 
ATOM   2090 C  CE  . LYS A 1 277 ? 20.849 3.508  69.112  1.00 43.42 ? 277  LYS A CE  1 
ATOM   2091 N  NZ  . LYS A 1 277 ? 21.403 3.389  70.449  1.00 47.37 ? 277  LYS A NZ  1 
ATOM   2092 N  N   . LYS A 1 278 ? 23.520 7.970  66.147  1.00 21.53 ? 278  LYS A N   1 
ATOM   2093 C  CA  . LYS A 1 278 ? 24.327 7.593  65.014  1.00 23.97 ? 278  LYS A CA  1 
ATOM   2094 C  C   . LYS A 1 278 ? 25.710 8.228  65.075  1.00 20.33 ? 278  LYS A C   1 
ATOM   2095 O  O   . LYS A 1 278 ? 26.723 7.561  64.840  1.00 19.03 ? 278  LYS A O   1 
ATOM   2096 C  CB  . LYS A 1 278 ? 23.610 8.034  63.774  1.00 27.61 ? 278  LYS A CB  1 
ATOM   2097 C  CG  . LYS A 1 278 ? 24.058 7.337  62.535  1.00 35.47 ? 278  LYS A CG  1 
ATOM   2098 C  CD  . LYS A 1 278 ? 23.527 8.095  61.327  1.00 43.98 ? 278  LYS A CD  1 
ATOM   2099 C  CE  . LYS A 1 278 ? 21.987 8.280  61.230  1.00 49.67 ? 278  LYS A CE  1 
ATOM   2100 N  NZ  . LYS A 1 278 ? 21.652 9.069  60.047  1.00 51.67 ? 278  LYS A NZ  1 
ATOM   2101 N  N   . TYR A 1 279 ? 25.748 9.519  65.348  1.00 15.80 ? 279  TYR A N   1 
ATOM   2102 C  CA  . TYR A 1 279 ? 27.002 10.253 65.464  1.00 16.67 ? 279  TYR A CA  1 
ATOM   2103 C  C   . TYR A 1 279 ? 27.793 9.696  66.640  1.00 17.07 ? 279  TYR A C   1 
ATOM   2104 O  O   . TYR A 1 279 ? 29.010 9.540  66.495  1.00 16.35 ? 279  TYR A O   1 
ATOM   2105 C  CB  . TYR A 1 279 ? 26.726 11.760 65.676  1.00 11.79 ? 279  TYR A CB  1 
ATOM   2106 C  CG  . TYR A 1 279 ? 27.965 12.638 65.796  1.00 11.75 ? 279  TYR A CG  1 
ATOM   2107 C  CD1 . TYR A 1 279 ? 28.559 13.089 64.642  1.00 9.68  ? 279  TYR A CD1 1 
ATOM   2108 C  CD2 . TYR A 1 279 ? 28.484 12.961 67.038  1.00 10.39 ? 279  TYR A CD2 1 
ATOM   2109 C  CE1 . TYR A 1 279 ? 29.675 13.872 64.726  1.00 7.61  ? 279  TYR A CE1 1 
ATOM   2110 C  CE2 . TYR A 1 279 ? 29.619 13.734 67.129  1.00 9.68  ? 279  TYR A CE2 1 
ATOM   2111 C  CZ  . TYR A 1 279 ? 30.193 14.181 65.954  1.00 10.15 ? 279  TYR A CZ  1 
ATOM   2112 O  OH  . TYR A 1 279 ? 31.331 14.964 65.950  1.00 12.40 ? 279  TYR A OH  1 
ATOM   2113 N  N   . LEU A 1 280 ? 27.198 9.403  67.809  1.00 16.65 ? 280  LEU A N   1 
ATOM   2114 C  CA  . LEU A 1 280 ? 27.889 8.802  68.941  1.00 16.92 ? 280  LEU A CA  1 
ATOM   2115 C  C   . LEU A 1 280 ? 28.507 7.481  68.548  1.00 19.03 ? 280  LEU A C   1 
ATOM   2116 O  O   . LEU A 1 280 ? 29.629 7.182  68.931  1.00 20.00 ? 280  LEU A O   1 
ATOM   2117 C  CB  . LEU A 1 280 ? 26.935 8.536  70.102  1.00 14.77 ? 280  LEU A CB  1 
ATOM   2118 C  CG  . LEU A 1 280 ? 26.520 9.805  70.857  1.00 16.51 ? 280  LEU A CG  1 
ATOM   2119 C  CD1 . LEU A 1 280 ? 25.289 9.539  71.738  1.00 13.15 ? 280  LEU A CD1 1 
ATOM   2120 C  CD2 . LEU A 1 280 ? 27.701 10.283 71.688  1.00 14.58 ? 280  LEU A CD2 1 
ATOM   2121 N  N   . SER A 1 281 ? 27.817 6.633  67.808  1.00 21.64 ? 281  SER A N   1 
ATOM   2122 C  CA  . SER A 1 281 ? 28.368 5.370  67.385  1.00 20.42 ? 281  SER A CA  1 
ATOM   2123 C  C   . SER A 1 281 ? 29.508 5.532  66.414  1.00 21.54 ? 281  SER A C   1 
ATOM   2124 O  O   . SER A 1 281 ? 30.496 4.825  66.586  1.00 20.53 ? 281  SER A O   1 
ATOM   2125 C  CB  . SER A 1 281 ? 27.300 4.529  66.743  1.00 21.59 ? 281  SER A CB  1 
ATOM   2126 O  OG  . SER A 1 281 ? 26.368 4.245  67.774  1.00 30.10 ? 281  SER A OG  1 
ATOM   2127 N  N   . LYS A 1 282 ? 29.423 6.431  65.436  1.00 18.67 ? 282  LYS A N   1 
ATOM   2128 C  CA  . LYS A 1 282 ? 30.508 6.649  64.511  1.00 18.67 ? 282  LYS A CA  1 
ATOM   2129 C  C   . LYS A 1 282 ? 31.663 7.375  65.204  1.00 18.28 ? 282  LYS A C   1 
ATOM   2130 O  O   . LYS A 1 282 ? 32.756 7.398  64.663  1.00 20.29 ? 282  LYS A O   1 
ATOM   2131 C  CB  . LYS A 1 282 ? 29.930 7.421  63.350  1.00 18.62 ? 282  LYS A CB  1 
ATOM   2132 C  CG  . LYS A 1 282 ? 30.842 7.901  62.219  1.00 28.07 ? 282  LYS A CG  1 
ATOM   2133 C  CD  . LYS A 1 282 ? 31.456 6.860  61.275  1.00 29.99 ? 282  LYS A CD  1 
ATOM   2134 C  CE  . LYS A 1 282 ? 30.445 6.061  60.481  1.00 33.75 ? 282  LYS A CE  1 
ATOM   2135 N  NZ  . LYS A 1 282 ? 31.126 5.205  59.510  1.00 36.56 ? 282  LYS A NZ  1 
ATOM   2136 N  N   . THR A 1 283 ? 31.546 7.944  66.400  1.00 16.46 ? 283  THR A N   1 
ATOM   2137 C  CA  . THR A 1 283 ? 32.694 8.545  67.048  1.00 16.18 ? 283  THR A CA  1 
ATOM   2138 C  C   . THR A 1 283 ? 33.151 7.705  68.218  1.00 15.39 ? 283  THR A C   1 
ATOM   2139 O  O   . THR A 1 283 ? 33.604 8.177  69.261  1.00 17.36 ? 283  THR A O   1 
ATOM   2140 C  CB  . THR A 1 283 ? 32.365 9.989  67.519  1.00 17.51 ? 283  THR A CB  1 
ATOM   2141 O  OG1 . THR A 1 283 ? 31.199 9.978  68.329  1.00 15.74 ? 283  THR A OG1 1 
ATOM   2142 C  CG2 . THR A 1 283 ? 32.227 10.912 66.308  1.00 15.92 ? 283  THR A CG2 1 
ATOM   2143 N  N   . GLY A 1 284 ? 32.977 6.400  68.108  1.00 14.93 ? 284  GLY A N   1 
ATOM   2144 C  CA  . GLY A 1 284 ? 33.453 5.477  69.124  1.00 12.15 ? 284  GLY A CA  1 
ATOM   2145 C  C   . GLY A 1 284 ? 32.673 5.478  70.420  1.00 14.69 ? 284  GLY A C   1 
ATOM   2146 O  O   . GLY A 1 284 ? 33.211 4.977  71.408  1.00 12.64 ? 284  GLY A O   1 
ATOM   2147 N  N   . ARG A 1 285 ? 31.440 5.960  70.506  1.00 14.69 ? 285  ARG A N   1 
ATOM   2148 C  CA  . ARG A 1 285 ? 30.740 6.069  71.784  1.00 13.72 ? 285  ARG A CA  1 
ATOM   2149 C  C   . ARG A 1 285 ? 29.348 5.407  71.761  1.00 16.70 ? 285  ARG A C   1 
ATOM   2150 O  O   . ARG A 1 285 ? 28.336 5.907  72.292  1.00 15.45 ? 285  ARG A O   1 
ATOM   2151 C  CB  . ARG A 1 285 ? 30.687 7.565  72.092  1.00 12.70 ? 285  ARG A CB  1 
ATOM   2152 C  CG  . ARG A 1 285 ? 32.054 8.154  72.428  1.00 12.81 ? 285  ARG A CG  1 
ATOM   2153 C  CD  . ARG A 1 285 ? 31.966 9.675  72.611  1.00 11.18 ? 285  ARG A CD  1 
ATOM   2154 N  NE  . ARG A 1 285 ? 31.644 10.389 71.370  1.00 10.85 ? 285  ARG A NE  1 
ATOM   2155 C  CZ  . ARG A 1 285 ? 31.121 11.659 71.329  1.00 11.96 ? 285  ARG A CZ  1 
ATOM   2156 N  NH1 . ARG A 1 285 ? 30.983 12.398 72.440  1.00 8.75  ? 285  ARG A NH1 1 
ATOM   2157 N  NH2 . ARG A 1 285 ? 30.808 12.255 70.167  1.00 12.13 ? 285  ARG A NH2 1 
ATOM   2158 N  N   . ALA A 1 286 ? 29.283 4.231  71.119  1.00 14.87 ? 286  ALA A N   1 
ATOM   2159 C  CA  . ALA A 1 286 ? 28.094 3.387  71.061  1.00 14.81 ? 286  ALA A CA  1 
ATOM   2160 C  C   . ALA A 1 286 ? 27.608 2.993  72.444  1.00 13.08 ? 286  ALA A C   1 
ATOM   2161 O  O   . ALA A 1 286 ? 26.389 2.931  72.659  1.00 19.12 ? 286  ALA A O   1 
ATOM   2162 C  CB  . ALA A 1 286 ? 28.376 2.096  70.318  1.00 14.27 ? 286  ALA A CB  1 
ATOM   2163 N  N   . ASP A 1 287 ? 28.466 2.746  73.429  1.00 12.51 ? 287  ASP A N   1 
ATOM   2164 C  CA  . ASP A 1 287 ? 28.027 2.465  74.777  1.00 12.01 ? 287  ASP A CA  1 
ATOM   2165 C  C   . ASP A 1 287 ? 27.288 3.623  75.429  1.00 13.41 ? 287  ASP A C   1 
ATOM   2166 O  O   . ASP A 1 287 ? 26.354 3.385  76.191  1.00 14.43 ? 287  ASP A O   1 
ATOM   2167 C  CB  . ASP A 1 287 ? 29.231 2.081  75.627  1.00 14.00 ? 287  ASP A CB  1 
ATOM   2168 C  CG  . ASP A 1 287 ? 30.421 3.035  75.665  1.00 18.15 ? 287  ASP A CG  1 
ATOM   2169 O  OD1 . ASP A 1 287 ? 30.626 3.845  74.757  1.00 19.32 ? 287  ASP A OD1 1 
ATOM   2170 O  OD2 . ASP A 1 287 ? 31.150 3.032  76.650  1.00 21.33 ? 287  ASP A OD2 1 
ATOM   2171 N  N   . ILE A 1 288 ? 27.664 4.888  75.130  1.00 15.65 ? 288  ILE A N   1 
ATOM   2172 C  CA  . ILE A 1 288 ? 27.011 6.101  75.653  1.00 14.27 ? 288  ILE A CA  1 
ATOM   2173 C  C   . ILE A 1 288 ? 25.657 6.197  74.942  1.00 13.70 ? 288  ILE A C   1 
ATOM   2174 O  O   . ILE A 1 288 ? 24.690 6.466  75.653  1.00 13.72 ? 288  ILE A O   1 
ATOM   2175 C  CB  . ILE A 1 288 ? 27.871 7.409  75.390  1.00 14.88 ? 288  ILE A CB  1 
ATOM   2176 C  CG1 . ILE A 1 288 ? 29.137 7.409  76.272  1.00 12.47 ? 288  ILE A CG1 1 
ATOM   2177 C  CG2 . ILE A 1 288 ? 27.034 8.672  75.692  1.00 13.05 ? 288  ILE A CG2 1 
ATOM   2178 C  CD1 . ILE A 1 288 ? 30.083 8.618  76.089  1.00 11.73 ? 288  ILE A CD1 1 
ATOM   2179 N  N   . ALA A 1 289 ? 25.529 5.943  73.622  1.00 9.86  ? 289  ALA A N   1 
ATOM   2180 C  CA  . ALA A 1 289 ? 24.232 5.928  72.934  1.00 12.68 ? 289  ALA A CA  1 
ATOM   2181 C  C   . ALA A 1 289 ? 23.300 4.891  73.522  1.00 13.65 ? 289  ALA A C   1 
ATOM   2182 O  O   . ALA A 1 289 ? 22.118 5.116  73.707  1.00 15.88 ? 289  ALA A O   1 
ATOM   2183 C  CB  . ALA A 1 289 ? 24.393 5.596  71.457  1.00 9.84  ? 289  ALA A CB  1 
ATOM   2184 N  N   . ASN A 1 290 ? 23.837 3.726  73.870  1.00 15.26 ? 290  ASN A N   1 
ATOM   2185 C  CA  . ASN A 1 290 ? 23.083 2.653  74.459  1.00 12.71 ? 290  ASN A CA  1 
ATOM   2186 C  C   . ASN A 1 290 ? 22.613 3.057  75.818  1.00 12.70 ? 290  ASN A C   1 
ATOM   2187 O  O   . ASN A 1 290 ? 21.459 2.759  76.147  1.00 11.45 ? 290  ASN A O   1 
ATOM   2188 C  CB  . ASN A 1 290 ? 23.925 1.354  74.611  1.00 15.88 ? 290  ASN A CB  1 
ATOM   2189 C  CG  . ASN A 1 290 ? 24.108 0.558  73.329  1.00 15.00 ? 290  ASN A CG  1 
ATOM   2190 O  OD1 . ASN A 1 290 ? 23.300 0.717  72.406  1.00 18.90 ? 290  ASN A OD1 1 
ATOM   2191 N  ND2 . ASN A 1 290 ? 25.138 -0.269 73.128  1.00 17.08 ? 290  ASN A ND2 1 
ATOM   2192 N  N   . LEU A 1 291 ? 23.444 3.686  76.644  1.00 11.11 ? 291  LEU A N   1 
ATOM   2193 C  CA  . LEU A 1 291 ? 22.977 4.128  77.950  1.00 11.50 ? 291  LEU A CA  1 
ATOM   2194 C  C   . LEU A 1 291 ? 21.950 5.261  77.823  1.00 14.26 ? 291  LEU A C   1 
ATOM   2195 O  O   . LEU A 1 291 ? 20.967 5.307  78.555  1.00 15.96 ? 291  LEU A O   1 
ATOM   2196 C  CB  . LEU A 1 291 ? 24.136 4.620  78.762  1.00 13.81 ? 291  LEU A CB  1 
ATOM   2197 C  CG  . LEU A 1 291 ? 23.839 5.131  80.174  1.00 14.30 ? 291  LEU A CG  1 
ATOM   2198 C  CD1 . LEU A 1 291 ? 23.333 4.021  81.068  1.00 14.42 ? 291  LEU A CD1 1 
ATOM   2199 C  CD2 . LEU A 1 291 ? 25.125 5.682  80.762  1.00 17.38 ? 291  LEU A CD2 1 
ATOM   2200 N  N   . ALA A 1 292 ? 22.109 6.203  76.890  1.00 14.54 ? 292  ALA A N   1 
ATOM   2201 C  CA  . ALA A 1 292 ? 21.172 7.299  76.701  1.00 12.84 ? 292  ALA A CA  1 
ATOM   2202 C  C   . ALA A 1 292 ? 19.852 6.709  76.239  1.00 16.71 ? 292  ALA A C   1 
ATOM   2203 O  O   . ALA A 1 292 ? 18.827 7.245  76.654  1.00 17.68 ? 292  ALA A O   1 
ATOM   2204 C  CB  . ALA A 1 292 ? 21.690 8.260  75.648  1.00 11.49 ? 292  ALA A CB  1 
ATOM   2205 N  N   . ASP A 1 293 ? 19.807 5.632  75.430  1.00 18.54 ? 293  ASP A N   1 
ATOM   2206 C  CA  . ASP A 1 293 ? 18.560 4.936  75.103  1.00 19.50 ? 293  ASP A CA  1 
ATOM   2207 C  C   . ASP A 1 293 ? 17.826 4.410  76.331  1.00 18.67 ? 293  ASP A C   1 
ATOM   2208 O  O   . ASP A 1 293 ? 16.600 4.503  76.426  1.00 20.66 ? 293  ASP A O   1 
ATOM   2209 C  CB  . ASP A 1 293 ? 18.785 3.744  74.231  1.00 21.09 ? 293  ASP A CB  1 
ATOM   2210 C  CG  . ASP A 1 293 ? 19.105 3.984  72.773  1.00 24.30 ? 293  ASP A CG  1 
ATOM   2211 O  OD1 . ASP A 1 293 ? 19.112 5.104  72.267  1.00 23.89 ? 293  ASP A OD1 1 
ATOM   2212 O  OD2 . ASP A 1 293 ? 19.438 3.012  72.090  1.00 27.77 ? 293  ASP A OD2 1 
ATOM   2213 N  N   . GLU A 1 294 ? 18.514 3.878  77.327  1.00 17.59 ? 294  GLU A N   1 
ATOM   2214 C  CA  . GLU A 1 294 ? 17.843 3.458  78.532  1.00 18.67 ? 294  GLU A CA  1 
ATOM   2215 C  C   . GLU A 1 294 ? 17.358 4.638  79.351  1.00 18.51 ? 294  GLU A C   1 
ATOM   2216 O  O   . GLU A 1 294 ? 16.452 4.458  80.179  1.00 20.31 ? 294  GLU A O   1 
ATOM   2217 C  CB  . GLU A 1 294 ? 18.721 2.635  79.473  1.00 18.52 ? 294  GLU A CB  1 
ATOM   2218 C  CG  . GLU A 1 294 ? 19.110 1.252  78.990  1.00 23.18 ? 294  GLU A CG  1 
ATOM   2219 C  CD  . GLU A 1 294 ? 19.562 0.298  80.118  1.00 27.96 ? 294  GLU A CD  1 
ATOM   2220 O  OE1 . GLU A 1 294 ? 19.677 0.685  81.303  1.00 27.72 ? 294  GLU A OE1 1 
ATOM   2221 O  OE2 . GLU A 1 294 ? 19.765 -0.886 79.800  1.00 30.34 ? 294  GLU A OE2 1 
ATOM   2222 N  N   . PHE A 1 295 ? 17.935 5.840  79.207  1.00 16.71 ? 295  PHE A N   1 
ATOM   2223 C  CA  . PHE A 1 295 ? 17.480 6.995  79.962  1.00 15.53 ? 295  PHE A CA  1 
ATOM   2224 C  C   . PHE A 1 295 ? 16.760 8.057  79.146  1.00 14.28 ? 295  PHE A C   1 
ATOM   2225 O  O   . PHE A 1 295 ? 16.520 9.156  79.640  1.00 16.92 ? 295  PHE A O   1 
ATOM   2226 C  CB  . PHE A 1 295 ? 18.654 7.635  80.687  1.00 15.20 ? 295  PHE A CB  1 
ATOM   2227 C  CG  . PHE A 1 295 ? 19.016 6.851  81.933  1.00 16.80 ? 295  PHE A CG  1 
ATOM   2228 C  CD1 . PHE A 1 295 ? 19.886 5.768  81.855  1.00 18.44 ? 295  PHE A CD1 1 
ATOM   2229 C  CD2 . PHE A 1 295 ? 18.502 7.240  83.146  1.00 16.02 ? 295  PHE A CD2 1 
ATOM   2230 C  CE1 . PHE A 1 295 ? 20.241 5.085  83.007  1.00 16.80 ? 295  PHE A CE1 1 
ATOM   2231 C  CE2 . PHE A 1 295 ? 18.863 6.552  84.291  1.00 18.62 ? 295  PHE A CE2 1 
ATOM   2232 C  CZ  . PHE A 1 295 ? 19.731 5.474  84.233  1.00 16.69 ? 295  PHE A CZ  1 
ATOM   2233 N  N   . LYS A 1 296 ? 16.355 7.697  77.938  1.00 14.59 ? 296  LYS A N   1 
ATOM   2234 C  CA  . LYS A 1 296 ? 15.716 8.512  76.925  1.00 17.41 ? 296  LYS A CA  1 
ATOM   2235 C  C   . LYS A 1 296 ? 14.611 9.407  77.430  1.00 17.46 ? 296  LYS A C   1 
ATOM   2236 O  O   . LYS A 1 296 ? 14.502 10.543 76.965  1.00 17.83 ? 296  LYS A O   1 
ATOM   2237 C  CB  . LYS A 1 296 ? 15.245 7.530  75.898  1.00 19.44 ? 296  LYS A CB  1 
ATOM   2238 C  CG  . LYS A 1 296 ? 14.429 7.932  74.716  1.00 27.32 ? 296  LYS A CG  1 
ATOM   2239 C  CD  . LYS A 1 296 ? 15.155 8.752  73.685  1.00 30.00 ? 296  LYS A CD  1 
ATOM   2240 C  CE  . LYS A 1 296 ? 14.247 8.703  72.465  1.00 34.24 ? 296  LYS A CE  1 
ATOM   2241 N  NZ  . LYS A 1 296 ? 14.883 9.211  71.268  1.00 38.39 ? 296  LYS A NZ  1 
ATOM   2242 N  N   . ASP A 1 297 ? 13.829 8.985  78.416  1.00 18.65 ? 297  ASP A N   1 
ATOM   2243 C  CA  . ASP A 1 297 ? 12.775 9.828  78.955  1.00 23.84 ? 297  ASP A CA  1 
ATOM   2244 C  C   . ASP A 1 297 ? 13.208 11.143 79.527  1.00 20.95 ? 297  ASP A C   1 
ATOM   2245 O  O   . ASP A 1 297 ? 12.478 12.142 79.525  1.00 21.46 ? 297  ASP A O   1 
ATOM   2246 C  CB  . ASP A 1 297 ? 12.010 9.225  80.103  1.00 29.05 ? 297  ASP A CB  1 
ATOM   2247 C  CG  . ASP A 1 297 ? 11.240 7.989  79.731  1.00 36.43 ? 297  ASP A CG  1 
ATOM   2248 O  OD1 . ASP A 1 297 ? 10.912 7.797  78.554  1.00 37.43 ? 297  ASP A OD1 1 
ATOM   2249 O  OD2 . ASP A 1 297 ? 11.015 7.200  80.650  1.00 43.50 ? 297  ASP A OD2 1 
ATOM   2250 N  N   . HIS A 1 298 ? 14.383 11.096 80.141  1.00 19.54 ? 298  HIS A N   1 
ATOM   2251 C  CA  . HIS A 1 298 ? 14.951 12.270 80.799  1.00 18.76 ? 298  HIS A CA  1 
ATOM   2252 C  C   . HIS A 1 298 ? 15.726 13.129 79.817  1.00 16.61 ? 298  HIS A C   1 
ATOM   2253 O  O   . HIS A 1 298 ? 16.182 14.198 80.215  1.00 16.13 ? 298  HIS A O   1 
ATOM   2254 C  CB  . HIS A 1 298 ? 15.870 11.868 81.929  1.00 20.21 ? 298  HIS A CB  1 
ATOM   2255 C  CG  . HIS A 1 298 ? 15.173 10.892 82.847  1.00 25.07 ? 298  HIS A CG  1 
ATOM   2256 N  ND1 . HIS A 1 298 ? 14.228 11.140 83.759  1.00 25.86 ? 298  HIS A ND1 1 
ATOM   2257 C  CD2 . HIS A 1 298 ? 15.426 9.536  82.852  1.00 27.88 ? 298  HIS A CD2 1 
ATOM   2258 C  CE1 . HIS A 1 298 ? 13.916 9.981  84.295  1.00 26.35 ? 298  HIS A CE1 1 
ATOM   2259 N  NE2 . HIS A 1 298 ? 14.631 9.026  83.758  1.00 28.86 ? 298  HIS A NE2 1 
ATOM   2260 N  N   . LEU A 1 299 ? 15.799 12.709 78.541  1.00 14.58 ? 299  LEU A N   1 
ATOM   2261 C  CA  . LEU A 1 299 ? 16.604 13.366 77.518  1.00 14.23 ? 299  LEU A CA  1 
ATOM   2262 C  C   . LEU A 1 299 ? 15.760 13.946 76.383  1.00 12.23 ? 299  LEU A C   1 
ATOM   2263 O  O   . LEU A 1 299 ? 16.255 14.336 75.322  1.00 13.32 ? 299  LEU A O   1 
ATOM   2264 C  CB  . LEU A 1 299 ? 17.645 12.298 77.028  1.00 12.77 ? 299  LEU A CB  1 
ATOM   2265 C  CG  . LEU A 1 299 ? 18.587 11.678 78.106  1.00 13.27 ? 299  LEU A CG  1 
ATOM   2266 C  CD1 . LEU A 1 299 ? 19.513 10.676 77.463  1.00 10.40 ? 299  LEU A CD1 1 
ATOM   2267 C  CD2 . LEU A 1 299 ? 19.392 12.780 78.810  1.00 11.51 ? 299  LEU A CD2 1 
ATOM   2268 N  N   . VAL A 1 300 ? 14.431 14.003 76.579  1.00 13.15 ? 300  VAL A N   1 
ATOM   2269 C  CA  . VAL A 1 300 ? 13.481 14.615 75.656  1.00 10.74 ? 300  VAL A CA  1 
ATOM   2270 C  C   . VAL A 1 300 ? 12.584 15.502 76.523  1.00 11.71 ? 300  VAL A C   1 
ATOM   2271 O  O   . VAL A 1 300 ? 12.568 15.336 77.762  1.00 14.31 ? 300  VAL A O   1 
ATOM   2272 C  CB  . VAL A 1 300 ? 12.622 13.528 74.898  1.00 15.78 ? 300  VAL A CB  1 
ATOM   2273 C  CG1 . VAL A 1 300 ? 13.512 12.701 73.960  1.00 12.38 ? 300  VAL A CG1 1 
ATOM   2274 C  CG2 . VAL A 1 300 ? 11.938 12.585 75.895  1.00 14.01 ? 300  VAL A CG2 1 
ATOM   2275 N  N   . PRO A 1 301 ? 11.862 16.518 76.011  1.00 12.11 ? 301  PRO A N   1 
ATOM   2276 C  CA  . PRO A 1 301 ? 10.962 17.330 76.846  1.00 11.84 ? 301  PRO A CA  1 
ATOM   2277 C  C   . PRO A 1 301 ? 9.734  16.553 77.323  1.00 13.05 ? 301  PRO A C   1 
ATOM   2278 O  O   . PRO A 1 301 ? 9.371  15.529 76.741  1.00 14.29 ? 301  PRO A O   1 
ATOM   2279 C  CB  . PRO A 1 301 ? 10.641 18.544 75.970  1.00 10.99 ? 301  PRO A CB  1 
ATOM   2280 C  CG  . PRO A 1 301 ? 10.846 18.063 74.533  1.00 11.27 ? 301  PRO A CG  1 
ATOM   2281 C  CD  . PRO A 1 301 ? 11.935 16.991 74.621  1.00 8.97  ? 301  PRO A CD  1 
ATOM   2282 N  N   . ASP A 1 302 ? 9.191  16.930 78.483  1.00 14.29 ? 302  ASP A N   1 
ATOM   2283 C  CA  . ASP A 1 302 ? 7.967  16.337 78.969  1.00 14.16 ? 302  ASP A CA  1 
ATOM   2284 C  C   . ASP A 1 302 ? 6.826  16.717 78.065  1.00 13.98 ? 302  ASP A C   1 
ATOM   2285 O  O   . ASP A 1 302 ? 6.829  17.850 77.549  1.00 17.32 ? 302  ASP A O   1 
ATOM   2286 C  CB  . ASP A 1 302 ? 7.587  16.815 80.354  1.00 11.70 ? 302  ASP A CB  1 
ATOM   2287 C  CG  . ASP A 1 302 ? 8.345  16.126 81.437  1.00 12.98 ? 302  ASP A CG  1 
ATOM   2288 O  OD1 . ASP A 1 302 ? 8.894  15.049 81.217  1.00 16.10 ? 302  ASP A OD1 1 
ATOM   2289 O  OD2 . ASP A 1 302 ? 8.355  16.611 82.560  1.00 13.43 ? 302  ASP A OD2 1 
ATOM   2290 N  N   . PRO A 1 303 ? 5.811  15.856 77.839  1.00 17.01 ? 303  PRO A N   1 
ATOM   2291 C  CA  . PRO A 1 303 ? 4.609  16.203 77.096  1.00 15.86 ? 303  PRO A CA  1 
ATOM   2292 C  C   . PRO A 1 303 ? 3.963  17.417 77.701  1.00 13.33 ? 303  PRO A C   1 
ATOM   2293 O  O   . PRO A 1 303 ? 3.848  17.555 78.918  1.00 15.50 ? 303  PRO A O   1 
ATOM   2294 C  CB  . PRO A 1 303 ? 3.740  14.993 77.180  1.00 18.83 ? 303  PRO A CB  1 
ATOM   2295 C  CG  . PRO A 1 303 ? 4.747  13.885 77.330  1.00 19.26 ? 303  PRO A CG  1 
ATOM   2296 C  CD  . PRO A 1 303 ? 5.692  14.489 78.345  1.00 18.03 ? 303  PRO A CD  1 
ATOM   2297 N  N   . GLY A 1 304 ? 3.699  18.356 76.808  1.00 13.44 ? 304  GLY A N   1 
ATOM   2298 C  CA  . GLY A 1 304 ? 3.001  19.572 77.159  1.00 14.01 ? 304  GLY A CA  1 
ATOM   2299 C  C   . GLY A 1 304 ? 3.766  20.550 78.031  1.00 17.73 ? 304  GLY A C   1 
ATOM   2300 O  O   . GLY A 1 304 ? 3.168  21.281 78.832  1.00 15.14 ? 304  GLY A O   1 
ATOM   2301 N  N   . CYS A 1 305 ? 5.094  20.622 77.892  1.00 15.25 ? 305  CYS A N   1 
ATOM   2302 C  CA  . CYS A 1 305 ? 5.852  21.581 78.666  1.00 14.46 ? 305  CYS A CA  1 
ATOM   2303 C  C   . CYS A 1 305 ? 5.635  23.021 78.146  1.00 15.37 ? 305  CYS A C   1 
ATOM   2304 O  O   . CYS A 1 305 ? 5.358  23.282 76.963  1.00 13.84 ? 305  CYS A O   1 
ATOM   2305 C  CB  . CYS A 1 305 ? 7.319  21.137 78.609  1.00 9.69  ? 305  CYS A CB  1 
ATOM   2306 S  SG  . CYS A 1 305 ? 7.957  21.223 76.927  1.00 13.66 ? 305  CYS A SG  1 
ATOM   2307 N  N   . HIS A 1 306 ? 5.730  24.015 79.024  1.00 16.54 ? 306  HIS A N   1 
ATOM   2308 C  CA  . HIS A 1 306 ? 5.527  25.402 78.629  1.00 19.66 ? 306  HIS A CA  1 
ATOM   2309 C  C   . HIS A 1 306 ? 6.781  26.194 78.262  1.00 17.82 ? 306  HIS A C   1 
ATOM   2310 O  O   . HIS A 1 306 ? 7.645  26.458 79.113  1.00 17.92 ? 306  HIS A O   1 
ATOM   2311 C  CB  . HIS A 1 306 ? 4.790  26.182 79.766  1.00 26.42 ? 306  HIS A CB  1 
ATOM   2312 C  CG  . HIS A 1 306 ? 4.544  27.705 79.563  1.00 34.96 ? 306  HIS A CG  1 
ATOM   2313 N  ND1 . HIS A 1 306 ? 5.184  28.743 80.142  1.00 36.03 ? 306  HIS A ND1 1 
ATOM   2314 C  CD2 . HIS A 1 306 ? 3.590  28.246 78.689  1.00 35.52 ? 306  HIS A CD2 1 
ATOM   2315 C  CE1 . HIS A 1 306 ? 4.666  29.842 79.649  1.00 35.97 ? 306  HIS A CE1 1 
ATOM   2316 N  NE2 . HIS A 1 306 ? 3.711  29.548 78.779  1.00 36.36 ? 306  HIS A NE2 1 
ATOM   2317 N  N   . TYR A 1 307 ? 6.801  26.666 77.030  1.00 16.02 ? 307  TYR A N   1 
ATOM   2318 C  CA  . TYR A 1 307 ? 7.794  27.598 76.537  1.00 16.33 ? 307  TYR A CA  1 
ATOM   2319 C  C   . TYR A 1 307 ? 7.328  29.036 76.779  1.00 19.65 ? 307  TYR A C   1 
ATOM   2320 O  O   . TYR A 1 307 ? 6.127  29.317 76.747  1.00 21.90 ? 307  TYR A O   1 
ATOM   2321 C  CB  . TYR A 1 307 ? 7.993  27.370 75.062  1.00 13.40 ? 307  TYR A CB  1 
ATOM   2322 C  CG  . TYR A 1 307 ? 8.550  25.976 74.814  1.00 16.63 ? 307  TYR A CG  1 
ATOM   2323 C  CD1 . TYR A 1 307 ? 9.740  25.581 75.401  1.00 14.83 ? 307  TYR A CD1 1 
ATOM   2324 C  CD2 . TYR A 1 307 ? 7.862  25.105 73.984  1.00 16.16 ? 307  TYR A CD2 1 
ATOM   2325 C  CE1 . TYR A 1 307 ? 10.237 24.318 75.152  1.00 15.98 ? 307  TYR A CE1 1 
ATOM   2326 C  CE2 . TYR A 1 307 ? 8.363  23.845 73.741  1.00 15.96 ? 307  TYR A CE2 1 
ATOM   2327 C  CZ  . TYR A 1 307 ? 9.553  23.457 74.329  1.00 15.76 ? 307  TYR A CZ  1 
ATOM   2328 O  OH  . TYR A 1 307 ? 10.057 22.180 74.079  1.00 18.45 ? 307  TYR A OH  1 
ATOM   2329 N  N   . ASP A 1 308 ? 8.208  29.970 77.098  1.00 17.90 ? 308  ASP A N   1 
ATOM   2330 C  CA  . ASP A 1 308 ? 7.835  31.343 77.330  1.00 17.58 ? 308  ASP A CA  1 
ATOM   2331 C  C   . ASP A 1 308 ? 7.594  32.065 76.041  1.00 18.76 ? 308  ASP A C   1 
ATOM   2332 O  O   . ASP A 1 308 ? 6.935  33.100 76.021  1.00 21.87 ? 308  ASP A O   1 
ATOM   2333 C  CB  . ASP A 1 308 ? 8.902  32.063 78.090  1.00 15.90 ? 308  ASP A CB  1 
ATOM   2334 C  CG  . ASP A 1 308 ? 9.014  31.493 79.474  1.00 19.14 ? 308  ASP A CG  1 
ATOM   2335 O  OD1 . ASP A 1 308 ? 8.223  31.828 80.341  1.00 18.59 ? 308  ASP A OD1 1 
ATOM   2336 O  OD2 . ASP A 1 308 ? 9.951  30.739 79.734  1.00 18.98 ? 308  ASP A OD2 1 
ATOM   2337 N  N   . GLN A 1 309 ? 8.068  31.521 74.938  1.00 21.35 ? 309  GLN A N   1 
ATOM   2338 C  CA  . GLN A 1 309 ? 7.844  32.109 73.637  1.00 21.12 ? 309  GLN A CA  1 
ATOM   2339 C  C   . GLN A 1 309 ? 7.962  30.958 72.686  1.00 20.89 ? 309  GLN A C   1 
ATOM   2340 O  O   . GLN A 1 309 ? 8.782  30.076 72.940  1.00 20.72 ? 309  GLN A O   1 
ATOM   2341 C  CB  . GLN A 1 309 ? 8.911  33.147 73.370  1.00 26.87 ? 309  GLN A CB  1 
ATOM   2342 C  CG  . GLN A 1 309 ? 8.945  33.537 71.921  1.00 35.15 ? 309  GLN A CG  1 
ATOM   2343 C  CD  . GLN A 1 309 ? 9.412  34.959 71.645  1.00 40.97 ? 309  GLN A CD  1 
ATOM   2344 O  OE1 . GLN A 1 309 ? 10.089 35.597 72.460  1.00 41.35 ? 309  GLN A OE1 1 
ATOM   2345 N  NE2 . GLN A 1 309 ? 9.075  35.471 70.447  1.00 42.00 ? 309  GLN A NE2 1 
ATOM   2346 N  N   . VAL A 1 310 ? 7.160  30.865 71.636  1.00 19.89 ? 310  VAL A N   1 
ATOM   2347 C  CA  . VAL A 1 310 ? 7.306  29.809 70.671  1.00 19.65 ? 310  VAL A CA  1 
ATOM   2348 C  C   . VAL A 1 310 ? 7.484  30.470 69.339  1.00 19.50 ? 310  VAL A C   1 
ATOM   2349 O  O   . VAL A 1 310 ? 6.898  31.526 69.090  1.00 25.12 ? 310  VAL A O   1 
ATOM   2350 C  CB  . VAL A 1 310 ? 6.052  28.908 70.680  1.00 19.79 ? 310  VAL A CB  1 
ATOM   2351 C  CG1 . VAL A 1 310 ? 6.058  27.909 69.543  1.00 18.03 ? 310  VAL A CG1 1 
ATOM   2352 C  CG2 . VAL A 1 310 ? 6.075  28.076 71.951  1.00 20.63 ? 310  VAL A CG2 1 
ATOM   2353 N  N   . ILE A 1 311 ? 8.375  29.931 68.519  1.00 16.41 ? 311  ILE A N   1 
ATOM   2354 C  CA  . ILE A 1 311 ? 8.561  30.402 67.161  1.00 15.29 ? 311  ILE A CA  1 
ATOM   2355 C  C   . ILE A 1 311 ? 8.417  29.149 66.357  1.00 17.25 ? 311  ILE A C   1 
ATOM   2356 O  O   . ILE A 1 311 ? 8.796  28.083 66.835  1.00 17.42 ? 311  ILE A O   1 
ATOM   2357 C  CB  . ILE A 1 311 ? 9.963  31.016 67.041  1.00 20.88 ? 311  ILE A CB  1 
ATOM   2358 C  CG1 . ILE A 1 311 ? 9.954  32.335 67.770  1.00 22.61 ? 311  ILE A CG1 1 
ATOM   2359 C  CG2 . ILE A 1 311 ? 10.366 31.258 65.606  1.00 18.94 ? 311  ILE A CG2 1 
ATOM   2360 C  CD1 . ILE A 1 311 ? 11.388 32.657 68.175  1.00 28.58 ? 311  ILE A CD1 1 
ATOM   2361 N  N   . GLU A 1 312 ? 7.840  29.196 65.171  1.00 18.77 ? 312  GLU A N   1 
ATOM   2362 C  CA  . GLU A 1 312 ? 7.697  28.023 64.356  1.00 19.85 ? 312  GLU A CA  1 
ATOM   2363 C  C   . GLU A 1 312 ? 8.347  28.310 63.030  1.00 19.61 ? 312  GLU A C   1 
ATOM   2364 O  O   . GLU A 1 312 ? 8.174  29.405 62.476  1.00 20.76 ? 312  GLU A O   1 
ATOM   2365 C  CB  . GLU A 1 312 ? 6.231  27.689 64.146  1.00 21.91 ? 312  GLU A CB  1 
ATOM   2366 C  CG  . GLU A 1 312 ? 6.084  26.454 63.275  1.00 30.57 ? 312  GLU A CG  1 
ATOM   2367 C  CD  . GLU A 1 312 ? 4.723  25.773 63.283  1.00 35.97 ? 312  GLU A CD  1 
ATOM   2368 O  OE1 . GLU A 1 312 ? 4.082  25.648 64.341  1.00 37.36 ? 312  GLU A OE1 1 
ATOM   2369 O  OE2 . GLU A 1 312 ? 4.357  25.229 62.243  1.00 37.91 ? 312  GLU A OE2 1 
ATOM   2370 N  N   . ILE A 1 313 ? 9.183  27.374 62.582  1.00 19.81 ? 313  ILE A N   1 
ATOM   2371 C  CA  . ILE A 1 313 ? 9.838  27.486 61.296  1.00 21.85 ? 313  ILE A CA  1 
ATOM   2372 C  C   . ILE A 1 313 ? 9.580  26.215 60.505  1.00 19.07 ? 313  ILE A C   1 
ATOM   2373 O  O   . ILE A 1 313 ? 9.731  25.058 60.918  1.00 18.53 ? 313  ILE A O   1 
ATOM   2374 C  CB  . ILE A 1 313 ? 11.401 27.736 61.432  1.00 23.37 ? 313  ILE A CB  1 
ATOM   2375 C  CG1 . ILE A 1 313 ? 11.596 29.113 62.090  1.00 23.62 ? 313  ILE A CG1 1 
ATOM   2376 C  CG2 . ILE A 1 313 ? 12.121 27.666 60.054  1.00 25.38 ? 313  ILE A CG2 1 
ATOM   2377 C  CD1 . ILE A 1 313 ? 13.005 29.674 62.137  1.00 25.64 ? 313  ILE A CD1 1 
ATOM   2378 N  N   . ASN A 1 314 ? 9.150  26.504 59.295  1.00 18.99 ? 314  ASN A N   1 
ATOM   2379 C  CA  . ASN A 1 314 ? 8.862  25.467 58.347  1.00 23.68 ? 314  ASN A CA  1 
ATOM   2380 C  C   . ASN A 1 314 ? 10.083 25.392 57.474  1.00 22.28 ? 314  ASN A C   1 
ATOM   2381 O  O   . ASN A 1 314 ? 10.323 26.243 56.626  1.00 24.89 ? 314  ASN A O   1 
ATOM   2382 C  CB  . ASN A 1 314 ? 7.656  25.777 57.450  1.00 26.99 ? 314  ASN A CB  1 
ATOM   2383 C  CG  . ASN A 1 314 ? 7.371  24.658 56.454  1.00 27.23 ? 314  ASN A CG  1 
ATOM   2384 O  OD1 . ASN A 1 314 ? 7.831  23.530 56.600  1.00 29.63 ? 314  ASN A OD1 1 
ATOM   2385 N  ND2 . ASN A 1 314 ? 6.654  24.919 55.373  1.00 32.44 ? 314  ASN A ND2 1 
ATOM   2386 N  N   . LEU A 1 315 ? 10.776 24.294 57.703  1.00 22.98 ? 315  LEU A N   1 
ATOM   2387 C  CA  . LEU A 1 315 ? 12.019 23.949 57.063  1.00 21.59 ? 315  LEU A CA  1 
ATOM   2388 C  C   . LEU A 1 315 ? 11.831 23.805 55.585  1.00 21.89 ? 315  LEU A C   1 
ATOM   2389 O  O   . LEU A 1 315 ? 12.714 24.276 54.882  1.00 22.16 ? 315  LEU A O   1 
ATOM   2390 C  CB  . LEU A 1 315 ? 12.527 22.655 57.660  1.00 20.79 ? 315  LEU A CB  1 
ATOM   2391 C  CG  . LEU A 1 315 ? 13.609 22.598 58.716  1.00 21.11 ? 315  LEU A CG  1 
ATOM   2392 C  CD1 . LEU A 1 315 ? 13.631 23.822 59.583  1.00 18.43 ? 315  LEU A CD1 1 
ATOM   2393 C  CD2 . LEU A 1 315 ? 13.394 21.336 59.476  1.00 18.77 ? 315  LEU A CD2 1 
ATOM   2394 N  N   . SER A 1 316 ? 10.680 23.291 55.117  1.00 21.15 ? 316  SER A N   1 
ATOM   2395 C  CA  . SER A 1 316 ? 10.418 23.124 53.698  1.00 21.10 ? 316  SER A CA  1 
ATOM   2396 C  C   . SER A 1 316 ? 10.251 24.435 52.939  1.00 24.04 ? 316  SER A C   1 
ATOM   2397 O  O   . SER A 1 316 ? 10.557 24.502 51.742  1.00 27.81 ? 316  SER A O   1 
ATOM   2398 C  CB  . SER A 1 316 ? 9.174  22.252 53.527  1.00 21.75 ? 316  SER A CB  1 
ATOM   2399 O  OG  . SER A 1 316 ? 9.416  21.054 54.250  1.00 22.42 ? 316  SER A OG  1 
ATOM   2400 N  N   . GLU A 1 317 ? 9.839  25.522 53.603  1.00 26.57 ? 317  GLU A N   1 
ATOM   2401 C  CA  . GLU A 1 317 ? 9.727  26.822 52.957  1.00 29.33 ? 317  GLU A CA  1 
ATOM   2402 C  C   . GLU A 1 317 ? 10.979 27.695 53.135  1.00 27.41 ? 317  GLU A C   1 
ATOM   2403 O  O   . GLU A 1 317 ? 11.137 28.771 52.522  1.00 24.95 ? 317  GLU A O   1 
ATOM   2404 C  CB  . GLU A 1 317 ? 8.528  27.587 53.512  1.00 36.23 ? 317  GLU A CB  1 
ATOM   2405 C  CG  . GLU A 1 317 ? 7.327  27.678 52.567  1.00 47.95 ? 317  GLU A CG  1 
ATOM   2406 C  CD  . GLU A 1 317 ? 6.409  26.459 52.525  1.00 54.83 ? 317  GLU A CD  1 
ATOM   2407 O  OE1 . GLU A 1 317 ? 5.492  26.386 53.349  1.00 59.38 ? 317  GLU A OE1 1 
ATOM   2408 O  OE2 . GLU A 1 317 ? 6.606  25.562 51.695  1.00 59.41 ? 317  GLU A OE2 1 
ATOM   2409 N  N   . LEU A 1 318 ? 11.916 27.267 53.990  1.00 23.80 ? 318  LEU A N   1 
ATOM   2410 C  CA  . LEU A 1 318 ? 13.094 28.062 54.234  1.00 21.23 ? 318  LEU A CA  1 
ATOM   2411 C  C   . LEU A 1 318 ? 14.005 28.083 53.008  1.00 21.60 ? 318  LEU A C   1 
ATOM   2412 O  O   . LEU A 1 318 ? 14.246 27.138 52.236  1.00 24.59 ? 318  LEU A O   1 
ATOM   2413 C  CB  . LEU A 1 318 ? 13.807 27.505 55.482  1.00 20.69 ? 318  LEU A CB  1 
ATOM   2414 C  CG  . LEU A 1 318 ? 15.050 28.276 56.016  1.00 19.50 ? 318  LEU A CG  1 
ATOM   2415 C  CD1 . LEU A 1 318 ? 14.765 29.737 56.353  1.00 14.96 ? 318  LEU A CD1 1 
ATOM   2416 C  CD2 . LEU A 1 318 ? 15.516 27.539 57.228  1.00 19.72 ? 318  LEU A CD2 1 
ATOM   2417 N  N   . LYS A 1 319 ? 14.455 29.292 52.738  1.00 23.72 ? 319  LYS A N   1 
ATOM   2418 C  CA  . LYS A 1 319 ? 15.356 29.545 51.636  1.00 26.01 ? 319  LYS A CA  1 
ATOM   2419 C  C   . LYS A 1 319 ? 16.769 29.909 52.106  1.00 20.29 ? 319  LYS A C   1 
ATOM   2420 O  O   . LYS A 1 319 ? 16.916 30.428 53.210  1.00 17.81 ? 319  LYS A O   1 
ATOM   2421 C  CB  . LYS A 1 319 ? 14.679 30.642 50.824  1.00 33.74 ? 319  LYS A CB  1 
ATOM   2422 C  CG  . LYS A 1 319 ? 14.265 30.120 49.444  1.00 42.79 ? 319  LYS A CG  1 
ATOM   2423 C  CD  . LYS A 1 319 ? 13.467 28.806 49.475  1.00 49.15 ? 319  LYS A CD  1 
ATOM   2424 C  CE  . LYS A 1 319 ? 13.659 27.990 48.175  1.00 54.14 ? 319  LYS A CE  1 
ATOM   2425 N  NZ  . LYS A 1 319 ? 15.045 27.549 47.998  1.00 59.79 ? 319  LYS A NZ  1 
ATOM   2426 N  N   . PRO A 1 320 ? 17.819 29.711 51.334  1.00 18.79 ? 320  PRO A N   1 
ATOM   2427 C  CA  . PRO A 1 320 ? 19.180 30.158 51.666  1.00 18.73 ? 320  PRO A CA  1 
ATOM   2428 C  C   . PRO A 1 320 ? 19.307 31.626 52.113  1.00 18.96 ? 320  PRO A C   1 
ATOM   2429 O  O   . PRO A 1 320 ? 18.818 32.536 51.414  1.00 20.44 ? 320  PRO A O   1 
ATOM   2430 C  CB  . PRO A 1 320 ? 19.949 29.854 50.406  1.00 15.38 ? 320  PRO A CB  1 
ATOM   2431 C  CG  . PRO A 1 320 ? 19.208 28.691 49.820  1.00 16.58 ? 320  PRO A CG  1 
ATOM   2432 C  CD  . PRO A 1 320 ? 17.782 29.087 50.020  1.00 16.03 ? 320  PRO A CD  1 
ATOM   2433 N  N   . HIS A 1 321 ? 19.978 31.900 53.249  1.00 18.10 ? 321  HIS A N   1 
ATOM   2434 C  CA  . HIS A 1 321 ? 20.154 33.224 53.827  1.00 19.65 ? 321  HIS A CA  1 
ATOM   2435 C  C   . HIS A 1 321 ? 21.606 33.657 53.869  1.00 19.18 ? 321  HIS A C   1 
ATOM   2436 O  O   . HIS A 1 321 ? 22.506 32.844 53.758  1.00 19.99 ? 321  HIS A O   1 
ATOM   2437 C  CB  . HIS A 1 321 ? 19.575 33.279 55.274  1.00 22.47 ? 321  HIS A CB  1 
ATOM   2438 C  CG  . HIS A 1 321 ? 18.065 33.541 55.279  1.00 26.65 ? 321  HIS A CG  1 
ATOM   2439 N  ND1 . HIS A 1 321 ? 17.410 34.674 55.564  1.00 29.52 ? 321  HIS A ND1 1 
ATOM   2440 C  CD2 . HIS A 1 321 ? 17.119 32.624 54.874  1.00 25.35 ? 321  HIS A CD2 1 
ATOM   2441 C  CE1 . HIS A 1 321 ? 16.136 34.465 55.328  1.00 28.73 ? 321  HIS A CE1 1 
ATOM   2442 N  NE2 . HIS A 1 321 ? 15.976 33.230 54.914  1.00 27.59 ? 321  HIS A NE2 1 
ATOM   2443 N  N   . ILE A 1 322 ? 21.848 34.961 53.962  1.00 18.22 ? 322  ILE A N   1 
ATOM   2444 C  CA  . ILE A 1 322 ? 23.159 35.554 54.130  1.00 15.96 ? 322  ILE A CA  1 
ATOM   2445 C  C   . ILE A 1 322 ? 22.920 36.780 54.999  1.00 18.02 ? 322  ILE A C   1 
ATOM   2446 O  O   . ILE A 1 322 ? 22.074 37.659 54.719  1.00 16.92 ? 322  ILE A O   1 
ATOM   2447 C  CB  . ILE A 1 322 ? 23.770 35.863 52.693  1.00 16.50 ? 322  ILE A CB  1 
ATOM   2448 C  CG1 . ILE A 1 322 ? 25.126 36.543 52.880  1.00 13.17 ? 322  ILE A CG1 1 
ATOM   2449 C  CG2 . ILE A 1 322 ? 22.817 36.654 51.827  1.00 12.35 ? 322  ILE A CG2 1 
ATOM   2450 C  CD1 . ILE A 1 322 ? 25.986 36.371 51.619  1.00 12.03 ? 322  ILE A CD1 1 
ATOM   2451 N  N   . ASN A 1 323 ? 23.623 36.800 56.131  1.00 15.51 ? 323  ASN A N   1 
ATOM   2452 C  CA  . ASN A 1 323 ? 23.429 37.861 57.091  1.00 15.66 ? 323  ASN A CA  1 
ATOM   2453 C  C   . ASN A 1 323 ? 24.577 38.860 57.197  1.00 19.47 ? 323  ASN A C   1 
ATOM   2454 O  O   . ASN A 1 323 ? 25.749 38.487 57.051  1.00 20.55 ? 323  ASN A O   1 
ATOM   2455 C  CB  . ASN A 1 323 ? 23.146 37.231 58.467  1.00 13.52 ? 323  ASN A CB  1 
ATOM   2456 C  CG  . ASN A 1 323 ? 21.759 36.574 58.590  1.00 12.30 ? 323  ASN A CG  1 
ATOM   2457 O  OD1 . ASN A 1 323 ? 21.156 36.098 57.621  1.00 11.17 ? 323  ASN A OD1 1 
ATOM   2458 N  ND2 . ASN A 1 323 ? 21.165 36.484 59.765  1.00 7.98  ? 323  ASN A ND2 1 
ATOM   2459 N  N   . GLY A 1 324 ? 24.281 40.133 57.457  1.00 18.93 ? 324  GLY A N   1 
ATOM   2460 C  CA  . GLY A 1 324 ? 25.287 41.160 57.599  1.00 20.87 ? 324  GLY A CA  1 
ATOM   2461 C  C   . GLY A 1 324 ? 25.038 42.306 56.629  1.00 26.23 ? 324  GLY A C   1 
ATOM   2462 O  O   . GLY A 1 324 ? 24.071 42.254 55.864  1.00 27.22 ? 324  GLY A O   1 
ATOM   2463 N  N   . PRO A 1 325 ? 25.826 43.380 56.547  1.00 26.64 ? 325  PRO A N   1 
ATOM   2464 C  CA  . PRO A 1 325 ? 27.170 43.424 56.996  1.00 26.12 ? 325  PRO A CA  1 
ATOM   2465 C  C   . PRO A 1 325 ? 27.650 43.798 58.366  1.00 25.91 ? 325  PRO A C   1 
ATOM   2466 O  O   . PRO A 1 325 ? 28.865 43.605 58.455  1.00 35.87 ? 325  PRO A O   1 
ATOM   2467 C  CB  . PRO A 1 325 ? 27.858 44.278 55.958  1.00 27.89 ? 325  PRO A CB  1 
ATOM   2468 C  CG  . PRO A 1 325 ? 26.860 45.386 55.791  1.00 27.35 ? 325  PRO A CG  1 
ATOM   2469 C  CD  . PRO A 1 325 ? 25.614 44.520 55.665  1.00 27.36 ? 325  PRO A CD  1 
ATOM   2470 N  N   . PHE A 1 326 ? 27.121 44.313 59.461  1.00 24.99 ? 326  PHE A N   1 
ATOM   2471 C  CA  . PHE A 1 326 ? 28.066 44.465 60.612  1.00 21.54 ? 326  PHE A CA  1 
ATOM   2472 C  C   . PHE A 1 326 ? 27.530 43.916 61.927  1.00 18.63 ? 326  PHE A C   1 
ATOM   2473 O  O   . PHE A 1 326 ? 28.055 44.072 63.032  1.00 19.23 ? 326  PHE A O   1 
ATOM   2474 C  CB  . PHE A 1 326 ? 28.433 45.980 60.696  1.00 25.91 ? 326  PHE A CB  1 
ATOM   2475 C  CG  . PHE A 1 326 ? 29.462 46.493 59.646  1.00 27.09 ? 326  PHE A CG  1 
ATOM   2476 C  CD1 . PHE A 1 326 ? 29.077 46.859 58.365  1.00 27.41 ? 326  PHE A CD1 1 
ATOM   2477 C  CD2 . PHE A 1 326 ? 30.819 46.535 59.963  1.00 28.35 ? 326  PHE A CD2 1 
ATOM   2478 C  CE1 . PHE A 1 326 ? 30.022 47.242 57.426  1.00 27.69 ? 326  PHE A CE1 1 
ATOM   2479 C  CE2 . PHE A 1 326 ? 31.762 46.918 59.020  1.00 28.49 ? 326  PHE A CE2 1 
ATOM   2480 C  CZ  . PHE A 1 326 ? 31.363 47.272 57.747  1.00 28.21 ? 326  PHE A CZ  1 
ATOM   2481 N  N   . THR A 1 327 ? 26.384 43.255 61.724  1.00 17.20 ? 327  THR A N   1 
ATOM   2482 C  CA  . THR A 1 327 ? 25.579 42.588 62.724  1.00 17.93 ? 327  THR A CA  1 
ATOM   2483 C  C   . THR A 1 327 ? 25.231 41.262 62.082  1.00 15.47 ? 327  THR A C   1 
ATOM   2484 O  O   . THR A 1 327 ? 25.000 41.178 60.853  1.00 18.70 ? 327  THR A O   1 
ATOM   2485 C  CB  . THR A 1 327 ? 24.183 43.162 63.037  1.00 18.93 ? 327  THR A CB  1 
ATOM   2486 O  OG1 . THR A 1 327 ? 23.869 44.288 62.199  1.00 22.72 ? 327  THR A OG1 1 
ATOM   2487 C  CG2 . THR A 1 327 ? 24.136 43.333 64.508  1.00 14.95 ? 327  THR A CG2 1 
ATOM   2488 N  N   . PRO A 1 328 ? 25.161 40.208 62.895  1.00 15.93 ? 328  PRO A N   1 
ATOM   2489 C  CA  . PRO A 1 328 ? 24.713 38.901 62.420  1.00 17.11 ? 328  PRO A CA  1 
ATOM   2490 C  C   . PRO A 1 328 ? 23.169 38.777 62.275  1.00 18.94 ? 328  PRO A C   1 
ATOM   2491 O  O   . PRO A 1 328 ? 22.680 37.759 61.773  1.00 18.81 ? 328  PRO A O   1 
ATOM   2492 C  CB  . PRO A 1 328 ? 25.372 37.982 63.435  1.00 12.48 ? 328  PRO A CB  1 
ATOM   2493 C  CG  . PRO A 1 328 ? 25.340 38.741 64.722  1.00 11.30 ? 328  PRO A CG  1 
ATOM   2494 C  CD  . PRO A 1 328 ? 25.646 40.161 64.289  1.00 12.63 ? 328  PRO A CD  1 
ATOM   2495 N  N   . ASP A 1 329 ? 22.336 39.775 62.650  1.00 20.07 ? 329  ASP A N   1 
ATOM   2496 C  CA  . ASP A 1 329 ? 20.896 39.668 62.551  1.00 21.77 ? 329  ASP A CA  1 
ATOM   2497 C  C   . ASP A 1 329 ? 20.317 40.498 61.424  1.00 22.06 ? 329  ASP A C   1 
ATOM   2498 O  O   . ASP A 1 329 ? 19.102 40.581 61.282  1.00 24.15 ? 329  ASP A O   1 
ATOM   2499 C  CB  . ASP A 1 329 ? 20.239 40.079 63.868  1.00 19.67 ? 329  ASP A CB  1 
ATOM   2500 C  CG  . ASP A 1 329 ? 20.410 41.493 64.374  1.00 20.80 ? 329  ASP A CG  1 
ATOM   2501 O  OD1 . ASP A 1 329 ? 21.125 42.274 63.786  1.00 22.35 ? 329  ASP A OD1 1 
ATOM   2502 O  OD2 . ASP A 1 329 ? 19.894 41.825 65.422  1.00 20.00 ? 329  ASP A OD2 1 
ATOM   2503 N  N   . LEU A 1 330 ? 21.138 41.050 60.531  1.00 19.38 ? 330  LEU A N   1 
ATOM   2504 C  CA  . LEU A 1 330 ? 20.600 41.761 59.402  1.00 18.03 ? 330  LEU A CA  1 
ATOM   2505 C  C   . LEU A 1 330 ? 20.438 40.608 58.426  1.00 18.49 ? 330  LEU A C   1 
ATOM   2506 O  O   . LEU A 1 330 ? 21.431 40.266 57.784  1.00 17.25 ? 330  LEU A O   1 
ATOM   2507 C  CB  . LEU A 1 330 ? 21.622 42.792 58.932  1.00 19.83 ? 330  LEU A CB  1 
ATOM   2508 C  CG  . LEU A 1 330 ? 21.160 44.152 58.402  1.00 23.80 ? 330  LEU A CG  1 
ATOM   2509 C  CD1 . LEU A 1 330 ? 22.138 44.628 57.332  1.00 20.68 ? 330  LEU A CD1 1 
ATOM   2510 C  CD2 . LEU A 1 330 ? 19.758 44.063 57.798  1.00 23.94 ? 330  LEU A CD2 1 
ATOM   2511 N  N   . ALA A 1 331 ? 19.275 39.952 58.281  1.00 17.21 ? 331  ALA A N   1 
ATOM   2512 C  CA  . ALA A 1 331 ? 19.164 38.760 57.439  1.00 17.08 ? 331  ALA A CA  1 
ATOM   2513 C  C   . ALA A 1 331 ? 18.628 38.989 56.067  1.00 18.48 ? 331  ALA A C   1 
ATOM   2514 O  O   . ALA A 1 331 ? 17.649 39.715 55.937  1.00 24.98 ? 331  ALA A O   1 
ATOM   2515 C  CB  . ALA A 1 331 ? 18.262 37.720 58.081  1.00 15.80 ? 331  ALA A CB  1 
ATOM   2516 N  N   . HIS A 1 332 ? 19.164 38.422 55.002  1.00 19.98 ? 332  HIS A N   1 
ATOM   2517 C  CA  . HIS A 1 332 ? 18.646 38.672 53.658  1.00 20.48 ? 332  HIS A CA  1 
ATOM   2518 C  C   . HIS A 1 332 ? 18.539 37.300 53.048  1.00 21.97 ? 332  HIS A C   1 
ATOM   2519 O  O   . HIS A 1 332 ? 19.357 36.431 53.360  1.00 21.06 ? 332  HIS A O   1 
ATOM   2520 C  CB  . HIS A 1 332 ? 19.591 39.466 52.715  1.00 23.06 ? 332  HIS A CB  1 
ATOM   2521 C  CG  . HIS A 1 332 ? 20.242 40.634 53.417  1.00 24.62 ? 332  HIS A CG  1 
ATOM   2522 N  ND1 . HIS A 1 332 ? 19.701 41.791 53.772  1.00 26.75 ? 332  HIS A ND1 1 
ATOM   2523 C  CD2 . HIS A 1 332 ? 21.529 40.637 53.877  1.00 25.85 ? 332  HIS A CD2 1 
ATOM   2524 C  CE1 . HIS A 1 332 ? 20.584 42.502 54.426  1.00 24.17 ? 332  HIS A CE1 1 
ATOM   2525 N  NE2 . HIS A 1 332 ? 21.675 41.786 54.478  1.00 27.00 ? 332  HIS A NE2 1 
ATOM   2526 N  N   . PRO A 1 333 ? 17.575 36.972 52.199  1.00 23.03 ? 333  PRO A N   1 
ATOM   2527 C  CA  . PRO A 1 333 ? 17.648 35.770 51.387  1.00 22.34 ? 333  PRO A CA  1 
ATOM   2528 C  C   . PRO A 1 333 ? 18.780 35.976 50.402  1.00 23.30 ? 333  PRO A C   1 
ATOM   2529 O  O   . PRO A 1 333 ? 19.009 37.104 49.938  1.00 19.52 ? 333  PRO A O   1 
ATOM   2530 C  CB  . PRO A 1 333 ? 16.305 35.663 50.718  1.00 22.20 ? 333  PRO A CB  1 
ATOM   2531 C  CG  . PRO A 1 333 ? 15.411 36.454 51.637  1.00 24.98 ? 333  PRO A CG  1 
ATOM   2532 C  CD  . PRO A 1 333 ? 16.296 37.663 52.042  1.00 23.82 ? 333  PRO A CD  1 
ATOM   2533 N  N   . VAL A 1 334 ? 19.456 34.897 50.006  1.00 24.81 ? 334  VAL A N   1 
ATOM   2534 C  CA  . VAL A 1 334 ? 20.566 35.010 49.060  1.00 26.25 ? 334  VAL A CA  1 
ATOM   2535 C  C   . VAL A 1 334 ? 20.044 35.624 47.756  1.00 28.92 ? 334  VAL A C   1 
ATOM   2536 O  O   . VAL A 1 334 ? 20.692 36.488 47.158  1.00 30.42 ? 334  VAL A O   1 
ATOM   2537 C  CB  . VAL A 1 334 ? 21.218 33.598 48.836  1.00 23.88 ? 334  VAL A CB  1 
ATOM   2538 C  CG1 . VAL A 1 334 ? 22.194 33.606 47.633  1.00 20.45 ? 334  VAL A CG1 1 
ATOM   2539 C  CG2 . VAL A 1 334 ? 22.020 33.223 50.099  1.00 18.34 ? 334  VAL A CG2 1 
ATOM   2540 N  N   . ALA A 1 335 ? 18.818 35.278 47.369  1.00 29.35 ? 335  ALA A N   1 
ATOM   2541 C  CA  . ALA A 1 335 ? 18.186 35.835 46.172  1.00 29.10 ? 335  ALA A CA  1 
ATOM   2542 C  C   . ALA A 1 335 ? 18.053 37.357 46.220  1.00 29.45 ? 335  ALA A C   1 
ATOM   2543 O  O   . ALA A 1 335 ? 17.998 37.980 45.162  1.00 31.89 ? 335  ALA A O   1 
ATOM   2544 C  CB  . ALA A 1 335 ? 16.811 35.215 46.002  1.00 27.21 ? 335  ALA A CB  1 
ATOM   2545 N  N   . GLU A 1 336 ? 18.071 38.028 47.367  1.00 32.14 ? 336  GLU A N   1 
ATOM   2546 C  CA  . GLU A 1 336 ? 17.972 39.474 47.365  1.00 36.42 ? 336  GLU A CA  1 
ATOM   2547 C  C   . GLU A 1 336 ? 19.190 40.225 47.825  1.00 34.20 ? 336  GLU A C   1 
ATOM   2548 O  O   . GLU A 1 336 ? 19.222 41.454 47.670  1.00 35.46 ? 336  GLU A O   1 
ATOM   2549 C  CB  . GLU A 1 336 ? 16.907 39.959 48.246  1.00 41.40 ? 336  GLU A CB  1 
ATOM   2550 C  CG  . GLU A 1 336 ? 15.561 39.506 47.811  1.00 49.45 ? 336  GLU A CG  1 
ATOM   2551 C  CD  . GLU A 1 336 ? 14.683 39.341 49.036  1.00 55.81 ? 336  GLU A CD  1 
ATOM   2552 O  OE1 . GLU A 1 336 ? 14.838 40.087 50.031  1.00 56.95 ? 336  GLU A OE1 1 
ATOM   2553 O  OE2 . GLU A 1 336 ? 13.855 38.425 48.975  1.00 59.99 ? 336  GLU A OE2 1 
ATOM   2554 N  N   . VAL A 1 337 ? 20.212 39.575 48.380  1.00 30.20 ? 337  VAL A N   1 
ATOM   2555 C  CA  . VAL A 1 337 ? 21.353 40.335 48.874  1.00 27.77 ? 337  VAL A CA  1 
ATOM   2556 C  C   . VAL A 1 337 ? 22.007 41.123 47.727  1.00 26.11 ? 337  VAL A C   1 
ATOM   2557 O  O   . VAL A 1 337 ? 22.402 42.271 47.943  1.00 24.15 ? 337  VAL A O   1 
ATOM   2558 C  CB  . VAL A 1 337 ? 22.335 39.344 49.586  1.00 25.35 ? 337  VAL A CB  1 
ATOM   2559 C  CG1 . VAL A 1 337 ? 23.060 38.424 48.609  1.00 21.02 ? 337  VAL A CG1 1 
ATOM   2560 C  CG2 . VAL A 1 337 ? 23.257 40.194 50.450  1.00 23.99 ? 337  VAL A CG2 1 
ATOM   2561 N  N   . GLY A 1 338 ? 21.996 40.621 46.492  1.00 25.76 ? 338  GLY A N   1 
ATOM   2562 C  CA  . GLY A 1 338 ? 22.564 41.326 45.352  1.00 30.66 ? 338  GLY A CA  1 
ATOM   2563 C  C   . GLY A 1 338 ? 21.961 42.717 45.121  1.00 33.02 ? 338  GLY A C   1 
ATOM   2564 O  O   . GLY A 1 338 ? 22.649 43.666 44.712  1.00 34.55 ? 338  GLY A O   1 
ATOM   2565 N  N   . SER A 1 339 ? 20.667 42.859 45.385  1.00 33.93 ? 339  SER A N   1 
ATOM   2566 C  CA  . SER A 1 339 ? 19.982 44.122 45.156  1.00 34.18 ? 339  SER A CA  1 
ATOM   2567 C  C   . SER A 1 339 ? 20.016 45.033 46.367  1.00 32.08 ? 339  SER A C   1 
ATOM   2568 O  O   . SER A 1 339 ? 20.156 46.250 46.222  1.00 35.23 ? 339  SER A O   1 
ATOM   2569 C  CB  . SER A 1 339 ? 18.558 43.792 44.732  1.00 37.98 ? 339  SER A CB  1 
ATOM   2570 O  OG  . SER A 1 339 ? 18.611 42.815 43.667  1.00 47.23 ? 339  SER A OG  1 
ATOM   2571 N  N   . VAL A 1 340 ? 19.969 44.495 47.582  1.00 28.87 ? 340  VAL A N   1 
ATOM   2572 C  CA  . VAL A 1 340 ? 20.082 45.312 48.780  1.00 26.64 ? 340  VAL A CA  1 
ATOM   2573 C  C   . VAL A 1 340 ? 21.491 45.892 48.833  1.00 29.82 ? 340  VAL A C   1 
ATOM   2574 O  O   . VAL A 1 340 ? 21.667 47.067 49.167  1.00 32.00 ? 340  VAL A O   1 
ATOM   2575 C  CB  . VAL A 1 340 ? 19.850 44.484 50.019  1.00 23.39 ? 340  VAL A CB  1 
ATOM   2576 C  CG1 . VAL A 1 340 ? 19.871 45.356 51.242  1.00 19.23 ? 340  VAL A CG1 1 
ATOM   2577 C  CG2 . VAL A 1 340 ? 18.532 43.775 49.880  1.00 26.50 ? 340  VAL A CG2 1 
ATOM   2578 N  N   . ALA A 1 341 ? 22.506 45.106 48.471  1.00 29.89 ? 341  ALA A N   1 
ATOM   2579 C  CA  . ALA A 1 341 ? 23.882 45.589 48.488  1.00 33.09 ? 341  ALA A CA  1 
ATOM   2580 C  C   . ALA A 1 341 ? 24.072 46.801 47.594  1.00 33.77 ? 341  ALA A C   1 
ATOM   2581 O  O   . ALA A 1 341 ? 24.560 47.848 48.031  1.00 33.17 ? 341  ALA A O   1 
ATOM   2582 C  CB  . ALA A 1 341 ? 24.844 44.486 48.033  1.00 32.01 ? 341  ALA A CB  1 
ATOM   2583 N  N   . GLU A 1 342 ? 23.538 46.644 46.388  1.00 36.10 ? 342  GLU A N   1 
ATOM   2584 C  CA  . GLU A 1 342 ? 23.556 47.643 45.344  1.00 40.13 ? 342  GLU A CA  1 
ATOM   2585 C  C   . GLU A 1 342 ? 22.900 48.923 45.836  1.00 39.55 ? 342  GLU A C   1 
ATOM   2586 O  O   . GLU A 1 342 ? 23.478 50.007 45.803  1.00 38.54 ? 342  GLU A O   1 
ATOM   2587 C  CB  . GLU A 1 342 ? 22.853 46.973 44.209  1.00 44.65 ? 342  GLU A CB  1 
ATOM   2588 C  CG  . GLU A 1 342 ? 22.923 47.570 42.830  1.00 52.51 ? 342  GLU A CG  1 
ATOM   2589 C  CD  . GLU A 1 342 ? 22.666 46.458 41.814  1.00 57.70 ? 342  GLU A CD  1 
ATOM   2590 O  OE1 . GLU A 1 342 ? 21.599 45.822 41.798  1.00 61.78 ? 342  GLU A OE1 1 
ATOM   2591 O  OE2 . GLU A 1 342 ? 23.576 46.067 41.082  1.00 58.96 ? 342  GLU A OE2 1 
ATOM   2592 N  N   . LYS A 1 343 ? 21.714 48.785 46.403  1.00 40.72 ? 343  LYS A N   1 
ATOM   2593 C  CA  . LYS A 1 343 ? 21.011 49.911 46.987  1.00 43.69 ? 343  LYS A CA  1 
ATOM   2594 C  C   . LYS A 1 343 ? 21.769 50.548 48.152  1.00 41.75 ? 343  LYS A C   1 
ATOM   2595 O  O   . LYS A 1 343 ? 21.843 51.775 48.244  1.00 42.57 ? 343  LYS A O   1 
ATOM   2596 C  CB  . LYS A 1 343 ? 19.623 49.403 47.416  1.00 46.84 ? 343  LYS A CB  1 
ATOM   2597 C  CG  . LYS A 1 343 ? 18.876 50.183 48.495  1.00 53.18 ? 343  LYS A CG  1 
ATOM   2598 C  CD  . LYS A 1 343 ? 17.807 49.231 49.045  1.00 58.93 ? 343  LYS A CD  1 
ATOM   2599 C  CE  . LYS A 1 343 ? 17.174 49.683 50.382  1.00 62.36 ? 343  LYS A CE  1 
ATOM   2600 N  NZ  . LYS A 1 343 ? 17.801 49.065 51.557  1.00 64.03 ? 343  LYS A NZ  1 
ATOM   2601 N  N   . GLU A 1 344 ? 22.350 49.753 49.051  1.00 39.73 ? 344  GLU A N   1 
ATOM   2602 C  CA  . GLU A 1 344 ? 22.989 50.280 50.238  1.00 36.35 ? 344  GLU A CA  1 
ATOM   2603 C  C   . GLU A 1 344 ? 24.443 50.711 50.068  1.00 33.07 ? 344  GLU A C   1 
ATOM   2604 O  O   . GLU A 1 344 ? 25.069 51.231 50.994  1.00 31.37 ? 344  GLU A O   1 
ATOM   2605 C  CB  . GLU A 1 344 ? 22.900 49.237 51.305  1.00 37.60 ? 344  GLU A CB  1 
ATOM   2606 C  CG  . GLU A 1 344 ? 22.201 49.775 52.530  1.00 43.19 ? 344  GLU A CG  1 
ATOM   2607 C  CD  . GLU A 1 344 ? 20.717 49.516 52.470  1.00 47.58 ? 344  GLU A CD  1 
ATOM   2608 O  OE1 . GLU A 1 344 ? 20.284 48.410 52.142  1.00 52.01 ? 344  GLU A OE1 1 
ATOM   2609 O  OE2 . GLU A 1 344 ? 19.896 50.401 52.709  1.00 50.57 ? 344  GLU A OE2 1 
ATOM   2610 N  N   . GLY A 1 345 ? 25.046 50.465 48.907  1.00 31.90 ? 345  GLY A N   1 
ATOM   2611 C  CA  . GLY A 1 345 ? 26.438 50.814 48.704  1.00 34.10 ? 345  GLY A CA  1 
ATOM   2612 C  C   . GLY A 1 345 ? 27.405 49.828 49.350  1.00 35.24 ? 345  GLY A C   1 
ATOM   2613 O  O   . GLY A 1 345 ? 28.538 50.181 49.716  1.00 38.68 ? 345  GLY A O   1 
ATOM   2614 N  N   . TRP A 1 346 ? 26.977 48.580 49.511  1.00 31.95 ? 346  TRP A N   1 
ATOM   2615 C  CA  . TRP A 1 346 ? 27.862 47.530 49.972  1.00 29.50 ? 346  TRP A CA  1 
ATOM   2616 C  C   . TRP A 1 346 ? 28.600 46.987 48.755  1.00 27.79 ? 346  TRP A C   1 
ATOM   2617 O  O   . TRP A 1 346 ? 27.952 46.737 47.734  1.00 28.95 ? 346  TRP A O   1 
ATOM   2618 C  CB  . TRP A 1 346 ? 27.115 46.374 50.603  1.00 28.65 ? 346  TRP A CB  1 
ATOM   2619 C  CG  . TRP A 1 346 ? 26.250 46.770 51.779  1.00 27.07 ? 346  TRP A CG  1 
ATOM   2620 C  CD1 . TRP A 1 346 ? 26.544 47.842 52.577  1.00 26.05 ? 346  TRP A CD1 1 
ATOM   2621 C  CD2 . TRP A 1 346 ? 25.129 46.083 52.163  1.00 26.16 ? 346  TRP A CD2 1 
ATOM   2622 N  NE1 . TRP A 1 346 ? 25.592 47.844 53.472  1.00 28.13 ? 346  TRP A NE1 1 
ATOM   2623 C  CE2 . TRP A 1 346 ? 24.714 46.829 53.245  1.00 26.97 ? 346  TRP A CE2 1 
ATOM   2624 C  CE3 . TRP A 1 346 ? 24.396 45.001 51.726  1.00 25.52 ? 346  TRP A CE3 1 
ATOM   2625 C  CZ2 . TRP A 1 346 ? 23.579 46.450 53.955  1.00 24.76 ? 346  TRP A CZ2 1 
ATOM   2626 C  CZ3 . TRP A 1 346 ? 23.274 44.630 52.427  1.00 24.88 ? 346  TRP A CZ3 1 
ATOM   2627 C  CH2 . TRP A 1 346 ? 22.853 45.366 53.517  1.00 22.91 ? 346  TRP A CH2 1 
ATOM   2628 N  N   . PRO A 1 347 ? 29.941 46.801 48.789  1.00 26.43 ? 347  PRO A N   1 
ATOM   2629 C  CA  . PRO A 1 347 ? 30.716 46.323 47.639  1.00 23.40 ? 347  PRO A CA  1 
ATOM   2630 C  C   . PRO A 1 347 ? 30.193 44.980 47.147  1.00 25.05 ? 347  PRO A C   1 
ATOM   2631 O  O   . PRO A 1 347 ? 29.899 44.088 47.949  1.00 24.61 ? 347  PRO A O   1 
ATOM   2632 C  CB  . PRO A 1 347 ? 32.128 46.303 48.176  1.00 23.27 ? 347  PRO A CB  1 
ATOM   2633 C  CG  . PRO A 1 347 ? 32.141 47.292 49.339  1.00 22.44 ? 347  PRO A CG  1 
ATOM   2634 C  CD  . PRO A 1 347 ? 30.786 47.024 49.971  1.00 22.45 ? 347  PRO A CD  1 
ATOM   2635 N  N   . LEU A 1 348 ? 30.019 44.853 45.836  1.00 25.52 ? 348  LEU A N   1 
ATOM   2636 C  CA  . LEU A 1 348 ? 29.444 43.641 45.292  1.00 29.47 ? 348  LEU A CA  1 
ATOM   2637 C  C   . LEU A 1 348 ? 30.416 42.527 44.967  1.00 30.31 ? 348  LEU A C   1 
ATOM   2638 O  O   . LEU A 1 348 ? 30.038 41.348 45.012  1.00 29.89 ? 348  LEU A O   1 
ATOM   2639 C  CB  . LEU A 1 348 ? 28.642 43.917 44.013  1.00 31.35 ? 348  LEU A CB  1 
ATOM   2640 C  CG  . LEU A 1 348 ? 27.178 44.404 44.077  1.00 34.10 ? 348  LEU A CG  1 
ATOM   2641 C  CD1 . LEU A 1 348 ? 26.330 43.473 44.947  1.00 34.57 ? 348  LEU A CD1 1 
ATOM   2642 C  CD2 . LEU A 1 348 ? 27.140 45.792 44.672  1.00 35.94 ? 348  LEU A CD2 1 
ATOM   2643 N  N   . ASP A 1 349 ? 31.657 42.857 44.615  1.00 31.46 ? 349  ASP A N   1 
ATOM   2644 C  CA  . ASP A 1 349 ? 32.624 41.860 44.247  1.00 31.82 ? 349  ASP A CA  1 
ATOM   2645 C  C   . ASP A 1 349 ? 33.191 41.377 45.573  1.00 25.74 ? 349  ASP A C   1 
ATOM   2646 O  O   . ASP A 1 349 ? 33.363 42.110 46.556  1.00 22.09 ? 349  ASP A O   1 
ATOM   2647 C  CB  . ASP A 1 349 ? 33.661 42.515 43.302  1.00 40.31 ? 349  ASP A CB  1 
ATOM   2648 C  CG  . ASP A 1 349 ? 34.525 43.589 43.946  1.00 49.20 ? 349  ASP A CG  1 
ATOM   2649 O  OD1 . ASP A 1 349 ? 34.014 44.650 44.337  1.00 53.93 ? 349  ASP A OD1 1 
ATOM   2650 O  OD2 . ASP A 1 349 ? 35.723 43.345 44.128  1.00 54.51 ? 349  ASP A OD2 1 
ATOM   2651 N  N   . ILE A 1 350 ? 33.288 40.045 45.586  1.00 22.21 ? 350  ILE A N   1 
ATOM   2652 C  CA  . ILE A 1 350 ? 33.713 39.339 46.779  1.00 21.43 ? 350  ILE A CA  1 
ATOM   2653 C  C   . ILE A 1 350 ? 35.214 39.117 46.645  1.00 20.66 ? 350  ILE A C   1 
ATOM   2654 O  O   . ILE A 1 350 ? 35.727 38.623 45.624  1.00 20.65 ? 350  ILE A O   1 
ATOM   2655 C  CB  . ILE A 1 350 ? 32.941 37.994 46.890  1.00 20.44 ? 350  ILE A CB  1 
ATOM   2656 C  CG1 . ILE A 1 350 ? 31.449 38.263 46.879  1.00 21.69 ? 350  ILE A CG1 1 
ATOM   2657 C  CG2 . ILE A 1 350 ? 33.303 37.271 48.187  1.00 20.21 ? 350  ILE A CG2 1 
ATOM   2658 C  CD1 . ILE A 1 350 ? 30.584 37.001 46.721  1.00 20.09 ? 350  ILE A CD1 1 
ATOM   2659 N  N   . ARG A 1 351 ? 35.928 39.546 47.665  1.00 21.86 ? 351  ARG A N   1 
ATOM   2660 C  CA  . ARG A 1 351 ? 37.376 39.436 47.619  1.00 27.15 ? 351  ARG A CA  1 
ATOM   2661 C  C   . ARG A 1 351 ? 37.811 38.046 48.054  1.00 25.81 ? 351  ARG A C   1 
ATOM   2662 O  O   . ARG A 1 351 ? 38.510 37.336 47.319  1.00 26.06 ? 351  ARG A O   1 
ATOM   2663 C  CB  . ARG A 1 351 ? 37.989 40.507 48.522  1.00 30.86 ? 351  ARG A CB  1 
ATOM   2664 C  CG  . ARG A 1 351 ? 37.704 41.966 48.160  1.00 36.85 ? 351  ARG A CG  1 
ATOM   2665 C  CD  . ARG A 1 351 ? 38.253 42.518 46.826  1.00 44.16 ? 351  ARG A CD  1 
ATOM   2666 N  NE  . ARG A 1 351 ? 38.728 43.913 47.047  1.00 52.62 ? 351  ARG A NE  1 
ATOM   2667 C  CZ  . ARG A 1 351 ? 38.021 45.041 46.751  1.00 54.27 ? 351  ARG A CZ  1 
ATOM   2668 N  NH1 . ARG A 1 351 ? 36.871 44.995 46.030  1.00 57.33 ? 351  ARG A NH1 1 
ATOM   2669 N  NH2 . ARG A 1 351 ? 38.535 46.237 47.110  1.00 53.48 ? 351  ARG A NH2 1 
ATOM   2670 N  N   . VAL A 1 352 ? 37.303 37.622 49.227  1.00 22.75 ? 352  VAL A N   1 
ATOM   2671 C  CA  . VAL A 1 352 ? 37.636 36.336 49.824  1.00 20.01 ? 352  VAL A CA  1 
ATOM   2672 C  C   . VAL A 1 352 ? 36.359 35.629 50.305  1.00 20.65 ? 352  VAL A C   1 
ATOM   2673 O  O   . VAL A 1 352 ? 35.438 36.269 50.834  1.00 19.11 ? 352  VAL A O   1 
ATOM   2674 C  CB  . VAL A 1 352 ? 38.581 36.513 51.036  1.00 18.90 ? 352  VAL A CB  1 
ATOM   2675 C  CG1 . VAL A 1 352 ? 39.203 35.166 51.332  1.00 15.70 ? 352  VAL A CG1 1 
ATOM   2676 C  CG2 . VAL A 1 352 ? 39.645 37.610 50.779  1.00 18.07 ? 352  VAL A CG2 1 
ATOM   2677 N  N   . GLY A 1 353 ? 36.306 34.311 50.087  1.00 19.36 ? 353  GLY A N   1 
ATOM   2678 C  CA  . GLY A 1 353 ? 35.271 33.429 50.585  1.00 17.94 ? 353  GLY A CA  1 
ATOM   2679 C  C   . GLY A 1 353 ? 35.932 32.491 51.595  1.00 16.87 ? 353  GLY A C   1 
ATOM   2680 O  O   . GLY A 1 353 ? 36.908 31.805 51.287  1.00 13.84 ? 353  GLY A O   1 
ATOM   2681 N  N   . LEU A 1 354 ? 35.445 32.424 52.819  1.00 15.92 ? 354  LEU A N   1 
ATOM   2682 C  CA  . LEU A 1 354 ? 36.091 31.643 53.866  1.00 16.36 ? 354  LEU A CA  1 
ATOM   2683 C  C   . LEU A 1 354 ? 35.185 30.587 54.495  1.00 16.73 ? 354  LEU A C   1 
ATOM   2684 O  O   . LEU A 1 354 ? 34.172 30.964 55.094  1.00 15.65 ? 354  LEU A O   1 
ATOM   2685 C  CB  . LEU A 1 354 ? 36.588 32.596 54.952  1.00 17.13 ? 354  LEU A CB  1 
ATOM   2686 C  CG  . LEU A 1 354 ? 37.511 33.744 54.516  1.00 16.89 ? 354  LEU A CG  1 
ATOM   2687 C  CD1 . LEU A 1 354 ? 36.729 35.037 54.222  1.00 15.88 ? 354  LEU A CD1 1 
ATOM   2688 C  CD2 . LEU A 1 354 ? 38.498 33.997 55.635  1.00 16.19 ? 354  LEU A CD2 1 
ATOM   2689 N  N   . ILE A 1 355 ? 35.419 29.272 54.367  1.00 16.01 ? 355  ILE A N   1 
ATOM   2690 C  CA  . ILE A 1 355 ? 34.602 28.305 55.060  1.00 17.09 ? 355  ILE A CA  1 
ATOM   2691 C  C   . ILE A 1 355 ? 35.367 27.768 56.255  1.00 18.08 ? 355  ILE A C   1 
ATOM   2692 O  O   . ILE A 1 355 ? 36.612 27.674 56.311  1.00 16.75 ? 355  ILE A O   1 
ATOM   2693 C  CB  . ILE A 1 355 ? 34.125 27.133 54.113  1.00 18.06 ? 355  ILE A CB  1 
ATOM   2694 C  CG1 . ILE A 1 355 ? 35.191 26.331 53.447  1.00 21.23 ? 355  ILE A CG1 1 
ATOM   2695 C  CG2 . ILE A 1 355 ? 33.368 27.799 52.958  1.00 17.26 ? 355  ILE A CG2 1 
ATOM   2696 C  CD1 . ILE A 1 355 ? 34.662 25.387 52.332  1.00 20.77 ? 355  ILE A CD1 1 
ATOM   2697 N  N   . GLY A 1 356 ? 34.581 27.490 57.286  1.00 17.12 ? 356  GLY A N   1 
ATOM   2698 C  CA  . GLY A 1 356 ? 35.103 27.014 58.525  1.00 16.26 ? 356  GLY A CA  1 
ATOM   2699 C  C   . GLY A 1 356 ? 34.432 27.657 59.729  1.00 16.40 ? 356  GLY A C   1 
ATOM   2700 O  O   . GLY A 1 356 ? 33.244 27.985 59.731  1.00 18.67 ? 356  GLY A O   1 
ATOM   2701 N  N   . SER A 1 357 ? 35.270 27.829 60.753  1.00 13.33 ? 357  SER A N   1 
ATOM   2702 C  CA  . SER A 1 357 ? 34.938 28.199 62.135  1.00 13.87 ? 357  SER A CA  1 
ATOM   2703 C  C   . SER A 1 357 ? 34.200 27.001 62.781  1.00 13.06 ? 357  SER A C   1 
ATOM   2704 O  O   . SER A 1 357 ? 33.777 26.022 62.142  1.00 10.92 ? 357  SER A O   1 
ATOM   2705 C  CB  . SER A 1 357 ? 34.018 29.440 62.271  1.00 13.61 ? 357  SER A CB  1 
ATOM   2706 O  OG  . SER A 1 357 ? 32.637 29.217 61.996  1.00 18.88 ? 357  SER A OG  1 
ATOM   2707 N  N   . CYS A 1 358 ? 33.980 27.118 64.085  1.00 12.03 ? 358  CYS A N   1 
ATOM   2708 C  CA  . CYS A 1 358 ? 33.247 26.120 64.825  1.00 12.05 ? 358  CYS A CA  1 
ATOM   2709 C  C   . CYS A 1 358 ? 31.785 25.972 64.352  1.00 13.95 ? 358  CYS A C   1 
ATOM   2710 O  O   . CYS A 1 358 ? 31.128 24.950 64.628  1.00 14.43 ? 358  CYS A O   1 
ATOM   2711 C  CB  . CYS A 1 358 ? 33.342 26.495 66.296  1.00 9.55  ? 358  CYS A CB  1 
ATOM   2712 S  SG  . CYS A 1 358 ? 32.747 28.168 66.720  1.00 12.90 ? 358  CYS A SG  1 
ATOM   2713 N  N   . THR A 1 359 ? 31.230 26.961 63.653  1.00 14.41 ? 359  THR A N   1 
ATOM   2714 C  CA  . THR A 1 359 ? 29.834 26.948 63.250  1.00 14.83 ? 359  THR A CA  1 
ATOM   2715 C  C   . THR A 1 359 ? 29.687 26.074 62.037  1.00 14.34 ? 359  THR A C   1 
ATOM   2716 O  O   . THR A 1 359 ? 28.626 25.515 61.819  1.00 19.42 ? 359  THR A O   1 
ATOM   2717 C  CB  . THR A 1 359 ? 29.333 28.359 62.853  1.00 14.37 ? 359  THR A CB  1 
ATOM   2718 O  OG1 . THR A 1 359 ? 29.683 29.239 63.897  1.00 14.07 ? 359  THR A OG1 1 
ATOM   2719 C  CG2 . THR A 1 359 ? 27.838 28.438 62.654  1.00 12.33 ? 359  THR A CG2 1 
ATOM   2720 N  N   . ASN A 1 360 ? 30.688 25.940 61.189  1.00 12.81 ? 360  ASN A N   1 
ATOM   2721 C  CA  . ASN A 1 360 ? 30.501 25.242 59.953  1.00 10.44 ? 360  ASN A CA  1 
ATOM   2722 C  C   . ASN A 1 360 ? 31.769 24.641 59.416  1.00 11.99 ? 360  ASN A C   1 
ATOM   2723 O  O   . ASN A 1 360 ? 32.250 24.967 58.313  1.00 12.61 ? 360  ASN A O   1 
ATOM   2724 C  CB  . ASN A 1 360 ? 29.913 26.192 58.898  1.00 9.78  ? 360  ASN A CB  1 
ATOM   2725 C  CG  . ASN A 1 360 ? 28.379 26.258 58.778  1.00 9.11  ? 360  ASN A CG  1 
ATOM   2726 O  OD1 . ASN A 1 360 ? 27.804 27.347 58.895  1.00 11.52 ? 360  ASN A OD1 1 
ATOM   2727 N  ND2 . ASN A 1 360 ? 27.672 25.188 58.472  1.00 7.53  ? 360  ASN A ND2 1 
ATOM   2728 N  N   . SER A 1 361 ? 32.319 23.695 60.152  1.00 12.71 ? 361  SER A N   1 
ATOM   2729 C  CA  . SER A 1 361 ? 33.542 23.030 59.741  1.00 14.42 ? 361  SER A CA  1 
ATOM   2730 C  C   . SER A 1 361 ? 33.527 21.530 59.807  1.00 14.95 ? 361  SER A C   1 
ATOM   2731 O  O   . SER A 1 361 ? 34.600 20.906 59.811  1.00 15.24 ? 361  SER A O   1 
ATOM   2732 C  CB  . SER A 1 361 ? 34.697 23.546 60.579  1.00 13.10 ? 361  SER A CB  1 
ATOM   2733 O  OG  . SER A 1 361 ? 34.480 23.477 61.998  1.00 12.91 ? 361  SER A OG  1 
ATOM   2734 N  N   . SER A 1 362 ? 32.329 20.931 59.796  1.00 13.64 ? 362  SER A N   1 
ATOM   2735 C  CA  . SER A 1 362 ? 32.195 19.503 59.951  1.00 8.08  ? 362  SER A CA  1 
ATOM   2736 C  C   . SER A 1 362 ? 32.474 18.743 58.695  1.00 9.15  ? 362  SER A C   1 
ATOM   2737 O  O   . SER A 1 362 ? 32.548 19.331 57.621  1.00 11.83 ? 362  SER A O   1 
ATOM   2738 C  CB  . SER A 1 362 ? 30.794 19.180 60.397  1.00 11.51 ? 362  SER A CB  1 
ATOM   2739 O  OG  . SER A 1 362 ? 29.807 19.302 59.347  1.00 13.68 ? 362  SER A OG  1 
ATOM   2740 N  N   . TYR A 1 363 ? 32.568 17.411 58.751  1.00 11.56 ? 363  TYR A N   1 
ATOM   2741 C  CA  . TYR A 1 363 ? 32.686 16.565 57.564  1.00 15.64 ? 363  TYR A CA  1 
ATOM   2742 C  C   . TYR A 1 363 ? 31.622 16.805 56.484  1.00 17.22 ? 363  TYR A C   1 
ATOM   2743 O  O   . TYR A 1 363 ? 31.890 16.797 55.263  1.00 16.14 ? 363  TYR A O   1 
ATOM   2744 C  CB  . TYR A 1 363 ? 32.651 15.109 58.065  1.00 15.87 ? 363  TYR A CB  1 
ATOM   2745 C  CG  . TYR A 1 363 ? 32.754 14.086 56.962  1.00 18.85 ? 363  TYR A CG  1 
ATOM   2746 C  CD1 . TYR A 1 363 ? 33.994 13.684 56.498  1.00 18.51 ? 363  TYR A CD1 1 
ATOM   2747 C  CD2 . TYR A 1 363 ? 31.604 13.515 56.432  1.00 17.44 ? 363  TYR A CD2 1 
ATOM   2748 C  CE1 . TYR A 1 363 ? 34.089 12.757 55.489  1.00 17.81 ? 363  TYR A CE1 1 
ATOM   2749 C  CE2 . TYR A 1 363 ? 31.694 12.594 55.423  1.00 17.98 ? 363  TYR A CE2 1 
ATOM   2750 C  CZ  . TYR A 1 363 ? 32.936 12.215 54.971  1.00 20.59 ? 363  TYR A CZ  1 
ATOM   2751 O  OH  . TYR A 1 363 ? 33.026 11.256 53.992  1.00 23.16 ? 363  TYR A OH  1 
ATOM   2752 N  N   . GLU A 1 364 ? 30.373 16.959 56.968  1.00 17.29 ? 364  GLU A N   1 
ATOM   2753 C  CA  . GLU A 1 364 ? 29.257 17.212 56.080  1.00 15.02 ? 364  GLU A CA  1 
ATOM   2754 C  C   . GLU A 1 364 ? 29.336 18.586 55.411  1.00 12.99 ? 364  GLU A C   1 
ATOM   2755 O  O   . GLU A 1 364 ? 29.043 18.725 54.209  1.00 14.05 ? 364  GLU A O   1 
ATOM   2756 C  CB  . GLU A 1 364 ? 27.972 17.045 56.908  1.00 14.06 ? 364  GLU A CB  1 
ATOM   2757 C  CG  . GLU A 1 364 ? 26.742 17.302 56.075  1.00 17.59 ? 364  GLU A CG  1 
ATOM   2758 C  CD  . GLU A 1 364 ? 25.394 17.274 56.798  1.00 21.68 ? 364  GLU A CD  1 
ATOM   2759 O  OE1 . GLU A 1 364 ? 25.206 17.891 57.839  1.00 21.71 ? 364  GLU A OE1 1 
ATOM   2760 O  OE2 . GLU A 1 364 ? 24.472 16.686 56.266  1.00 22.07 ? 364  GLU A OE2 1 
ATOM   2761 N  N   . ASP A 1 365 ? 29.757 19.625 56.143  1.00 12.29 ? 365  ASP A N   1 
ATOM   2762 C  CA  . ASP A 1 365 ? 29.948 20.940 55.579  1.00 12.68 ? 365  ASP A CA  1 
ATOM   2763 C  C   . ASP A 1 365 ? 31.032 20.885 54.535  1.00 14.14 ? 365  ASP A C   1 
ATOM   2764 O  O   . ASP A 1 365 ? 30.886 21.442 53.456  1.00 13.23 ? 365  ASP A O   1 
ATOM   2765 C  CB  . ASP A 1 365 ? 30.357 21.945 56.654  1.00 14.52 ? 365  ASP A CB  1 
ATOM   2766 C  CG  . ASP A 1 365 ? 29.300 22.235 57.717  1.00 16.18 ? 365  ASP A CG  1 
ATOM   2767 O  OD1 . ASP A 1 365 ? 28.157 22.498 57.375  1.00 20.59 ? 365  ASP A OD1 1 
ATOM   2768 O  OD2 . ASP A 1 365 ? 29.605 22.270 58.900  1.00 16.04 ? 365  ASP A OD2 1 
ATOM   2769 N  N   . MET A 1 366 ? 32.126 20.159 54.781  1.00 17.63 ? 366  MET A N   1 
ATOM   2770 C  CA  . MET A 1 366 ? 33.197 20.030 53.786  1.00 16.41 ? 366  MET A CA  1 
ATOM   2771 C  C   . MET A 1 366 ? 32.710 19.208 52.598  1.00 14.84 ? 366  MET A C   1 
ATOM   2772 O  O   . MET A 1 366 ? 33.014 19.509 51.444  1.00 17.82 ? 366  MET A O   1 
ATOM   2773 C  CB  . MET A 1 366 ? 34.422 19.371 54.425  1.00 16.32 ? 366  MET A CB  1 
ATOM   2774 C  CG  . MET A 1 366 ? 35.102 20.083 55.590  1.00 18.26 ? 366  MET A CG  1 
ATOM   2775 S  SD  . MET A 1 366 ? 35.773 21.691 55.103  1.00 25.30 ? 366  MET A SD  1 
ATOM   2776 C  CE  . MET A 1 366 ? 34.913 22.780 56.183  1.00 25.31 ? 366  MET A CE  1 
ATOM   2777 N  N   . GLY A 1 367 ? 31.916 18.156 52.784  1.00 17.95 ? 367  GLY A N   1 
ATOM   2778 C  CA  . GLY A 1 367 ? 31.340 17.385 51.683  1.00 16.29 ? 367  GLY A CA  1 
ATOM   2779 C  C   . GLY A 1 367 ? 30.368 18.200 50.844  1.00 18.59 ? 367  GLY A C   1 
ATOM   2780 O  O   . GLY A 1 367 ? 30.398 18.126 49.605  1.00 20.47 ? 367  GLY A O   1 
ATOM   2781 N  N   . ARG A 1 368 ? 29.492 18.990 51.474  1.00 18.29 ? 368  ARG A N   1 
ATOM   2782 C  CA  . ARG A 1 368 ? 28.550 19.811 50.737  1.00 20.80 ? 368  ARG A CA  1 
ATOM   2783 C  C   . ARG A 1 368 ? 29.320 20.898 49.972  1.00 22.63 ? 368  ARG A C   1 
ATOM   2784 O  O   . ARG A 1 368 ? 29.049 21.091 48.781  1.00 21.65 ? 368  ARG A O   1 
ATOM   2785 C  CB  . ARG A 1 368 ? 27.536 20.397 51.735  1.00 19.78 ? 368  ARG A CB  1 
ATOM   2786 C  CG  . ARG A 1 368 ? 26.502 19.299 52.039  1.00 25.52 ? 368  ARG A CG  1 
ATOM   2787 C  CD  . ARG A 1 368 ? 25.326 19.710 52.938  1.00 30.21 ? 368  ARG A CD  1 
ATOM   2788 N  NE  . ARG A 1 368 ? 24.547 20.861 52.432  1.00 34.51 ? 368  ARG A NE  1 
ATOM   2789 C  CZ  . ARG A 1 368 ? 23.403 20.778 51.684  1.00 35.49 ? 368  ARG A CZ  1 
ATOM   2790 N  NH1 . ARG A 1 368 ? 22.939 19.584 51.305  1.00 36.15 ? 368  ARG A NH1 1 
ATOM   2791 N  NH2 . ARG A 1 368 ? 22.751 21.896 51.286  1.00 33.54 ? 368  ARG A NH2 1 
ATOM   2792 N  N   . SER A 1 369 ? 30.306 21.607 50.545  1.00 20.62 ? 369  SER A N   1 
ATOM   2793 C  CA  . SER A 1 369 ? 31.109 22.547 49.769  1.00 20.28 ? 369  SER A CA  1 
ATOM   2794 C  C   . SER A 1 369 ? 31.834 21.853 48.609  1.00 18.27 ? 369  SER A C   1 
ATOM   2795 O  O   . SER A 1 369 ? 31.854 22.368 47.485  1.00 16.80 ? 369  SER A O   1 
ATOM   2796 C  CB  . SER A 1 369 ? 32.116 23.211 50.701  1.00 18.60 ? 369  SER A CB  1 
ATOM   2797 O  OG  . SER A 1 369 ? 31.413 23.718 51.833  1.00 21.27 ? 369  SER A OG  1 
ATOM   2798 N  N   . ALA A 1 370 ? 32.393 20.656 48.808  1.00 17.27 ? 370  ALA A N   1 
ATOM   2799 C  CA  . ALA A 1 370 ? 33.090 19.936 47.758  1.00 17.80 ? 370  ALA A CA  1 
ATOM   2800 C  C   . ALA A 1 370 ? 32.161 19.573 46.615  1.00 19.47 ? 370  ALA A C   1 
ATOM   2801 O  O   . ALA A 1 370 ? 32.558 19.551 45.445  1.00 18.89 ? 370  ALA A O   1 
ATOM   2802 C  CB  . ALA A 1 370 ? 33.692 18.628 48.273  1.00 15.59 ? 370  ALA A CB  1 
ATOM   2803 N  N   . ALA A 1 371 ? 30.893 19.325 46.944  1.00 19.77 ? 371  ALA A N   1 
ATOM   2804 C  CA  . ALA A 1 371 ? 29.922 18.957 45.953  1.00 18.86 ? 371  ALA A CA  1 
ATOM   2805 C  C   . ALA A 1 371 ? 29.611 20.091 44.979  1.00 20.77 ? 371  ALA A C   1 
ATOM   2806 O  O   . ALA A 1 371 ? 29.287 19.839 43.799  1.00 22.63 ? 371  ALA A O   1 
ATOM   2807 C  CB  . ALA A 1 371 ? 28.673 18.497 46.683  1.00 19.27 ? 371  ALA A CB  1 
ATOM   2808 N  N   . VAL A 1 372 ? 29.683 21.343 45.428  1.00 19.34 ? 372  VAL A N   1 
ATOM   2809 C  CA  . VAL A 1 372 ? 29.481 22.522 44.575  1.00 18.45 ? 372  VAL A CA  1 
ATOM   2810 C  C   . VAL A 1 372 ? 30.716 22.730 43.696  1.00 18.61 ? 372  VAL A C   1 
ATOM   2811 O  O   . VAL A 1 372 ? 30.671 22.927 42.472  1.00 18.25 ? 372  VAL A O   1 
ATOM   2812 C  CB  . VAL A 1 372 ? 29.234 23.755 45.475  1.00 18.12 ? 372  VAL A CB  1 
ATOM   2813 C  CG1 . VAL A 1 372 ? 29.089 25.054 44.692  1.00 18.73 ? 372  VAL A CG1 1 
ATOM   2814 C  CG2 . VAL A 1 372 ? 27.957 23.527 46.200  1.00 17.71 ? 372  VAL A CG2 1 
ATOM   2815 N  N   . ALA A 1 373 ? 31.856 22.648 44.372  1.00 19.62 ? 373  ALA A N   1 
ATOM   2816 C  CA  . ALA A 1 373 ? 33.145 22.775 43.729  1.00 21.15 ? 373  ALA A CA  1 
ATOM   2817 C  C   . ALA A 1 373 ? 33.340 21.725 42.654  1.00 20.42 ? 373  ALA A C   1 
ATOM   2818 O  O   . ALA A 1 373 ? 33.809 22.145 41.599  1.00 22.56 ? 373  ALA A O   1 
ATOM   2819 C  CB  . ALA A 1 373 ? 34.272 22.635 44.751  1.00 18.99 ? 373  ALA A CB  1 
ATOM   2820 N  N   . LYS A 1 374 ? 32.971 20.427 42.776  1.00 24.41 ? 374  LYS A N   1 
ATOM   2821 C  CA  . LYS A 1 374 ? 33.223 19.480 41.685  1.00 27.51 ? 374  LYS A CA  1 
ATOM   2822 C  C   . LYS A 1 374 ? 32.433 19.840 40.448  1.00 25.53 ? 374  LYS A C   1 
ATOM   2823 O  O   . LYS A 1 374 ? 32.923 19.648 39.348  1.00 24.78 ? 374  LYS A O   1 
ATOM   2824 C  CB  . LYS A 1 374 ? 32.909 17.991 42.024  1.00 32.13 ? 374  LYS A CB  1 
ATOM   2825 C  CG  . LYS A 1 374 ? 31.603 17.472 42.644  1.00 43.49 ? 374  LYS A CG  1 
ATOM   2826 C  CD  . LYS A 1 374 ? 30.227 17.636 41.922  1.00 47.71 ? 374  LYS A CD  1 
ATOM   2827 C  CE  . LYS A 1 374 ? 28.994 17.058 42.695  1.00 48.69 ? 374  LYS A CE  1 
ATOM   2828 N  NZ  . LYS A 1 374 ? 27.740 17.793 42.452  1.00 50.59 ? 374  LYS A NZ  1 
ATOM   2829 N  N   . GLN A 1 375 ? 31.263 20.450 40.587  1.00 24.08 ? 375  GLN A N   1 
ATOM   2830 C  CA  . GLN A 1 375 ? 30.473 20.890 39.455  1.00 25.08 ? 375  GLN A CA  1 
ATOM   2831 C  C   . GLN A 1 375 ? 31.170 22.004 38.671  1.00 26.43 ? 375  GLN A C   1 
ATOM   2832 O  O   . GLN A 1 375 ? 31.093 22.028 37.427  1.00 27.72 ? 375  GLN A O   1 
ATOM   2833 C  CB  . GLN A 1 375 ? 29.144 21.426 39.914  1.00 25.17 ? 375  GLN A CB  1 
ATOM   2834 C  CG  . GLN A 1 375 ? 28.346 20.416 40.721  1.00 26.33 ? 375  GLN A CG  1 
ATOM   2835 C  CD  . GLN A 1 375 ? 27.027 20.992 41.198  1.00 27.72 ? 375  GLN A CD  1 
ATOM   2836 O  OE1 . GLN A 1 375 ? 26.227 21.424 40.372  1.00 25.42 ? 375  GLN A OE1 1 
ATOM   2837 N  NE2 . GLN A 1 375 ? 26.784 21.089 42.501  1.00 26.08 ? 375  GLN A NE2 1 
ATOM   2838 N  N   . ALA A 1 376 ? 31.813 22.957 39.384  1.00 26.23 ? 376  ALA A N   1 
ATOM   2839 C  CA  . ALA A 1 376 ? 32.550 24.047 38.749  1.00 23.89 ? 376  ALA A CA  1 
ATOM   2840 C  C   . ALA A 1 376 ? 33.748 23.497 37.983  1.00 24.50 ? 376  ALA A C   1 
ATOM   2841 O  O   . ALA A 1 376 ? 33.958 23.777 36.796  1.00 22.94 ? 376  ALA A O   1 
ATOM   2842 C  CB  . ALA A 1 376 ? 33.050 25.014 39.784  1.00 24.50 ? 376  ALA A CB  1 
ATOM   2843 N  N   . LEU A 1 377 ? 34.454 22.594 38.657  1.00 23.82 ? 377  LEU A N   1 
ATOM   2844 C  CA  . LEU A 1 377 ? 35.577 21.894 38.084  1.00 24.91 ? 377  LEU A CA  1 
ATOM   2845 C  C   . LEU A 1 377 ? 35.208 21.116 36.841  1.00 25.18 ? 377  LEU A C   1 
ATOM   2846 O  O   . LEU A 1 377 ? 35.923 21.191 35.845  1.00 25.96 ? 377  LEU A O   1 
ATOM   2847 C  CB  . LEU A 1 377 ? 36.202 20.929 39.105  1.00 24.16 ? 377  LEU A CB  1 
ATOM   2848 C  CG  . LEU A 1 377 ? 37.025 21.580 40.216  1.00 26.29 ? 377  LEU A CG  1 
ATOM   2849 C  CD1 . LEU A 1 377 ? 37.640 20.524 41.100  1.00 27.09 ? 377  LEU A CD1 1 
ATOM   2850 C  CD2 . LEU A 1 377 ? 38.146 22.413 39.603  1.00 27.10 ? 377  LEU A CD2 1 
ATOM   2851 N  N   . ALA A 1 378 ? 34.075 20.424 36.823  1.00 25.18 ? 378  ALA A N   1 
ATOM   2852 C  CA  . ALA A 1 378 ? 33.601 19.712 35.646  1.00 24.10 ? 378  ALA A CA  1 
ATOM   2853 C  C   . ALA A 1 378 ? 33.347 20.653 34.461  1.00 25.92 ? 378  ALA A C   1 
ATOM   2854 O  O   . ALA A 1 378 ? 33.233 20.238 33.304  1.00 27.81 ? 378  ALA A O   1 
ATOM   2855 C  CB  . ALA A 1 378 ? 32.313 18.988 36.001  1.00 24.02 ? 378  ALA A CB  1 
ATOM   2856 N  N   . HIS A 1 379 ? 33.199 21.961 34.689  1.00 27.66 ? 379  HIS A N   1 
ATOM   2857 C  CA  . HIS A 1 379 ? 33.080 22.920 33.590  1.00 30.00 ? 379  HIS A CA  1 
ATOM   2858 C  C   . HIS A 1 379 ? 34.336 23.745 33.315  1.00 28.44 ? 379  HIS A C   1 
ATOM   2859 O  O   . HIS A 1 379 ? 34.310 24.695 32.516  1.00 28.18 ? 379  HIS A O   1 
ATOM   2860 C  CB  . HIS A 1 379 ? 31.920 23.858 33.867  1.00 30.96 ? 379  HIS A CB  1 
ATOM   2861 C  CG  . HIS A 1 379 ? 30.675 23.042 33.668  1.00 34.51 ? 379  HIS A CG  1 
ATOM   2862 N  ND1 . HIS A 1 379 ? 30.084 22.269 34.583  1.00 36.37 ? 379  HIS A ND1 1 
ATOM   2863 C  CD2 . HIS A 1 379 ? 30.011 22.928 32.475  1.00 35.87 ? 379  HIS A CD2 1 
ATOM   2864 C  CE1 . HIS A 1 379 ? 29.086 21.677 33.985  1.00 35.96 ? 379  HIS A CE1 1 
ATOM   2865 N  NE2 . HIS A 1 379 ? 29.055 22.079 32.732  1.00 36.74 ? 379  HIS A NE2 1 
ATOM   2866 N  N   . GLY A 1 380 ? 35.442 23.402 33.983  1.00 26.05 ? 380  GLY A N   1 
ATOM   2867 C  CA  . GLY A 1 380 ? 36.709 24.075 33.811  1.00 24.78 ? 380  GLY A CA  1 
ATOM   2868 C  C   . GLY A 1 380 ? 36.745 25.420 34.479  1.00 24.90 ? 380  GLY A C   1 
ATOM   2869 O  O   . GLY A 1 380 ? 37.400 26.342 33.967  1.00 25.90 ? 380  GLY A O   1 
ATOM   2870 N  N   . LEU A 1 381 ? 36.047 25.579 35.599  1.00 25.37 ? 381  LEU A N   1 
ATOM   2871 C  CA  . LEU A 1 381 ? 36.083 26.841 36.301  1.00 25.52 ? 381  LEU A CA  1 
ATOM   2872 C  C   . LEU A 1 381 ? 36.817 26.674 37.613  1.00 25.80 ? 381  LEU A C   1 
ATOM   2873 O  O   . LEU A 1 381 ? 37.002 25.560 38.103  1.00 26.66 ? 381  LEU A O   1 
ATOM   2874 C  CB  . LEU A 1 381 ? 34.676 27.351 36.595  1.00 26.95 ? 381  LEU A CB  1 
ATOM   2875 C  CG  . LEU A 1 381 ? 33.716 27.676 35.454  1.00 29.40 ? 381  LEU A CG  1 
ATOM   2876 C  CD1 . LEU A 1 381 ? 32.461 28.311 36.051  1.00 27.37 ? 381  LEU A CD1 1 
ATOM   2877 C  CD2 . LEU A 1 381 ? 34.370 28.639 34.452  1.00 28.75 ? 381  LEU A CD2 1 
ATOM   2878 N  N   . LYS A 1 382 ? 37.256 27.790 38.195  1.00 28.43 ? 382  LYS A N   1 
ATOM   2879 C  CA  . LYS A 1 382 ? 37.903 27.858 39.510  1.00 27.53 ? 382  LYS A CA  1 
ATOM   2880 C  C   . LYS A 1 382 ? 37.342 29.125 40.137  1.00 24.93 ? 382  LYS A C   1 
ATOM   2881 O  O   . LYS A 1 382 ? 36.734 29.944 39.445  1.00 23.42 ? 382  LYS A O   1 
ATOM   2882 C  CB  . LYS A 1 382 ? 39.414 28.065 39.458  1.00 30.40 ? 382  LYS A CB  1 
ATOM   2883 C  CG  . LYS A 1 382 ? 40.123 27.628 38.200  1.00 36.78 ? 382  LYS A CG  1 
ATOM   2884 C  CD  . LYS A 1 382 ? 41.588 27.329 38.436  1.00 41.48 ? 382  LYS A CD  1 
ATOM   2885 C  CE  . LYS A 1 382 ? 41.693 26.151 39.364  1.00 46.18 ? 382  LYS A CE  1 
ATOM   2886 N  NZ  . LYS A 1 382 ? 40.921 25.020 38.857  1.00 50.60 ? 382  LYS A NZ  1 
ATOM   2887 N  N   . CYS A 1 383 ? 37.585 29.312 41.425  1.00 25.14 ? 383  CYS A N   1 
ATOM   2888 C  CA  . CYS A 1 383 ? 37.158 30.479 42.160  1.00 26.55 ? 383  CYS A CA  1 
ATOM   2889 C  C   . CYS A 1 383 ? 37.655 31.773 41.569  1.00 27.47 ? 383  CYS A C   1 
ATOM   2890 O  O   . CYS A 1 383 ? 38.805 31.849 41.121  1.00 26.88 ? 383  CYS A O   1 
ATOM   2891 C  CB  . CYS A 1 383 ? 37.653 30.399 43.580  1.00 26.98 ? 383  CYS A CB  1 
ATOM   2892 S  SG  . CYS A 1 383 ? 36.757 29.048 44.350  1.00 26.36 ? 383  CYS A SG  1 
ATOM   2893 N  N   . LYS A 1 384 ? 36.757 32.757 41.498  1.00 27.63 ? 384  LYS A N   1 
ATOM   2894 C  CA  . LYS A 1 384 ? 37.138 34.086 41.074  1.00 27.64 ? 384  LYS A CA  1 
ATOM   2895 C  C   . LYS A 1 384 ? 37.626 34.753 42.340  1.00 26.69 ? 384  LYS A C   1 
ATOM   2896 O  O   . LYS A 1 384 ? 38.556 35.557 42.287  1.00 27.67 ? 384  LYS A O   1 
ATOM   2897 C  CB  . LYS A 1 384 ? 35.958 34.841 40.498  1.00 31.08 ? 384  LYS A CB  1 
ATOM   2898 C  CG  . LYS A 1 384 ? 36.309 36.222 39.917  1.00 41.23 ? 384  LYS A CG  1 
ATOM   2899 C  CD  . LYS A 1 384 ? 35.713 37.496 40.623  1.00 47.37 ? 384  LYS A CD  1 
ATOM   2900 C  CE  . LYS A 1 384 ? 36.304 37.991 41.981  1.00 48.94 ? 384  LYS A CE  1 
ATOM   2901 N  NZ  . LYS A 1 384 ? 35.575 39.092 42.611  1.00 46.99 ? 384  LYS A NZ  1 
ATOM   2902 N  N   . SER A 1 385 ? 37.003 34.530 43.493  1.00 25.43 ? 385  SER A N   1 
ATOM   2903 C  CA  . SER A 1 385 ? 37.502 35.099 44.731  1.00 24.18 ? 385  SER A CA  1 
ATOM   2904 C  C   . SER A 1 385 ? 38.584 34.177 45.305  1.00 23.91 ? 385  SER A C   1 
ATOM   2905 O  O   . SER A 1 385 ? 38.756 33.016 44.930  1.00 23.39 ? 385  SER A O   1 
ATOM   2906 C  CB  . SER A 1 385 ? 36.358 35.227 45.725  1.00 23.67 ? 385  SER A CB  1 
ATOM   2907 O  OG  . SER A 1 385 ? 35.240 35.921 45.166  1.00 26.72 ? 385  SER A OG  1 
ATOM   2908 N  N   . GLN A 1 386 ? 39.334 34.712 46.247  1.00 23.35 ? 386  GLN A N   1 
ATOM   2909 C  CA  . GLN A 1 386 ? 40.265 33.931 47.035  1.00 28.29 ? 386  GLN A CA  1 
ATOM   2910 C  C   . GLN A 1 386 ? 39.382 33.029 47.896  1.00 25.04 ? 386  GLN A C   1 
ATOM   2911 O  O   . GLN A 1 386 ? 38.278 33.441 48.280  1.00 23.62 ? 386  GLN A O   1 
ATOM   2912 C  CB  . GLN A 1 386 ? 41.072 34.896 47.866  1.00 32.19 ? 386  GLN A CB  1 
ATOM   2913 C  CG  . GLN A 1 386 ? 42.229 34.336 48.670  1.00 40.91 ? 386  GLN A CG  1 
ATOM   2914 C  CD  . GLN A 1 386 ? 43.093 35.470 49.213  1.00 46.36 ? 386  GLN A CD  1 
ATOM   2915 O  OE1 . GLN A 1 386 ? 43.353 35.518 50.427  1.00 48.50 ? 386  GLN A OE1 1 
ATOM   2916 N  NE2 . GLN A 1 386 ? 43.544 36.405 48.353  1.00 47.12 ? 386  GLN A NE2 1 
ATOM   2917 N  N   . PHE A 1 387 ? 39.836 31.853 48.283  1.00 22.59 ? 387  PHE A N   1 
ATOM   2918 C  CA  . PHE A 1 387 ? 38.989 30.920 48.961  1.00 20.47 ? 387  PHE A CA  1 
ATOM   2919 C  C   . PHE A 1 387 ? 39.798 30.189 50.026  1.00 18.78 ? 387  PHE A C   1 
ATOM   2920 O  O   . PHE A 1 387 ? 40.803 29.533 49.721  1.00 17.59 ? 387  PHE A O   1 
ATOM   2921 C  CB  . PHE A 1 387 ? 38.418 30.031 47.817  1.00 17.42 ? 387  PHE A CB  1 
ATOM   2922 C  CG  . PHE A 1 387 ? 37.436 28.925 48.199  1.00 20.63 ? 387  PHE A CG  1 
ATOM   2923 C  CD1 . PHE A 1 387 ? 36.415 29.161 49.112  1.00 19.91 ? 387  PHE A CD1 1 
ATOM   2924 C  CD2 . PHE A 1 387 ? 37.558 27.663 47.606  1.00 21.95 ? 387  PHE A CD2 1 
ATOM   2925 C  CE1 . PHE A 1 387 ? 35.520 28.150 49.437  1.00 21.16 ? 387  PHE A CE1 1 
ATOM   2926 C  CE2 . PHE A 1 387 ? 36.659 26.655 47.932  1.00 23.22 ? 387  PHE A CE2 1 
ATOM   2927 C  CZ  . PHE A 1 387 ? 35.640 26.902 48.848  1.00 23.13 ? 387  PHE A CZ  1 
ATOM   2928 N  N   . THR A 1 388 ? 39.425 30.286 51.301  1.00 18.27 ? 388  THR A N   1 
ATOM   2929 C  CA  . THR A 1 388 ? 40.144 29.548 52.310  1.00 19.11 ? 388  THR A CA  1 
ATOM   2930 C  C   . THR A 1 388 ? 39.218 28.523 52.962  1.00 21.12 ? 388  THR A C   1 
ATOM   2931 O  O   . THR A 1 388 ? 37.985 28.708 52.960  1.00 21.43 ? 388  THR A O   1 
ATOM   2932 C  CB  . THR A 1 388 ? 40.723 30.544 53.328  1.00 19.43 ? 388  THR A CB  1 
ATOM   2933 O  OG1 . THR A 1 388 ? 39.652 31.106 54.045  1.00 23.10 ? 388  THR A OG1 1 
ATOM   2934 C  CG2 . THR A 1 388 ? 41.403 31.742 52.691  1.00 19.82 ? 388  THR A CG2 1 
ATOM   2935 N  N   . ILE A 1 389 ? 39.777 27.423 53.493  1.00 17.19 ? 389  ILE A N   1 
ATOM   2936 C  CA  . ILE A 1 389 ? 39.034 26.333 54.074  1.00 14.32 ? 389  ILE A CA  1 
ATOM   2937 C  C   . ILE A 1 389 ? 39.687 25.948 55.382  1.00 15.59 ? 389  ILE A C   1 
ATOM   2938 O  O   . ILE A 1 389 ? 40.873 25.620 55.383  1.00 14.82 ? 389  ILE A O   1 
ATOM   2939 C  CB  . ILE A 1 389 ? 39.034 25.142 53.093  1.00 15.61 ? 389  ILE A CB  1 
ATOM   2940 C  CG1 . ILE A 1 389 ? 38.347 25.558 51.796  1.00 17.60 ? 389  ILE A CG1 1 
ATOM   2941 C  CG2 . ILE A 1 389 ? 38.303 23.942 53.720  1.00 13.52 ? 389  ILE A CG2 1 
ATOM   2942 C  CD1 . ILE A 1 389 ? 39.231 25.389 50.558  1.00 19.09 ? 389  ILE A CD1 1 
ATOM   2943 N  N   . THR A 1 390 ? 38.984 25.991 56.514  1.00 14.80 ? 390  THR A N   1 
ATOM   2944 C  CA  . THR A 1 390 ? 39.499 25.571 57.809  1.00 12.93 ? 390  THR A CA  1 
ATOM   2945 C  C   . THR A 1 390 ? 38.776 24.261 58.172  1.00 16.91 ? 390  THR A C   1 
ATOM   2946 O  O   . THR A 1 390 ? 37.550 24.331 58.363  1.00 14.19 ? 390  THR A O   1 
ATOM   2947 C  CB  . THR A 1 390 ? 39.190 26.607 58.920  1.00 12.71 ? 390  THR A CB  1 
ATOM   2948 O  OG1 . THR A 1 390 ? 39.732 27.860 58.539  1.00 13.64 ? 390  THR A OG1 1 
ATOM   2949 C  CG2 . THR A 1 390 ? 39.702 26.122 60.265  1.00 10.15 ? 390  THR A CG2 1 
ATOM   2950 N  N   . PRO A 1 391 ? 39.393 23.057 58.264  1.00 18.18 ? 391  PRO A N   1 
ATOM   2951 C  CA  . PRO A 1 391 ? 38.784 21.858 58.839  1.00 15.27 ? 391  PRO A CA  1 
ATOM   2952 C  C   . PRO A 1 391 ? 38.631 22.086 60.335  1.00 14.63 ? 391  PRO A C   1 
ATOM   2953 O  O   . PRO A 1 391 ? 39.445 22.740 60.991  1.00 11.70 ? 391  PRO A O   1 
ATOM   2954 C  CB  . PRO A 1 391 ? 39.738 20.722 58.512  1.00 17.69 ? 391  PRO A CB  1 
ATOM   2955 C  CG  . PRO A 1 391 ? 40.584 21.275 57.391  1.00 18.11 ? 391  PRO A CG  1 
ATOM   2956 C  CD  . PRO A 1 391 ? 40.746 22.745 57.799  1.00 17.22 ? 391  PRO A CD  1 
ATOM   2957 N  N   . GLY A 1 392 ? 37.529 21.612 60.905  1.00 13.89 ? 392  GLY A N   1 
ATOM   2958 C  CA  . GLY A 1 392 ? 37.304 21.841 62.324  1.00 12.98 ? 392  GLY A CA  1 
ATOM   2959 C  C   . GLY A 1 392 ? 38.200 21.049 63.239  1.00 11.60 ? 392  GLY A C   1 
ATOM   2960 O  O   . GLY A 1 392 ? 38.351 21.475 64.382  1.00 10.61 ? 392  GLY A O   1 
ATOM   2961 N  N   . SER A 1 393 ? 38.771 19.893 62.845  1.00 11.67 ? 393  SER A N   1 
ATOM   2962 C  CA  . SER A 1 393 ? 39.600 19.128 63.758  1.00 9.94  ? 393  SER A CA  1 
ATOM   2963 C  C   . SER A 1 393 ? 40.558 18.274 62.960  1.00 10.40 ? 393  SER A C   1 
ATOM   2964 O  O   . SER A 1 393 ? 40.419 18.188 61.730  1.00 10.50 ? 393  SER A O   1 
ATOM   2965 C  CB  . SER A 1 393 ? 38.723 18.245 64.627  1.00 9.51  ? 393  SER A CB  1 
ATOM   2966 O  OG  . SER A 1 393 ? 38.084 17.249 63.853  1.00 11.92 ? 393  SER A OG  1 
ATOM   2967 N  N   . GLU A 1 394 ? 41.483 17.562 63.601  1.00 12.58 ? 394  GLU A N   1 
ATOM   2968 C  CA  . GLU A 1 394 ? 42.429 16.688 62.913  1.00 13.97 ? 394  GLU A CA  1 
ATOM   2969 C  C   . GLU A 1 394 ? 41.797 15.478 62.281  1.00 13.43 ? 394  GLU A C   1 
ATOM   2970 O  O   . GLU A 1 394 ? 42.120 15.070 61.164  1.00 14.07 ? 394  GLU A O   1 
ATOM   2971 C  CB  . GLU A 1 394 ? 43.536 16.259 63.913  1.00 18.14 ? 394  GLU A CB  1 
ATOM   2972 C  CG  . GLU A 1 394 ? 44.698 15.392 63.387  1.00 18.04 ? 394  GLU A CG  1 
ATOM   2973 C  CD  . GLU A 1 394 ? 45.397 15.833 62.120  1.00 21.26 ? 394  GLU A CD  1 
ATOM   2974 O  OE1 . GLU A 1 394 ? 45.342 17.010 61.727  1.00 20.69 ? 394  GLU A OE1 1 
ATOM   2975 O  OE2 . GLU A 1 394 ? 46.000 14.967 61.491  1.00 20.81 ? 394  GLU A OE2 1 
ATOM   2976 N  N   . GLN A 1 395 ? 40.838 14.911 63.006  1.00 14.58 ? 395  GLN A N   1 
ATOM   2977 C  CA  . GLN A 1 395 ? 40.013 13.832 62.499  1.00 13.10 ? 395  GLN A CA  1 
ATOM   2978 C  C   . GLN A 1 395 ? 39.265 14.233 61.230  1.00 11.81 ? 395  GLN A C   1 
ATOM   2979 O  O   . GLN A 1 395 ? 39.233 13.498 60.253  1.00 11.91 ? 395  GLN A O   1 
ATOM   2980 C  CB  . GLN A 1 395 ? 39.085 13.469 63.608  1.00 19.50 ? 395  GLN A CB  1 
ATOM   2981 C  CG  . GLN A 1 395 ? 38.135 12.383 63.210  1.00 26.44 ? 395  GLN A CG  1 
ATOM   2982 C  CD  . GLN A 1 395 ? 37.570 11.728 64.449  1.00 29.02 ? 395  GLN A CD  1 
ATOM   2983 O  OE1 . GLN A 1 395 ? 36.486 12.037 64.924  1.00 33.25 ? 395  GLN A OE1 1 
ATOM   2984 N  NE2 . GLN A 1 395 ? 38.281 10.775 65.013  1.00 30.31 ? 395  GLN A NE2 1 
ATOM   2985 N  N   . ILE A 1 396 ? 38.624 15.401 61.174  1.00 11.50 ? 396  ILE A N   1 
ATOM   2986 C  CA  . ILE A 1 396 ? 37.980 15.859 59.942  1.00 11.98 ? 396  ILE A CA  1 
ATOM   2987 C  C   . ILE A 1 396 ? 39.035 16.157 58.894  1.00 11.03 ? 396  ILE A C   1 
ATOM   2988 O  O   . ILE A 1 396 ? 38.808 15.718 57.766  1.00 12.72 ? 396  ILE A O   1 
ATOM   2989 C  CB  . ILE A 1 396 ? 37.064 17.154 60.212  1.00 12.01 ? 396  ILE A CB  1 
ATOM   2990 C  CG1 . ILE A 1 396 ? 35.823 16.747 60.988  1.00 10.29 ? 396  ILE A CG1 1 
ATOM   2991 C  CG2 . ILE A 1 396 ? 36.660 17.829 58.910  1.00 9.27  ? 396  ILE A CG2 1 
ATOM   2992 C  CD1 . ILE A 1 396 ? 35.311 17.945 61.769  1.00 8.61  ? 396  ILE A CD1 1 
ATOM   2993 N  N   . ARG A 1 397 ? 40.152 16.870 59.145  1.00 12.50 ? 397  ARG A N   1 
ATOM   2994 C  CA  . ARG A 1 397 ? 41.173 17.074 58.116  1.00 11.88 ? 397  ARG A CA  1 
ATOM   2995 C  C   . ARG A 1 397 ? 41.644 15.725 57.554  1.00 11.18 ? 397  ARG A C   1 
ATOM   2996 O  O   . ARG A 1 397 ? 41.700 15.560 56.339  1.00 12.11 ? 397  ARG A O   1 
ATOM   2997 C  CB  . ARG A 1 397 ? 42.395 17.813 58.690  1.00 10.30 ? 397  ARG A CB  1 
ATOM   2998 C  CG  . ARG A 1 397 ? 43.450 18.123 57.634  1.00 13.20 ? 397  ARG A CG  1 
ATOM   2999 C  CD  . ARG A 1 397 ? 44.862 18.189 58.260  1.00 14.25 ? 397  ARG A CD  1 
ATOM   3000 N  NE  . ARG A 1 397 ? 45.293 16.934 58.883  1.00 18.40 ? 397  ARG A NE  1 
ATOM   3001 C  CZ  . ARG A 1 397 ? 45.690 15.826 58.191  1.00 17.40 ? 397  ARG A CZ  1 
ATOM   3002 N  NH1 . ARG A 1 397 ? 45.795 15.870 56.862  1.00 17.81 ? 397  ARG A NH1 1 
ATOM   3003 N  NH2 . ARG A 1 397 ? 45.951 14.688 58.858  1.00 17.33 ? 397  ARG A NH2 1 
ATOM   3004 N  N   . ALA A 1 398 ? 41.997 14.740 58.375  1.00 13.69 ? 398  ALA A N   1 
ATOM   3005 C  CA  . ALA A 1 398 ? 42.460 13.428 57.918  1.00 14.69 ? 398  ALA A CA  1 
ATOM   3006 C  C   . ALA A 1 398 ? 41.403 12.691 57.096  1.00 15.86 ? 398  ALA A C   1 
ATOM   3007 O  O   . ALA A 1 398 ? 41.670 12.219 55.980  1.00 16.52 ? 398  ALA A O   1 
ATOM   3008 C  CB  . ALA A 1 398 ? 42.823 12.612 59.144  1.00 16.05 ? 398  ALA A CB  1 
ATOM   3009 N  N   . THR A 1 399 ? 40.148 12.682 57.552  1.00 16.05 ? 399  THR A N   1 
ATOM   3010 C  CA  . THR A 1 399 ? 39.077 12.037 56.806  1.00 15.05 ? 399  THR A CA  1 
ATOM   3011 C  C   . THR A 1 399 ? 38.695 12.786 55.533  1.00 15.52 ? 399  THR A C   1 
ATOM   3012 O  O   . THR A 1 399 ? 38.543 12.136 54.491  1.00 16.99 ? 399  THR A O   1 
ATOM   3013 C  CB  . THR A 1 399 ? 37.873 11.878 57.759  1.00 16.08 ? 399  THR A CB  1 
ATOM   3014 O  OG1 . THR A 1 399 ? 38.344 11.265 58.958  1.00 16.51 ? 399  THR A OG1 1 
ATOM   3015 C  CG2 . THR A 1 399 ? 36.826 10.939 57.214  1.00 15.34 ? 399  THR A CG2 1 
ATOM   3016 N  N   . ILE A 1 400 ? 38.565 14.118 55.459  1.00 13.63 ? 400  ILE A N   1 
ATOM   3017 C  CA  . ILE A 1 400 ? 38.187 14.738 54.186  1.00 14.50 ? 400  ILE A CA  1 
ATOM   3018 C  C   . ILE A 1 400 ? 39.297 14.614 53.151  1.00 16.63 ? 400  ILE A C   1 
ATOM   3019 O  O   . ILE A 1 400 ? 39.088 14.729 51.933  1.00 19.81 ? 400  ILE A O   1 
ATOM   3020 C  CB  . ILE A 1 400 ? 37.868 16.246 54.292  1.00 13.55 ? 400  ILE A CB  1 
ATOM   3021 C  CG1 . ILE A 1 400 ? 39.041 17.085 54.839  1.00 12.65 ? 400  ILE A CG1 1 
ATOM   3022 C  CG2 . ILE A 1 400 ? 36.558 16.318 55.080  1.00 12.95 ? 400  ILE A CG2 1 
ATOM   3023 C  CD1 . ILE A 1 400 ? 38.827 18.627 54.820  1.00 12.72 ? 400  ILE A CD1 1 
ATOM   3024 N  N   . GLU A 1 401 ? 40.506 14.422 53.657  1.00 18.68 ? 401  GLU A N   1 
ATOM   3025 C  CA  . GLU A 1 401 ? 41.684 14.219 52.824  1.00 23.48 ? 401  GLU A CA  1 
ATOM   3026 C  C   . GLU A 1 401 ? 41.554 12.837 52.210  1.00 22.89 ? 401  GLU A C   1 
ATOM   3027 O  O   . GLU A 1 401 ? 41.565 12.655 50.983  1.00 24.24 ? 401  GLU A O   1 
ATOM   3028 C  CB  . GLU A 1 401 ? 42.864 14.376 53.756  1.00 21.72 ? 401  GLU A CB  1 
ATOM   3029 C  CG  . GLU A 1 401 ? 44.134 14.629 53.067  1.00 27.07 ? 401  GLU A CG  1 
ATOM   3030 C  CD  . GLU A 1 401 ? 44.221 15.933 52.327  1.00 26.92 ? 401  GLU A CD  1 
ATOM   3031 O  OE1 . GLU A 1 401 ? 44.334 16.962 52.981  1.00 28.08 ? 401  GLU A OE1 1 
ATOM   3032 O  OE2 . GLU A 1 401 ? 44.202 15.955 51.096  1.00 28.46 ? 401  GLU A OE2 1 
ATOM   3033 N  N   . ARG A 1 402 ? 41.280 11.881 53.092  1.00 23.27 ? 402  ARG A N   1 
ATOM   3034 C  CA  . ARG A 1 402 ? 41.076 10.509 52.679  1.00 23.67 ? 402  ARG A CA  1 
ATOM   3035 C  C   . ARG A 1 402 ? 39.900 10.349 51.733  1.00 25.50 ? 402  ARG A C   1 
ATOM   3036 O  O   . ARG A 1 402 ? 40.037 9.713  50.684  1.00 27.54 ? 402  ARG A O   1 
ATOM   3037 C  CB  . ARG A 1 402 ? 40.872 9.672  53.920  1.00 24.30 ? 402  ARG A CB  1 
ATOM   3038 C  CG  . ARG A 1 402 ? 40.893 8.170  53.716  1.00 24.86 ? 402  ARG A CG  1 
ATOM   3039 C  CD  . ARG A 1 402 ? 39.505 7.681  53.967  1.00 28.28 ? 402  ARG A CD  1 
ATOM   3040 N  NE  . ARG A 1 402 ? 39.360 7.309  55.344  1.00 29.17 ? 402  ARG A NE  1 
ATOM   3041 C  CZ  . ARG A 1 402 ? 38.199 7.211  56.021  1.00 25.09 ? 402  ARG A CZ  1 
ATOM   3042 N  NH1 . ARG A 1 402 ? 36.991 7.631  55.596  1.00 24.44 ? 402  ARG A NH1 1 
ATOM   3043 N  NH2 . ARG A 1 402 ? 38.397 6.719  57.222  1.00 26.23 ? 402  ARG A NH2 1 
ATOM   3044 N  N   . ASP A 1 403 ? 38.773 10.994 51.991  1.00 22.93 ? 403  ASP A N   1 
ATOM   3045 C  CA  . ASP A 1 403 ? 37.616 10.736 51.179  1.00 21.93 ? 403  ASP A CA  1 
ATOM   3046 C  C   . ASP A 1 403 ? 37.556 11.606 49.971  1.00 20.73 ? 403  ASP A C   1 
ATOM   3047 O  O   . ASP A 1 403 ? 36.595 11.587 49.206  1.00 21.21 ? 403  ASP A O   1 
ATOM   3048 C  CB  . ASP A 1 403 ? 36.366 10.859 52.082  1.00 23.66 ? 403  ASP A CB  1 
ATOM   3049 C  CG  . ASP A 1 403 ? 36.240 9.691  53.078  1.00 25.38 ? 403  ASP A CG  1 
ATOM   3050 O  OD1 . ASP A 1 403 ? 36.956 8.711  52.967  1.00 27.72 ? 403  ASP A OD1 1 
ATOM   3051 O  OD2 . ASP A 1 403 ? 35.450 9.671  54.025  1.00 27.58 ? 403  ASP A OD2 1 
ATOM   3052 N  N   . GLY A 1 404 ? 38.594 12.401 49.751  1.00 21.03 ? 404  GLY A N   1 
ATOM   3053 C  CA  . GLY A 1 404 ? 38.699 13.130 48.502  1.00 21.16 ? 404  GLY A CA  1 
ATOM   3054 C  C   . GLY A 1 404 ? 38.175 14.558 48.484  1.00 23.56 ? 404  GLY A C   1 
ATOM   3055 O  O   . GLY A 1 404 ? 38.368 15.258 47.479  1.00 24.70 ? 404  GLY A O   1 
ATOM   3056 N  N   . TYR A 1 405 ? 37.625 15.086 49.568  1.00 22.19 ? 405  TYR A N   1 
ATOM   3057 C  CA  . TYR A 1 405 ? 37.049 16.417 49.495  1.00 22.95 ? 405  TYR A CA  1 
ATOM   3058 C  C   . TYR A 1 405 ? 38.097 17.507 49.476  1.00 22.47 ? 405  TYR A C   1 
ATOM   3059 O  O   . TYR A 1 405 ? 37.947 18.467 48.707  1.00 22.05 ? 405  TYR A O   1 
ATOM   3060 C  CB  . TYR A 1 405 ? 36.141 16.698 50.666  1.00 23.50 ? 405  TYR A CB  1 
ATOM   3061 C  CG  . TYR A 1 405 ? 35.001 15.736 50.895  1.00 24.04 ? 405  TYR A CG  1 
ATOM   3062 C  CD1 . TYR A 1 405 ? 34.365 15.079 49.865  1.00 23.22 ? 405  TYR A CD1 1 
ATOM   3063 C  CD2 . TYR A 1 405 ? 34.615 15.579 52.210  1.00 26.57 ? 405  TYR A CD2 1 
ATOM   3064 C  CE1 . TYR A 1 405 ? 33.319 14.251 50.190  1.00 26.03 ? 405  TYR A CE1 1 
ATOM   3065 C  CE2 . TYR A 1 405 ? 33.566 14.757 52.533  1.00 26.99 ? 405  TYR A CE2 1 
ATOM   3066 C  CZ  . TYR A 1 405 ? 32.929 14.102 51.509  1.00 28.08 ? 405  TYR A CZ  1 
ATOM   3067 O  OH  . TYR A 1 405 ? 31.827 13.303 51.788  1.00 32.88 ? 405  TYR A OH  1 
ATOM   3068 N  N   . ALA A 1 406 ? 39.187 17.360 50.259  1.00 21.22 ? 406  ALA A N   1 
ATOM   3069 C  CA  . ALA A 1 406 ? 40.204 18.399 50.316  1.00 19.82 ? 406  ALA A CA  1 
ATOM   3070 C  C   . ALA A 1 406 ? 40.865 18.672 48.963  1.00 19.56 ? 406  ALA A C   1 
ATOM   3071 O  O   . ALA A 1 406 ? 41.094 19.837 48.602  1.00 18.15 ? 406  ALA A O   1 
ATOM   3072 C  CB  . ALA A 1 406 ? 41.259 18.004 51.344  1.00 17.43 ? 406  ALA A CB  1 
ATOM   3073 N  N   . GLN A 1 407 ? 41.139 17.619 48.179  1.00 19.14 ? 407  GLN A N   1 
ATOM   3074 C  CA  . GLN A 1 407 ? 41.700 17.809 46.852  1.00 21.72 ? 407  GLN A CA  1 
ATOM   3075 C  C   . GLN A 1 407 ? 40.773 18.543 45.889  1.00 21.22 ? 407  GLN A C   1 
ATOM   3076 O  O   . GLN A 1 407 ? 41.269 19.438 45.214  1.00 24.54 ? 407  GLN A O   1 
ATOM   3077 C  CB  . GLN A 1 407 ? 42.131 16.441 46.274  1.00 24.51 ? 407  GLN A CB  1 
ATOM   3078 C  CG  . GLN A 1 407 ? 43.174 16.563 45.111  1.00 30.84 ? 407  GLN A CG  1 
ATOM   3079 C  CD  . GLN A 1 407 ? 44.380 17.529 45.345  1.00 35.40 ? 407  GLN A CD  1 
ATOM   3080 O  OE1 . GLN A 1 407 ? 45.092 17.494 46.360  1.00 36.02 ? 407  GLN A OE1 1 
ATOM   3081 N  NE2 . GLN A 1 407 ? 44.679 18.497 44.490  1.00 34.62 ? 407  GLN A NE2 1 
ATOM   3082 N  N   . VAL A 1 408 ? 39.448 18.330 45.890  1.00 17.75 ? 408  VAL A N   1 
ATOM   3083 C  CA  . VAL A 1 408 ? 38.515 19.073 45.055  1.00 17.48 ? 408  VAL A CA  1 
ATOM   3084 C  C   . VAL A 1 408 ? 38.572 20.561 45.374  1.00 18.28 ? 408  VAL A C   1 
ATOM   3085 O  O   . VAL A 1 408 ? 38.581 21.439 44.516  1.00 21.95 ? 408  VAL A O   1 
ATOM   3086 C  CB  . VAL A 1 408 ? 37.096 18.562 45.303  1.00 17.75 ? 408  VAL A CB  1 
ATOM   3087 C  CG1 . VAL A 1 408 ? 36.108 19.294 44.473  1.00 19.94 ? 408  VAL A CG1 1 
ATOM   3088 C  CG2 . VAL A 1 408 ? 37.000 17.138 44.904  1.00 18.53 ? 408  VAL A CG2 1 
ATOM   3089 N  N   . LEU A 1 409 ? 38.617 20.857 46.657  1.00 18.84 ? 409  LEU A N   1 
ATOM   3090 C  CA  . LEU A 1 409 ? 38.632 22.210 47.152  1.00 20.08 ? 409  LEU A CA  1 
ATOM   3091 C  C   . LEU A 1 409 ? 39.964 22.833 46.819  1.00 19.90 ? 409  LEU A C   1 
ATOM   3092 O  O   . LEU A 1 409 ? 39.981 24.012 46.456  1.00 19.20 ? 409  LEU A O   1 
ATOM   3093 C  CB  . LEU A 1 409 ? 38.375 22.180 48.668  1.00 21.79 ? 409  LEU A CB  1 
ATOM   3094 C  CG  . LEU A 1 409 ? 36.965 21.739 49.105  1.00 20.32 ? 409  LEU A CG  1 
ATOM   3095 C  CD1 . LEU A 1 409 ? 36.946 21.492 50.598  1.00 20.32 ? 409  LEU A CD1 1 
ATOM   3096 C  CD2 . LEU A 1 409 ? 35.959 22.790 48.695  1.00 18.61 ? 409  LEU A CD2 1 
ATOM   3097 N  N   . ARG A 1 410 ? 41.079 22.107 46.909  1.00 19.13 ? 410  ARG A N   1 
ATOM   3098 C  CA  . ARG A 1 410 ? 42.341 22.644 46.431  1.00 21.42 ? 410  ARG A CA  1 
ATOM   3099 C  C   . ARG A 1 410 ? 42.249 22.878 44.936  1.00 21.49 ? 410  ARG A C   1 
ATOM   3100 O  O   . ARG A 1 410 ? 42.666 23.953 44.491  1.00 25.31 ? 410  ARG A O   1 
ATOM   3101 C  CB  . ARG A 1 410 ? 43.488 21.711 46.612  1.00 20.38 ? 410  ARG A CB  1 
ATOM   3102 C  CG  . ARG A 1 410 ? 44.074 21.758 47.972  1.00 21.53 ? 410  ARG A CG  1 
ATOM   3103 C  CD  . ARG A 1 410 ? 45.054 20.599 47.928  1.00 22.83 ? 410  ARG A CD  1 
ATOM   3104 N  NE  . ARG A 1 410 ? 45.009 20.142 49.290  1.00 27.21 ? 410  ARG A NE  1 
ATOM   3105 C  CZ  . ARG A 1 410 ? 44.765 18.901 49.706  1.00 26.32 ? 410  ARG A CZ  1 
ATOM   3106 N  NH1 . ARG A 1 410 ? 44.617 17.824 48.939  1.00 22.47 ? 410  ARG A NH1 1 
ATOM   3107 N  NH2 . ARG A 1 410 ? 44.718 18.762 51.019  1.00 28.28 ? 410  ARG A NH2 1 
ATOM   3108 N  N   . ASP A 1 411 ? 41.677 21.968 44.148  1.00 20.13 ? 411  ASP A N   1 
ATOM   3109 C  CA  . ASP A 1 411 ? 41.653 22.156 42.717  1.00 22.76 ? 411  ASP A CA  1 
ATOM   3110 C  C   . ASP A 1 411 ? 40.789 23.321 42.254  1.00 24.08 ? 411  ASP A C   1 
ATOM   3111 O  O   . ASP A 1 411 ? 41.106 23.914 41.203  1.00 24.42 ? 411  ASP A O   1 
ATOM   3112 C  CB  . ASP A 1 411 ? 41.196 20.857 42.037  1.00 23.44 ? 411  ASP A CB  1 
ATOM   3113 C  CG  . ASP A 1 411 ? 42.157 19.672 42.156  1.00 26.69 ? 411  ASP A CG  1 
ATOM   3114 O  OD1 . ASP A 1 411 ? 43.355 19.855 42.359  1.00 30.17 ? 411  ASP A OD1 1 
ATOM   3115 O  OD2 . ASP A 1 411 ? 41.738 18.525 42.073  1.00 30.52 ? 411  ASP A OD2 1 
ATOM   3116 N  N   . VAL A 1 412 ? 39.695 23.735 42.927  1.00 23.68 ? 412  VAL A N   1 
ATOM   3117 C  CA  . VAL A 1 412 ? 38.954 24.924 42.495  1.00 19.27 ? 412  VAL A CA  1 
ATOM   3118 C  C   . VAL A 1 412 ? 39.688 26.181 42.890  1.00 19.85 ? 412  VAL A C   1 
ATOM   3119 O  O   . VAL A 1 412 ? 39.259 27.269 42.493  1.00 22.95 ? 412  VAL A O   1 
ATOM   3120 C  CB  . VAL A 1 412 ? 37.529 25.207 43.077  1.00 21.33 ? 412  VAL A CB  1 
ATOM   3121 C  CG1 . VAL A 1 412 ? 36.540 24.634 42.123  1.00 21.92 ? 412  VAL A CG1 1 
ATOM   3122 C  CG2 . VAL A 1 412 ? 37.391 24.761 44.499  1.00 18.23 ? 412  VAL A CG2 1 
ATOM   3123 N  N   . GLY A 1 413 ? 40.768 26.111 43.668  1.00 20.22 ? 413  GLY A N   1 
ATOM   3124 C  CA  . GLY A 1 413 ? 41.546 27.295 43.994  1.00 16.41 ? 413  GLY A CA  1 
ATOM   3125 C  C   . GLY A 1 413 ? 41.583 27.648 45.464  1.00 18.22 ? 413  GLY A C   1 
ATOM   3126 O  O   . GLY A 1 413 ? 41.934 28.791 45.763  1.00 22.83 ? 413  GLY A O   1 
ATOM   3127 N  N   . GLY A 1 414 ? 41.218 26.765 46.389  1.00 18.09 ? 414  GLY A N   1 
ATOM   3128 C  CA  . GLY A 1 414 ? 41.220 27.078 47.807  1.00 17.77 ? 414  GLY A CA  1 
ATOM   3129 C  C   . GLY A 1 414 ? 42.519 26.704 48.509  1.00 18.44 ? 414  GLY A C   1 
ATOM   3130 O  O   . GLY A 1 414 ? 43.305 25.851 48.053  1.00 20.31 ? 414  GLY A O   1 
ATOM   3131 N  N   . ILE A 1 415 ? 42.767 27.386 49.620  1.00 18.21 ? 415  ILE A N   1 
ATOM   3132 C  CA  . ILE A 1 415 ? 43.928 27.110 50.433  1.00 19.94 ? 415  ILE A CA  1 
ATOM   3133 C  C   . ILE A 1 415 ? 43.372 26.526 51.740  1.00 18.99 ? 415  ILE A C   1 
ATOM   3134 O  O   . ILE A 1 415 ? 42.429 27.043 52.355  1.00 17.70 ? 415  ILE A O   1 
ATOM   3135 C  CB  . ILE A 1 415 ? 44.769 28.470 50.584  1.00 19.57 ? 415  ILE A CB  1 
ATOM   3136 C  CG1 . ILE A 1 415 ? 46.006 28.214 51.422  1.00 23.27 ? 415  ILE A CG1 1 
ATOM   3137 C  CG2 . ILE A 1 415 ? 44.092 29.532 51.377  1.00 18.14 ? 415  ILE A CG2 1 
ATOM   3138 C  CD1 . ILE A 1 415 ? 47.116 27.419 50.724  1.00 28.47 ? 415  ILE A CD1 1 
ATOM   3139 N  N   . VAL A 1 416 ? 43.865 25.346 52.115  1.00 16.59 ? 416  VAL A N   1 
ATOM   3140 C  CA  . VAL A 1 416 ? 43.460 24.708 53.353  1.00 15.32 ? 416  VAL A CA  1 
ATOM   3141 C  C   . VAL A 1 416 ? 44.362 25.244 54.463  1.00 18.71 ? 416  VAL A C   1 
ATOM   3142 O  O   . VAL A 1 416 ? 45.612 25.180 54.402  1.00 21.06 ? 416  VAL A O   1 
ATOM   3143 C  CB  . VAL A 1 416 ? 43.569 23.133 53.241  1.00 17.03 ? 416  VAL A CB  1 
ATOM   3144 C  CG1 . VAL A 1 416 ? 43.100 22.442 54.539  1.00 12.02 ? 416  VAL A CG1 1 
ATOM   3145 C  CG2 . VAL A 1 416 ? 42.703 22.649 52.057  1.00 14.28 ? 416  VAL A CG2 1 
ATOM   3146 N  N   . LEU A 1 417 ? 43.702 25.784 55.484  1.00 15.45 ? 417  LEU A N   1 
ATOM   3147 C  CA  . LEU A 1 417 ? 44.346 26.381 56.627  1.00 13.85 ? 417  LEU A CA  1 
ATOM   3148 C  C   . LEU A 1 417 ? 44.483 25.396 57.771  1.00 12.57 ? 417  LEU A C   1 
ATOM   3149 O  O   . LEU A 1 417 ? 43.947 24.291 57.714  1.00 14.03 ? 417  LEU A O   1 
ATOM   3150 C  CB  . LEU A 1 417 ? 43.527 27.610 57.025  1.00 12.79 ? 417  LEU A CB  1 
ATOM   3151 C  CG  . LEU A 1 417 ? 43.248 28.680 55.966  1.00 13.04 ? 417  LEU A CG  1 
ATOM   3152 C  CD1 . LEU A 1 417 ? 42.490 29.792 56.672  1.00 12.70 ? 417  LEU A CD1 1 
ATOM   3153 C  CD2 . LEU A 1 417 ? 44.532 29.252 55.324  1.00 13.54 ? 417  LEU A CD2 1 
ATOM   3154 N  N   . ALA A 1 418 ? 45.341 25.670 58.749  1.00 12.96 ? 418  ALA A N   1 
ATOM   3155 C  CA  . ALA A 1 418 ? 45.414 24.823 59.918  1.00 14.31 ? 418  ALA A CA  1 
ATOM   3156 C  C   . ALA A 1 418 ? 44.036 24.637 60.618  1.00 14.19 ? 418  ALA A C   1 
ATOM   3157 O  O   . ALA A 1 418 ? 43.136 25.468 60.441  1.00 14.68 ? 418  ALA A O   1 
ATOM   3158 C  CB  . ALA A 1 418 ? 46.442 25.434 60.864  1.00 10.68 ? 418  ALA A CB  1 
ATOM   3159 N  N   . ASN A 1 419 ? 43.843 23.592 61.439  1.00 14.36 ? 419  ASN A N   1 
ATOM   3160 C  CA  . ASN A 1 419 ? 42.613 23.263 62.141  1.00 14.28 ? 419  ASN A CA  1 
ATOM   3161 C  C   . ASN A 1 419 ? 42.587 24.211 63.314  1.00 12.46 ? 419  ASN A C   1 
ATOM   3162 O  O   . ASN A 1 419 ? 42.964 23.825 64.428  1.00 16.23 ? 419  ASN A O   1 
ATOM   3163 C  CB  . ASN A 1 419 ? 42.644 21.801 62.641  1.00 12.70 ? 419  ASN A CB  1 
ATOM   3164 C  CG  . ASN A 1 419 ? 43.091 20.802 61.602  1.00 10.32 ? 419  ASN A CG  1 
ATOM   3165 O  OD1 . ASN A 1 419 ? 42.879 20.986 60.400  1.00 11.37 ? 419  ASN A OD1 1 
ATOM   3166 N  ND2 . ASN A 1 419 ? 43.771 19.739 62.047  1.00 9.03  ? 419  ASN A ND2 1 
ATOM   3167 N  N   . ALA A 1 420 ? 42.197 25.475 63.063  1.00 11.40 ? 420  ALA A N   1 
ATOM   3168 C  CA  . ALA A 1 420 ? 42.222 26.547 64.059  1.00 11.14 ? 420  ALA A CA  1 
ATOM   3169 C  C   . ALA A 1 420 ? 41.275 27.697 63.673  1.00 10.68 ? 420  ALA A C   1 
ATOM   3170 O  O   . ALA A 1 420 ? 40.823 27.765 62.521  1.00 10.36 ? 420  ALA A O   1 
ATOM   3171 C  CB  . ALA A 1 420 ? 43.639 27.123 64.180  1.00 10.27 ? 420  ALA A CB  1 
ATOM   3172 N  N   . CYS A 1 421 ? 40.940 28.577 64.623  1.00 12.03 ? 421  CYS A N   1 
ATOM   3173 C  CA  . CYS A 1 421 ? 40.056 29.706 64.403  1.00 11.56 ? 421  CYS A CA  1 
ATOM   3174 C  C   . CYS A 1 421 ? 40.514 30.567 63.258  1.00 13.37 ? 421  CYS A C   1 
ATOM   3175 O  O   . CYS A 1 421 ? 39.713 30.943 62.396  1.00 14.93 ? 421  CYS A O   1 
ATOM   3176 C  CB  . CYS A 1 421 ? 40.007 30.528 65.650  1.00 10.45 ? 421  CYS A CB  1 
ATOM   3177 S  SG  . CYS A 1 421 ? 39.428 29.552 67.037  1.00 11.12 ? 421  CYS A SG  1 
ATOM   3178 N  N   . GLY A 1 422 ? 41.780 30.989 63.335  1.00 11.71 ? 422  GLY A N   1 
ATOM   3179 C  CA  . GLY A 1 422 ? 42.359 31.696 62.209  1.00 8.88  ? 422  GLY A CA  1 
ATOM   3180 C  C   . GLY A 1 422 ? 41.642 32.990 61.845  1.00 9.74  ? 422  GLY A C   1 
ATOM   3181 O  O   . GLY A 1 422 ? 41.456 33.856 62.728  1.00 10.02 ? 422  GLY A O   1 
ATOM   3182 N  N   . PRO A 1 423 ? 41.268 33.236 60.580  1.00 8.18  ? 423  PRO A N   1 
ATOM   3183 C  CA  . PRO A 1 423 ? 40.612 34.464 60.154  1.00 10.70 ? 423  PRO A CA  1 
ATOM   3184 C  C   . PRO A 1 423 ? 39.362 34.781 60.950  1.00 15.22 ? 423  PRO A C   1 
ATOM   3185 O  O   . PRO A 1 423 ? 39.031 35.970 61.018  1.00 15.77 ? 423  PRO A O   1 
ATOM   3186 C  CB  . PRO A 1 423 ? 40.322 34.275 58.680  1.00 11.34 ? 423  PRO A CB  1 
ATOM   3187 C  CG  . PRO A 1 423 ? 41.377 33.280 58.243  1.00 9.89  ? 423  PRO A CG  1 
ATOM   3188 C  CD  . PRO A 1 423 ? 41.394 32.334 59.447  1.00 8.25  ? 423  PRO A CD  1 
ATOM   3189 N  N   . CYS A 1 424 ? 38.674 33.797 61.583  1.00 14.34 ? 424  CYS A N   1 
ATOM   3190 C  CA  . CYS A 1 424 ? 37.542 34.116 62.419  1.00 14.46 ? 424  CYS A CA  1 
ATOM   3191 C  C   . CYS A 1 424 ? 37.895 34.998 63.612  1.00 14.02 ? 424  CYS A C   1 
ATOM   3192 O  O   . CYS A 1 424 ? 37.030 35.816 63.920  1.00 12.20 ? 424  CYS A O   1 
ATOM   3193 C  CB  . CYS A 1 424 ? 36.919 32.772 62.814  1.00 14.30 ? 424  CYS A CB  1 
ATOM   3194 S  SG  . CYS A 1 424 ? 35.306 32.810 63.658  1.00 13.27 ? 424  CYS A SG  1 
ATOM   3195 N  N   . ILE A 1 425 ? 39.023 34.972 64.361  1.00 13.36 ? 425  ILE A N   1 
ATOM   3196 C  CA  . ILE A 1 425 ? 39.226 36.000 65.402  1.00 12.71 ? 425  ILE A CA  1 
ATOM   3197 C  C   . ILE A 1 425 ? 40.296 37.011 64.920  1.00 12.74 ? 425  ILE A C   1 
ATOM   3198 O  O   . ILE A 1 425 ? 41.048 37.598 65.713  1.00 15.32 ? 425  ILE A O   1 
ATOM   3199 C  CB  . ILE A 1 425 ? 39.758 35.514 66.835  1.00 15.96 ? 425  ILE A CB  1 
ATOM   3200 C  CG1 . ILE A 1 425 ? 40.002 34.053 66.826  1.00 16.71 ? 425  ILE A CG1 1 
ATOM   3201 C  CG2 . ILE A 1 425 ? 38.797 35.987 67.970  1.00 11.55 ? 425  ILE A CG2 1 
ATOM   3202 C  CD1 . ILE A 1 425 ? 41.404 33.685 66.352  1.00 18.45 ? 425  ILE A CD1 1 
ATOM   3203 N  N   . GLY A 1 426 ? 40.468 37.155 63.611  1.00 11.45 ? 426  GLY A N   1 
ATOM   3204 C  CA  . GLY A 1 426 ? 41.388 38.102 63.054  1.00 11.84 ? 426  GLY A CA  1 
ATOM   3205 C  C   . GLY A 1 426 ? 42.805 37.587 63.025  1.00 14.41 ? 426  GLY A C   1 
ATOM   3206 O  O   . GLY A 1 426 ? 43.701 38.421 62.957  1.00 16.70 ? 426  GLY A O   1 
ATOM   3207 N  N   . GLN A 1 427 ? 43.082 36.284 63.126  1.00 14.03 ? 427  GLN A N   1 
ATOM   3208 C  CA  . GLN A 1 427 ? 44.437 35.730 63.081  1.00 15.55 ? 427  GLN A CA  1 
ATOM   3209 C  C   . GLN A 1 427 ? 44.665 35.357 61.630  1.00 13.65 ? 427  GLN A C   1 
ATOM   3210 O  O   . GLN A 1 427 ? 44.590 34.193 61.196  1.00 13.16 ? 427  GLN A O   1 
ATOM   3211 C  CB  . GLN A 1 427 ? 44.527 34.493 63.983  1.00 16.84 ? 427  GLN A CB  1 
ATOM   3212 C  CG  . GLN A 1 427 ? 44.559 34.826 65.458  1.00 21.34 ? 427  GLN A CG  1 
ATOM   3213 C  CD  . GLN A 1 427 ? 45.912 35.380 65.873  1.00 26.58 ? 427  GLN A CD  1 
ATOM   3214 O  OE1 . GLN A 1 427 ? 46.946 34.778 65.597  1.00 29.63 ? 427  GLN A OE1 1 
ATOM   3215 N  NE2 . GLN A 1 427 ? 46.065 36.533 66.497  1.00 30.04 ? 427  GLN A NE2 1 
ATOM   3216 N  N   . TRP A 1 428 ? 44.911 36.417 60.880  1.00 13.02 ? 428  TRP A N   1 
ATOM   3217 C  CA  . TRP A 1 428 ? 44.970 36.335 59.446  1.00 14.06 ? 428  TRP A CA  1 
ATOM   3218 C  C   . TRP A 1 428 ? 45.919 37.417 58.983  1.00 15.77 ? 428  TRP A C   1 
ATOM   3219 O  O   . TRP A 1 428 ? 45.641 38.575 59.266  1.00 15.96 ? 428  TRP A O   1 
ATOM   3220 C  CB  . TRP A 1 428 ? 43.571 36.578 58.909  1.00 14.00 ? 428  TRP A CB  1 
ATOM   3221 C  CG  . TRP A 1 428 ? 43.362 36.536 57.403  1.00 15.05 ? 428  TRP A CG  1 
ATOM   3222 C  CD1 . TRP A 1 428 ? 44.256 35.958 56.533  1.00 15.47 ? 428  TRP A CD1 1 
ATOM   3223 C  CD2 . TRP A 1 428 ? 42.228 36.994 56.766  1.00 16.96 ? 428  TRP A CD2 1 
ATOM   3224 N  NE1 . TRP A 1 428 ? 43.683 36.034 55.349  1.00 16.92 ? 428  TRP A NE1 1 
ATOM   3225 C  CE2 . TRP A 1 428 ? 42.481 36.641 55.447  1.00 18.02 ? 428  TRP A CE2 1 
ATOM   3226 C  CE3 . TRP A 1 428 ? 41.042 37.632 57.099  1.00 20.05 ? 428  TRP A CE3 1 
ATOM   3227 C  CZ2 . TRP A 1 428 ? 41.564 36.913 54.443  1.00 20.92 ? 428  TRP A CZ2 1 
ATOM   3228 C  CZ3 . TRP A 1 428 ? 40.124 37.899 56.094  1.00 18.71 ? 428  TRP A CZ3 1 
ATOM   3229 C  CH2 . TRP A 1 428 ? 40.376 37.548 54.779  1.00 19.06 ? 428  TRP A CH2 1 
ATOM   3230 N  N   . ASP A 1 429 ? 46.936 37.075 58.195  1.00 19.41 ? 429  ASP A N   1 
ATOM   3231 C  CA  . ASP A 1 429 ? 47.840 38.051 57.638  1.00 20.41 ? 429  ASP A CA  1 
ATOM   3232 C  C   . ASP A 1 429 ? 47.327 38.394 56.249  1.00 19.22 ? 429  ASP A C   1 
ATOM   3233 O  O   . ASP A 1 429 ? 47.725 37.881 55.212  1.00 20.52 ? 429  ASP A O   1 
ATOM   3234 C  CB  . ASP A 1 429 ? 49.251 37.463 57.577  1.00 23.84 ? 429  ASP A CB  1 
ATOM   3235 C  CG  . ASP A 1 429 ? 50.340 38.471 57.188  1.00 26.84 ? 429  ASP A CG  1 
ATOM   3236 O  OD1 . ASP A 1 429 ? 50.224 39.687 57.367  1.00 26.20 ? 429  ASP A OD1 1 
ATOM   3237 O  OD2 . ASP A 1 429 ? 51.343 38.088 56.578  1.00 31.20 ? 429  ASP A OD2 1 
ATOM   3238 N  N   . ARG A 1 430 ? 46.371 39.309 56.228  1.00 23.18 ? 430  ARG A N   1 
ATOM   3239 C  CA  . ARG A 1 430 ? 45.651 39.752 55.029  1.00 26.64 ? 430  ARG A CA  1 
ATOM   3240 C  C   . ARG A 1 430 ? 46.276 40.956 54.309  1.00 27.69 ? 430  ARG A C   1 
ATOM   3241 O  O   . ARG A 1 430 ? 46.378 42.061 54.882  1.00 27.67 ? 430  ARG A O   1 
ATOM   3242 C  CB  . ARG A 1 430 ? 44.217 40.040 55.482  1.00 25.77 ? 430  ARG A CB  1 
ATOM   3243 C  CG  . ARG A 1 430 ? 43.392 40.938 54.624  1.00 27.97 ? 430  ARG A CG  1 
ATOM   3244 C  CD  . ARG A 1 430 ? 42.467 40.212 53.732  1.00 29.74 ? 430  ARG A CD  1 
ATOM   3245 N  NE  . ARG A 1 430 ? 41.224 40.931 53.865  1.00 30.45 ? 430  ARG A NE  1 
ATOM   3246 C  CZ  . ARG A 1 430 ? 40.253 41.137 52.959  1.00 26.43 ? 430  ARG A CZ  1 
ATOM   3247 N  NH1 . ARG A 1 430 ? 40.279 40.830 51.655  1.00 25.23 ? 430  ARG A NH1 1 
ATOM   3248 N  NH2 . ARG A 1 430 ? 39.243 41.768 53.488  1.00 23.80 ? 430  ARG A NH2 1 
ATOM   3249 N  N   . LYS A 1 431 ? 46.647 40.801 53.036  1.00 29.35 ? 431  LYS A N   1 
ATOM   3250 C  CA  . LYS A 1 431 ? 47.359 41.891 52.388  1.00 33.45 ? 431  LYS A CA  1 
ATOM   3251 C  C   . LYS A 1 431 ? 46.855 42.350 51.058  1.00 32.14 ? 431  LYS A C   1 
ATOM   3252 O  O   . LYS A 1 431 ? 47.393 43.340 50.536  1.00 33.75 ? 431  LYS A O   1 
ATOM   3253 C  CB  . LYS A 1 431 ? 48.850 41.540 52.248  1.00 36.40 ? 431  LYS A CB  1 
ATOM   3254 C  CG  . LYS A 1 431 ? 49.524 41.809 53.576  1.00 40.00 ? 431  LYS A CG  1 
ATOM   3255 C  CD  . LYS A 1 431 ? 51.023 41.959 53.448  1.00 46.41 ? 431  LYS A CD  1 
ATOM   3256 C  CE  . LYS A 1 431 ? 51.681 41.726 54.814  1.00 49.09 ? 431  LYS A CE  1 
ATOM   3257 N  NZ  . LYS A 1 431 ? 51.608 40.307 55.140  1.00 54.45 ? 431  LYS A NZ  1 
ATOM   3258 N  N   . ASP A 1 432 ? 45.757 41.710 50.616  1.00 29.63 ? 432  ASP A N   1 
ATOM   3259 C  CA  . ASP A 1 432 ? 45.107 42.075 49.367  1.00 28.70 ? 432  ASP A CA  1 
ATOM   3260 C  C   . ASP A 1 432 ? 44.365 43.404 49.446  1.00 28.43 ? 432  ASP A C   1 
ATOM   3261 O  O   . ASP A 1 432 ? 43.975 43.915 48.398  1.00 33.62 ? 432  ASP A O   1 
ATOM   3262 C  CB  . ASP A 1 432 ? 44.094 40.982 48.908  1.00 26.79 ? 432  ASP A CB  1 
ATOM   3263 C  CG  . ASP A 1 432 ? 42.913 40.740 49.841  1.00 28.15 ? 432  ASP A CG  1 
ATOM   3264 O  OD1 . ASP A 1 432 ? 43.168 40.395 50.983  1.00 28.21 ? 432  ASP A OD1 1 
ATOM   3265 O  OD2 . ASP A 1 432 ? 41.741 40.942 49.508  1.00 27.67 ? 432  ASP A OD2 1 
ATOM   3266 N  N   . ILE A 1 433 ? 44.115 44.016 50.603  1.00 28.42 ? 433  ILE A N   1 
ATOM   3267 C  CA  . ILE A 1 433 ? 43.408 45.299 50.674  1.00 30.11 ? 433  ILE A CA  1 
ATOM   3268 C  C   . ILE A 1 433 ? 44.308 46.255 51.423  1.00 32.49 ? 433  ILE A C   1 
ATOM   3269 O  O   . ILE A 1 433 ? 45.120 45.775 52.224  1.00 31.59 ? 433  ILE A O   1 
ATOM   3270 C  CB  . ILE A 1 433 ? 41.997 45.221 51.427  1.00 26.88 ? 433  ILE A CB  1 
ATOM   3271 C  CG1 . ILE A 1 433 ? 41.995 44.419 52.712  1.00 25.88 ? 433  ILE A CG1 1 
ATOM   3272 C  CG2 . ILE A 1 433 ? 41.039 44.585 50.452  1.00 25.41 ? 433  ILE A CG2 1 
ATOM   3273 C  CD1 . ILE A 1 433 ? 41.872 45.228 54.010  1.00 26.67 ? 433  ILE A CD1 1 
ATOM   3274 N  N   . LYS A 1 434 ? 44.227 47.571 51.222  1.00 37.53 ? 434  LYS A N   1 
ATOM   3275 C  CA  . LYS A 1 434 ? 45.010 48.521 52.000  1.00 41.88 ? 434  LYS A CA  1 
ATOM   3276 C  C   . LYS A 1 434 ? 44.234 48.741 53.283  1.00 40.58 ? 434  LYS A C   1 
ATOM   3277 O  O   . LYS A 1 434 ? 43.057 48.371 53.336  1.00 41.10 ? 434  LYS A O   1 
ATOM   3278 C  CB  . LYS A 1 434 ? 45.174 49.875 51.283  1.00 46.84 ? 434  LYS A CB  1 
ATOM   3279 C  CG  . LYS A 1 434 ? 43.939 50.777 51.226  1.00 53.33 ? 434  LYS A CG  1 
ATOM   3280 C  CD  . LYS A 1 434 ? 44.326 52.262 51.232  1.00 56.87 ? 434  LYS A CD  1 
ATOM   3281 C  CE  . LYS A 1 434 ? 43.106 53.202 51.247  1.00 57.54 ? 434  LYS A CE  1 
ATOM   3282 N  NZ  . LYS A 1 434 ? 42.459 53.235 52.548  1.00 57.28 ? 434  LYS A NZ  1 
ATOM   3283 N  N   . LYS A 1 435 ? 44.753 49.338 54.355  1.00 41.48 ? 435  LYS A N   1 
ATOM   3284 C  CA  . LYS A 1 435 ? 43.857 49.508 55.490  1.00 44.53 ? 435  LYS A CA  1 
ATOM   3285 C  C   . LYS A 1 435 ? 42.868 50.624 55.153  1.00 43.33 ? 435  LYS A C   1 
ATOM   3286 O  O   . LYS A 1 435 ? 43.165 51.540 54.345  1.00 46.55 ? 435  LYS A O   1 
ATOM   3287 C  CB  . LYS A 1 435 ? 44.604 49.858 56.770  1.00 49.49 ? 435  LYS A CB  1 
ATOM   3288 C  CG  . LYS A 1 435 ? 43.670 49.562 57.969  1.00 55.02 ? 435  LYS A CG  1 
ATOM   3289 C  CD  . LYS A 1 435 ? 43.160 48.091 57.996  1.00 58.66 ? 435  LYS A CD  1 
ATOM   3290 C  CE  . LYS A 1 435 ? 43.958 47.121 58.897  1.00 60.10 ? 435  LYS A CE  1 
ATOM   3291 N  NZ  . LYS A 1 435 ? 43.889 47.525 60.298  1.00 61.21 ? 435  LYS A NZ  1 
ATOM   3292 N  N   . GLY A 1 436 ? 41.645 50.478 55.684  1.00 37.75 ? 436  GLY A N   1 
ATOM   3293 C  CA  . GLY A 1 436 ? 40.553 51.384 55.406  1.00 30.72 ? 436  GLY A CA  1 
ATOM   3294 C  C   . GLY A 1 436 ? 39.975 51.129 54.014  1.00 29.23 ? 436  GLY A C   1 
ATOM   3295 O  O   . GLY A 1 436 ? 39.192 51.940 53.517  1.00 30.13 ? 436  GLY A O   1 
ATOM   3296 N  N   . GLU A 1 437 ? 40.362 50.109 53.252  1.00 26.98 ? 437  GLU A N   1 
ATOM   3297 C  CA  . GLU A 1 437 ? 39.762 49.908 51.951  1.00 27.64 ? 437  GLU A CA  1 
ATOM   3298 C  C   . GLU A 1 437 ? 38.408 49.190 52.079  1.00 27.94 ? 437  GLU A C   1 
ATOM   3299 O  O   . GLU A 1 437 ? 38.263 48.190 52.771  1.00 26.41 ? 437  GLU A O   1 
ATOM   3300 C  CB  . GLU A 1 437 ? 40.710 49.104 51.129  1.00 29.82 ? 437  GLU A CB  1 
ATOM   3301 C  CG  . GLU A 1 437 ? 40.321 49.089 49.675  1.00 34.38 ? 437  GLU A CG  1 
ATOM   3302 C  CD  . GLU A 1 437 ? 41.172 48.196 48.803  1.00 37.66 ? 437  GLU A CD  1 
ATOM   3303 O  OE1 . GLU A 1 437 ? 42.355 48.042 49.077  1.00 39.47 ? 437  GLU A OE1 1 
ATOM   3304 O  OE2 . GLU A 1 437 ? 40.645 47.646 47.837  1.00 43.21 ? 437  GLU A OE2 1 
ATOM   3305 N  N   . LYS A 1 438 ? 37.385 49.738 51.447  1.00 27.60 ? 438  LYS A N   1 
ATOM   3306 C  CA  . LYS A 1 438 ? 36.050 49.191 51.459  1.00 27.55 ? 438  LYS A CA  1 
ATOM   3307 C  C   . LYS A 1 438 ? 36.011 47.941 50.574  1.00 25.80 ? 438  LYS A C   1 
ATOM   3308 O  O   . LYS A 1 438 ? 36.357 47.961 49.378  1.00 25.45 ? 438  LYS A O   1 
ATOM   3309 C  CB  . LYS A 1 438 ? 35.123 50.264 50.957  1.00 30.49 ? 438  LYS A CB  1 
ATOM   3310 C  CG  . LYS A 1 438 ? 33.691 50.026 51.316  1.00 36.89 ? 438  LYS A CG  1 
ATOM   3311 C  CD  . LYS A 1 438 ? 32.878 51.066 50.554  1.00 44.00 ? 438  LYS A CD  1 
ATOM   3312 C  CE  . LYS A 1 438 ? 31.478 51.312 51.142  1.00 47.95 ? 438  LYS A CE  1 
ATOM   3313 N  NZ  . LYS A 1 438 ? 31.584 51.940 52.469  1.00 54.94 ? 438  LYS A NZ  1 
ATOM   3314 N  N   . ASN A 1 439 ? 35.557 46.818 51.146  1.00 23.20 ? 439  ASN A N   1 
ATOM   3315 C  CA  . ASN A 1 439 ? 35.547 45.552 50.402  1.00 21.33 ? 439  ASN A CA  1 
ATOM   3316 C  C   . ASN A 1 439 ? 34.606 44.558 51.053  1.00 19.62 ? 439  ASN A C   1 
ATOM   3317 O  O   . ASN A 1 439 ? 34.244 44.743 52.225  1.00 19.64 ? 439  ASN A O   1 
ATOM   3318 C  CB  . ASN A 1 439 ? 36.972 44.944 50.364  1.00 18.96 ? 439  ASN A CB  1 
ATOM   3319 C  CG  . ASN A 1 439 ? 37.427 44.365 51.704  1.00 19.09 ? 439  ASN A CG  1 
ATOM   3320 O  OD1 . ASN A 1 439 ? 37.734 45.011 52.724  1.00 18.82 ? 439  ASN A OD1 1 
ATOM   3321 N  ND2 . ASN A 1 439 ? 37.386 43.060 51.791  1.00 13.78 ? 439  ASN A ND2 1 
ATOM   3322 N  N   . THR A 1 440 ? 34.257 43.496 50.330  1.00 19.09 ? 440  THR A N   1 
ATOM   3323 C  CA  . THR A 1 440 ? 33.335 42.503 50.817  1.00 21.53 ? 440  THR A CA  1 
ATOM   3324 C  C   . THR A 1 440 ? 33.954 41.113 50.877  1.00 20.44 ? 440  THR A C   1 
ATOM   3325 O  O   . THR A 1 440 ? 34.576 40.651 49.914  1.00 21.77 ? 440  THR A O   1 
ATOM   3326 C  CB  . THR A 1 440 ? 32.055 42.541 49.879  1.00 22.39 ? 440  THR A CB  1 
ATOM   3327 O  OG1 . THR A 1 440 ? 31.223 43.652 50.287  1.00 19.44 ? 440  THR A OG1 1 
ATOM   3328 C  CG2 . THR A 1 440 ? 31.249 41.246 49.928  1.00 22.00 ? 440  THR A CG2 1 
ATOM   3329 N  N   . ILE A 1 441 ? 33.825 40.469 52.045  1.00 20.68 ? 441  ILE A N   1 
ATOM   3330 C  CA  . ILE A 1 441 ? 34.167 39.059 52.181  1.00 21.01 ? 441  ILE A CA  1 
ATOM   3331 C  C   . ILE A 1 441 ? 32.934 38.246 52.648  1.00 20.21 ? 441  ILE A C   1 
ATOM   3332 O  O   . ILE A 1 441 ? 32.100 38.764 53.402  1.00 22.64 ? 441  ILE A O   1 
ATOM   3333 C  CB  . ILE A 1 441 ? 35.355 38.864 53.189  1.00 17.65 ? 441  ILE A CB  1 
ATOM   3334 C  CG1 . ILE A 1 441 ? 34.962 39.226 54.618  1.00 17.19 ? 441  ILE A CG1 1 
ATOM   3335 C  CG2 . ILE A 1 441 ? 36.543 39.680 52.671  1.00 16.96 ? 441  ILE A CG2 1 
ATOM   3336 C  CD1 . ILE A 1 441 ? 36.054 38.995 55.695  1.00 13.22 ? 441  ILE A CD1 1 
ATOM   3337 N  N   . VAL A 1 442 ? 32.741 36.996 52.231  1.00 19.47 ? 442  VAL A N   1 
ATOM   3338 C  CA  . VAL A 1 442 ? 31.630 36.200 52.733  1.00 20.53 ? 442  VAL A CA  1 
ATOM   3339 C  C   . VAL A 1 442 ? 32.210 34.967 53.411  1.00 19.87 ? 442  VAL A C   1 
ATOM   3340 O  O   . VAL A 1 442 ? 33.142 34.310 52.913  1.00 20.42 ? 442  VAL A O   1 
ATOM   3341 C  CB  . VAL A 1 442 ? 30.625 35.759 51.606  1.00 18.41 ? 442  VAL A CB  1 
ATOM   3342 C  CG1 . VAL A 1 442 ? 30.208 37.011 50.850  1.00 18.53 ? 442  VAL A CG1 1 
ATOM   3343 C  CG2 . VAL A 1 442 ? 31.215 34.822 50.593  1.00 20.69 ? 442  VAL A CG2 1 
ATOM   3344 N  N   . THR A 1 443 ? 31.693 34.672 54.606  1.00 19.92 ? 443  THR A N   1 
ATOM   3345 C  CA  . THR A 1 443 ? 32.195 33.584 55.436  1.00 16.91 ? 443  THR A CA  1 
ATOM   3346 C  C   . THR A 1 443 ? 31.138 32.573 55.844  1.00 17.64 ? 443  THR A C   1 
ATOM   3347 O  O   . THR A 1 443 ? 29.961 32.905 55.836  1.00 20.93 ? 443  THR A O   1 
ATOM   3348 C  CB  . THR A 1 443 ? 32.841 34.144 56.744  1.00 17.42 ? 443  THR A CB  1 
ATOM   3349 O  OG1 . THR A 1 443 ? 31.820 34.606 57.627  1.00 15.01 ? 443  THR A OG1 1 
ATOM   3350 C  CG2 . THR A 1 443 ? 33.710 35.398 56.492  1.00 18.08 ? 443  THR A CG2 1 
ATOM   3351 N  N   . SER A 1 444 ? 31.461 31.373 56.300  1.00 13.79 ? 444  SER A N   1 
ATOM   3352 C  CA  . SER A 1 444 ? 30.480 30.534 56.936  1.00 10.44 ? 444  SER A CA  1 
ATOM   3353 C  C   . SER A 1 444 ? 30.715 30.619 58.437  1.00 9.74  ? 444  SER A C   1 
ATOM   3354 O  O   . SER A 1 444 ? 30.551 29.671 59.198  1.00 10.23 ? 444  SER A O   1 
ATOM   3355 C  CB  . SER A 1 444 ? 30.618 29.109 56.442  1.00 7.70  ? 444  SER A CB  1 
ATOM   3356 O  OG  . SER A 1 444 ? 31.845 28.487 56.801  1.00 12.17 ? 444  SER A OG  1 
ATOM   3357 N  N   . TYR A 1 445 ? 31.022 31.807 58.942  1.00 12.92 ? 445  TYR A N   1 
ATOM   3358 C  CA  . TYR A 1 445 ? 31.294 32.016 60.371  1.00 14.77 ? 445  TYR A CA  1 
ATOM   3359 C  C   . TYR A 1 445 ? 30.002 32.415 61.078  1.00 14.63 ? 445  TYR A C   1 
ATOM   3360 O  O   . TYR A 1 445 ? 28.929 31.968 60.656  1.00 16.62 ? 445  TYR A O   1 
ATOM   3361 C  CB  . TYR A 1 445 ? 32.415 33.099 60.514  1.00 14.43 ? 445  TYR A CB  1 
ATOM   3362 C  CG  . TYR A 1 445 ? 33.782 32.749 59.865  1.00 15.41 ? 445  TYR A CG  1 
ATOM   3363 C  CD1 . TYR A 1 445 ? 34.108 31.470 59.458  1.00 12.39 ? 445  TYR A CD1 1 
ATOM   3364 C  CD2 . TYR A 1 445 ? 34.732 33.763 59.723  1.00 18.33 ? 445  TYR A CD2 1 
ATOM   3365 C  CE1 . TYR A 1 445 ? 35.362 31.204 58.933  1.00 16.83 ? 445  TYR A CE1 1 
ATOM   3366 C  CE2 . TYR A 1 445 ? 35.994 33.506 59.198  1.00 17.37 ? 445  TYR A CE2 1 
ATOM   3367 C  CZ  . TYR A 1 445 ? 36.289 32.220 58.813  1.00 16.46 ? 445  TYR A CZ  1 
ATOM   3368 O  OH  . TYR A 1 445 ? 37.531 31.914 58.301  1.00 18.03 ? 445  TYR A OH  1 
ATOM   3369 N  N   . ASN A 1 446 ? 30.059 33.241 62.108  1.00 14.53 ? 446  ASN A N   1 
ATOM   3370 C  CA  . ASN A 1 446 ? 28.917 33.614 62.903  1.00 18.41 ? 446  ASN A CA  1 
ATOM   3371 C  C   . ASN A 1 446 ? 28.893 35.114 63.222  1.00 18.02 ? 446  ASN A C   1 
ATOM   3372 O  O   . ASN A 1 446 ? 27.921 35.771 62.884  1.00 22.71 ? 446  ASN A O   1 
ATOM   3373 C  CB  . ASN A 1 446 ? 28.933 32.769 64.192  1.00 15.42 ? 446  ASN A CB  1 
ATOM   3374 C  CG  . ASN A 1 446 ? 30.265 32.745 64.920  1.00 17.14 ? 446  ASN A CG  1 
ATOM   3375 O  OD1 . ASN A 1 446 ? 30.756 33.748 65.451  1.00 19.28 ? 446  ASN A OD1 1 
ATOM   3376 N  ND2 . ASN A 1 446 ? 30.881 31.592 64.981  1.00 12.65 ? 446  ASN A ND2 1 
ATOM   3377 N  N   . ARG A 1 447 ? 29.866 35.758 63.849  1.00 19.81 ? 447  ARG A N   1 
ATOM   3378 C  CA  . ARG A 1 447 ? 29.844 37.204 64.070  1.00 18.96 ? 447  ARG A CA  1 
ATOM   3379 C  C   . ARG A 1 447 ? 30.538 37.852 62.899  1.00 19.88 ? 447  ARG A C   1 
ATOM   3380 O  O   . ARG A 1 447 ? 31.341 37.185 62.221  1.00 19.78 ? 447  ARG A O   1 
ATOM   3381 C  CB  . ARG A 1 447 ? 30.614 37.636 65.290  1.00 17.47 ? 447  ARG A CB  1 
ATOM   3382 C  CG  . ARG A 1 447 ? 30.150 36.828 66.416  1.00 14.53 ? 447  ARG A CG  1 
ATOM   3383 C  CD  . ARG A 1 447 ? 30.888 37.182 67.682  1.00 19.10 ? 447  ARG A CD  1 
ATOM   3384 N  NE  . ARG A 1 447 ? 30.140 36.449 68.672  1.00 14.98 ? 447  ARG A NE  1 
ATOM   3385 C  CZ  . ARG A 1 447 ? 30.632 35.797 69.703  1.00 15.46 ? 447  ARG A CZ  1 
ATOM   3386 N  NH1 . ARG A 1 447 ? 31.956 35.715 69.938  1.00 15.59 ? 447  ARG A NH1 1 
ATOM   3387 N  NH2 . ARG A 1 447 ? 29.704 35.236 70.463  1.00 15.11 ? 447  ARG A NH2 1 
ATOM   3388 N  N   . ASN A 1 448 ? 30.277 39.155 62.702  1.00 19.74 ? 448  ASN A N   1 
ATOM   3389 C  CA  . ASN A 1 448 ? 30.802 39.920 61.567  1.00 18.42 ? 448  ASN A CA  1 
ATOM   3390 C  C   . ASN A 1 448 ? 30.899 41.387 61.956  1.00 20.15 ? 448  ASN A C   1 
ATOM   3391 O  O   . ASN A 1 448 ? 30.722 42.334 61.181  1.00 22.03 ? 448  ASN A O   1 
ATOM   3392 C  CB  . ASN A 1 448 ? 29.881 39.767 60.323  1.00 17.24 ? 448  ASN A CB  1 
ATOM   3393 C  CG  . ASN A 1 448 ? 28.398 40.078 60.561  1.00 15.94 ? 448  ASN A CG  1 
ATOM   3394 O  OD1 . ASN A 1 448 ? 27.956 40.365 61.675  1.00 11.99 ? 448  ASN A OD1 1 
ATOM   3395 N  ND2 . ASN A 1 448 ? 27.549 40.032 59.580  1.00 11.29 ? 448  ASN A ND2 1 
ATOM   3396 N  N   . PHE A 1 449 ? 31.221 41.546 63.237  1.00 16.79 ? 449  PHE A N   1 
ATOM   3397 C  CA  . PHE A 1 449 ? 31.429 42.845 63.844  1.00 20.32 ? 449  PHE A CA  1 
ATOM   3398 C  C   . PHE A 1 449 ? 32.603 43.593 63.227  1.00 21.09 ? 449  PHE A C   1 
ATOM   3399 O  O   . PHE A 1 449 ? 33.550 42.937 62.779  1.00 18.29 ? 449  PHE A O   1 
ATOM   3400 C  CB  . PHE A 1 449 ? 31.683 42.666 65.337  1.00 17.74 ? 449  PHE A CB  1 
ATOM   3401 C  CG  . PHE A 1 449 ? 30.584 41.974 66.136  1.00 22.05 ? 449  PHE A CG  1 
ATOM   3402 C  CD1 . PHE A 1 449 ? 29.247 42.025 65.733  1.00 21.14 ? 449  PHE A CD1 1 
ATOM   3403 C  CD2 . PHE A 1 449 ? 30.946 41.340 67.319  1.00 20.99 ? 449  PHE A CD2 1 
ATOM   3404 C  CE1 . PHE A 1 449 ? 28.282 41.451 66.524  1.00 21.97 ? 449  PHE A CE1 1 
ATOM   3405 C  CE2 . PHE A 1 449 ? 29.966 40.763 68.116  1.00 23.49 ? 449  PHE A CE2 1 
ATOM   3406 C  CZ  . PHE A 1 449 ? 28.638 40.823 67.715  1.00 24.54 ? 449  PHE A CZ  1 
ATOM   3407 N  N   . THR A 1 450 ? 32.569 44.937 63.255  1.00 24.46 ? 450  THR A N   1 
ATOM   3408 C  CA  . THR A 1 450 ? 33.589 45.858 62.711  1.00 25.43 ? 450  THR A CA  1 
ATOM   3409 C  C   . THR A 1 450 ? 35.023 45.475 63.052  1.00 23.40 ? 450  THR A C   1 
ATOM   3410 O  O   . THR A 1 450 ? 35.356 45.358 64.238  1.00 24.10 ? 450  THR A O   1 
ATOM   3411 C  CB  . THR A 1 450 ? 33.358 47.305 63.244  1.00 28.48 ? 450  THR A CB  1 
ATOM   3412 O  OG1 . THR A 1 450 ? 31.978 47.592 63.045  1.00 32.28 ? 450  THR A OG1 1 
ATOM   3413 C  CG2 . THR A 1 450 ? 34.209 48.356 62.535  1.00 27.06 ? 450  THR A CG2 1 
ATOM   3414 N  N   . GLY A 1 451 ? 35.843 45.338 62.003  1.00 23.40 ? 451  GLY A N   1 
ATOM   3415 C  CA  . GLY A 1 451 ? 37.252 44.980 62.045  1.00 23.66 ? 451  GLY A CA  1 
ATOM   3416 C  C   . GLY A 1 451 ? 37.601 43.666 62.731  1.00 23.45 ? 451  GLY A C   1 
ATOM   3417 O  O   . GLY A 1 451 ? 38.777 43.458 63.050  1.00 24.94 ? 451  GLY A O   1 
ATOM   3418 N  N   . ARG A 1 452 ? 36.684 42.711 62.885  1.00 22.33 ? 452  ARG A N   1 
ATOM   3419 C  CA  . ARG A 1 452 ? 36.964 41.459 63.578  1.00 20.74 ? 452  ARG A CA  1 
ATOM   3420 C  C   . ARG A 1 452 ? 37.783 40.483 62.755  1.00 17.51 ? 452  ARG A C   1 
ATOM   3421 O  O   . ARG A 1 452 ? 38.568 39.738 63.319  1.00 19.90 ? 452  ARG A O   1 
ATOM   3422 C  CB  . ARG A 1 452 ? 35.653 40.801 63.956  1.00 22.65 ? 452  ARG A CB  1 
ATOM   3423 C  CG  . ARG A 1 452 ? 35.805 39.541 64.782  1.00 21.09 ? 452  ARG A CG  1 
ATOM   3424 C  CD  . ARG A 1 452 ? 34.416 38.940 64.907  1.00 21.73 ? 452  ARG A CD  1 
ATOM   3425 N  NE  . ARG A 1 452 ? 34.550 37.510 65.104  1.00 15.79 ? 452  ARG A NE  1 
ATOM   3426 C  CZ  . ARG A 1 452 ? 34.739 36.952 66.306  1.00 14.20 ? 452  ARG A CZ  1 
ATOM   3427 N  NH1 . ARG A 1 452 ? 34.741 37.650 67.439  1.00 14.27 ? 452  ARG A NH1 1 
ATOM   3428 N  NH2 . ARG A 1 452 ? 34.913 35.661 66.321  1.00 16.20 ? 452  ARG A NH2 1 
ATOM   3429 N  N   . ASN A 1 453 ? 37.676 40.424 61.445  1.00 18.39 ? 453  ASN A N   1 
ATOM   3430 C  CA  . ASN A 1 453 ? 38.418 39.429 60.691  1.00 20.65 ? 453  ASN A CA  1 
ATOM   3431 C  C   . ASN A 1 453 ? 39.771 39.884 60.198  1.00 21.86 ? 453  ASN A C   1 
ATOM   3432 O  O   . ASN A 1 453 ? 40.669 39.068 59.964  1.00 21.15 ? 453  ASN A O   1 
ATOM   3433 C  CB  . ASN A 1 453 ? 37.635 38.988 59.492  1.00 21.31 ? 453  ASN A CB  1 
ATOM   3434 C  CG  . ASN A 1 453 ? 36.319 38.356 59.920  1.00 23.82 ? 453  ASN A CG  1 
ATOM   3435 O  OD1 . ASN A 1 453 ? 35.254 38.881 59.575  1.00 25.02 ? 453  ASN A OD1 1 
ATOM   3436 N  ND2 . ASN A 1 453 ? 36.277 37.249 60.648  1.00 20.50 ? 453  ASN A ND2 1 
ATOM   3437 N  N   . ASP A 1 454 ? 39.934 41.197 60.047  1.00 20.96 ? 454  ASP A N   1 
ATOM   3438 C  CA  . ASP A 1 454 ? 41.154 41.727 59.455  1.00 22.54 ? 454  ASP A CA  1 
ATOM   3439 C  C   . ASP A 1 454 ? 41.519 43.099 59.967  1.00 22.66 ? 454  ASP A C   1 
ATOM   3440 O  O   . ASP A 1 454 ? 42.316 43.829 59.362  1.00 28.13 ? 454  ASP A O   1 
ATOM   3441 C  CB  . ASP A 1 454 ? 41.020 41.782 57.900  1.00 19.49 ? 454  ASP A CB  1 
ATOM   3442 C  CG  . ASP A 1 454 ? 39.895 42.639 57.317  1.00 17.59 ? 454  ASP A CG  1 
ATOM   3443 O  OD1 . ASP A 1 454 ? 39.349 43.458 58.041  1.00 17.71 ? 454  ASP A OD1 1 
ATOM   3444 O  OD2 . ASP A 1 454 ? 39.585 42.515 56.123  1.00 17.78 ? 454  ASP A OD2 1 
ATOM   3445 N  N   . ALA A 1 455 ? 40.959 43.481 61.112  1.00 23.09 ? 455  ALA A N   1 
ATOM   3446 C  CA  . ALA A 1 455 ? 41.152 44.786 61.719  1.00 22.78 ? 455  ALA A CA  1 
ATOM   3447 C  C   . ALA A 1 455 ? 40.864 45.942 60.780  1.00 25.26 ? 455  ALA A C   1 
ATOM   3448 O  O   . ALA A 1 455 ? 41.317 47.073 61.036  1.00 26.23 ? 455  ALA A O   1 
ATOM   3449 C  CB  . ALA A 1 455 ? 42.579 44.916 62.230  1.00 19.86 ? 455  ALA A CB  1 
ATOM   3450 N  N   . ASN A 1 456 ? 40.212 45.739 59.634  1.00 23.85 ? 456  ASN A N   1 
ATOM   3451 C  CA  . ASN A 1 456 ? 39.879 46.840 58.781  1.00 24.07 ? 456  ASN A CA  1 
ATOM   3452 C  C   . ASN A 1 456 ? 38.415 47.171 59.044  1.00 27.06 ? 456  ASN A C   1 
ATOM   3453 O  O   . ASN A 1 456 ? 37.537 46.400 58.671  1.00 28.82 ? 456  ASN A O   1 
ATOM   3454 C  CB  . ASN A 1 456 ? 40.077 46.451 57.320  1.00 21.00 ? 456  ASN A CB  1 
ATOM   3455 C  CG  . ASN A 1 456 ? 39.586 47.508 56.335  1.00 21.21 ? 456  ASN A CG  1 
ATOM   3456 O  OD1 . ASN A 1 456 ? 39.475 48.680 56.705  1.00 24.54 ? 456  ASN A OD1 1 
ATOM   3457 N  ND2 . ASN A 1 456 ? 39.262 47.199 55.087  1.00 16.88 ? 456  ASN A ND2 1 
ATOM   3458 N  N   . PRO A 1 457 ? 38.036 48.276 59.673  1.00 29.78 ? 457  PRO A N   1 
ATOM   3459 C  CA  . PRO A 1 457 ? 36.648 48.684 59.815  1.00 29.96 ? 457  PRO A CA  1 
ATOM   3460 C  C   . PRO A 1 457 ? 35.806 48.815 58.546  1.00 29.75 ? 457  PRO A C   1 
ATOM   3461 O  O   . PRO A 1 457 ? 34.579 48.715 58.657  1.00 32.87 ? 457  PRO A O   1 
ATOM   3462 C  CB  . PRO A 1 457 ? 36.734 49.969 60.614  1.00 32.05 ? 457  PRO A CB  1 
ATOM   3463 C  CG  . PRO A 1 457 ? 38.159 50.438 60.413  1.00 34.37 ? 457  PRO A CG  1 
ATOM   3464 C  CD  . PRO A 1 457 ? 38.912 49.125 60.458  1.00 32.03 ? 457  PRO A CD  1 
ATOM   3465 N  N   . GLU A 1 458 ? 36.358 48.967 57.345  1.00 26.53 ? 458  GLU A N   1 
ATOM   3466 C  CA  . GLU A 1 458 ? 35.494 49.055 56.198  1.00 28.82 ? 458  GLU A CA  1 
ATOM   3467 C  C   . GLU A 1 458 ? 35.360 47.745 55.463  1.00 23.98 ? 458  GLU A C   1 
ATOM   3468 O  O   . GLU A 1 458 ? 34.874 47.657 54.319  1.00 22.39 ? 458  GLU A O   1 
ATOM   3469 C  CB  . GLU A 1 458 ? 36.004 50.204 55.296  1.00 35.17 ? 458  GLU A CB  1 
ATOM   3470 C  CG  . GLU A 1 458 ? 35.188 51.543 55.482  1.00 46.49 ? 458  GLU A CG  1 
ATOM   3471 C  CD  . GLU A 1 458 ? 33.812 51.723 54.764  1.00 53.70 ? 458  GLU A CD  1 
ATOM   3472 O  OE1 . GLU A 1 458 ? 32.870 50.915 54.845  1.00 57.35 ? 458  GLU A OE1 1 
ATOM   3473 O  OE2 . GLU A 1 458 ? 33.602 52.692 54.018  1.00 58.90 ? 458  GLU A OE2 1 
ATOM   3474 N  N   . THR A 1 459 ? 35.735 46.643 56.114  1.00 25.68 ? 459  THR A N   1 
ATOM   3475 C  CA  . THR A 1 459 ? 35.494 45.332 55.512  1.00 24.82 ? 459  THR A CA  1 
ATOM   3476 C  C   . THR A 1 459 ? 34.046 44.957 55.822  1.00 21.88 ? 459  THR A C   1 
ATOM   3477 O  O   . THR A 1 459 ? 33.622 44.991 56.969  1.00 20.70 ? 459  THR A O   1 
ATOM   3478 C  CB  . THR A 1 459 ? 36.452 44.257 56.085  1.00 25.33 ? 459  THR A CB  1 
ATOM   3479 O  OG1 . THR A 1 459 ? 37.703 44.569 55.504  1.00 25.71 ? 459  THR A OG1 1 
ATOM   3480 C  CG2 . THR A 1 459 ? 36.137 42.807 55.690  1.00 24.12 ? 459  THR A CG2 1 
ATOM   3481 N  N   . HIS A 1 460 ? 33.288 44.596 54.798  1.00 20.38 ? 460  HIS A N   1 
ATOM   3482 C  CA  . HIS A 1 460 ? 31.879 44.255 54.906  1.00 21.55 ? 460  HIS A CA  1 
ATOM   3483 C  C   . HIS A 1 460 ? 31.843 42.745 54.955  1.00 18.02 ? 460  HIS A C   1 
ATOM   3484 O  O   . HIS A 1 460 ? 32.153 42.126 53.941  1.00 18.91 ? 460  HIS A O   1 
ATOM   3485 C  CB  . HIS A 1 460 ? 31.119 44.832 53.667  1.00 21.17 ? 460  HIS A CB  1 
ATOM   3486 C  CG  . HIS A 1 460 ? 31.073 46.365 53.705  1.00 23.82 ? 460  HIS A CG  1 
ATOM   3487 N  ND1 . HIS A 1 460 ? 32.042 47.261 53.966  1.00 24.18 ? 460  HIS A ND1 1 
ATOM   3488 C  CD2 . HIS A 1 460 ? 29.919 47.096 53.550  1.00 26.04 ? 460  HIS A CD2 1 
ATOM   3489 C  CE1 . HIS A 1 460 ? 31.518 48.454 53.990  1.00 24.93 ? 460  HIS A CE1 1 
ATOM   3490 N  NE2 . HIS A 1 460 ? 30.235 48.356 53.736  1.00 26.85 ? 460  HIS A NE2 1 
ATOM   3491 N  N   . ALA A 1 461 ? 31.590 42.114 56.099  1.00 18.15 ? 461  ALA A N   1 
ATOM   3492 C  CA  . ALA A 1 461 ? 31.557 40.659 56.156  1.00 19.06 ? 461  ALA A CA  1 
ATOM   3493 C  C   . ALA A 1 461 ? 30.125 40.107 56.308  1.00 18.37 ? 461  ALA A C   1 
ATOM   3494 O  O   . ALA A 1 461 ? 29.347 40.530 57.170  1.00 22.17 ? 461  ALA A O   1 
ATOM   3495 C  CB  . ALA A 1 461 ? 32.449 40.203 57.328  1.00 14.22 ? 461  ALA A CB  1 
ATOM   3496 N  N   . PHE A 1 462 ? 29.752 39.167 55.444  1.00 17.59 ? 462  PHE A N   1 
ATOM   3497 C  CA  . PHE A 1 462 ? 28.451 38.516 55.395  1.00 16.50 ? 462  PHE A CA  1 
ATOM   3498 C  C   . PHE A 1 462 ? 28.629 37.059 55.823  1.00 19.87 ? 462  PHE A C   1 
ATOM   3499 O  O   . PHE A 1 462 ? 29.555 36.392 55.341  1.00 19.61 ? 462  PHE A O   1 
ATOM   3500 C  CB  . PHE A 1 462 ? 27.878 38.523 53.959  1.00 19.17 ? 462  PHE A CB  1 
ATOM   3501 C  CG  . PHE A 1 462 ? 27.642 39.921 53.415  1.00 23.22 ? 462  PHE A CG  1 
ATOM   3502 C  CD1 . PHE A 1 462 ? 28.699 40.662 52.876  1.00 23.42 ? 462  PHE A CD1 1 
ATOM   3503 C  CD2 . PHE A 1 462 ? 26.383 40.489 53.522  1.00 21.91 ? 462  PHE A CD2 1 
ATOM   3504 C  CE1 . PHE A 1 462 ? 28.504 41.972 52.455  1.00 23.50 ? 462  PHE A CE1 1 
ATOM   3505 C  CE2 . PHE A 1 462 ? 26.200 41.799 53.098  1.00 23.70 ? 462  PHE A CE2 1 
ATOM   3506 C  CZ  . PHE A 1 462 ? 27.253 42.543 52.568  1.00 24.60 ? 462  PHE A CZ  1 
ATOM   3507 N  N   . VAL A 1 463 ? 27.812 36.498 56.722  1.00 19.59 ? 463  VAL A N   1 
ATOM   3508 C  CA  . VAL A 1 463 ? 27.918 35.100 57.117  1.00 15.70 ? 463  VAL A CA  1 
ATOM   3509 C  C   . VAL A 1 463 ? 26.800 34.299 56.457  1.00 15.77 ? 463  VAL A C   1 
ATOM   3510 O  O   . VAL A 1 463 ? 25.676 34.772 56.297  1.00 14.56 ? 463  VAL A O   1 
ATOM   3511 C  CB  . VAL A 1 463 ? 27.874 34.968 58.661  1.00 14.29 ? 463  VAL A CB  1 
ATOM   3512 C  CG1 . VAL A 1 463 ? 29.014 35.785 59.223  1.00 13.69 ? 463  VAL A CG1 1 
ATOM   3513 C  CG2 . VAL A 1 463 ? 26.620 35.549 59.285  1.00 16.38 ? 463  VAL A CG2 1 
ATOM   3514 N  N   . THR A 1 464 ? 27.121 33.101 55.975  1.00 16.68 ? 464  THR A N   1 
ATOM   3515 C  CA  . THR A 1 464 ? 26.195 32.234 55.305  1.00 15.05 ? 464  THR A CA  1 
ATOM   3516 C  C   . THR A 1 464 ? 26.612 30.744 55.513  1.00 15.91 ? 464  THR A C   1 
ATOM   3517 O  O   . THR A 1 464 ? 27.343 30.404 56.473  1.00 15.91 ? 464  THR A O   1 
ATOM   3518 C  CB  . THR A 1 464 ? 26.176 32.767 53.825  1.00 15.11 ? 464  THR A CB  1 
ATOM   3519 O  OG1 . THR A 1 464 ? 25.162 31.996 53.195  1.00 16.31 ? 464  THR A OG1 1 
ATOM   3520 C  CG2 . THR A 1 464 ? 27.455 32.607 53.003  1.00 11.83 ? 464  THR A CG2 1 
ATOM   3521 N  N   . SER A 1 465 ? 26.057 29.797 54.752  1.00 14.34 ? 465  SER A N   1 
ATOM   3522 C  CA  . SER A 1 465 ? 26.402 28.383 54.812  1.00 18.13 ? 465  SER A CA  1 
ATOM   3523 C  C   . SER A 1 465 ? 27.649 28.076 53.963  1.00 17.19 ? 465  SER A C   1 
ATOM   3524 O  O   . SER A 1 465 ? 27.905 28.786 52.976  1.00 16.80 ? 465  SER A O   1 
ATOM   3525 C  CB  . SER A 1 465 ? 25.245 27.530 54.284  1.00 15.01 ? 465  SER A CB  1 
ATOM   3526 O  OG  . SER A 1 465 ? 24.979 27.933 52.950  1.00 17.61 ? 465  SER A OG  1 
ATOM   3527 N  N   . PRO A 1 466 ? 28.443 27.035 54.248  1.00 17.76 ? 466  PRO A N   1 
ATOM   3528 C  CA  . PRO A 1 466 ? 29.628 26.735 53.473  1.00 17.09 ? 466  PRO A CA  1 
ATOM   3529 C  C   . PRO A 1 466 ? 29.379 26.505 51.984  1.00 16.33 ? 466  PRO A C   1 
ATOM   3530 O  O   . PRO A 1 466 ? 30.127 27.046 51.158  1.00 15.25 ? 466  PRO A O   1 
ATOM   3531 C  CB  . PRO A 1 466 ? 30.242 25.562 54.254  1.00 16.06 ? 466  PRO A CB  1 
ATOM   3532 C  CG  . PRO A 1 466 ? 29.142 24.979 55.068  1.00 15.98 ? 466  PRO A CG  1 
ATOM   3533 C  CD  . PRO A 1 466 ? 28.345 26.195 55.443  1.00 17.23 ? 466  PRO A CD  1 
ATOM   3534 N  N   . GLU A 1 467 ? 28.312 25.847 51.553  1.00 14.94 ? 467  GLU A N   1 
ATOM   3535 C  CA  . GLU A 1 467 ? 28.021 25.616 50.142  1.00 14.71 ? 467  GLU A CA  1 
ATOM   3536 C  C   . GLU A 1 467 ? 27.629 26.908 49.453  1.00 15.39 ? 467  GLU A C   1 
ATOM   3537 O  O   . GLU A 1 467 ? 27.885 27.047 48.251  1.00 17.91 ? 467  GLU A O   1 
ATOM   3538 C  CB  . GLU A 1 467 ? 26.889 24.589 49.943  1.00 17.08 ? 467  GLU A CB  1 
ATOM   3539 C  CG  . GLU A 1 467 ? 25.580 24.833 50.703  1.00 19.12 ? 467  GLU A CG  1 
ATOM   3540 C  CD  . GLU A 1 467 ? 25.506 24.240 52.114  1.00 22.23 ? 467  GLU A CD  1 
ATOM   3541 O  OE1 . GLU A 1 467 ? 26.452 24.299 52.900  1.00 20.63 ? 467  GLU A OE1 1 
ATOM   3542 O  OE2 . GLU A 1 467 ? 24.468 23.677 52.450  1.00 23.37 ? 467  GLU A OE2 1 
ATOM   3543 N  N   . ILE A 1 468 ? 27.035 27.896 50.136  1.00 14.04 ? 468  ILE A N   1 
ATOM   3544 C  CA  . ILE A 1 468 ? 26.748 29.160 49.489  1.00 15.44 ? 468  ILE A CA  1 
ATOM   3545 C  C   . ILE A 1 468 ? 28.066 29.954 49.392  1.00 19.78 ? 468  ILE A C   1 
ATOM   3546 O  O   . ILE A 1 468 ? 28.280 30.583 48.341  1.00 21.02 ? 468  ILE A O   1 
ATOM   3547 C  CB  . ILE A 1 468 ? 25.657 29.938 50.278  1.00 16.15 ? 468  ILE A CB  1 
ATOM   3548 C  CG1 . ILE A 1 468 ? 24.265 29.255 50.120  1.00 16.79 ? 468  ILE A CG1 1 
ATOM   3549 C  CG2 . ILE A 1 468 ? 25.574 31.382 49.736  1.00 16.07 ? 468  ILE A CG2 1 
ATOM   3550 C  CD1 . ILE A 1 468 ? 23.726 29.202 48.650  1.00 17.67 ? 468  ILE A CD1 1 
ATOM   3551 N  N   . VAL A 1 469 ? 29.002 29.937 50.377  1.00 20.48 ? 469  VAL A N   1 
ATOM   3552 C  CA  . VAL A 1 469 ? 30.304 30.605 50.235  1.00 15.89 ? 469  VAL A CA  1 
ATOM   3553 C  C   . VAL A 1 469 ? 30.976 30.025 48.990  1.00 17.02 ? 469  VAL A C   1 
ATOM   3554 O  O   . VAL A 1 469 ? 31.424 30.789 48.127  1.00 19.29 ? 469  VAL A O   1 
ATOM   3555 C  CB  . VAL A 1 469 ? 31.193 30.355 51.464  1.00 14.45 ? 469  VAL A CB  1 
ATOM   3556 C  CG1 . VAL A 1 469 ? 32.573 30.948 51.210  1.00 13.96 ? 469  VAL A CG1 1 
ATOM   3557 C  CG2 . VAL A 1 469 ? 30.641 31.036 52.697  1.00 13.05 ? 469  VAL A CG2 1 
ATOM   3558 N  N   . THR A 1 470 ? 31.005 28.700 48.816  1.00 16.88 ? 470  THR A N   1 
ATOM   3559 C  CA  . THR A 1 470 ? 31.653 28.097 47.659  1.00 17.16 ? 470  THR A CA  1 
ATOM   3560 C  C   . THR A 1 470 ? 31.062 28.581 46.331  1.00 19.36 ? 470  THR A C   1 
ATOM   3561 O  O   . THR A 1 470 ? 31.795 28.969 45.416  1.00 19.88 ? 470  THR A O   1 
ATOM   3562 C  CB  . THR A 1 470 ? 31.546 26.551 47.784  1.00 13.73 ? 470  THR A CB  1 
ATOM   3563 O  OG1 . THR A 1 470 ? 32.000 26.189 49.084  1.00 14.10 ? 470  THR A OG1 1 
ATOM   3564 C  CG2 . THR A 1 470 ? 32.396 25.809 46.755  1.00 12.14 ? 470  THR A CG2 1 
ATOM   3565 N  N   . ALA A 1 471 ? 29.740 28.635 46.217  1.00 19.66 ? 471  ALA A N   1 
ATOM   3566 C  CA  . ALA A 1 471 ? 29.076 29.112 45.014  1.00 19.99 ? 471  ALA A CA  1 
ATOM   3567 C  C   . ALA A 1 471 ? 29.363 30.599 44.760  1.00 19.73 ? 471  ALA A C   1 
ATOM   3568 O  O   . ALA A 1 471 ? 29.686 31.016 43.640  1.00 20.07 ? 471  ALA A O   1 
ATOM   3569 C  CB  . ALA A 1 471 ? 27.578 28.879 45.184  1.00 16.65 ? 471  ALA A CB  1 
ATOM   3570 N  N   . LEU A 1 472 ? 29.292 31.458 45.772  1.00 19.73 ? 472  LEU A N   1 
ATOM   3571 C  CA  . LEU A 1 472 ? 29.581 32.872 45.600  1.00 21.95 ? 472  LEU A CA  1 
ATOM   3572 C  C   . LEU A 1 472 ? 31.066 33.131 45.364  1.00 22.90 ? 472  LEU A C   1 
ATOM   3573 O  O   . LEU A 1 472 ? 31.415 34.136 44.753  1.00 22.45 ? 472  LEU A O   1 
ATOM   3574 C  CB  . LEU A 1 472 ? 29.144 33.682 46.830  1.00 22.25 ? 472  LEU A CB  1 
ATOM   3575 C  CG  . LEU A 1 472 ? 27.648 33.724 47.203  1.00 23.84 ? 472  LEU A CG  1 
ATOM   3576 C  CD1 . LEU A 1 472 ? 27.467 34.636 48.388  1.00 20.25 ? 472  LEU A CD1 1 
ATOM   3577 C  CD2 . LEU A 1 472 ? 26.813 34.189 46.031  1.00 23.73 ? 472  LEU A CD2 1 
ATOM   3578 N  N   . ALA A 1 473 ? 31.975 32.272 45.834  1.00 21.87 ? 473  ALA A N   1 
ATOM   3579 C  CA  . ALA A 1 473 ? 33.411 32.410 45.590  1.00 20.75 ? 473  ALA A CA  1 
ATOM   3580 C  C   . ALA A 1 473 ? 33.750 32.044 44.160  1.00 19.51 ? 473  ALA A C   1 
ATOM   3581 O  O   . ALA A 1 473 ? 34.684 32.623 43.584  1.00 21.00 ? 473  ALA A O   1 
ATOM   3582 C  CB  . ALA A 1 473 ? 34.254 31.497 46.494  1.00 17.85 ? 473  ALA A CB  1 
ATOM   3583 N  N   . ILE A 1 474 ? 33.032 31.075 43.592  1.00 18.57 ? 474  ILE A N   1 
ATOM   3584 C  CA  . ILE A 1 474 ? 33.162 30.700 42.190  1.00 19.73 ? 474  ILE A CA  1 
ATOM   3585 C  C   . ILE A 1 474 ? 32.616 31.823 41.299  1.00 23.59 ? 474  ILE A C   1 
ATOM   3586 O  O   . ILE A 1 474 ? 33.220 32.110 40.263  1.00 25.53 ? 474  ILE A O   1 
ATOM   3587 C  CB  . ILE A 1 474 ? 32.392 29.376 41.943  1.00 20.03 ? 474  ILE A CB  1 
ATOM   3588 C  CG1 . ILE A 1 474 ? 33.196 28.252 42.570  1.00 20.78 ? 474  ILE A CG1 1 
ATOM   3589 C  CG2 . ILE A 1 474 ? 32.183 29.083 40.451  1.00 19.89 ? 474  ILE A CG2 1 
ATOM   3590 C  CD1 . ILE A 1 474 ? 32.430 26.912 42.699  1.00 19.18 ? 474  ILE A CD1 1 
ATOM   3591 N  N   . ALA A 1 475 ? 31.498 32.479 41.652  1.00 21.60 ? 475  ALA A N   1 
ATOM   3592 C  CA  . ALA A 1 475 ? 30.990 33.576 40.864  1.00 21.31 ? 475  ALA A CA  1 
ATOM   3593 C  C   . ALA A 1 475 ? 31.718 34.876 41.162  1.00 21.65 ? 475  ALA A C   1 
ATOM   3594 O  O   . ALA A 1 475 ? 31.829 35.771 40.316  1.00 23.36 ? 475  ALA A O   1 
ATOM   3595 C  CB  . ALA A 1 475 ? 29.522 33.774 41.159  1.00 21.38 ? 475  ALA A CB  1 
ATOM   3596 N  N   . GLY A 1 476 ? 32.165 35.062 42.396  1.00 20.55 ? 476  GLY A N   1 
ATOM   3597 C  CA  . GLY A 1 476 ? 32.951 36.223 42.782  1.00 20.29 ? 476  GLY A CA  1 
ATOM   3598 C  C   . GLY A 1 476 ? 32.146 37.493 42.948  1.00 20.60 ? 476  GLY A C   1 
ATOM   3599 O  O   . GLY A 1 476 ? 32.718 38.590 43.095  1.00 21.18 ? 476  GLY A O   1 
ATOM   3600 N  N   . THR A 1 477 ? 30.833 37.381 42.959  1.00 21.28 ? 477  THR A N   1 
ATOM   3601 C  CA  . THR A 1 477 ? 29.982 38.524 43.135  1.00 22.31 ? 477  THR A CA  1 
ATOM   3602 C  C   . THR A 1 477 ? 28.781 38.101 43.965  1.00 23.31 ? 477  THR A C   1 
ATOM   3603 O  O   . THR A 1 477 ? 28.257 36.985 43.851  1.00 24.23 ? 477  THR A O   1 
ATOM   3604 C  CB  . THR A 1 477 ? 29.516 39.075 41.737  1.00 24.27 ? 477  THR A CB  1 
ATOM   3605 O  OG1 . THR A 1 477 ? 28.704 40.216 41.977  1.00 25.90 ? 477  THR A OG1 1 
ATOM   3606 C  CG2 . THR A 1 477 ? 28.661 38.087 40.936  1.00 23.48 ? 477  THR A CG2 1 
ATOM   3607 N  N   . LEU A 1 478 ? 28.383 39.047 44.823  1.00 25.87 ? 478  LEU A N   1 
ATOM   3608 C  CA  . LEU A 1 478 ? 27.179 38.940 45.633  1.00 28.47 ? 478  LEU A CA  1 
ATOM   3609 C  C   . LEU A 1 478 ? 25.919 38.891 44.766  1.00 32.23 ? 478  LEU A C   1 
ATOM   3610 O  O   . LEU A 1 478 ? 24.854 38.435 45.190  1.00 34.28 ? 478  LEU A O   1 
ATOM   3611 C  CB  . LEU A 1 478 ? 27.042 40.122 46.551  1.00 25.80 ? 478  LEU A CB  1 
ATOM   3612 C  CG  . LEU A 1 478 ? 27.773 40.148 47.866  1.00 26.88 ? 478  LEU A CG  1 
ATOM   3613 C  CD1 . LEU A 1 478 ? 27.410 41.451 48.559  1.00 23.59 ? 478  LEU A CD1 1 
ATOM   3614 C  CD2 . LEU A 1 478 ? 27.411 38.922 48.710  1.00 26.11 ? 478  LEU A CD2 1 
ATOM   3615 N  N   . LYS A 1 479 ? 25.973 39.456 43.555  1.00 35.25 ? 479  LYS A N   1 
ATOM   3616 C  CA  . LYS A 1 479 ? 24.881 39.432 42.603  1.00 38.68 ? 479  LYS A CA  1 
ATOM   3617 C  C   . LYS A 1 479 ? 24.785 38.074 41.929  1.00 37.45 ? 479  LYS A C   1 
ATOM   3618 O  O   . LYS A 1 479 ? 24.698 38.009 40.698  1.00 44.56 ? 479  LYS A O   1 
ATOM   3619 C  CB  . LYS A 1 479 ? 25.099 40.505 41.540  1.00 42.13 ? 479  LYS A CB  1 
ATOM   3620 C  CG  . LYS A 1 479 ? 25.275 41.915 42.028  1.00 47.27 ? 479  LYS A CG  1 
ATOM   3621 C  CD  . LYS A 1 479 ? 24.923 42.829 40.870  1.00 51.45 ? 479  LYS A CD  1 
ATOM   3622 C  CE  . LYS A 1 479 ? 23.394 42.793 40.672  1.00 54.81 ? 479  LYS A CE  1 
ATOM   3623 N  NZ  . LYS A 1 479 ? 22.723 43.422 41.809  1.00 57.02 ? 479  LYS A NZ  1 
ATOM   3624 N  N   . PHE A 1 480 ? 24.876 36.975 42.665  1.00 32.57 ? 480  PHE A N   1 
ATOM   3625 C  CA  . PHE A 1 480 ? 24.748 35.686 42.045  1.00 28.21 ? 480  PHE A CA  1 
ATOM   3626 C  C   . PHE A 1 480 ? 23.859 34.908 42.987  1.00 29.15 ? 480  PHE A C   1 
ATOM   3627 O  O   . PHE A 1 480 ? 24.095 34.864 44.202  1.00 29.79 ? 480  PHE A O   1 
ATOM   3628 C  CB  . PHE A 1 480 ? 26.100 35.015 41.925  1.00 25.56 ? 480  PHE A CB  1 
ATOM   3629 C  CG  . PHE A 1 480 ? 26.023 33.641 41.288  1.00 21.95 ? 480  PHE A CG  1 
ATOM   3630 C  CD1 . PHE A 1 480 ? 25.713 33.515 39.948  1.00 21.73 ? 480  PHE A CD1 1 
ATOM   3631 C  CD2 . PHE A 1 480 ? 26.260 32.530 42.063  1.00 20.10 ? 480  PHE A CD2 1 
ATOM   3632 C  CE1 . PHE A 1 480 ? 25.646 32.259 39.389  1.00 20.25 ? 480  PHE A CE1 1 
ATOM   3633 C  CE2 . PHE A 1 480 ? 26.188 31.286 41.486  1.00 19.95 ? 480  PHE A CE2 1 
ATOM   3634 C  CZ  . PHE A 1 480 ? 25.877 31.139 40.153  1.00 20.13 ? 480  PHE A CZ  1 
ATOM   3635 N  N   . ASN A 1 481 ? 22.815 34.313 42.437  1.00 26.74 ? 481  ASN A N   1 
ATOM   3636 C  CA  . ASN A 1 481 ? 21.969 33.448 43.213  1.00 27.58 ? 481  ASN A CA  1 
ATOM   3637 C  C   . ASN A 1 481 ? 22.177 32.032 42.674  1.00 27.07 ? 481  ASN A C   1 
ATOM   3638 O  O   . ASN A 1 481 ? 21.755 31.734 41.557  1.00 29.59 ? 481  ASN A O   1 
ATOM   3639 C  CB  . ASN A 1 481 ? 20.482 33.884 43.086  1.00 30.04 ? 481  ASN A CB  1 
ATOM   3640 C  CG  . ASN A 1 481 ? 19.498 32.974 43.833  1.00 30.40 ? 481  ASN A CG  1 
ATOM   3641 O  OD1 . ASN A 1 481 ? 19.871 32.024 44.538  1.00 32.66 ? 481  ASN A OD1 1 
ATOM   3642 N  ND2 . ASN A 1 481 ? 18.186 33.123 43.741  1.00 32.25 ? 481  ASN A ND2 1 
ATOM   3643 N  N   . PRO A 1 482 ? 22.776 31.089 43.429  1.00 26.16 ? 482  PRO A N   1 
ATOM   3644 C  CA  . PRO A 1 482 ? 23.075 29.720 43.013  1.00 26.25 ? 482  PRO A CA  1 
ATOM   3645 C  C   . PRO A 1 482 ? 21.849 28.959 42.544  1.00 28.80 ? 482  PRO A C   1 
ATOM   3646 O  O   . PRO A 1 482 ? 21.933 28.048 41.708  1.00 29.47 ? 482  PRO A O   1 
ATOM   3647 C  CB  . PRO A 1 482 ? 23.694 29.079 44.225  1.00 25.41 ? 482  PRO A CB  1 
ATOM   3648 C  CG  . PRO A 1 482 ? 24.217 30.234 45.035  1.00 24.18 ? 482  PRO A CG  1 
ATOM   3649 C  CD  . PRO A 1 482 ? 23.146 31.269 44.840  1.00 25.28 ? 482  PRO A CD  1 
ATOM   3650 N  N   . GLU A 1 483 ? 20.684 29.298 43.120  1.00 29.96 ? 483  GLU A N   1 
ATOM   3651 C  CA  . GLU A 1 483 ? 19.449 28.631 42.775  1.00 31.93 ? 483  GLU A CA  1 
ATOM   3652 C  C   . GLU A 1 483 ? 18.993 28.993 41.388  1.00 30.28 ? 483  GLU A C   1 
ATOM   3653 O  O   . GLU A 1 483 ? 18.617 28.114 40.621  1.00 32.01 ? 483  GLU A O   1 
ATOM   3654 C  CB  . GLU A 1 483 ? 18.340 28.994 43.755  1.00 34.05 ? 483  GLU A CB  1 
ATOM   3655 C  CG  . GLU A 1 483 ? 18.553 28.381 45.132  1.00 36.40 ? 483  GLU A CG  1 
ATOM   3656 C  CD  . GLU A 1 483 ? 17.301 28.118 45.953  1.00 37.90 ? 483  GLU A CD  1 
ATOM   3657 O  OE1 . GLU A 1 483 ? 16.725 29.046 46.514  1.00 39.42 ? 483  GLU A OE1 1 
ATOM   3658 O  OE2 . GLU A 1 483 ? 16.857 26.977 46.085  1.00 39.07 ? 483  GLU A OE2 1 
ATOM   3659 N  N   . THR A 1 484 ? 19.136 30.224 40.953  1.00 31.88 ? 484  THR A N   1 
ATOM   3660 C  CA  . THR A 1 484 ? 18.556 30.608 39.686  1.00 34.39 ? 484  THR A CA  1 
ATOM   3661 C  C   . THR A 1 484 ? 19.487 30.797 38.497  1.00 37.33 ? 484  THR A C   1 
ATOM   3662 O  O   . THR A 1 484 ? 19.164 30.398 37.363  1.00 38.80 ? 484  THR A O   1 
ATOM   3663 C  CB  . THR A 1 484 ? 17.731 31.877 39.977  1.00 33.98 ? 484  THR A CB  1 
ATOM   3664 O  OG1 . THR A 1 484 ? 18.504 32.778 40.767  1.00 36.89 ? 484  THR A OG1 1 
ATOM   3665 C  CG2 . THR A 1 484 ? 16.503 31.536 40.785  1.00 32.65 ? 484  THR A CG2 1 
ATOM   3666 N  N   . ASP A 1 485 ? 20.677 31.333 38.813  1.00 35.83 ? 485  ASP A N   1 
ATOM   3667 C  CA  . ASP A 1 485 ? 21.573 31.815 37.792  1.00 33.66 ? 485  ASP A CA  1 
ATOM   3668 C  C   . ASP A 1 485 ? 22.562 30.835 37.210  1.00 33.66 ? 485  ASP A C   1 
ATOM   3669 O  O   . ASP A 1 485 ? 22.862 29.768 37.751  1.00 31.83 ? 485  ASP A O   1 
ATOM   3670 C  CB  . ASP A 1 485 ? 22.331 33.018 38.329  1.00 31.64 ? 485  ASP A CB  1 
ATOM   3671 C  CG  . ASP A 1 485 ? 21.509 34.122 38.938  1.00 30.19 ? 485  ASP A CG  1 
ATOM   3672 O  OD1 . ASP A 1 485 ? 20.307 34.183 38.705  1.00 34.26 ? 485  ASP A OD1 1 
ATOM   3673 O  OD2 . ASP A 1 485 ? 22.056 34.900 39.706  1.00 28.51 ? 485  ASP A OD2 1 
ATOM   3674 N  N   . PHE A 1 486 ? 23.046 31.266 36.057  1.00 35.68 ? 486  PHE A N   1 
ATOM   3675 C  CA  . PHE A 1 486 ? 23.937 30.514 35.194  1.00 36.07 ? 486  PHE A CA  1 
ATOM   3676 C  C   . PHE A 1 486 ? 25.379 30.944 35.235  1.00 35.02 ? 486  PHE A C   1 
ATOM   3677 O  O   . PHE A 1 486 ? 25.646 32.149 35.156  1.00 36.34 ? 486  PHE A O   1 
ATOM   3678 C  CB  . PHE A 1 486 ? 23.488 30.627 33.743  1.00 35.64 ? 486  PHE A CB  1 
ATOM   3679 C  CG  . PHE A 1 486 ? 22.305 29.733 33.509  1.00 38.88 ? 486  PHE A CG  1 
ATOM   3680 C  CD1 . PHE A 1 486 ? 21.035 30.151 33.847  1.00 40.39 ? 486  PHE A CD1 1 
ATOM   3681 C  CD2 . PHE A 1 486 ? 22.530 28.478 33.000  1.00 39.34 ? 486  PHE A CD2 1 
ATOM   3682 C  CE1 . PHE A 1 486 ? 19.985 29.274 33.671  1.00 42.04 ? 486  PHE A CE1 1 
ATOM   3683 C  CE2 . PHE A 1 486 ? 21.478 27.611 32.826  1.00 41.23 ? 486  PHE A CE2 1 
ATOM   3684 C  CZ  . PHE A 1 486 ? 20.205 28.010 33.164  1.00 41.13 ? 486  PHE A CZ  1 
ATOM   3685 N  N   . LEU A 1 487 ? 26.298 29.986 35.266  1.00 32.49 ? 487  LEU A N   1 
ATOM   3686 C  CA  . LEU A 1 487 ? 27.704 30.281 35.099  1.00 31.67 ? 487  LEU A CA  1 
ATOM   3687 C  C   . LEU A 1 487 ? 28.032 29.888 33.657  1.00 32.19 ? 487  LEU A C   1 
ATOM   3688 O  O   . LEU A 1 487 ? 27.209 29.291 32.953  1.00 30.59 ? 487  LEU A O   1 
ATOM   3689 C  CB  . LEU A 1 487 ? 28.533 29.468 36.066  1.00 29.75 ? 487  LEU A CB  1 
ATOM   3690 C  CG  . LEU A 1 487 ? 29.023 29.990 37.412  1.00 29.93 ? 487  LEU A CG  1 
ATOM   3691 C  CD1 . LEU A 1 487 ? 28.711 31.460 37.608  1.00 25.87 ? 487  LEU A CD1 1 
ATOM   3692 C  CD2 . LEU A 1 487 ? 28.436 29.084 38.461  1.00 27.93 ? 487  LEU A CD2 1 
ATOM   3693 N  N   . THR A 1 488 ? 29.163 30.333 33.116  1.00 34.31 ? 488  THR A N   1 
ATOM   3694 C  CA  . THR A 1 488 ? 29.545 29.995 31.757  1.00 35.56 ? 488  THR A CA  1 
ATOM   3695 C  C   . THR A 1 488 ? 30.793 29.112 31.890  1.00 35.04 ? 488  THR A C   1 
ATOM   3696 O  O   . THR A 1 488 ? 31.778 29.578 32.473  1.00 35.42 ? 488  THR A O   1 
ATOM   3697 C  CB  . THR A 1 488 ? 29.837 31.325 31.014  1.00 36.55 ? 488  THR A CB  1 
ATOM   3698 O  OG1 . THR A 1 488 ? 28.732 32.247 31.185  1.00 40.63 ? 488  THR A OG1 1 
ATOM   3699 C  CG2 . THR A 1 488 ? 30.070 31.062 29.560  1.00 35.56 ? 488  THR A CG2 1 
ATOM   3700 N  N   . GLY A 1 489 ? 30.802 27.858 31.467  1.00 34.60 ? 489  GLY A N   1 
ATOM   3701 C  CA  . GLY A 1 489 ? 31.991 27.042 31.525  1.00 38.09 ? 489  GLY A CA  1 
ATOM   3702 C  C   . GLY A 1 489 ? 33.033 27.498 30.497  1.00 40.37 ? 489  GLY A C   1 
ATOM   3703 O  O   . GLY A 1 489 ? 32.851 28.402 29.659  1.00 36.95 ? 489  GLY A O   1 
ATOM   3704 N  N   . LYS A 1 490 ? 34.133 26.758 30.561  1.00 41.79 ? 490  LYS A N   1 
ATOM   3705 C  CA  . LYS A 1 490 ? 35.283 26.958 29.703  1.00 45.41 ? 490  LYS A CA  1 
ATOM   3706 C  C   . LYS A 1 490 ? 34.930 26.795 28.215  1.00 46.45 ? 490  LYS A C   1 
ATOM   3707 O  O   . LYS A 1 490 ? 35.314 27.584 27.342  1.00 47.24 ? 490  LYS A O   1 
ATOM   3708 C  CB  . LYS A 1 490 ? 36.339 25.957 30.183  1.00 46.21 ? 490  LYS A CB  1 
ATOM   3709 C  CG  . LYS A 1 490 ? 37.699 26.053 29.518  1.00 49.25 ? 490  LYS A CG  1 
ATOM   3710 C  CD  . LYS A 1 490 ? 38.754 25.327 30.338  1.00 52.72 ? 490  LYS A CD  1 
ATOM   3711 C  CE  . LYS A 1 490 ? 39.600 26.319 31.168  1.00 55.18 ? 490  LYS A CE  1 
ATOM   3712 N  NZ  . LYS A 1 490 ? 38.808 27.227 31.997  1.00 54.99 ? 490  LYS A NZ  1 
ATOM   3713 N  N   . ASP A 1 491 ? 34.110 25.771 28.005  1.00 46.98 ? 491  ASP A N   1 
ATOM   3714 C  CA  . ASP A 1 491 ? 33.580 25.298 26.741  1.00 48.03 ? 491  ASP A CA  1 
ATOM   3715 C  C   . ASP A 1 491 ? 32.576 26.239 26.101  1.00 44.96 ? 491  ASP A C   1 
ATOM   3716 O  O   . ASP A 1 491 ? 32.074 25.938 25.021  1.00 45.59 ? 491  ASP A O   1 
ATOM   3717 C  CB  . ASP A 1 491 ? 32.909 23.963 27.003  1.00 53.19 ? 491  ASP A CB  1 
ATOM   3718 C  CG  . ASP A 1 491 ? 31.663 24.138 27.886  1.00 56.98 ? 491  ASP A CG  1 
ATOM   3719 O  OD1 . ASP A 1 491 ? 31.749 24.461 29.086  1.00 58.60 ? 491  ASP A OD1 1 
ATOM   3720 O  OD2 . ASP A 1 491 ? 30.585 24.007 27.322  1.00 59.78 ? 491  ASP A OD2 1 
ATOM   3721 N  N   . GLY A 1 492 ? 32.207 27.344 26.740  1.00 44.14 ? 492  GLY A N   1 
ATOM   3722 C  CA  . GLY A 1 492 ? 31.238 28.274 26.192  1.00 42.25 ? 492  GLY A CA  1 
ATOM   3723 C  C   . GLY A 1 492 ? 29.808 27.986 26.646  1.00 41.49 ? 492  GLY A C   1 
ATOM   3724 O  O   . GLY A 1 492 ? 28.904 28.786 26.347  1.00 41.56 ? 492  GLY A O   1 
ATOM   3725 N  N   . LYS A 1 493 ? 29.492 26.871 27.311  1.00 40.48 ? 493  LYS A N   1 
ATOM   3726 C  CA  . LYS A 1 493 ? 28.116 26.653 27.726  1.00 39.88 ? 493  LYS A CA  1 
ATOM   3727 C  C   . LYS A 1 493 ? 27.769 27.168 29.119  1.00 38.90 ? 493  LYS A C   1 
ATOM   3728 O  O   . LYS A 1 493 ? 28.555 27.172 30.073  1.00 36.88 ? 493  LYS A O   1 
ATOM   3729 C  CB  . LYS A 1 493 ? 27.781 25.161 27.640  1.00 39.07 ? 493  LYS A CB  1 
ATOM   3730 C  CG  . LYS A 1 493 ? 27.615 24.747 26.186  1.00 40.77 ? 493  LYS A CG  1 
ATOM   3731 C  CD  . LYS A 1 493 ? 27.441 23.244 25.996  1.00 42.15 ? 493  LYS A CD  1 
ATOM   3732 C  CE  . LYS A 1 493 ? 26.133 22.686 26.558  1.00 43.19 ? 493  LYS A CE  1 
ATOM   3733 N  NZ  . LYS A 1 493 ? 25.756 21.475 25.834  1.00 44.57 ? 493  LYS A NZ  1 
ATOM   3734 N  N   . LYS A 1 494 ? 26.534 27.664 29.184  1.00 37.88 ? 494  LYS A N   1 
ATOM   3735 C  CA  . LYS A 1 494 ? 25.892 28.150 30.395  1.00 37.94 ? 494  LYS A CA  1 
ATOM   3736 C  C   . LYS A 1 494 ? 25.462 26.911 31.130  1.00 33.99 ? 494  LYS A C   1 
ATOM   3737 O  O   . LYS A 1 494 ? 25.011 25.939 30.519  1.00 36.47 ? 494  LYS A O   1 
ATOM   3738 C  CB  . LYS A 1 494 ? 24.668 28.977 30.084  1.00 41.66 ? 494  LYS A CB  1 
ATOM   3739 C  CG  . LYS A 1 494 ? 24.953 30.127 29.129  1.00 47.11 ? 494  LYS A CG  1 
ATOM   3740 C  CD  . LYS A 1 494 ? 25.956 31.115 29.715  1.00 52.58 ? 494  LYS A CD  1 
ATOM   3741 C  CE  . LYS A 1 494 ? 25.290 31.924 30.844  1.00 58.29 ? 494  LYS A CE  1 
ATOM   3742 N  NZ  . LYS A 1 494 ? 26.153 32.073 32.011  1.00 61.13 ? 494  LYS A NZ  1 
ATOM   3743 N  N   . PHE A 1 495 ? 25.644 26.915 32.432  1.00 29.58 ? 495  PHE A N   1 
ATOM   3744 C  CA  . PHE A 1 495 ? 25.256 25.752 33.181  1.00 29.15 ? 495  PHE A CA  1 
ATOM   3745 C  C   . PHE A 1 495 ? 24.825 26.278 34.529  1.00 29.42 ? 495  PHE A C   1 
ATOM   3746 O  O   . PHE A 1 495 ? 25.148 27.408 34.938  1.00 26.74 ? 495  PHE A O   1 
ATOM   3747 C  CB  . PHE A 1 495 ? 26.436 24.765 33.336  1.00 30.28 ? 495  PHE A CB  1 
ATOM   3748 C  CG  . PHE A 1 495 ? 27.583 25.152 34.279  1.00 29.42 ? 495  PHE A CG  1 
ATOM   3749 C  CD1 . PHE A 1 495 ? 28.538 26.072 33.864  1.00 27.42 ? 495  PHE A CD1 1 
ATOM   3750 C  CD2 . PHE A 1 495 ? 27.659 24.570 35.550  1.00 26.95 ? 495  PHE A CD2 1 
ATOM   3751 C  CE1 . PHE A 1 495 ? 29.565 26.392 34.738  1.00 26.17 ? 495  PHE A CE1 1 
ATOM   3752 C  CE2 . PHE A 1 495 ? 28.689 24.906 36.401  1.00 25.09 ? 495  PHE A CE2 1 
ATOM   3753 C  CZ  . PHE A 1 495 ? 29.640 25.816 35.999  1.00 26.04 ? 495  PHE A CZ  1 
ATOM   3754 N  N   . LYS A 1 496 ? 24.064 25.428 35.200  1.00 29.94 ? 496  LYS A N   1 
ATOM   3755 C  CA  . LYS A 1 496 ? 23.575 25.748 36.521  1.00 33.92 ? 496  LYS A CA  1 
ATOM   3756 C  C   . LYS A 1 496 ? 24.093 24.754 37.560  1.00 32.92 ? 496  LYS A C   1 
ATOM   3757 O  O   . LYS A 1 496 ? 24.256 23.574 37.242  1.00 34.18 ? 496  LYS A O   1 
ATOM   3758 C  CB  . LYS A 1 496 ? 22.060 25.705 36.532  1.00 37.13 ? 496  LYS A CB  1 
ATOM   3759 C  CG  . LYS A 1 496 ? 21.425 27.048 36.791  1.00 42.32 ? 496  LYS A CG  1 
ATOM   3760 C  CD  . LYS A 1 496 ? 20.006 26.854 37.341  1.00 47.99 ? 496  LYS A CD  1 
ATOM   3761 C  CE  . LYS A 1 496 ? 20.007 26.034 38.660  1.00 52.59 ? 496  LYS A CE  1 
ATOM   3762 N  NZ  . LYS A 1 496 ? 20.890 26.607 39.694  1.00 57.51 ? 496  LYS A NZ  1 
ATOM   3763 N  N   . LEU A 1 497 ? 24.499 25.333 38.708  1.00 32.52 ? 497  LEU A N   1 
ATOM   3764 C  CA  . LEU A 1 497 ? 24.730 24.573 39.902  1.00 33.07 ? 497  LEU A CA  1 
ATOM   3765 C  C   . LEU A 1 497 ? 23.536 23.818 40.511  1.00 34.30 ? 497  LEU A C   1 
ATOM   3766 O  O   . LEU A 1 497 ? 22.460 24.381 40.772  1.00 37.60 ? 497  LEU A O   1 
ATOM   3767 C  CB  . LEU A 1 497 ? 25.307 25.550 40.893  1.00 30.14 ? 497  LEU A CB  1 
ATOM   3768 C  CG  . LEU A 1 497 ? 26.815 25.737 41.025  1.00 30.12 ? 497  LEU A CG  1 
ATOM   3769 C  CD1 . LEU A 1 497 ? 27.620 25.278 39.836  1.00 27.67 ? 497  LEU A CD1 1 
ATOM   3770 C  CD2 . LEU A 1 497 ? 26.980 27.196 41.326  1.00 30.01 ? 497  LEU A CD2 1 
ATOM   3771 N  N   . GLU A 1 498 ? 23.687 22.490 40.510  1.00 36.37 ? 498  GLU A N   1 
ATOM   3772 C  CA  . GLU A 1 498 ? 22.792 21.551 41.138  1.00 40.02 ? 498  GLU A CA  1 
ATOM   3773 C  C   . GLU A 1 498 ? 23.050 21.731 42.645  1.00 36.57 ? 498  GLU A C   1 
ATOM   3774 O  O   . GLU A 1 498 ? 24.136 22.059 43.154  1.00 35.77 ? 498  GLU A O   1 
ATOM   3775 C  CB  . GLU A 1 498 ? 23.169 20.162 40.530  1.00 47.33 ? 498  GLU A CB  1 
ATOM   3776 C  CG  . GLU A 1 498 ? 22.954 18.814 41.255  1.00 59.27 ? 498  GLU A CG  1 
ATOM   3777 C  CD  . GLU A 1 498 ? 24.116 17.775 41.232  1.00 65.11 ? 498  GLU A CD  1 
ATOM   3778 O  OE1 . GLU A 1 498 ? 25.241 18.029 41.738  1.00 68.17 ? 498  GLU A OE1 1 
ATOM   3779 O  OE2 . GLU A 1 498 ? 23.903 16.664 40.735  1.00 66.77 ? 498  GLU A OE2 1 
ATOM   3780 N  N   . ALA A 1 499 ? 21.988 21.595 43.405  1.00 33.52 ? 499  ALA A N   1 
ATOM   3781 C  CA  . ALA A 1 499 ? 22.062 21.657 44.854  1.00 30.74 ? 499  ALA A CA  1 
ATOM   3782 C  C   . ALA A 1 499 ? 22.983 20.570 45.387  1.00 30.69 ? 499  ALA A C   1 
ATOM   3783 O  O   . ALA A 1 499 ? 22.941 19.431 44.922  1.00 28.44 ? 499  ALA A O   1 
ATOM   3784 C  CB  . ALA A 1 499 ? 20.719 21.417 45.486  1.00 29.33 ? 499  ALA A CB  1 
ATOM   3785 N  N   . PRO A 1 500 ? 23.826 20.870 46.362  1.00 30.34 ? 500  PRO A N   1 
ATOM   3786 C  CA  . PRO A 1 500 ? 24.788 19.920 46.863  1.00 32.36 ? 500  PRO A CA  1 
ATOM   3787 C  C   . PRO A 1 500 ? 24.121 18.828 47.667  1.00 34.51 ? 500  PRO A C   1 
ATOM   3788 O  O   . PRO A 1 500 ? 23.169 19.050 48.430  1.00 36.26 ? 500  PRO A O   1 
ATOM   3789 C  CB  . PRO A 1 500 ? 25.742 20.777 47.648  1.00 31.88 ? 500  PRO A CB  1 
ATOM   3790 C  CG  . PRO A 1 500 ? 24.838 21.864 48.191  1.00 31.95 ? 500  PRO A CG  1 
ATOM   3791 C  CD  . PRO A 1 500 ? 23.942 22.167 47.009  1.00 30.81 ? 500  PRO A CD  1 
ATOM   3792 N  N   . ASP A 1 501 ? 24.670 17.642 47.495  1.00 38.83 ? 501  ASP A N   1 
ATOM   3793 C  CA  . ASP A 1 501 ? 24.264 16.495 48.278  1.00 41.24 ? 501  ASP A CA  1 
ATOM   3794 C  C   . ASP A 1 501 ? 25.568 15.891 48.779  1.00 38.48 ? 501  ASP A C   1 
ATOM   3795 O  O   . ASP A 1 501 ? 26.562 15.847 48.039  1.00 40.33 ? 501  ASP A O   1 
ATOM   3796 C  CB  . ASP A 1 501 ? 23.537 15.424 47.451  1.00 47.49 ? 501  ASP A CB  1 
ATOM   3797 C  CG  . ASP A 1 501 ? 23.215 14.186 48.311  1.00 55.35 ? 501  ASP A CG  1 
ATOM   3798 O  OD1 . ASP A 1 501 ? 22.609 14.341 49.390  1.00 56.06 ? 501  ASP A OD1 1 
ATOM   3799 O  OD2 . ASP A 1 501 ? 23.625 13.077 47.926  1.00 58.62 ? 501  ASP A OD2 1 
ATOM   3800 N  N   . ALA A 1 502 ? 25.601 15.437 50.024  1.00 32.18 ? 502  ALA A N   1 
ATOM   3801 C  CA  . ALA A 1 502 ? 26.796 14.822 50.547  1.00 30.70 ? 502  ALA A CA  1 
ATOM   3802 C  C   . ALA A 1 502 ? 26.478 13.922 51.724  1.00 28.90 ? 502  ALA A C   1 
ATOM   3803 O  O   . ALA A 1 502 ? 25.440 14.155 52.326  1.00 29.53 ? 502  ALA A O   1 
ATOM   3804 C  CB  . ALA A 1 502 ? 27.763 15.886 51.017  1.00 30.83 ? 502  ALA A CB  1 
ATOM   3805 N  N   . ASP A 1 503 ? 27.303 12.960 52.152  1.00 27.18 ? 503  ASP A N   1 
ATOM   3806 C  CA  . ASP A 1 503 ? 27.001 12.176 53.327  1.00 25.66 ? 503  ASP A CA  1 
ATOM   3807 C  C   . ASP A 1 503 ? 27.213 13.000 54.598  1.00 24.44 ? 503  ASP A C   1 
ATOM   3808 O  O   . ASP A 1 503 ? 28.103 13.864 54.681  1.00 22.17 ? 503  ASP A O   1 
ATOM   3809 C  CB  . ASP A 1 503 ? 27.894 10.929 53.374  1.00 29.39 ? 503  ASP A CB  1 
ATOM   3810 C  CG  . ASP A 1 503 ? 27.840 9.984  52.178  1.00 32.26 ? 503  ASP A CG  1 
ATOM   3811 O  OD1 . ASP A 1 503 ? 26.831 9.912  51.480  1.00 34.71 ? 503  ASP A OD1 1 
ATOM   3812 O  OD2 . ASP A 1 503 ? 28.819 9.284  51.912  1.00 34.97 ? 503  ASP A OD2 1 
ATOM   3813 N  N   . GLU A 1 504 ? 26.424 12.727 55.641  1.00 22.75 ? 504  GLU A N   1 
ATOM   3814 C  CA  . GLU A 1 504 ? 26.571 13.467 56.887  1.00 25.84 ? 504  GLU A CA  1 
ATOM   3815 C  C   . GLU A 1 504 ? 27.791 13.023 57.662  1.00 25.39 ? 504  GLU A C   1 
ATOM   3816 O  O   . GLU A 1 504 ? 28.465 13.805 58.339  1.00 27.73 ? 504  GLU A O   1 
ATOM   3817 C  CB  . GLU A 1 504 ? 25.333 13.309 57.778  1.00 28.66 ? 504  GLU A CB  1 
ATOM   3818 C  CG  . GLU A 1 504 ? 25.022 11.956 58.433  1.00 34.75 ? 504  GLU A CG  1 
ATOM   3819 C  CD  . GLU A 1 504 ? 23.768 11.931 59.304  1.00 39.06 ? 504  GLU A CD  1 
ATOM   3820 O  OE1 . GLU A 1 504 ? 22.871 12.749 59.167  1.00 40.72 ? 504  GLU A OE1 1 
ATOM   3821 O  OE2 . GLU A 1 504 ? 23.601 11.027 60.116  1.00 42.91 ? 504  GLU A OE2 1 
ATOM   3822 N  N   . LEU A 1 505 ? 28.134 11.742 57.561  1.00 25.15 ? 505  LEU A N   1 
ATOM   3823 C  CA  . LEU A 1 505 ? 29.250 11.162 58.282  1.00 23.20 ? 505  LEU A CA  1 
ATOM   3824 C  C   . LEU A 1 505 ? 30.013 10.284 57.284  1.00 24.39 ? 505  LEU A C   1 
ATOM   3825 O  O   . LEU A 1 505 ? 29.451 9.966  56.226  1.00 22.03 ? 505  LEU A O   1 
ATOM   3826 C  CB  . LEU A 1 505 ? 28.720 10.334 59.469  1.00 22.84 ? 505  LEU A CB  1 
ATOM   3827 C  CG  . LEU A 1 505 ? 28.189 11.098 60.675  1.00 24.25 ? 505  LEU A CG  1 
ATOM   3828 C  CD1 . LEU A 1 505 ? 27.449 10.143 61.613  1.00 24.97 ? 505  LEU A CD1 1 
ATOM   3829 C  CD2 . LEU A 1 505 ? 29.348 11.794 61.372  1.00 23.10 ? 505  LEU A CD2 1 
ATOM   3830 N  N   . PRO A 1 506 ? 31.297 9.904  57.487  1.00 23.76 ? 506  PRO A N   1 
ATOM   3831 C  CA  . PRO A 1 506 ? 32.016 9.052  56.557  1.00 23.62 ? 506  PRO A CA  1 
ATOM   3832 C  C   . PRO A 1 506 ? 31.398 7.670  56.531  1.00 27.49 ? 506  PRO A C   1 
ATOM   3833 O  O   . PRO A 1 506 ? 30.954 7.151  57.571  1.00 25.18 ? 506  PRO A O   1 
ATOM   3834 C  CB  . PRO A 1 506 ? 33.436 9.098  57.062  1.00 23.51 ? 506  PRO A CB  1 
ATOM   3835 C  CG  . PRO A 1 506 ? 33.309 9.395  58.526  1.00 23.21 ? 506  PRO A CG  1 
ATOM   3836 C  CD  . PRO A 1 506 ? 32.161 10.370 58.566  1.00 21.05 ? 506  PRO A CD  1 
ATOM   3837 N  N   . ARG A 1 507 ? 31.304 7.097  55.331  1.00 31.54 ? 507  ARG A N   1 
ATOM   3838 C  CA  . ARG A 1 507 ? 30.778 5.750  55.164  1.00 37.49 ? 507  ARG A CA  1 
ATOM   3839 C  C   . ARG A 1 507 ? 31.702 4.775  55.855  1.00 36.61 ? 507  ARG A C   1 
ATOM   3840 O  O   . ARG A 1 507 ? 31.277 3.901  56.627  1.00 37.48 ? 507  ARG A O   1 
ATOM   3841 C  CB  . ARG A 1 507 ? 30.669 5.405  53.692  1.00 44.27 ? 507  ARG A CB  1 
ATOM   3842 C  CG  . ARG A 1 507 ? 29.303 5.797  53.132  1.00 53.42 ? 507  ARG A CG  1 
ATOM   3843 C  CD  . ARG A 1 507 ? 29.379 5.713  51.619  1.00 59.99 ? 507  ARG A CD  1 
ATOM   3844 N  NE  . ARG A 1 507 ? 28.111 5.344  51.001  1.00 66.78 ? 507  ARG A NE  1 
ATOM   3845 C  CZ  . ARG A 1 507 ? 27.372 6.228  50.303  1.00 69.46 ? 507  ARG A CZ  1 
ATOM   3846 N  NH1 . ARG A 1 507 ? 27.754 7.529  50.175  1.00 71.50 ? 507  ARG A NH1 1 
ATOM   3847 N  NH2 . ARG A 1 507 ? 26.236 5.780  49.752  1.00 70.15 ? 507  ARG A NH2 1 
ATOM   3848 N  N   . ALA A 1 508 ? 32.992 4.991  55.643  1.00 34.68 ? 508  ALA A N   1 
ATOM   3849 C  CA  . ALA A 1 508 ? 33.948 4.219  56.392  1.00 37.96 ? 508  ALA A CA  1 
ATOM   3850 C  C   . ALA A 1 508 ? 34.068 4.905  57.752  1.00 40.00 ? 508  ALA A C   1 
ATOM   3851 O  O   . ALA A 1 508 ? 33.364 5.890  58.053  1.00 42.11 ? 508  ALA A O   1 
ATOM   3852 C  CB  . ALA A 1 508 ? 35.276 4.238  55.672  1.00 38.29 ? 508  ALA A CB  1 
ATOM   3853 N  N   . GLU A 1 509 ? 34.922 4.435  58.645  1.00 39.23 ? 509  GLU A N   1 
ATOM   3854 C  CA  . GLU A 1 509 ? 35.046 5.130  59.905  1.00 40.11 ? 509  GLU A CA  1 
ATOM   3855 C  C   . GLU A 1 509 ? 35.817 6.430  59.730  1.00 34.37 ? 509  GLU A C   1 
ATOM   3856 O  O   . GLU A 1 509 ? 36.276 6.754  58.631  1.00 31.70 ? 509  GLU A O   1 
ATOM   3857 C  CB  . GLU A 1 509 ? 35.692 4.141  60.885  1.00 46.91 ? 509  GLU A CB  1 
ATOM   3858 C  CG  . GLU A 1 509 ? 34.768 2.901  61.090  1.00 58.25 ? 509  GLU A CG  1 
ATOM   3859 C  CD  . GLU A 1 509 ? 33.248 3.202  61.135  1.00 63.70 ? 509  GLU A CD  1 
ATOM   3860 O  OE1 . GLU A 1 509 ? 32.758 3.799  62.102  1.00 65.80 ? 509  GLU A OE1 1 
ATOM   3861 O  OE2 . GLU A 1 509 ? 32.537 2.920  60.150  1.00 66.79 ? 509  GLU A OE2 1 
ATOM   3862 N  N   . PHE A 1 510 ? 35.877 7.268  60.737  1.00 29.57 ? 510  PHE A N   1 
ATOM   3863 C  CA  . PHE A 1 510 ? 36.658 8.484  60.638  1.00 29.11 ? 510  PHE A CA  1 
ATOM   3864 C  C   . PHE A 1 510 ? 38.130 8.133  60.685  1.00 30.57 ? 510  PHE A C   1 
ATOM   3865 O  O   . PHE A 1 510 ? 38.469 7.144  61.340  1.00 32.13 ? 510  PHE A O   1 
ATOM   3866 C  CB  . PHE A 1 510 ? 36.370 9.412  61.793  1.00 24.85 ? 510  PHE A CB  1 
ATOM   3867 C  CG  . PHE A 1 510 ? 35.158 10.341 61.665  1.00 24.53 ? 510  PHE A CG  1 
ATOM   3868 C  CD1 . PHE A 1 510 ? 35.248 11.493 60.884  1.00 22.11 ? 510  PHE A CD1 1 
ATOM   3869 C  CD2 . PHE A 1 510 ? 34.020 10.097 62.423  1.00 20.98 ? 510  PHE A CD2 1 
ATOM   3870 C  CE1 . PHE A 1 510 ? 34.206 12.397 60.890  1.00 22.02 ? 510  PHE A CE1 1 
ATOM   3871 C  CE2 . PHE A 1 510 ? 32.986 11.011 62.420  1.00 21.21 ? 510  PHE A CE2 1 
ATOM   3872 C  CZ  . PHE A 1 510 ? 33.083 12.155 61.659  1.00 20.37 ? 510  PHE A CZ  1 
ATOM   3873 N  N   . ASP A 1 511 ? 39.017 8.825  59.968  1.00 32.05 ? 511  ASP A N   1 
ATOM   3874 C  CA  . ASP A 1 511 ? 40.442 8.651  60.191  1.00 29.75 ? 511  ASP A CA  1 
ATOM   3875 C  C   . ASP A 1 511 ? 40.776 9.659  61.307  1.00 29.16 ? 511  ASP A C   1 
ATOM   3876 O  O   . ASP A 1 511 ? 40.483 10.861 61.252  1.00 28.71 ? 511  ASP A O   1 
ATOM   3877 C  CB  . ASP A 1 511 ? 41.210 8.975  58.930  1.00 30.59 ? 511  ASP A CB  1 
ATOM   3878 C  CG  . ASP A 1 511 ? 42.710 8.661  59.005  1.00 33.58 ? 511  ASP A CG  1 
ATOM   3879 O  OD1 . ASP A 1 511 ? 43.370 8.888  60.032  1.00 31.67 ? 511  ASP A OD1 1 
ATOM   3880 O  OD2 . ASP A 1 511 ? 43.219 8.183  57.991  1.00 34.73 ? 511  ASP A OD2 1 
ATOM   3881 N  N   . PRO A 1 512 ? 41.319 9.223  62.434  1.00 30.89 ? 512  PRO A N   1 
ATOM   3882 C  CA  . PRO A 1 512 ? 41.601 10.085 63.561  1.00 31.38 ? 512  PRO A CA  1 
ATOM   3883 C  C   . PRO A 1 512 ? 42.717 11.080 63.359  1.00 31.67 ? 512  PRO A C   1 
ATOM   3884 O  O   . PRO A 1 512 ? 42.746 12.029 64.140  1.00 32.82 ? 512  PRO A O   1 
ATOM   3885 C  CB  . PRO A 1 512 ? 41.867 9.121  64.677  1.00 34.53 ? 512  PRO A CB  1 
ATOM   3886 C  CG  . PRO A 1 512 ? 42.530 7.960  63.973  1.00 33.74 ? 512  PRO A CG  1 
ATOM   3887 C  CD  . PRO A 1 512 ? 41.650 7.833  62.740  1.00 31.98 ? 512  PRO A CD  1 
ATOM   3888 N  N   . GLY A 1 513 ? 43.576 10.892 62.345  1.00 32.48 ? 513  GLY A N   1 
ATOM   3889 C  CA  . GLY A 1 513 ? 44.681 11.801 62.071  1.00 35.43 ? 513  GLY A CA  1 
ATOM   3890 C  C   . GLY A 1 513 ? 45.820 11.620 63.063  1.00 36.96 ? 513  GLY A C   1 
ATOM   3891 O  O   . GLY A 1 513 ? 45.929 10.558 63.684  1.00 35.87 ? 513  GLY A O   1 
ATOM   3892 N  N   . GLN A 1 514 ? 46.715 12.600 63.230  1.00 39.21 ? 514  GLN A N   1 
ATOM   3893 C  CA  . GLN A 1 514 ? 47.788 12.431 64.191  1.00 43.00 ? 514  GLN A CA  1 
ATOM   3894 C  C   . GLN A 1 514 ? 47.361 12.704 65.625  1.00 41.94 ? 514  GLN A C   1 
ATOM   3895 O  O   . GLN A 1 514 ? 46.385 13.398 65.928  1.00 40.10 ? 514  GLN A O   1 
ATOM   3896 C  CB  . GLN A 1 514 ? 49.019 13.313 63.783  1.00 48.95 ? 514  GLN A CB  1 
ATOM   3897 C  CG  . GLN A 1 514 ? 48.886 14.791 63.404  1.00 58.85 ? 514  GLN A CG  1 
ATOM   3898 C  CD  . GLN A 1 514 ? 49.281 15.839 64.455  1.00 64.63 ? 514  GLN A CD  1 
ATOM   3899 O  OE1 . GLN A 1 514 ? 49.261 17.061 64.183  1.00 67.30 ? 514  GLN A OE1 1 
ATOM   3900 N  NE2 . GLN A 1 514 ? 49.680 15.418 65.665  1.00 66.58 ? 514  GLN A NE2 1 
ATOM   3901 N  N   . ASP A 1 515 ? 48.107 12.051 66.517  1.00 42.91 ? 515  ASP A N   1 
ATOM   3902 C  CA  . ASP A 1 515 ? 47.967 12.114 67.967  1.00 44.44 ? 515  ASP A CA  1 
ATOM   3903 C  C   . ASP A 1 515 ? 48.029 13.565 68.446  1.00 40.89 ? 515  ASP A C   1 
ATOM   3904 O  O   . ASP A 1 515 ? 48.982 14.298 68.123  1.00 42.72 ? 515  ASP A O   1 
ATOM   3905 C  CB  . ASP A 1 515 ? 49.117 11.314 68.608  1.00 55.22 ? 515  ASP A CB  1 
ATOM   3906 C  CG  . ASP A 1 515 ? 50.538 11.925 68.386  1.00 63.55 ? 515  ASP A CG  1 
ATOM   3907 O  OD1 . ASP A 1 515 ? 51.004 12.007 67.228  1.00 65.35 ? 515  ASP A OD1 1 
ATOM   3908 O  OD2 . ASP A 1 515 ? 51.160 12.367 69.377  1.00 66.21 ? 515  ASP A OD2 1 
ATOM   3909 N  N   . THR A 1 516 ? 47.109 14.098 69.237  1.00 33.46 ? 516  THR A N   1 
ATOM   3910 C  CA  . THR A 1 516 ? 47.265 15.506 69.631  1.00 28.63 ? 516  THR A CA  1 
ATOM   3911 C  C   . THR A 1 516 ? 46.856 15.760 71.043  1.00 22.84 ? 516  THR A C   1 
ATOM   3912 O  O   . THR A 1 516 ? 47.073 16.843 71.560  1.00 24.24 ? 516  THR A O   1 
ATOM   3913 C  CB  . THR A 1 516 ? 46.472 16.423 68.667  1.00 29.59 ? 516  THR A CB  1 
ATOM   3914 O  OG1 . THR A 1 516 ? 45.343 15.654 68.260  1.00 36.44 ? 516  THR A OG1 1 
ATOM   3915 C  CG2 . THR A 1 516 ? 47.252 16.876 67.433  1.00 29.56 ? 516  THR A CG2 1 
ATOM   3916 N  N   . TYR A 1 517 ? 46.343 14.749 71.728  1.00 18.86 ? 517  TYR A N   1 
ATOM   3917 C  CA  . TYR A 1 517 ? 45.946 14.901 73.113  1.00 16.68 ? 517  TYR A CA  1 
ATOM   3918 C  C   . TYR A 1 517 ? 47.104 14.548 74.020  1.00 15.75 ? 517  TYR A C   1 
ATOM   3919 O  O   . TYR A 1 517 ? 47.851 13.613 73.759  1.00 17.96 ? 517  TYR A O   1 
ATOM   3920 C  CB  . TYR A 1 517 ? 44.763 13.983 73.428  1.00 10.46 ? 517  TYR A CB  1 
ATOM   3921 C  CG  . TYR A 1 517 ? 44.352 14.025 74.882  1.00 9.86  ? 517  TYR A CG  1 
ATOM   3922 C  CD1 . TYR A 1 517 ? 43.760 15.172 75.327  1.00 9.83  ? 517  TYR A CD1 1 
ATOM   3923 C  CD2 . TYR A 1 517 ? 44.566 12.936 75.702  1.00 7.17  ? 517  TYR A CD2 1 
ATOM   3924 C  CE1 . TYR A 1 517 ? 43.339 15.260 76.623  1.00 11.16 ? 517  TYR A CE1 1 
ATOM   3925 C  CE2 . TYR A 1 517 ? 44.150 13.017 76.995  1.00 8.50  ? 517  TYR A CE2 1 
ATOM   3926 C  CZ  . TYR A 1 517 ? 43.561 14.172 77.416  1.00 11.34 ? 517  TYR A CZ  1 
ATOM   3927 O  OH  . TYR A 1 517 ? 43.227 14.287 78.716  1.00 13.42 ? 517  TYR A OH  1 
ATOM   3928 N  N   . GLN A 1 518 ? 47.236 15.232 75.125  1.00 19.15 ? 518  GLN A N   1 
ATOM   3929 C  CA  . GLN A 1 518 ? 48.279 14.987 76.076  1.00 21.14 ? 518  GLN A CA  1 
ATOM   3930 C  C   . GLN A 1 518 ? 47.594 14.850 77.419  1.00 18.79 ? 518  GLN A C   1 
ATOM   3931 O  O   . GLN A 1 518 ? 47.090 15.841 77.975  1.00 17.76 ? 518  GLN A O   1 
ATOM   3932 C  CB  . GLN A 1 518 ? 49.199 16.185 75.979  1.00 27.40 ? 518  GLN A CB  1 
ATOM   3933 C  CG  . GLN A 1 518 ? 50.464 16.256 76.814  1.00 37.08 ? 518  GLN A CG  1 
ATOM   3934 C  CD  . GLN A 1 518 ? 51.441 17.280 76.198  1.00 43.63 ? 518  GLN A CD  1 
ATOM   3935 O  OE1 . GLN A 1 518 ? 51.829 17.158 75.006  1.00 46.21 ? 518  GLN A OE1 1 
ATOM   3936 N  NE2 . GLN A 1 518 ? 51.857 18.313 76.945  1.00 42.76 ? 518  GLN A NE2 1 
ATOM   3937 N  N   . HIS A 1 519 ? 47.552 13.629 77.951  1.00 18.34 ? 519  HIS A N   1 
ATOM   3938 C  CA  . HIS A 1 519 ? 46.932 13.367 79.239  1.00 22.49 ? 519  HIS A CA  1 
ATOM   3939 C  C   . HIS A 1 519 ? 47.787 13.939 80.380  1.00 25.79 ? 519  HIS A C   1 
ATOM   3940 O  O   . HIS A 1 519 ? 49.016 13.952 80.221  1.00 24.40 ? 519  HIS A O   1 
ATOM   3941 C  CB  . HIS A 1 519 ? 46.706 11.819 79.434  1.00 28.98 ? 519  HIS A CB  1 
ATOM   3942 C  CG  . HIS A 1 519 ? 45.545 11.542 80.410  1.00 37.03 ? 519  HIS A CG  1 
ATOM   3943 N  ND1 . HIS A 1 519 ? 45.504 10.961 81.630  1.00 40.76 ? 519  HIS A ND1 1 
ATOM   3944 C  CD2 . HIS A 1 519 ? 44.250 12.022 80.182  1.00 38.27 ? 519  HIS A CD2 1 
ATOM   3945 C  CE1 . HIS A 1 519 ? 44.274 11.103 82.123  1.00 41.45 ? 519  HIS A CE1 1 
ATOM   3946 N  NE2 . HIS A 1 519 ? 43.537 11.741 81.243  1.00 39.77 ? 519  HIS A NE2 1 
ATOM   3947 N  N   . PRO A 1 520 ? 47.254 14.483 81.505  1.00 23.94 ? 520  PRO A N   1 
ATOM   3948 C  CA  . PRO A 1 520 ? 48.046 14.854 82.660  1.00 26.32 ? 520  PRO A CA  1 
ATOM   3949 C  C   . PRO A 1 520 ? 48.774 13.652 83.279  1.00 31.16 ? 520  PRO A C   1 
ATOM   3950 O  O   . PRO A 1 520 ? 48.202 12.561 83.348  1.00 30.52 ? 520  PRO A O   1 
ATOM   3951 C  CB  . PRO A 1 520 ? 47.041 15.537 83.586  1.00 24.72 ? 520  PRO A CB  1 
ATOM   3952 C  CG  . PRO A 1 520 ? 45.713 14.968 83.192  1.00 22.61 ? 520  PRO A CG  1 
ATOM   3953 C  CD  . PRO A 1 520 ? 45.871 14.908 81.687  1.00 23.33 ? 520  PRO A CD  1 
ATOM   3954 N  N   . PRO A 1 521 ? 50.025 13.773 83.740  1.00 35.54 ? 521  PRO A N   1 
ATOM   3955 C  CA  . PRO A 1 521 ? 50.699 12.766 84.544  1.00 39.46 ? 521  PRO A CA  1 
ATOM   3956 C  C   . PRO A 1 521 ? 49.806 12.670 85.753  1.00 43.39 ? 521  PRO A C   1 
ATOM   3957 O  O   . PRO A 1 521 ? 49.565 13.686 86.429  1.00 43.92 ? 521  PRO A O   1 
ATOM   3958 C  CB  . PRO A 1 521 ? 52.051 13.377 84.817  1.00 37.95 ? 521  PRO A CB  1 
ATOM   3959 C  CG  . PRO A 1 521 ? 51.822 14.888 84.793  1.00 37.41 ? 521  PRO A CG  1 
ATOM   3960 C  CD  . PRO A 1 521 ? 50.880 14.958 83.590  1.00 36.69 ? 521  PRO A CD  1 
ATOM   3961 N  N   . LYS A 1 522 ? 49.172 11.559 86.034  1.00 52.76 ? 522  LYS A N   1 
ATOM   3962 C  CA  . LYS A 1 522 ? 48.390 11.533 87.261  1.00 62.85 ? 522  LYS A CA  1 
ATOM   3963 C  C   . LYS A 1 522 ? 49.038 10.542 88.218  1.00 66.72 ? 522  LYS A C   1 
ATOM   3964 O  O   . LYS A 1 522 ? 48.500 9.629  88.856  1.00 68.71 ? 522  LYS A O   1 
ATOM   3965 C  CB  . LYS A 1 522 ? 46.907 11.243 86.864  1.00 64.25 ? 522  LYS A CB  1 
ATOM   3966 C  CG  . LYS A 1 522 ? 46.226 12.554 86.346  1.00 64.30 ? 522  LYS A CG  1 
ATOM   3967 C  CD  . LYS A 1 522 ? 45.903 13.693 87.388  1.00 64.95 ? 522  LYS A CD  1 
ATOM   3968 C  CE  . LYS A 1 522 ? 46.998 14.578 88.113  1.00 65.62 ? 522  LYS A CE  1 
ATOM   3969 N  NZ  . LYS A 1 522 ? 47.803 15.495 87.278  1.00 62.67 ? 522  LYS A NZ  1 
ATOM   3970 N  N   . ASP A 1 523 ? 50.248 11.079 88.371  1.00 70.03 ? 523  ASP A N   1 
ATOM   3971 C  CA  . ASP A 1 523 ? 51.405 10.529 89.040  1.00 73.85 ? 523  ASP A CA  1 
ATOM   3972 C  C   . ASP A 1 523 ? 52.219 11.819 89.210  1.00 74.05 ? 523  ASP A C   1 
ATOM   3973 O  O   . ASP A 1 523 ? 51.699 12.689 89.908  1.00 73.94 ? 523  ASP A O   1 
ATOM   3974 C  CB  . ASP A 1 523 ? 52.062 9.467  88.101  1.00 75.55 ? 523  ASP A CB  1 
ATOM   3975 C  CG  . ASP A 1 523 ? 52.194 9.842  86.623  1.00 76.47 ? 523  ASP A CG  1 
ATOM   3976 O  OD1 . ASP A 1 523 ? 51.252 9.661  85.851  1.00 76.25 ? 523  ASP A OD1 1 
ATOM   3977 O  OD2 . ASP A 1 523 ? 53.239 10.362 86.254  1.00 77.53 ? 523  ASP A OD2 1 
ATOM   3978 N  N   . SER A 1 524 ? 53.358 12.056 88.544  1.00 75.37 ? 524  SER A N   1 
ATOM   3979 C  CA  . SER A 1 524 ? 54.185 13.261 88.598  1.00 76.54 ? 524  SER A CA  1 
ATOM   3980 C  C   . SER A 1 524 ? 53.596 14.589 89.083  1.00 76.88 ? 524  SER A C   1 
ATOM   3981 O  O   . SER A 1 524 ? 53.834 14.945 90.236  1.00 79.39 ? 524  SER A O   1 
ATOM   3982 C  CB  . SER A 1 524 ? 54.784 13.491 87.207  1.00 77.64 ? 524  SER A CB  1 
ATOM   3983 O  OG  . SER A 1 524 ? 55.447 12.358 86.642  1.00 79.35 ? 524  SER A OG  1 
ATOM   3984 N  N   . SER A 1 525 ? 52.909 15.412 88.271  1.00 76.30 ? 525  SER A N   1 
ATOM   3985 C  CA  . SER A 1 525 ? 52.338 16.690 88.680  1.00 75.58 ? 525  SER A CA  1 
ATOM   3986 C  C   . SER A 1 525 ? 53.164 17.673 89.534  1.00 74.89 ? 525  SER A C   1 
ATOM   3987 O  O   . SER A 1 525 ? 52.703 18.709 90.049  1.00 76.02 ? 525  SER A O   1 
ATOM   3988 C  CB  . SER A 1 525 ? 51.036 16.348 89.356  1.00 76.02 ? 525  SER A CB  1 
ATOM   3989 O  OG  . SER A 1 525 ? 50.027 15.767 88.522  1.00 78.42 ? 525  SER A OG  1 
ATOM   3990 N  N   . GLY A 1 526 ? 54.470 17.424 89.625  1.00 74.26 ? 526  GLY A N   1 
ATOM   3991 C  CA  . GLY A 1 526 ? 55.387 18.296 90.339  1.00 72.72 ? 526  GLY A CA  1 
ATOM   3992 C  C   . GLY A 1 526 ? 56.136 19.204 89.384  1.00 70.18 ? 526  GLY A C   1 
ATOM   3993 O  O   . GLY A 1 526 ? 57.338 19.464 89.520  1.00 71.09 ? 526  GLY A O   1 
ATOM   3994 N  N   . GLN A 1 527 ? 55.388 19.609 88.361  1.00 65.73 ? 527  GLN A N   1 
ATOM   3995 C  CA  . GLN A 1 527 ? 55.852 20.600 87.440  1.00 62.32 ? 527  GLN A CA  1 
ATOM   3996 C  C   . GLN A 1 527 ? 55.893 21.920 88.202  1.00 59.34 ? 527  GLN A C   1 
ATOM   3997 O  O   . GLN A 1 527 ? 55.125 22.145 89.161  1.00 59.41 ? 527  GLN A O   1 
ATOM   3998 C  CB  . GLN A 1 527 ? 54.887 20.713 86.259  1.00 63.48 ? 527  GLN A CB  1 
ATOM   3999 C  CG  . GLN A 1 527 ? 55.070 19.737 85.098  1.00 64.39 ? 527  GLN A CG  1 
ATOM   4000 C  CD  . GLN A 1 527 ? 54.816 18.264 85.408  1.00 66.16 ? 527  GLN A CD  1 
ATOM   4001 O  OE1 . GLN A 1 527 ? 54.378 17.837 86.484  1.00 66.45 ? 527  GLN A OE1 1 
ATOM   4002 N  NE2 . GLN A 1 527 ? 55.104 17.426 84.430  1.00 66.71 ? 527  GLN A NE2 1 
ATOM   4003 N  N   . ARG A 1 528 ? 56.857 22.753 87.831  1.00 55.44 ? 528  ARG A N   1 
ATOM   4004 C  CA  . ARG A 1 528 ? 56.882 24.127 88.277  1.00 52.03 ? 528  ARG A CA  1 
ATOM   4005 C  C   . ARG A 1 528 ? 56.307 24.865 87.081  1.00 46.28 ? 528  ARG A C   1 
ATOM   4006 O  O   . ARG A 1 528 ? 56.630 24.555 85.926  1.00 45.14 ? 528  ARG A O   1 
ATOM   4007 C  CB  . ARG A 1 528 ? 58.303 24.628 88.530  1.00 55.35 ? 528  ARG A CB  1 
ATOM   4008 C  CG  . ARG A 1 528 ? 58.771 24.240 89.912  1.00 58.94 ? 528  ARG A CG  1 
ATOM   4009 C  CD  . ARG A 1 528 ? 60.237 24.592 90.059  1.00 61.87 ? 528  ARG A CD  1 
ATOM   4010 N  NE  . ARG A 1 528 ? 60.652 24.462 91.444  1.00 64.08 ? 528  ARG A NE  1 
ATOM   4011 C  CZ  . ARG A 1 528 ? 61.830 24.948 91.900  1.00 64.86 ? 528  ARG A CZ  1 
ATOM   4012 N  NH1 . ARG A 1 528 ? 62.734 25.510 91.091  1.00 64.78 ? 528  ARG A NH1 1 
ATOM   4013 N  NH2 . ARG A 1 528 ? 62.104 24.835 93.193  1.00 67.26 ? 528  ARG A NH2 1 
ATOM   4014 N  N   . VAL A 1 529 ? 55.405 25.803 87.284  1.00 38.66 ? 529  VAL A N   1 
ATOM   4015 C  CA  . VAL A 1 529 ? 54.932 26.571 86.153  1.00 34.01 ? 529  VAL A CA  1 
ATOM   4016 C  C   . VAL A 1 529 ? 55.836 27.799 86.153  1.00 32.62 ? 529  VAL A C   1 
ATOM   4017 O  O   . VAL A 1 529 ? 55.871 28.484 87.186  1.00 33.97 ? 529  VAL A O   1 
ATOM   4018 C  CB  . VAL A 1 529 ? 53.458 26.956 86.367  1.00 34.07 ? 529  VAL A CB  1 
ATOM   4019 C  CG1 . VAL A 1 529 ? 52.961 27.679 85.131  1.00 33.74 ? 529  VAL A CG1 1 
ATOM   4020 C  CG2 . VAL A 1 529 ? 52.605 25.721 86.616  1.00 33.96 ? 529  VAL A CG2 1 
ATOM   4021 N  N   . ASP A 1 530 ? 56.573 28.102 85.084  1.00 30.86 ? 530  ASP A N   1 
ATOM   4022 C  CA  . ASP A 1 530 ? 57.406 29.304 85.088  1.00 33.30 ? 530  ASP A CA  1 
ATOM   4023 C  C   . ASP A 1 530 ? 56.817 30.428 84.254  1.00 30.14 ? 530  ASP A C   1 
ATOM   4024 O  O   . ASP A 1 530 ? 56.436 30.275 83.084  1.00 33.73 ? 530  ASP A O   1 
ATOM   4025 C  CB  . ASP A 1 530 ? 58.846 29.071 84.540  1.00 36.99 ? 530  ASP A CB  1 
ATOM   4026 C  CG  . ASP A 1 530 ? 59.773 30.298 84.687  1.00 40.92 ? 530  ASP A CG  1 
ATOM   4027 O  OD1 . ASP A 1 530 ? 59.906 30.862 85.787  1.00 39.72 ? 530  ASP A OD1 1 
ATOM   4028 O  OD2 . ASP A 1 530 ? 60.359 30.707 83.681  1.00 44.47 ? 530  ASP A OD2 1 
ATOM   4029 N  N   . VAL A 1 531 ? 56.693 31.572 84.905  1.00 24.67 ? 531  VAL A N   1 
ATOM   4030 C  CA  . VAL A 1 531 ? 56.279 32.784 84.239  1.00 22.99 ? 531  VAL A CA  1 
ATOM   4031 C  C   . VAL A 1 531 ? 57.454 33.744 84.481  1.00 25.05 ? 531  VAL A C   1 
ATOM   4032 O  O   . VAL A 1 531 ? 57.729 34.219 85.596  1.00 26.66 ? 531  VAL A O   1 
ATOM   4033 C  CB  . VAL A 1 531 ? 54.968 33.308 84.860  1.00 21.84 ? 531  VAL A CB  1 
ATOM   4034 C  CG1 . VAL A 1 531 ? 54.593 34.622 84.208  1.00 20.16 ? 531  VAL A CG1 1 
ATOM   4035 C  CG2 . VAL A 1 531 ? 53.834 32.279 84.672  1.00 21.85 ? 531  VAL A CG2 1 
ATOM   4036 N  N   . SER A 1 532 ? 58.235 34.014 83.453  1.00 23.87 ? 532  SER A N   1 
ATOM   4037 C  CA  . SER A 1 532 ? 59.318 34.982 83.505  1.00 26.72 ? 532  SER A CA  1 
ATOM   4038 C  C   . SER A 1 532 ? 58.787 36.343 83.931  1.00 26.10 ? 532  SER A C   1 
ATOM   4039 O  O   . SER A 1 532 ? 57.844 36.850 83.310  1.00 24.60 ? 532  SER A O   1 
ATOM   4040 C  CB  . SER A 1 532 ? 59.943 35.094 82.141  1.00 27.34 ? 532  SER A CB  1 
ATOM   4041 O  OG  . SER A 1 532 ? 60.955 36.094 82.108  1.00 34.60 ? 532  SER A OG  1 
ATOM   4042 N  N   . PRO A 1 533 ? 59.415 37.008 84.915  1.00 27.89 ? 533  PRO A N   1 
ATOM   4043 C  CA  . PRO A 1 533 ? 59.000 38.311 85.417  1.00 22.44 ? 533  PRO A CA  1 
ATOM   4044 C  C   . PRO A 1 533 ? 59.188 39.432 84.444  1.00 19.37 ? 533  PRO A C   1 
ATOM   4045 O  O   . PRO A 1 533 ? 58.777 40.549 84.726  1.00 23.18 ? 533  PRO A O   1 
ATOM   4046 C  CB  . PRO A 1 533 ? 59.791 38.524 86.683  1.00 24.90 ? 533  PRO A CB  1 
ATOM   4047 C  CG  . PRO A 1 533 ? 61.010 37.635 86.526  1.00 27.59 ? 533  PRO A CG  1 
ATOM   4048 C  CD  . PRO A 1 533 ? 60.451 36.418 85.784  1.00 27.21 ? 533  PRO A CD  1 
ATOM   4049 N  N   . THR A 1 534 ? 59.846 39.212 83.316  1.00 18.83 ? 534  THR A N   1 
ATOM   4050 C  CA  . THR A 1 534 ? 60.029 40.208 82.271  1.00 20.80 ? 534  THR A CA  1 
ATOM   4051 C  C   . THR A 1 534 ? 59.239 39.803 81.040  1.00 19.78 ? 534  THR A C   1 
ATOM   4052 O  O   . THR A 1 534 ? 59.434 40.342 79.947  1.00 19.44 ? 534  THR A O   1 
ATOM   4053 C  CB  . THR A 1 534 ? 61.561 40.334 81.920  1.00 23.99 ? 534  THR A CB  1 
ATOM   4054 O  OG1 . THR A 1 534 ? 62.057 38.994 81.772  1.00 26.21 ? 534  THR A OG1 1 
ATOM   4055 C  CG2 . THR A 1 534 ? 62.380 41.093 82.999  1.00 25.69 ? 534  THR A CG2 1 
ATOM   4056 N  N   . SER A 1 535 ? 58.371 38.772 81.146  1.00 21.53 ? 535  SER A N   1 
ATOM   4057 C  CA  . SER A 1 535 ? 57.570 38.374 80.015  1.00 16.51 ? 535  SER A CA  1 
ATOM   4058 C  C   . SER A 1 535 ? 56.602 39.503 79.658  1.00 13.81 ? 535  SER A C   1 
ATOM   4059 O  O   . SER A 1 535 ? 56.044 40.257 80.457  1.00 11.71 ? 535  SER A O   1 
ATOM   4060 C  CB  . SER A 1 535 ? 56.797 37.084 80.340  1.00 15.55 ? 535  SER A CB  1 
ATOM   4061 O  OG  . SER A 1 535 ? 55.916 36.837 79.248  1.00 17.00 ? 535  SER A OG  1 
ATOM   4062 N  N   . GLN A 1 536 ? 56.518 39.617 78.350  1.00 14.84 ? 536  GLN A N   1 
ATOM   4063 C  CA  . GLN A 1 536 ? 55.562 40.479 77.697  1.00 19.01 ? 536  GLN A CA  1 
ATOM   4064 C  C   . GLN A 1 536 ? 54.265 39.753 77.405  1.00 17.59 ? 536  GLN A C   1 
ATOM   4065 O  O   . GLN A 1 536 ? 53.271 40.399 77.093  1.00 17.30 ? 536  GLN A O   1 
ATOM   4066 C  CB  . GLN A 1 536 ? 56.124 41.032 76.382  1.00 23.24 ? 536  GLN A CB  1 
ATOM   4067 C  CG  . GLN A 1 536 ? 57.127 42.165 76.689  1.00 31.41 ? 536  GLN A CG  1 
ATOM   4068 C  CD  . GLN A 1 536 ? 56.607 43.258 77.658  1.00 36.28 ? 536  GLN A CD  1 
ATOM   4069 O  OE1 . GLN A 1 536 ? 56.759 43.245 78.887  1.00 38.81 ? 536  GLN A OE1 1 
ATOM   4070 N  NE2 . GLN A 1 536 ? 55.933 44.269 77.155  1.00 41.26 ? 536  GLN A NE2 1 
ATOM   4071 N  N   . ARG A 1 537 ? 54.233 38.419 77.503  1.00 19.01 ? 537  ARG A N   1 
ATOM   4072 C  CA  . ARG A 1 537 ? 53.023 37.658 77.187  1.00 16.11 ? 537  ARG A CA  1 
ATOM   4073 C  C   . ARG A 1 537 ? 52.307 37.082 78.383  1.00 12.63 ? 537  ARG A C   1 
ATOM   4074 O  O   . ARG A 1 537 ? 51.096 36.853 78.353  1.00 14.56 ? 537  ARG A O   1 
ATOM   4075 C  CB  . ARG A 1 537 ? 53.384 36.543 76.232  1.00 16.72 ? 537  ARG A CB  1 
ATOM   4076 C  CG  . ARG A 1 537 ? 53.652 37.242 74.910  1.00 19.02 ? 537  ARG A CG  1 
ATOM   4077 C  CD  . ARG A 1 537 ? 53.739 36.311 73.756  1.00 19.22 ? 537  ARG A CD  1 
ATOM   4078 N  NE  . ARG A 1 537 ? 52.429 35.797 73.378  1.00 21.03 ? 537  ARG A NE  1 
ATOM   4079 C  CZ  . ARG A 1 537 ? 52.294 35.010 72.299  1.00 21.76 ? 537  ARG A CZ  1 
ATOM   4080 N  NH1 . ARG A 1 537 ? 53.356 34.800 71.510  1.00 21.45 ? 537  ARG A NH1 1 
ATOM   4081 N  NH2 . ARG A 1 537 ? 51.104 34.477 71.979  1.00 21.22 ? 537  ARG A NH2 1 
ATOM   4082 N  N   . LEU A 1 538 ? 52.993 36.915 79.500  1.00 9.95  ? 538  LEU A N   1 
ATOM   4083 C  CA  . LEU A 1 538 ? 52.420 36.350 80.680  1.00 12.70 ? 538  LEU A CA  1 
ATOM   4084 C  C   . LEU A 1 538 ? 52.793 37.168 81.883  1.00 16.07 ? 538  LEU A C   1 
ATOM   4085 O  O   . LEU A 1 538 ? 53.900 37.715 81.943  1.00 19.50 ? 538  LEU A O   1 
ATOM   4086 C  CB  . LEU A 1 538 ? 52.911 34.933 80.830  1.00 14.25 ? 538  LEU A CB  1 
ATOM   4087 C  CG  . LEU A 1 538 ? 52.355 33.931 79.853  1.00 16.90 ? 538  LEU A CG  1 
ATOM   4088 C  CD1 . LEU A 1 538 ? 53.322 32.769 79.919  1.00 16.68 ? 538  LEU A CD1 1 
ATOM   4089 C  CD2 . LEU A 1 538 ? 50.900 33.540 80.150  1.00 13.95 ? 538  LEU A CD2 1 
ATOM   4090 N  N   . GLN A 1 539 ? 51.870 37.341 82.819  1.00 15.49 ? 539  GLN A N   1 
ATOM   4091 C  CA  . GLN A 1 539 ? 52.164 38.090 84.017  1.00 15.62 ? 539  GLN A CA  1 
ATOM   4092 C  C   . GLN A 1 539 ? 51.275 37.560 85.106  1.00 15.51 ? 539  GLN A C   1 
ATOM   4093 O  O   . GLN A 1 539 ? 50.063 37.450 84.914  1.00 15.96 ? 539  GLN A O   1 
ATOM   4094 C  CB  . GLN A 1 539 ? 51.873 39.580 83.792  1.00 22.92 ? 539  GLN A CB  1 
ATOM   4095 C  CG  . GLN A 1 539 ? 52.037 40.535 84.965  1.00 28.70 ? 539  GLN A CG  1 
ATOM   4096 C  CD  . GLN A 1 539 ? 51.690 41.991 84.634  1.00 33.47 ? 539  GLN A CD  1 
ATOM   4097 O  OE1 . GLN A 1 539 ? 52.646 42.755 84.411  1.00 38.28 ? 539  GLN A OE1 1 
ATOM   4098 N  NE2 . GLN A 1 539 ? 50.438 42.494 84.500  1.00 28.73 ? 539  GLN A NE2 1 
ATOM   4099 N  N   . LEU A 1 540 ? 51.820 37.208 86.268  1.00 14.40 ? 540  LEU A N   1 
ATOM   4100 C  CA  . LEU A 1 540 ? 51.043 36.821 87.430  1.00 16.58 ? 540  LEU A CA  1 
ATOM   4101 C  C   . LEU A 1 540 ? 50.240 38.036 87.883  1.00 18.80 ? 540  LEU A C   1 
ATOM   4102 O  O   . LEU A 1 540 ? 50.560 39.211 87.591  1.00 18.64 ? 540  LEU A O   1 
ATOM   4103 C  CB  . LEU A 1 540 ? 51.967 36.360 88.545  1.00 14.46 ? 540  LEU A CB  1 
ATOM   4104 C  CG  . LEU A 1 540 ? 52.850 35.143 88.278  1.00 16.20 ? 540  LEU A CG  1 
ATOM   4105 C  CD1 . LEU A 1 540 ? 53.703 34.945 89.531  1.00 17.08 ? 540  LEU A CD1 1 
ATOM   4106 C  CD2 . LEU A 1 540 ? 52.037 33.884 88.002  1.00 15.67 ? 540  LEU A CD2 1 
ATOM   4107 N  N   . LEU A 1 541 ? 49.071 37.713 88.434  1.00 19.85 ? 541  LEU A N   1 
ATOM   4108 C  CA  . LEU A 1 541 ? 48.135 38.685 88.913  1.00 17.19 ? 541  LEU A CA  1 
ATOM   4109 C  C   . LEU A 1 541 ? 48.427 39.142 90.326  1.00 18.23 ? 541  LEU A C   1 
ATOM   4110 O  O   . LEU A 1 541 ? 48.772 38.396 91.231  1.00 18.11 ? 541  LEU A O   1 
ATOM   4111 C  CB  . LEU A 1 541 ? 46.748 38.093 88.877  1.00 17.18 ? 541  LEU A CB  1 
ATOM   4112 C  CG  . LEU A 1 541 ? 46.154 37.723 87.516  1.00 20.06 ? 541  LEU A CG  1 
ATOM   4113 C  CD1 . LEU A 1 541 ? 44.846 36.980 87.816  1.00 21.44 ? 541  LEU A CD1 1 
ATOM   4114 C  CD2 . LEU A 1 541 ? 45.915 38.956 86.625  1.00 19.47 ? 541  LEU A CD2 1 
ATOM   4115 N  N   . GLU A 1 542 ? 48.252 40.435 90.451  1.00 18.62 ? 542  GLU A N   1 
ATOM   4116 C  CA  . GLU A 1 542 ? 48.260 41.085 91.727  1.00 19.65 ? 542  GLU A CA  1 
ATOM   4117 C  C   . GLU A 1 542 ? 46.760 41.238 92.082  1.00 17.99 ? 542  GLU A C   1 
ATOM   4118 O  O   . GLU A 1 542 ? 45.959 41.589 91.210  1.00 18.78 ? 542  GLU A O   1 
ATOM   4119 C  CB  . GLU A 1 542 ? 48.997 42.367 91.489  1.00 18.52 ? 542  GLU A CB  1 
ATOM   4120 C  CG  . GLU A 1 542 ? 49.240 43.132 92.735  1.00 23.17 ? 542  GLU A CG  1 
ATOM   4121 C  CD  . GLU A 1 542 ? 50.072 44.395 92.572  1.00 25.70 ? 542  GLU A CD  1 
ATOM   4122 O  OE1 . GLU A 1 542 ? 50.263 44.966 91.489  1.00 26.77 ? 542  GLU A OE1 1 
ATOM   4123 O  OE2 . GLU A 1 542 ? 50.566 44.831 93.596  1.00 25.36 ? 542  GLU A OE2 1 
ATOM   4124 N  N   . PRO A 1 543 ? 46.283 40.896 93.270  1.00 18.53 ? 543  PRO A N   1 
ATOM   4125 C  CA  . PRO A 1 543 ? 44.888 41.066 93.669  1.00 19.90 ? 543  PRO A CA  1 
ATOM   4126 C  C   . PRO A 1 543 ? 44.381 42.499 93.624  1.00 19.72 ? 543  PRO A C   1 
ATOM   4127 O  O   . PRO A 1 543 ? 45.149 43.436 93.853  1.00 21.32 ? 543  PRO A O   1 
ATOM   4128 C  CB  . PRO A 1 543 ? 44.810 40.472 95.058  1.00 18.87 ? 543  PRO A CB  1 
ATOM   4129 C  CG  . PRO A 1 543 ? 46.239 40.538 95.515  1.00 20.35 ? 543  PRO A CG  1 
ATOM   4130 C  CD  . PRO A 1 543 ? 47.025 40.183 94.285  1.00 18.91 ? 543  PRO A CD  1 
ATOM   4131 N  N   . PHE A 1 544 ? 43.114 42.699 93.251  1.00 18.41 ? 544  PHE A N   1 
ATOM   4132 C  CA  . PHE A 1 544 ? 42.473 43.998 93.255  1.00 15.99 ? 544  PHE A CA  1 
ATOM   4133 C  C   . PHE A 1 544 ? 42.206 44.371 94.705  1.00 16.88 ? 544  PHE A C   1 
ATOM   4134 O  O   . PHE A 1 544 ? 42.157 43.554 95.628  1.00 20.48 ? 544  PHE A O   1 
ATOM   4135 C  CB  . PHE A 1 544 ? 41.164 43.905 92.451  1.00 15.09 ? 544  PHE A CB  1 
ATOM   4136 C  CG  . PHE A 1 544 ? 41.356 43.671 90.964  1.00 12.26 ? 544  PHE A CG  1 
ATOM   4137 C  CD1 . PHE A 1 544 ? 42.185 44.501 90.232  1.00 12.35 ? 544  PHE A CD1 1 
ATOM   4138 C  CD2 . PHE A 1 544 ? 40.712 42.626 90.332  1.00 11.58 ? 544  PHE A CD2 1 
ATOM   4139 C  CE1 . PHE A 1 544 ? 42.359 44.274 88.879  1.00 12.65 ? 544  PHE A CE1 1 
ATOM   4140 C  CE2 . PHE A 1 544 ? 40.887 42.405 88.976  1.00 11.05 ? 544  PHE A CE2 1 
ATOM   4141 C  CZ  . PHE A 1 544 ? 41.714 43.225 88.239  1.00 13.57 ? 544  PHE A CZ  1 
ATOM   4142 N  N   . ASP A 1 545 ? 42.051 45.662 94.907  1.00 20.89 ? 545  ASP A N   1 
ATOM   4143 C  CA  . ASP A 1 545 ? 41.736 46.282 96.177  1.00 23.76 ? 545  ASP A CA  1 
ATOM   4144 C  C   . ASP A 1 545 ? 40.347 45.856 96.662  1.00 22.77 ? 545  ASP A C   1 
ATOM   4145 O  O   . ASP A 1 545 ? 39.423 45.666 95.863  1.00 22.28 ? 545  ASP A O   1 
ATOM   4146 C  CB  . ASP A 1 545 ? 41.791 47.844 96.008  1.00 31.25 ? 545  ASP A CB  1 
ATOM   4147 C  CG  . ASP A 1 545 ? 40.904 48.505 94.912  1.00 37.65 ? 545  ASP A CG  1 
ATOM   4148 O  OD1 . ASP A 1 545 ? 40.963 48.133 93.731  1.00 42.45 ? 545  ASP A OD1 1 
ATOM   4149 O  OD2 . ASP A 1 545 ? 40.109 49.407 95.194  1.00 42.21 ? 545  ASP A OD2 1 
ATOM   4150 N  N   . LYS A 1 546 ? 40.207 45.679 97.966  1.00 22.68 ? 546  LYS A N   1 
ATOM   4151 C  CA  . LYS A 1 546 ? 38.948 45.448 98.662  1.00 24.40 ? 546  LYS A CA  1 
ATOM   4152 C  C   . LYS A 1 546 ? 38.153 46.738 98.605  1.00 23.61 ? 546  LYS A C   1 
ATOM   4153 O  O   . LYS A 1 546 ? 38.772 47.805 98.529  1.00 25.30 ? 546  LYS A O   1 
ATOM   4154 C  CB  . LYS A 1 546 ? 39.160 45.144 100.130 1.00 28.21 ? 546  LYS A CB  1 
ATOM   4155 C  CG  . LYS A 1 546 ? 40.089 43.962 100.361 1.00 39.67 ? 546  LYS A CG  1 
ATOM   4156 C  CD  . LYS A 1 546 ? 39.341 42.626 100.438 1.00 44.32 ? 546  LYS A CD  1 
ATOM   4157 C  CE  . LYS A 1 546 ? 40.222 41.366 100.313 1.00 45.72 ? 546  LYS A CE  1 
ATOM   4158 N  NZ  . LYS A 1 546 ? 39.431 40.157 100.562 1.00 48.36 ? 546  LYS A NZ  1 
ATOM   4159 N  N   . TRP A 1 547 ? 36.813 46.723 98.663  1.00 22.69 ? 547  TRP A N   1 
ATOM   4160 C  CA  . TRP A 1 547 ? 36.007 47.944 98.726  1.00 22.49 ? 547  TRP A CA  1 
ATOM   4161 C  C   . TRP A 1 547 ? 36.331 48.703 100.018 1.00 24.65 ? 547  TRP A C   1 
ATOM   4162 O  O   . TRP A 1 547 ? 36.318 48.124 101.106 1.00 26.28 ? 547  TRP A O   1 
ATOM   4163 C  CB  . TRP A 1 547 ? 34.510 47.568 98.707  1.00 20.45 ? 547  TRP A CB  1 
ATOM   4164 C  CG  . TRP A 1 547 ? 33.510 48.718 98.959  1.00 21.14 ? 547  TRP A CG  1 
ATOM   4165 C  CD1 . TRP A 1 547 ? 33.483 49.891 98.232  1.00 21.54 ? 547  TRP A CD1 1 
ATOM   4166 C  CD2 . TRP A 1 547 ? 32.511 48.698 99.911  1.00 23.53 ? 547  TRP A CD2 1 
ATOM   4167 N  NE1 . TRP A 1 547 ? 32.481 50.604 98.713  1.00 18.65 ? 547  TRP A NE1 1 
ATOM   4168 C  CE2 . TRP A 1 547 ? 31.881 49.923 99.705  1.00 23.31 ? 547  TRP A CE2 1 
ATOM   4169 C  CE3 . TRP A 1 547 ? 32.071 47.829 100.889 1.00 23.48 ? 547  TRP A CE3 1 
ATOM   4170 C  CZ2 . TRP A 1 547 ? 30.798 50.288 100.477 1.00 26.44 ? 547  TRP A CZ2 1 
ATOM   4171 C  CZ3 . TRP A 1 547 ? 30.985 48.205 101.660 1.00 26.13 ? 547  TRP A CZ3 1 
ATOM   4172 C  CH2 . TRP A 1 547 ? 30.357 49.418 101.458 1.00 26.24 ? 547  TRP A CH2 1 
ATOM   4173 N  N   . ASP A 1 548 ? 36.507 50.021 99.960  1.00 26.22 ? 548  ASP A N   1 
ATOM   4174 C  CA  . ASP A 1 548 ? 36.882 50.837 101.115 1.00 27.15 ? 548  ASP A CA  1 
ATOM   4175 C  C   . ASP A 1 548 ? 35.801 51.169 102.125 1.00 29.62 ? 548  ASP A C   1 
ATOM   4176 O  O   . ASP A 1 548 ? 36.055 51.912 103.078 1.00 31.89 ? 548  ASP A O   1 
ATOM   4177 C  CB  . ASP A 1 548 ? 37.472 52.174 100.641 1.00 29.33 ? 548  ASP A CB  1 
ATOM   4178 C  CG  . ASP A 1 548 ? 36.601 53.043 99.748  1.00 29.33 ? 548  ASP A CG  1 
ATOM   4179 O  OD1 . ASP A 1 548 ? 35.407 52.821 99.579  1.00 28.95 ? 548  ASP A OD1 1 
ATOM   4180 O  OD2 . ASP A 1 548 ? 37.132 54.017 99.222  1.00 31.04 ? 548  ASP A OD2 1 
ATOM   4181 N  N   . GLY A 1 549 ? 34.565 50.740 101.880 1.00 29.52 ? 549  GLY A N   1 
ATOM   4182 C  CA  . GLY A 1 549 ? 33.446 50.966 102.775 1.00 28.14 ? 549  GLY A CA  1 
ATOM   4183 C  C   . GLY A 1 549 ? 32.717 52.262 102.462 1.00 30.42 ? 549  GLY A C   1 
ATOM   4184 O  O   . GLY A 1 549 ? 31.753 52.631 103.140 1.00 33.60 ? 549  GLY A O   1 
ATOM   4185 N  N   . LYS A 1 550 ? 33.107 53.006 101.429 1.00 32.20 ? 550  LYS A N   1 
ATOM   4186 C  CA  . LYS A 1 550 ? 32.426 54.241 101.137 1.00 32.83 ? 550  LYS A CA  1 
ATOM   4187 C  C   . LYS A 1 550 ? 31.703 54.281 99.827  1.00 32.03 ? 550  LYS A C   1 
ATOM   4188 O  O   . LYS A 1 550 ? 31.939 53.460 98.950  1.00 31.96 ? 550  LYS A O   1 
ATOM   4189 C  CB  . LYS A 1 550 ? 33.434 55.367 101.211 1.00 37.56 ? 550  LYS A CB  1 
ATOM   4190 C  CG  . LYS A 1 550 ? 33.680 55.708 102.693 1.00 44.25 ? 550  LYS A CG  1 
ATOM   4191 C  CD  . LYS A 1 550 ? 35.021 55.288 103.269 1.00 50.08 ? 550  LYS A CD  1 
ATOM   4192 C  CE  . LYS A 1 550 ? 36.152 56.149 102.668 1.00 55.48 ? 550  LYS A CE  1 
ATOM   4193 N  NZ  . LYS A 1 550 ? 36.423 55.872 101.248 1.00 61.10 ? 550  LYS A NZ  1 
ATOM   4194 N  N   . ASP A 1 551 ? 30.830 55.291 99.697  1.00 31.57 ? 551  ASP A N   1 
ATOM   4195 C  CA  . ASP A 1 551 ? 30.103 55.498 98.482  1.00 30.45 ? 551  ASP A CA  1 
ATOM   4196 C  C   . ASP A 1 551 ? 31.094 56.007 97.453  1.00 28.25 ? 551  ASP A C   1 
ATOM   4197 O  O   . ASP A 1 551 ? 32.246 56.346 97.736  1.00 28.90 ? 551  ASP A O   1 
ATOM   4198 C  CB  . ASP A 1 551 ? 28.982 56.512 98.719  1.00 34.06 ? 551  ASP A CB  1 
ATOM   4199 C  CG  . ASP A 1 551 ? 27.820 55.915 99.507  1.00 36.58 ? 551  ASP A CG  1 
ATOM   4200 O  OD1 . ASP A 1 551 ? 27.572 54.713 99.486  1.00 37.57 ? 551  ASP A OD1 1 
ATOM   4201 O  OD2 . ASP A 1 551 ? 27.187 56.606 100.299 1.00 38.65 ? 551  ASP A OD2 1 
ATOM   4202 N  N   . LEU A 1 552 ? 30.708 55.967 96.197  1.00 26.93 ? 552  LEU A N   1 
ATOM   4203 C  CA  . LEU A 1 552 ? 31.584 56.398 95.138  1.00 24.73 ? 552  LEU A CA  1 
ATOM   4204 C  C   . LEU A 1 552 ? 31.236 57.829 94.782  1.00 26.61 ? 552  LEU A C   1 
ATOM   4205 O  O   . LEU A 1 552 ? 30.257 58.018 94.052  1.00 27.90 ? 552  LEU A O   1 
ATOM   4206 C  CB  . LEU A 1 552 ? 31.403 55.488 93.946  1.00 24.18 ? 552  LEU A CB  1 
ATOM   4207 C  CG  . LEU A 1 552 ? 31.599 54.001 94.131  1.00 24.23 ? 552  LEU A CG  1 
ATOM   4208 C  CD1 . LEU A 1 552 ? 31.292 53.317 92.809  1.00 25.47 ? 552  LEU A CD1 1 
ATOM   4209 C  CD2 . LEU A 1 552 ? 33.024 53.693 94.558  1.00 23.86 ? 552  LEU A CD2 1 
ATOM   4210 N  N   . GLU A 1 553 ? 31.921 58.861 95.298  1.00 29.49 ? 553  GLU A N   1 
ATOM   4211 C  CA  . GLU A 1 553 ? 31.605 60.239 94.954  1.00 31.78 ? 553  GLU A CA  1 
ATOM   4212 C  C   . GLU A 1 553 ? 32.446 60.805 93.846  1.00 29.95 ? 553  GLU A C   1 
ATOM   4213 O  O   . GLU A 1 553 ? 33.602 60.428 93.683  1.00 27.98 ? 553  GLU A O   1 
ATOM   4214 C  CB  . GLU A 1 553 ? 31.785 61.257 96.076  1.00 35.82 ? 553  GLU A CB  1 
ATOM   4215 C  CG  . GLU A 1 553 ? 32.330 60.934 97.450  1.00 45.25 ? 553  GLU A CG  1 
ATOM   4216 C  CD  . GLU A 1 553 ? 31.273 60.564 98.473  1.00 51.35 ? 553  GLU A CD  1 
ATOM   4217 O  OE1 . GLU A 1 553 ? 30.129 61.022 98.353  1.00 56.29 ? 553  GLU A OE1 1 
ATOM   4218 O  OE2 . GLU A 1 553 ? 31.615 59.821 99.400  1.00 55.61 ? 553  GLU A OE2 1 
ATOM   4219 N  N   . ASP A 1 554 ? 31.814 61.678 93.061  1.00 30.67 ? 554  ASP A N   1 
ATOM   4220 C  CA  . ASP A 1 554 ? 32.449 62.492 92.052  1.00 32.89 ? 554  ASP A CA  1 
ATOM   4221 C  C   . ASP A 1 554 ? 33.350 61.751 91.115  1.00 31.14 ? 554  ASP A C   1 
ATOM   4222 O  O   . ASP A 1 554 ? 34.536 62.022 90.913  1.00 29.68 ? 554  ASP A O   1 
ATOM   4223 C  CB  . ASP A 1 554 ? 33.217 63.640 92.739  1.00 40.17 ? 554  ASP A CB  1 
ATOM   4224 C  CG  . ASP A 1 554 ? 32.229 64.560 93.453  1.00 46.11 ? 554  ASP A CG  1 
ATOM   4225 O  OD1 . ASP A 1 554 ? 31.334 65.151 92.832  1.00 48.32 ? 554  ASP A OD1 1 
ATOM   4226 O  OD2 . ASP A 1 554 ? 32.226 64.626 94.679  1.00 48.98 ? 554  ASP A OD2 1 
ATOM   4227 N  N   . LEU A 1 555 ? 32.664 60.800 90.508  1.00 26.93 ? 555  LEU A N   1 
ATOM   4228 C  CA  . LEU A 1 555 ? 33.259 59.906 89.550  1.00 23.34 ? 555  LEU A CA  1 
ATOM   4229 C  C   . LEU A 1 555 ? 33.316 60.662 88.237  1.00 19.30 ? 555  LEU A C   1 
ATOM   4230 O  O   . LEU A 1 555 ? 32.408 61.399 87.849  1.00 19.21 ? 555  LEU A O   1 
ATOM   4231 C  CB  . LEU A 1 555 ? 32.387 58.634 89.448  1.00 23.79 ? 555  LEU A CB  1 
ATOM   4232 C  CG  . LEU A 1 555 ? 32.277 57.685 90.667  1.00 24.46 ? 555  LEU A CG  1 
ATOM   4233 C  CD1 . LEU A 1 555 ? 31.165 56.655 90.428  1.00 22.79 ? 555  LEU A CD1 1 
ATOM   4234 C  CD2 . LEU A 1 555 ? 33.600 56.960 90.888  1.00 22.78 ? 555  LEU A CD2 1 
ATOM   4235 N  N   . GLN A 1 556 ? 34.412 60.493 87.553  1.00 16.20 ? 556  GLN A N   1 
ATOM   4236 C  CA  . GLN A 1 556 ? 34.590 61.082 86.254  1.00 15.22 ? 556  GLN A CA  1 
ATOM   4237 C  C   . GLN A 1 556 ? 34.016 60.153 85.192  1.00 15.27 ? 556  GLN A C   1 
ATOM   4238 O  O   . GLN A 1 556 ? 34.193 58.938 85.265  1.00 15.97 ? 556  GLN A O   1 
ATOM   4239 C  CB  . GLN A 1 556 ? 36.082 61.282 86.066  1.00 16.04 ? 556  GLN A CB  1 
ATOM   4240 C  CG  . GLN A 1 556 ? 36.499 61.654 84.657  1.00 17.04 ? 556  GLN A CG  1 
ATOM   4241 C  CD  . GLN A 1 556 ? 36.078 63.046 84.223  1.00 19.51 ? 556  GLN A CD  1 
ATOM   4242 O  OE1 . GLN A 1 556 ? 36.057 63.976 85.023  1.00 19.67 ? 556  GLN A OE1 1 
ATOM   4243 N  NE2 . GLN A 1 556 ? 35.672 63.283 82.972  1.00 20.92 ? 556  GLN A NE2 1 
ATOM   4244 N  N   . ILE A 1 557 ? 33.391 60.641 84.129  1.00 13.71 ? 557  ILE A N   1 
ATOM   4245 C  CA  . ILE A 1 557 ? 32.910 59.764 83.092  1.00 15.06 ? 557  ILE A CA  1 
ATOM   4246 C  C   . ILE A 1 557 ? 34.102 59.582 82.177  1.00 16.78 ? 557  ILE A C   1 
ATOM   4247 O  O   . ILE A 1 557 ? 34.589 60.590 81.664  1.00 16.78 ? 557  ILE A O   1 
ATOM   4248 C  CB  . ILE A 1 557 ? 31.705 60.454 82.411  1.00 14.58 ? 557  ILE A CB  1 
ATOM   4249 C  CG1 . ILE A 1 557 ? 30.533 60.422 83.394  1.00 13.13 ? 557  ILE A CG1 1 
ATOM   4250 C  CG2 . ILE A 1 557 ? 31.338 59.789 81.104  1.00 16.59 ? 557  ILE A CG2 1 
ATOM   4251 C  CD1 . ILE A 1 557 ? 29.393 61.266 82.818  1.00 14.51 ? 557  ILE A CD1 1 
ATOM   4252 N  N   . LEU A 1 558 ? 34.664 58.375 82.030  1.00 14.87 ? 558  LEU A N   1 
ATOM   4253 C  CA  . LEU A 1 558 ? 35.739 58.176 81.073  1.00 14.48 ? 558  LEU A CA  1 
ATOM   4254 C  C   . LEU A 1 558 ? 35.173 58.328 79.664  1.00 16.23 ? 558  LEU A C   1 
ATOM   4255 O  O   . LEU A 1 558 ? 35.801 58.953 78.816  1.00 16.39 ? 558  LEU A O   1 
ATOM   4256 C  CB  . LEU A 1 558 ? 36.381 56.769 81.165  1.00 13.00 ? 558  LEU A CB  1 
ATOM   4257 C  CG  . LEU A 1 558 ? 37.434 56.336 80.120  1.00 12.45 ? 558  LEU A CG  1 
ATOM   4258 C  CD1 . LEU A 1 558 ? 38.704 57.166 80.315  1.00 9.33  ? 558  LEU A CD1 1 
ATOM   4259 C  CD2 . LEU A 1 558 ? 37.762 54.870 80.260  1.00 7.92  ? 558  LEU A CD2 1 
ATOM   4260 N  N   . ILE A 1 559 ? 34.020 57.738 79.363  1.00 14.37 ? 559  ILE A N   1 
ATOM   4261 C  CA  . ILE A 1 559 ? 33.438 57.786 78.038  1.00 14.01 ? 559  ILE A CA  1 
ATOM   4262 C  C   . ILE A 1 559 ? 31.930 57.457 78.198  1.00 15.80 ? 559  ILE A C   1 
ATOM   4263 O  O   . ILE A 1 559 ? 31.523 56.646 79.048  1.00 13.57 ? 559  ILE A O   1 
ATOM   4264 C  CB  . ILE A 1 559 ? 34.212 56.740 77.067  1.00 13.13 ? 559  ILE A CB  1 
ATOM   4265 C  CG1 . ILE A 1 559 ? 33.710 56.920 75.623  1.00 14.51 ? 559  ILE A CG1 1 
ATOM   4266 C  CG2 . ILE A 1 559 ? 34.038 55.301 77.512  1.00 11.83 ? 559  ILE A CG2 1 
ATOM   4267 C  CD1 . ILE A 1 559 ? 34.332 56.051 74.527  1.00 15.49 ? 559  ILE A CD1 1 
ATOM   4268 N  N   . LYS A 1 560 ? 31.098 58.150 77.411  1.00 14.75 ? 560  LYS A N   1 
ATOM   4269 C  CA  . LYS A 1 560 ? 29.695 57.826 77.291  1.00 12.53 ? 560  LYS A CA  1 
ATOM   4270 C  C   . LYS A 1 560 ? 29.624 57.315 75.860  1.00 12.40 ? 560  LYS A C   1 
ATOM   4271 O  O   . LYS A 1 560 ? 29.860 58.029 74.882  1.00 14.85 ? 560  LYS A O   1 
ATOM   4272 C  CB  . LYS A 1 560 ? 28.838 59.071 77.476  1.00 13.06 ? 560  LYS A CB  1 
ATOM   4273 C  CG  . LYS A 1 560 ? 27.351 58.832 77.198  1.00 12.97 ? 560  LYS A CG  1 
ATOM   4274 C  CD  . LYS A 1 560 ? 26.573 60.113 77.460  1.00 14.53 ? 560  LYS A CD  1 
ATOM   4275 C  CE  . LYS A 1 560 ? 25.155 59.876 76.971  1.00 14.80 ? 560  LYS A CE  1 
ATOM   4276 N  NZ  . LYS A 1 560 ? 24.263 60.977 77.262  1.00 11.78 ? 560  LYS A NZ  1 
ATOM   4277 N  N   . VAL A 1 561 ? 29.366 56.027 75.738  1.00 15.78 ? 561  VAL A N   1 
ATOM   4278 C  CA  . VAL A 1 561 ? 29.315 55.325 74.461  1.00 18.12 ? 561  VAL A CA  1 
ATOM   4279 C  C   . VAL A 1 561 ? 27.939 55.440 73.808  1.00 20.37 ? 561  VAL A C   1 
ATOM   4280 O  O   . VAL A 1 561 ? 26.886 55.295 74.433  1.00 19.13 ? 561  VAL A O   1 
ATOM   4281 C  CB  . VAL A 1 561 ? 29.642 53.827 74.672  1.00 17.54 ? 561  VAL A CB  1 
ATOM   4282 C  CG1 . VAL A 1 561 ? 29.740 53.112 73.333  1.00 19.39 ? 561  VAL A CG1 1 
ATOM   4283 C  CG2 . VAL A 1 561 ? 30.935 53.723 75.471  1.00 17.25 ? 561  VAL A CG2 1 
ATOM   4284 N  N   . LYS A 1 562 ? 27.986 55.525 72.501  1.00 21.89 ? 562  LYS A N   1 
ATOM   4285 C  CA  . LYS A 1 562 ? 26.797 55.672 71.718  1.00 25.14 ? 562  LYS A CA  1 
ATOM   4286 C  C   . LYS A 1 562 ? 26.628 54.394 70.952  1.00 23.36 ? 562  LYS A C   1 
ATOM   4287 O  O   . LYS A 1 562 ? 27.523 54.066 70.162  1.00 19.35 ? 562  LYS A O   1 
ATOM   4288 C  CB  . LYS A 1 562 ? 26.988 56.836 70.756  1.00 30.64 ? 562  LYS A CB  1 
ATOM   4289 C  CG  . LYS A 1 562 ? 25.900 57.090 69.721  1.00 37.35 ? 562  LYS A CG  1 
ATOM   4290 C  CD  . LYS A 1 562 ? 26.564 57.360 68.361  1.00 43.02 ? 562  LYS A CD  1 
ATOM   4291 C  CE  . LYS A 1 562 ? 26.428 56.166 67.361  1.00 47.95 ? 562  LYS A CE  1 
ATOM   4292 N  NZ  . LYS A 1 562 ? 27.239 54.976 67.654  1.00 47.74 ? 562  LYS A NZ  1 
ATOM   4293 N  N   . GLY A 1 563 ? 25.480 53.721 71.007  1.00 21.45 ? 563  GLY A N   1 
ATOM   4294 C  CA  . GLY A 1 563 ? 25.288 52.593 70.121  1.00 18.32 ? 563  GLY A CA  1 
ATOM   4295 C  C   . GLY A 1 563 ? 25.863 51.288 70.630  1.00 19.77 ? 563  GLY A C   1 
ATOM   4296 O  O   . GLY A 1 563 ? 26.077 51.049 71.826  1.00 21.02 ? 563  GLY A O   1 
ATOM   4297 N  N   . LYS A 1 564 ? 26.051 50.433 69.620  1.00 20.25 ? 564  LYS A N   1 
ATOM   4298 C  CA  . LYS A 1 564 ? 26.520 49.052 69.795  1.00 23.83 ? 564  LYS A CA  1 
ATOM   4299 C  C   . LYS A 1 564 ? 27.913 49.026 70.387  1.00 22.12 ? 564  LYS A C   1 
ATOM   4300 O  O   . LYS A 1 564 ? 28.815 49.650 69.818  1.00 23.69 ? 564  LYS A O   1 
ATOM   4301 C  CB  . LYS A 1 564 ? 26.533 48.318 68.444  1.00 25.30 ? 564  LYS A CB  1 
ATOM   4302 C  CG  . LYS A 1 564 ? 26.708 46.779 68.455  1.00 28.30 ? 564  LYS A CG  1 
ATOM   4303 C  CD  . LYS A 1 564 ? 26.729 46.275 67.010  1.00 30.73 ? 564  LYS A CD  1 
ATOM   4304 C  CE  . LYS A 1 564 ? 26.690 44.755 66.793  1.00 33.76 ? 564  LYS A CE  1 
ATOM   4305 N  NZ  . LYS A 1 564 ? 25.440 44.139 67.237  1.00 33.62 ? 564  LYS A NZ  1 
ATOM   4306 N  N   . CYS A 1 565 ? 28.084 48.304 71.494  1.00 19.27 ? 565  CYS A N   1 
ATOM   4307 C  CA  . CYS A 1 565 ? 29.365 48.181 72.122  1.00 15.41 ? 565  CYS A CA  1 
ATOM   4308 C  C   . CYS A 1 565 ? 29.509 46.728 72.590  1.00 13.90 ? 565  CYS A C   1 
ATOM   4309 O  O   . CYS A 1 565 ? 29.173 46.297 73.684  1.00 17.94 ? 565  CYS A O   1 
ATOM   4310 C  CB  . CYS A 1 565 ? 29.428 49.157 73.279  1.00 16.75 ? 565  CYS A CB  1 
ATOM   4311 S  SG  . CYS A 1 565 ? 31.118 49.335 73.926  1.00 16.02 ? 565  CYS A SG  1 
ATOM   4312 N  N   . THR A 1 566 ? 30.045 45.979 71.663  1.00 11.33 ? 566  THR A N   1 
ATOM   4313 C  CA  . THR A 1 566 ? 30.435 44.572 71.680  1.00 13.03 ? 566  THR A CA  1 
ATOM   4314 C  C   . THR A 1 566 ? 31.676 44.338 72.578  1.00 16.84 ? 566  THR A C   1 
ATOM   4315 O  O   . THR A 1 566 ? 32.468 45.291 72.670  1.00 15.92 ? 566  THR A O   1 
ATOM   4316 C  CB  . THR A 1 566 ? 30.677 44.402 70.216  1.00 15.93 ? 566  THR A CB  1 
ATOM   4317 O  OG1 . THR A 1 566 ? 29.443 44.329 69.540  1.00 19.57 ? 566  THR A OG1 1 
ATOM   4318 C  CG2 . THR A 1 566 ? 31.541 43.320 69.959  1.00 14.99 ? 566  THR A CG2 1 
ATOM   4319 N  N   . THR A 1 567 ? 32.029 43.131 73.078  1.00 15.28 ? 567  THR A N   1 
ATOM   4320 C  CA  . THR A 1 567 ? 33.306 42.914 73.756  1.00 15.25 ? 567  THR A CA  1 
ATOM   4321 C  C   . THR A 1 567 ? 34.448 43.059 72.741  1.00 16.42 ? 567  THR A C   1 
ATOM   4322 O  O   . THR A 1 567 ? 35.571 43.312 73.152  1.00 18.61 ? 567  THR A O   1 
ATOM   4323 C  CB  . THR A 1 567 ? 33.397 41.527 74.413  1.00 12.66 ? 567  THR A CB  1 
ATOM   4324 O  OG1 . THR A 1 567 ? 33.082 40.556 73.426  1.00 16.49 ? 567  THR A OG1 1 
ATOM   4325 C  CG2 . THR A 1 567 ? 32.570 41.488 75.651  1.00 15.16 ? 567  THR A CG2 1 
ATOM   4326 N  N   . ASP A 1 568 ? 34.295 42.955 71.412  1.00 16.51 ? 568  ASP A N   1 
ATOM   4327 C  CA  . ASP A 1 568 ? 35.343 43.274 70.441  1.00 17.99 ? 568  ASP A CA  1 
ATOM   4328 C  C   . ASP A 1 568 ? 35.552 44.788 70.393  1.00 18.90 ? 568  ASP A C   1 
ATOM   4329 O  O   . ASP A 1 568 ? 36.658 45.281 70.160  1.00 20.94 ? 568  ASP A O   1 
ATOM   4330 C  CB  . ASP A 1 568 ? 34.996 42.679 69.024  1.00 21.78 ? 568  ASP A CB  1 
ATOM   4331 C  CG  . ASP A 1 568 ? 35.261 41.148 68.825  1.00 28.37 ? 568  ASP A CG  1 
ATOM   4332 O  OD1 . ASP A 1 568 ? 36.385 40.646 69.038  1.00 30.26 ? 568  ASP A OD1 1 
ATOM   4333 O  OD2 . ASP A 1 568 ? 34.348 40.412 68.422  1.00 27.60 ? 568  ASP A OD2 1 
ATOM   4334 N  N   . HIS A 1 569 ? 34.581 45.610 70.788  1.00 18.10 ? 569  HIS A N   1 
ATOM   4335 C  CA  . HIS A 1 569 ? 34.788 47.045 70.856  1.00 13.59 ? 569  HIS A CA  1 
ATOM   4336 C  C   . HIS A 1 569 ? 35.534 47.381 72.143  1.00 13.91 ? 569  HIS A C   1 
ATOM   4337 O  O   . HIS A 1 569 ? 36.307 48.357 72.159  1.00 14.16 ? 569  HIS A O   1 
ATOM   4338 C  CB  . HIS A 1 569 ? 33.460 47.849 70.881  1.00 19.01 ? 569  HIS A CB  1 
ATOM   4339 C  CG  . HIS A 1 569 ? 32.702 47.885 69.557  1.00 19.23 ? 569  HIS A CG  1 
ATOM   4340 N  ND1 . HIS A 1 569 ? 31.967 46.954 68.933  1.00 23.20 ? 569  HIS A ND1 1 
ATOM   4341 C  CD2 . HIS A 1 569 ? 32.674 48.978 68.756  1.00 21.51 ? 569  HIS A CD2 1 
ATOM   4342 C  CE1 . HIS A 1 569 ? 31.503 47.432 67.809  1.00 22.70 ? 569  HIS A CE1 1 
ATOM   4343 N  NE2 . HIS A 1 569 ? 31.945 48.650 67.730  1.00 24.32 ? 569  HIS A NE2 1 
ATOM   4344 N  N   . ILE A 1 570 ? 35.232 46.655 73.233  1.00 10.13 ? 570  ILE A N   1 
ATOM   4345 C  CA  . ILE A 1 570 ? 35.818 46.899 74.546  1.00 12.08 ? 570  ILE A CA  1 
ATOM   4346 C  C   . ILE A 1 570 ? 37.249 46.323 74.639  1.00 14.51 ? 570  ILE A C   1 
ATOM   4347 O  O   . ILE A 1 570 ? 38.115 46.980 75.218  1.00 16.02 ? 570  ILE A O   1 
ATOM   4348 C  CB  . ILE A 1 570 ? 34.957 46.264 75.660  1.00 10.75 ? 570  ILE A CB  1 
ATOM   4349 C  CG1 . ILE A 1 570 ? 33.486 46.746 75.585  1.00 11.09 ? 570  ILE A CG1 1 
ATOM   4350 C  CG2 . ILE A 1 570 ? 35.490 46.713 77.027  1.00 13.41 ? 570  ILE A CG2 1 
ATOM   4351 C  CD1 . ILE A 1 570 ? 32.519 45.895 76.449  1.00 7.22  ? 570  ILE A CD1 1 
ATOM   4352 N  N   . SER A 1 571 ? 37.544 45.134 74.107  1.00 14.12 ? 571  SER A N   1 
ATOM   4353 C  CA  . SER A 1 571 ? 38.849 44.502 74.154  1.00 13.32 ? 571  SER A CA  1 
ATOM   4354 C  C   . SER A 1 571 ? 38.966 43.637 72.911  1.00 11.86 ? 571  SER A C   1 
ATOM   4355 O  O   . SER A 1 571 ? 38.532 42.484 72.794  1.00 17.11 ? 571  SER A O   1 
ATOM   4356 C  CB  . SER A 1 571 ? 38.962 43.692 75.448  1.00 14.02 ? 571  SER A CB  1 
ATOM   4357 O  OG  . SER A 1 571 ? 40.098 42.842 75.522  1.00 14.09 ? 571  SER A OG  1 
ATOM   4358 N  N   . ALA A 1 572 ? 39.461 44.317 71.889  1.00 11.97 ? 572  ALA A N   1 
ATOM   4359 C  CA  . ALA A 1 572 ? 39.693 43.731 70.601  1.00 10.30 ? 572  ALA A CA  1 
ATOM   4360 C  C   . ALA A 1 572 ? 40.573 42.477 70.616  1.00 13.12 ? 572  ALA A C   1 
ATOM   4361 O  O   . ALA A 1 572 ? 41.337 42.220 71.534  1.00 12.66 ? 572  ALA A O   1 
ATOM   4362 C  CB  . ALA A 1 572 ? 40.322 44.792 69.743  1.00 11.11 ? 572  ALA A CB  1 
ATOM   4363 N  N   . ALA A 1 573 ? 40.450 41.626 69.616  1.00 13.39 ? 573  ALA A N   1 
ATOM   4364 C  CA  . ALA A 1 573 ? 41.237 40.407 69.500  1.00 17.09 ? 573  ALA A CA  1 
ATOM   4365 C  C   . ALA A 1 573 ? 42.248 40.566 68.365  1.00 18.66 ? 573  ALA A C   1 
ATOM   4366 O  O   . ALA A 1 573 ? 42.976 41.573 68.428  1.00 19.70 ? 573  ALA A O   1 
ATOM   4367 C  CB  . ALA A 1 573 ? 40.275 39.231 69.255  1.00 17.02 ? 573  ALA A CB  1 
ATOM   4368 N  N   . GLY A 1 574 ? 42.373 39.687 67.333  1.00 19.46 ? 574  GLY A N   1 
ATOM   4369 C  CA  . GLY A 1 574 ? 43.359 39.831 66.284  1.00 18.99 ? 574  GLY A CA  1 
ATOM   4370 C  C   . GLY A 1 574 ? 44.738 39.958 66.943  1.00 22.08 ? 574  GLY A C   1 
ATOM   4371 O  O   . GLY A 1 574 ? 45.121 39.086 67.758  1.00 20.81 ? 574  GLY A O   1 
ATOM   4372 N  N   . PRO A 1 575 ? 45.465 41.082 66.728  1.00 22.16 ? 575  PRO A N   1 
ATOM   4373 C  CA  . PRO A 1 575 ? 46.828 41.307 67.248  1.00 22.32 ? 575  PRO A CA  1 
ATOM   4374 C  C   . PRO A 1 575 ? 47.008 41.358 68.759  1.00 17.82 ? 575  PRO A C   1 
ATOM   4375 O  O   . PRO A 1 575 ? 48.091 41.088 69.302  1.00 19.99 ? 575  PRO A O   1 
ATOM   4376 C  CB  . PRO A 1 575 ? 47.258 42.578 66.565  1.00 23.46 ? 575  PRO A CB  1 
ATOM   4377 C  CG  . PRO A 1 575 ? 45.955 43.310 66.366  1.00 24.87 ? 575  PRO A CG  1 
ATOM   4378 C  CD  . PRO A 1 575 ? 45.030 42.206 65.907  1.00 22.84 ? 575  PRO A CD  1 
ATOM   4379 N  N   . TRP A 1 576 ? 45.927 41.681 69.443  1.00 15.12 ? 576  TRP A N   1 
ATOM   4380 C  CA  . TRP A 1 576 ? 45.932 41.754 70.883  1.00 13.33 ? 576  TRP A CA  1 
ATOM   4381 C  C   . TRP A 1 576 ? 45.880 40.370 71.486  1.00 11.20 ? 576  TRP A C   1 
ATOM   4382 O  O   . TRP A 1 576 ? 46.123 40.250 72.688  1.00 13.30 ? 576  TRP A O   1 
ATOM   4383 C  CB  . TRP A 1 576 ? 44.735 42.599 71.324  1.00 12.92 ? 576  TRP A CB  1 
ATOM   4384 C  CG  . TRP A 1 576 ? 44.890 44.054 70.887  1.00 12.91 ? 576  TRP A CG  1 
ATOM   4385 C  CD1 . TRP A 1 576 ? 44.320 44.552 69.732  1.00 12.21 ? 576  TRP A CD1 1 
ATOM   4386 C  CD2 . TRP A 1 576 ? 45.634 44.989 71.572  1.00 10.94 ? 576  TRP A CD2 1 
ATOM   4387 N  NE1 . TRP A 1 576 ? 44.711 45.809 69.676  1.00 11.17 ? 576  TRP A NE1 1 
ATOM   4388 C  CE2 . TRP A 1 576 ? 45.492 46.110 70.755  1.00 13.50 ? 576  TRP A CE2 1 
ATOM   4389 C  CE3 . TRP A 1 576 ? 46.375 44.989 72.749  1.00 12.24 ? 576  TRP A CE3 1 
ATOM   4390 C  CZ2 . TRP A 1 576 ? 46.122 47.284 71.131  1.00 13.17 ? 576  TRP A CZ2 1 
ATOM   4391 C  CZ3 . TRP A 1 576 ? 47.005 46.159 73.118  1.00 13.39 ? 576  TRP A CZ3 1 
ATOM   4392 C  CH2 . TRP A 1 576 ? 46.870 47.289 72.313  1.00 14.04 ? 576  TRP A CH2 1 
ATOM   4393 N  N   . LEU A 1 577 ? 45.635 39.277 70.732  1.00 9.92  ? 577  LEU A N   1 
ATOM   4394 C  CA  . LEU A 1 577 ? 45.625 37.943 71.352  1.00 12.03 ? 577  LEU A CA  1 
ATOM   4395 C  C   . LEU A 1 577 ? 46.973 37.553 71.966  1.00 15.35 ? 577  LEU A C   1 
ATOM   4396 O  O   . LEU A 1 577 ? 47.085 36.775 72.919  1.00 16.57 ? 577  LEU A O   1 
ATOM   4397 C  CB  . LEU A 1 577 ? 45.176 36.885 70.307  1.00 11.73 ? 577  LEU A CB  1 
ATOM   4398 C  CG  . LEU A 1 577 ? 43.672 36.914 69.870  1.00 11.99 ? 577  LEU A CG  1 
ATOM   4399 C  CD1 . LEU A 1 577 ? 43.252 35.719 69.007  1.00 11.81 ? 577  LEU A CD1 1 
ATOM   4400 C  CD2 . LEU A 1 577 ? 42.866 36.886 71.128  1.00 8.65  ? 577  LEU A CD2 1 
ATOM   4401 N  N   . LYS A 1 578 ? 48.008 38.195 71.458  1.00 15.76 ? 578  LYS A N   1 
ATOM   4402 C  CA  . LYS A 1 578 ? 49.390 38.055 71.925  1.00 18.92 ? 578  LYS A CA  1 
ATOM   4403 C  C   . LYS A 1 578 ? 49.522 38.361 73.417  1.00 15.88 ? 578  LYS A C   1 
ATOM   4404 O  O   . LYS A 1 578 ? 50.295 37.726 74.142  1.00 15.77 ? 578  LYS A O   1 
ATOM   4405 C  CB  . LYS A 1 578 ? 50.213 38.993 71.086  1.00 20.77 ? 578  LYS A CB  1 
ATOM   4406 C  CG  . LYS A 1 578 ? 51.681 38.911 71.326  1.00 30.04 ? 578  LYS A CG  1 
ATOM   4407 C  CD  . LYS A 1 578 ? 52.291 40.245 70.888  1.00 36.23 ? 578  LYS A CD  1 
ATOM   4408 C  CE  . LYS A 1 578 ? 51.972 40.679 69.436  1.00 42.52 ? 578  LYS A CE  1 
ATOM   4409 N  NZ  . LYS A 1 578 ? 50.796 41.540 69.267  1.00 48.74 ? 578  LYS A NZ  1 
ATOM   4410 N  N   . PHE A 1 579 ? 48.672 39.254 73.906  1.00 13.54 ? 579  PHE A N   1 
ATOM   4411 C  CA  . PHE A 1 579 ? 48.732 39.626 75.295  1.00 12.10 ? 579  PHE A CA  1 
ATOM   4412 C  C   . PHE A 1 579 ? 47.627 39.028 76.129  1.00 12.04 ? 579  PHE A C   1 
ATOM   4413 O  O   . PHE A 1 579 ? 47.436 39.560 77.234  1.00 10.84 ? 579  PHE A O   1 
ATOM   4414 C  CB  . PHE A 1 579 ? 48.685 41.154 75.411  1.00 13.23 ? 579  PHE A CB  1 
ATOM   4415 C  CG  . PHE A 1 579 ? 49.787 41.822 74.626  1.00 16.31 ? 579  PHE A CG  1 
ATOM   4416 C  CD1 . PHE A 1 579 ? 51.115 41.477 74.849  1.00 16.15 ? 579  PHE A CD1 1 
ATOM   4417 C  CD2 . PHE A 1 579 ? 49.440 42.785 73.708  1.00 19.47 ? 579  PHE A CD2 1 
ATOM   4418 C  CE1 . PHE A 1 579 ? 52.111 42.117 74.150  1.00 16.07 ? 579  PHE A CE1 1 
ATOM   4419 C  CE2 . PHE A 1 579 ? 50.445 43.419 73.019  1.00 17.95 ? 579  PHE A CE2 1 
ATOM   4420 C  CZ  . PHE A 1 579 ? 51.769 43.084 73.239  1.00 16.67 ? 579  PHE A CZ  1 
ATOM   4421 N  N   . ARG A 1 580 ? 46.876 37.968 75.745  1.00 10.92 ? 580  ARG A N   1 
ATOM   4422 C  CA  . ARG A 1 580 ? 45.815 37.504 76.636  1.00 10.75 ? 580  ARG A CA  1 
ATOM   4423 C  C   . ARG A 1 580 ? 46.252 36.993 78.008  1.00 15.15 ? 580  ARG A C   1 
ATOM   4424 O  O   . ARG A 1 580 ? 45.389 36.775 78.882  1.00 16.36 ? 580  ARG A O   1 
ATOM   4425 C  CB  . ARG A 1 580 ? 44.991 36.431 75.922  1.00 12.45 ? 580  ARG A CB  1 
ATOM   4426 C  CG  . ARG A 1 580 ? 44.208 37.092 74.772  1.00 10.35 ? 580  ARG A CG  1 
ATOM   4427 C  CD  . ARG A 1 580 ? 43.062 38.170 75.006  1.00 14.06 ? 580  ARG A CD  1 
ATOM   4428 N  NE  . ARG A 1 580 ? 41.957 37.363 75.205  1.00 16.74 ? 580  ARG A NE  1 
ATOM   4429 C  CZ  . ARG A 1 580 ? 40.957 37.107 74.328  1.00 15.83 ? 580  ARG A CZ  1 
ATOM   4430 N  NH1 . ARG A 1 580 ? 40.431 37.781 73.297  1.00 12.31 ? 580  ARG A NH1 1 
ATOM   4431 N  NH2 . ARG A 1 580 ? 40.395 35.965 74.642  1.00 20.35 ? 580  ARG A NH2 1 
ATOM   4432 N  N   . GLY A 1 581 ? 47.565 36.804 78.284  1.00 15.09 ? 581  GLY A N   1 
ATOM   4433 C  CA  . GLY A 1 581 ? 48.030 36.413 79.600  1.00 12.68 ? 581  GLY A CA  1 
ATOM   4434 C  C   . GLY A 1 581 ? 48.707 37.554 80.333  1.00 11.97 ? 581  GLY A C   1 
ATOM   4435 O  O   . GLY A 1 581 ? 49.234 37.393 81.430  1.00 13.26 ? 581  GLY A O   1 
ATOM   4436 N  N   . HIS A 1 582 ? 48.668 38.763 79.774  1.00 14.69 ? 582  HIS A N   1 
ATOM   4437 C  CA  . HIS A 1 582 ? 49.377 39.903 80.332  1.00 14.05 ? 582  HIS A CA  1 
ATOM   4438 C  C   . HIS A 1 582 ? 48.385 41.069 80.538  1.00 11.95 ? 582  HIS A C   1 
ATOM   4439 O  O   . HIS A 1 582 ? 48.220 41.899 79.640  1.00 10.53 ? 582  HIS A O   1 
ATOM   4440 C  CB  . HIS A 1 582 ? 50.529 40.345 79.369  1.00 12.13 ? 582  HIS A CB  1 
ATOM   4441 C  CG  . HIS A 1 582 ? 51.528 41.254 80.116  1.00 15.50 ? 582  HIS A CG  1 
ATOM   4442 N  ND1 . HIS A 1 582 ? 51.394 42.479 80.647  1.00 13.99 ? 582  HIS A ND1 1 
ATOM   4443 C  CD2 . HIS A 1 582 ? 52.815 40.857 80.409  1.00 15.98 ? 582  HIS A CD2 1 
ATOM   4444 C  CE1 . HIS A 1 582 ? 52.533 42.808 81.232  1.00 16.52 ? 582  HIS A CE1 1 
ATOM   4445 N  NE2 . HIS A 1 582 ? 53.382 41.818 81.079  1.00 15.54 ? 582  HIS A NE2 1 
ATOM   4446 N  N   . LEU A 1 583 ? 47.852 41.251 81.742  1.00 7.68  ? 583  LEU A N   1 
ATOM   4447 C  CA  . LEU A 1 583 ? 46.813 42.248 81.981  1.00 12.55 ? 583  LEU A CA  1 
ATOM   4448 C  C   . LEU A 1 583 ? 47.211 43.688 81.682  1.00 13.83 ? 583  LEU A C   1 
ATOM   4449 O  O   . LEU A 1 583 ? 46.448 44.450 81.067  1.00 14.21 ? 583  LEU A O   1 
ATOM   4450 C  CB  . LEU A 1 583 ? 46.356 42.178 83.429  1.00 13.21 ? 583  LEU A CB  1 
ATOM   4451 C  CG  . LEU A 1 583 ? 45.198 43.102 83.814  1.00 14.26 ? 583  LEU A CG  1 
ATOM   4452 C  CD1 . LEU A 1 583 ? 44.044 42.907 82.854  1.00 13.77 ? 583  LEU A CD1 1 
ATOM   4453 C  CD2 . LEU A 1 583 ? 44.780 42.812 85.220  1.00 14.54 ? 583  LEU A CD2 1 
ATOM   4454 N  N   . ASP A 1 584 ? 48.446 44.078 82.050  1.00 12.37 ? 584  ASP A N   1 
ATOM   4455 C  CA  . ASP A 1 584 ? 48.811 45.448 81.777  1.00 13.98 ? 584  ASP A CA  1 
ATOM   4456 C  C   . ASP A 1 584 ? 49.029 45.753 80.302  1.00 13.62 ? 584  ASP A C   1 
ATOM   4457 O  O   . ASP A 1 584 ? 48.611 46.800 79.773  1.00 10.50 ? 584  ASP A O   1 
ATOM   4458 C  CB  . ASP A 1 584 ? 50.060 45.822 82.599  1.00 20.75 ? 584  ASP A CB  1 
ATOM   4459 C  CG  . ASP A 1 584 ? 50.253 47.331 82.556  1.00 23.82 ? 584  ASP A CG  1 
ATOM   4460 O  OD1 . ASP A 1 584 ? 49.437 48.097 83.071  1.00 26.35 ? 584  ASP A OD1 1 
ATOM   4461 O  OD2 . ASP A 1 584 ? 51.196 47.754 81.901  1.00 32.60 ? 584  ASP A OD2 1 
ATOM   4462 N  N   . ASN A 1 585 ? 49.542 44.762 79.574  1.00 10.02 ? 585  ASN A N   1 
ATOM   4463 C  CA  . ASN A 1 585 ? 49.787 45.005 78.174  1.00 11.47 ? 585  ASN A CA  1 
ATOM   4464 C  C   . ASN A 1 585 ? 48.534 44.987 77.333  1.00 13.22 ? 585  ASN A C   1 
ATOM   4465 O  O   . ASN A 1 585 ? 48.429 45.782 76.383  1.00 12.69 ? 585  ASN A O   1 
ATOM   4466 C  CB  . ASN A 1 585 ? 50.760 43.995 77.570  1.00 12.31 ? 585  ASN A CB  1 
ATOM   4467 C  CG  . ASN A 1 585 ? 52.208 44.379 77.882  1.00 14.86 ? 585  ASN A CG  1 
ATOM   4468 O  OD1 . ASN A 1 585 ? 53.106 43.541 77.840  1.00 16.64 ? 585  ASN A OD1 1 
ATOM   4469 N  ND2 . ASN A 1 585 ? 52.545 45.565 78.349  1.00 12.00 ? 585  ASN A ND2 1 
ATOM   4470 N  N   . ILE A 1 586 ? 47.588 44.080 77.641  1.00 11.48 ? 586  ILE A N   1 
ATOM   4471 C  CA  . ILE A 1 586 ? 46.359 44.065 76.882  1.00 9.98  ? 586  ILE A CA  1 
ATOM   4472 C  C   . ILE A 1 586 ? 45.484 45.243 77.283  1.00 9.78  ? 586  ILE A C   1 
ATOM   4473 O  O   . ILE A 1 586 ? 44.766 45.708 76.402  1.00 12.08 ? 586  ILE A O   1 
ATOM   4474 C  CB  . ILE A 1 586 ? 45.706 42.656 77.099  1.00 10.29 ? 586  ILE A CB  1 
ATOM   4475 C  CG1 . ILE A 1 586 ? 44.905 42.461 75.834  1.00 10.53 ? 586  ILE A CG1 1 
ATOM   4476 C  CG2 . ILE A 1 586 ? 45.028 42.471 78.468  1.00 8.55  ? 586  ILE A CG2 1 
ATOM   4477 C  CD1 . ILE A 1 586 ? 44.116 41.159 75.690  1.00 8.32  ? 586  ILE A CD1 1 
ATOM   4478 N  N   . SER A 1 587 ? 45.584 45.835 78.502  1.00 9.45  ? 587  SER A N   1 
ATOM   4479 C  CA  . SER A 1 587 ? 44.794 47.006 78.848  1.00 9.97  ? 587  SER A CA  1 
ATOM   4480 C  C   . SER A 1 587 ? 45.013 48.203 77.934  1.00 14.92 ? 587  SER A C   1 
ATOM   4481 O  O   . SER A 1 587 ? 44.251 49.179 77.963  1.00 14.23 ? 587  SER A O   1 
ATOM   4482 C  CB  . SER A 1 587 ? 45.071 47.463 80.255  1.00 8.00  ? 587  SER A CB  1 
ATOM   4483 O  OG  . SER A 1 587 ? 44.693 46.537 81.272  1.00 11.00 ? 587  SER A OG  1 
ATOM   4484 N  N   . ASN A 1 588 ? 46.021 48.162 77.043  1.00 16.30 ? 588  ASN A N   1 
ATOM   4485 C  CA  . ASN A 1 588 ? 46.218 49.245 76.102  1.00 16.28 ? 588  ASN A CA  1 
ATOM   4486 C  C   . ASN A 1 588 ? 45.229 49.150 74.958  1.00 13.82 ? 588  ASN A C   1 
ATOM   4487 O  O   . ASN A 1 588 ? 45.315 49.964 74.050  1.00 12.72 ? 588  ASN A O   1 
ATOM   4488 C  CB  . ASN A 1 588 ? 47.637 49.237 75.534  1.00 18.67 ? 588  ASN A CB  1 
ATOM   4489 C  CG  . ASN A 1 588 ? 48.650 49.565 76.613  1.00 19.12 ? 588  ASN A CG  1 
ATOM   4490 O  OD1 . ASN A 1 588 ? 48.441 50.379 77.523  1.00 22.08 ? 588  ASN A OD1 1 
ATOM   4491 N  ND2 . ASN A 1 588 ? 49.752 48.837 76.711  1.00 25.29 ? 588  ASN A ND2 1 
ATOM   4492 N  N   . ASN A 1 589 ? 44.292 48.201 74.870  1.00 13.34 ? 589  ASN A N   1 
ATOM   4493 C  CA  . ASN A 1 589 ? 43.252 48.293 73.838  1.00 12.37 ? 589  ASN A CA  1 
ATOM   4494 C  C   . ASN A 1 589 ? 41.900 48.707 74.431  1.00 12.19 ? 589  ASN A C   1 
ATOM   4495 O  O   . ASN A 1 589 ? 40.917 48.647 73.682  1.00 14.45 ? 589  ASN A O   1 
ATOM   4496 C  CB  . ASN A 1 589 ? 42.977 46.962 73.097  1.00 9.43  ? 589  ASN A CB  1 
ATOM   4497 C  CG  . ASN A 1 589 ? 42.444 45.829 73.939  1.00 10.40 ? 589  ASN A CG  1 
ATOM   4498 O  OD1 . ASN A 1 589 ? 42.481 44.683 73.480  1.00 9.61  ? 589  ASN A OD1 1 
ATOM   4499 N  ND2 . ASN A 1 589 ? 41.985 45.971 75.181  1.00 7.10  ? 589  ASN A ND2 1 
ATOM   4500 N  N   . LEU A 1 590 ? 41.806 49.025 75.724  1.00 12.82 ? 590  LEU A N   1 
ATOM   4501 C  CA  . LEU A 1 590 ? 40.565 49.295 76.383  1.00 15.37 ? 590  LEU A CA  1 
ATOM   4502 C  C   . LEU A 1 590 ? 39.744 50.370 75.708  1.00 16.78 ? 590  LEU A C   1 
ATOM   4503 O  O   . LEU A 1 590 ? 40.153 51.523 75.578  1.00 17.42 ? 590  LEU A O   1 
ATOM   4504 C  CB  . LEU A 1 590 ? 40.748 49.734 77.841  1.00 14.05 ? 590  LEU A CB  1 
ATOM   4505 C  CG  . LEU A 1 590 ? 39.417 50.075 78.579  1.00 15.57 ? 590  LEU A CG  1 
ATOM   4506 C  CD1 . LEU A 1 590 ? 38.530 48.812 78.760  1.00 13.27 ? 590  LEU A CD1 1 
ATOM   4507 C  CD2 . LEU A 1 590 ? 39.735 50.706 79.897  1.00 13.62 ? 590  LEU A CD2 1 
ATOM   4508 N  N   . LEU A 1 591 ? 38.580 49.878 75.240  1.00 18.24 ? 591  LEU A N   1 
ATOM   4509 C  CA  . LEU A 1 591 ? 37.522 50.637 74.597  1.00 13.80 ? 591  LEU A CA  1 
ATOM   4510 C  C   . LEU A 1 591 ? 37.954 51.407 73.382  1.00 15.78 ? 591  LEU A C   1 
ATOM   4511 O  O   . LEU A 1 591 ? 37.263 52.342 73.001  1.00 18.12 ? 591  LEU A O   1 
ATOM   4512 C  CB  . LEU A 1 591 ? 36.911 51.562 75.642  1.00 12.60 ? 591  LEU A CB  1 
ATOM   4513 C  CG  . LEU A 1 591 ? 36.021 50.896 76.686  1.00 13.79 ? 591  LEU A CG  1 
ATOM   4514 C  CD1 . LEU A 1 591 ? 35.900 51.808 77.902  1.00 10.59 ? 591  LEU A CD1 1 
ATOM   4515 C  CD2 . LEU A 1 591 ? 34.657 50.547 76.045  1.00 12.79 ? 591  LEU A CD2 1 
ATOM   4516 N  N   . ILE A 1 592 ? 39.016 51.008 72.672  1.00 15.07 ? 592  ILE A N   1 
ATOM   4517 C  CA  . ILE A 1 592 ? 39.443 51.776 71.514  1.00 15.23 ? 592  ILE A CA  1 
ATOM   4518 C  C   . ILE A 1 592 ? 38.494 51.674 70.334  1.00 17.89 ? 592  ILE A C   1 
ATOM   4519 O  O   . ILE A 1 592 ? 38.598 52.466 69.389  1.00 19.06 ? 592  ILE A O   1 
ATOM   4520 C  CB  . ILE A 1 592 ? 40.896 51.377 71.021  1.00 13.96 ? 592  ILE A CB  1 
ATOM   4521 C  CG1 . ILE A 1 592 ? 41.035 49.951 70.539  1.00 16.44 ? 592  ILE A CG1 1 
ATOM   4522 C  CG2 . ILE A 1 592 ? 41.827 51.633 72.188  1.00 13.81 ? 592  ILE A CG2 1 
ATOM   4523 C  CD1 . ILE A 1 592 ? 42.438 49.740 69.907  1.00 15.97 ? 592  ILE A CD1 1 
ATOM   4524 N  N   . GLY A 1 593 ? 37.557 50.723 70.316  1.00 17.84 ? 593  GLY A N   1 
ATOM   4525 C  CA  . GLY A 1 593 ? 36.596 50.650 69.221  1.00 14.38 ? 593  GLY A CA  1 
ATOM   4526 C  C   . GLY A 1 593 ? 35.279 51.362 69.565  1.00 14.87 ? 593  GLY A C   1 
ATOM   4527 O  O   . GLY A 1 593 ? 34.435 51.576 68.696  1.00 15.79 ? 593  GLY A O   1 
ATOM   4528 N  N   . ALA A 1 594 ? 35.005 51.734 70.804  1.00 12.46 ? 594  ALA A N   1 
ATOM   4529 C  CA  . ALA A 1 594 ? 33.704 52.285 71.160  1.00 14.00 ? 594  ALA A CA  1 
ATOM   4530 C  C   . ALA A 1 594 ? 33.494 53.682 70.602  1.00 16.63 ? 594  ALA A C   1 
ATOM   4531 O  O   . ALA A 1 594 ? 34.456 54.447 70.573  1.00 18.15 ? 594  ALA A O   1 
ATOM   4532 C  CB  . ALA A 1 594 ? 33.597 52.355 72.650  1.00 10.62 ? 594  ALA A CB  1 
ATOM   4533 N  N   . ILE A 1 595 ? 32.326 54.092 70.097  1.00 19.97 ? 595  ILE A N   1 
ATOM   4534 C  CA  . ILE A 1 595 ? 32.063 55.435 69.594  1.00 17.67 ? 595  ILE A CA  1 
ATOM   4535 C  C   . ILE A 1 595 ? 31.683 56.322 70.769  1.00 17.01 ? 595  ILE A C   1 
ATOM   4536 O  O   . ILE A 1 595 ? 30.759 56.023 71.541  1.00 19.08 ? 595  ILE A O   1 
ATOM   4537 C  CB  . ILE A 1 595 ? 30.925 55.364 68.566  1.00 18.01 ? 595  ILE A CB  1 
ATOM   4538 C  CG1 . ILE A 1 595 ? 31.246 54.408 67.415  1.00 18.33 ? 595  ILE A CG1 1 
ATOM   4539 C  CG2 . ILE A 1 595 ? 30.674 56.793 68.088  1.00 20.17 ? 595  ILE A CG2 1 
ATOM   4540 C  CD1 . ILE A 1 595 ? 32.519 54.758 66.629  1.00 22.81 ? 595  ILE A CD1 1 
ATOM   4541 N  N   . ASN A 1 596 ? 32.433 57.421 70.893  1.00 17.77 ? 596  ASN A N   1 
ATOM   4542 C  CA  . ASN A 1 596 ? 32.197 58.436 71.908  1.00 17.48 ? 596  ASN A CA  1 
ATOM   4543 C  C   . ASN A 1 596 ? 31.055 59.313 71.408  1.00 18.30 ? 596  ASN A C   1 
ATOM   4544 O  O   . ASN A 1 596 ? 31.083 59.820 70.275  1.00 14.61 ? 596  ASN A O   1 
ATOM   4545 C  CB  . ASN A 1 596 ? 33.458 59.300 72.111  1.00 18.27 ? 596  ASN A CB  1 
ATOM   4546 C  CG  . ASN A 1 596 ? 33.364 60.521 73.024  1.00 19.50 ? 596  ASN A CG  1 
ATOM   4547 O  OD1 . ASN A 1 596 ? 32.412 60.749 73.791  1.00 16.53 ? 596  ASN A OD1 1 
ATOM   4548 N  ND2 . ASN A 1 596 ? 34.374 61.368 73.004  1.00 17.70 ? 596  ASN A ND2 1 
ATOM   4549 N  N   . ILE A 1 597 ? 30.041 59.500 72.248  1.00 20.61 ? 597  ILE A N   1 
ATOM   4550 C  CA  . ILE A 1 597 ? 28.912 60.329 71.868  1.00 20.83 ? 597  ILE A CA  1 
ATOM   4551 C  C   . ILE A 1 597 ? 29.359 61.774 71.649  1.00 22.91 ? 597  ILE A C   1 
ATOM   4552 O  O   . ILE A 1 597 ? 28.856 62.360 70.678  1.00 23.75 ? 597  ILE A O   1 
ATOM   4553 C  CB  . ILE A 1 597 ? 27.809 60.218 72.963  1.00 19.47 ? 597  ILE A CB  1 
ATOM   4554 C  CG1 . ILE A 1 597 ? 26.523 60.718 72.324  1.00 21.59 ? 597  ILE A CG1 1 
ATOM   4555 C  CG2 . ILE A 1 597 ? 28.123 61.005 74.248  1.00 16.43 ? 597  ILE A CG2 1 
ATOM   4556 C  CD1 . ILE A 1 597 ? 25.287 60.090 72.981  1.00 19.86 ? 597  ILE A CD1 1 
ATOM   4557 N  N   . GLU A 1 598 ? 30.335 62.325 72.414  1.00 19.49 ? 598  GLU A N   1 
ATOM   4558 C  CA  . GLU A 1 598 ? 30.763 63.713 72.259  1.00 20.66 ? 598  GLU A CA  1 
ATOM   4559 C  C   . GLU A 1 598 ? 31.188 64.067 70.838  1.00 19.87 ? 598  GLU A C   1 
ATOM   4560 O  O   . GLU A 1 598 ? 30.737 65.035 70.224  1.00 22.11 ? 598  GLU A O   1 
ATOM   4561 C  CB  . GLU A 1 598 ? 31.904 63.982 73.228  1.00 24.13 ? 598  GLU A CB  1 
ATOM   4562 C  CG  . GLU A 1 598 ? 32.191 65.461 73.391  1.00 27.90 ? 598  GLU A CG  1 
ATOM   4563 C  CD  . GLU A 1 598 ? 33.101 65.959 74.510  1.00 30.54 ? 598  GLU A CD  1 
ATOM   4564 O  OE1 . GLU A 1 598 ? 33.608 65.212 75.344  1.00 31.90 ? 598  GLU A OE1 1 
ATOM   4565 O  OE2 . GLU A 1 598 ? 33.311 67.166 74.576  1.00 32.68 ? 598  GLU A OE2 1 
ATOM   4566 N  N   . ASN A 1 599 ? 31.927 63.223 70.157  1.00 20.35 ? 599  ASN A N   1 
ATOM   4567 C  CA  . ASN A 1 599 ? 32.428 63.609 68.858  1.00 20.61 ? 599  ASN A CA  1 
ATOM   4568 C  C   . ASN A 1 599 ? 32.157 62.600 67.798  1.00 21.47 ? 599  ASN A C   1 
ATOM   4569 O  O   . ASN A 1 599 ? 32.510 62.814 66.636  1.00 23.41 ? 599  ASN A O   1 
ATOM   4570 C  CB  . ASN A 1 599 ? 33.926 63.854 69.000  1.00 22.46 ? 599  ASN A CB  1 
ATOM   4571 C  CG  . ASN A 1 599 ? 34.689 62.681 69.630  1.00 22.86 ? 599  ASN A CG  1 
ATOM   4572 O  OD1 . ASN A 1 599 ? 34.172 61.556 69.730  1.00 22.80 ? 599  ASN A OD1 1 
ATOM   4573 N  ND2 . ASN A 1 599 ? 35.907 62.875 70.090  1.00 19.80 ? 599  ASN A ND2 1 
ATOM   4574 N  N   . ARG A 1 600 ? 31.530 61.486 68.175  1.00 27.48 ? 600  ARG A N   1 
ATOM   4575 C  CA  . ARG A 1 600 ? 31.267 60.359 67.301  1.00 32.25 ? 600  ARG A CA  1 
ATOM   4576 C  C   . ARG A 1 600 ? 32.545 59.686 66.834  1.00 29.53 ? 600  ARG A C   1 
ATOM   4577 O  O   . ARG A 1 600 ? 32.629 59.131 65.739  1.00 29.01 ? 600  ARG A O   1 
ATOM   4578 C  CB  . ARG A 1 600 ? 30.450 60.803 66.081  1.00 45.43 ? 600  ARG A CB  1 
ATOM   4579 C  CG  . ARG A 1 600 ? 28.923 60.922 66.261  1.00 54.38 ? 600  ARG A CG  1 
ATOM   4580 C  CD  . ARG A 1 600 ? 28.394 62.184 65.548  1.00 58.48 ? 600  ARG A CD  1 
ATOM   4581 N  NE  . ARG A 1 600 ? 28.778 63.443 66.206  1.00 63.42 ? 600  ARG A NE  1 
ATOM   4582 C  CZ  . ARG A 1 600 ? 28.470 63.749 67.494  1.00 67.21 ? 600  ARG A CZ  1 
ATOM   4583 N  NH1 . ARG A 1 600 ? 27.721 62.926 68.271  1.00 67.94 ? 600  ARG A NH1 1 
ATOM   4584 N  NH2 . ARG A 1 600 ? 28.910 64.922 67.996  1.00 69.73 ? 600  ARG A NH2 1 
ATOM   4585 N  N   . LYS A 1 601 ? 33.604 59.747 67.623  1.00 28.12 ? 601  LYS A N   1 
ATOM   4586 C  CA  . LYS A 1 601 ? 34.888 59.179 67.258  1.00 27.43 ? 601  LYS A CA  1 
ATOM   4587 C  C   . LYS A 1 601 ? 35.227 57.944 68.055  1.00 20.32 ? 601  LYS A C   1 
ATOM   4588 O  O   . LYS A 1 601 ? 34.929 57.876 69.245  1.00 18.34 ? 601  LYS A O   1 
ATOM   4589 C  CB  . LYS A 1 601 ? 36.024 60.170 67.504  1.00 31.98 ? 601  LYS A CB  1 
ATOM   4590 C  CG  . LYS A 1 601 ? 36.612 60.969 66.363  1.00 39.09 ? 601  LYS A CG  1 
ATOM   4591 C  CD  . LYS A 1 601 ? 35.777 62.139 65.945  1.00 44.70 ? 601  LYS A CD  1 
ATOM   4592 C  CE  . LYS A 1 601 ? 35.145 61.971 64.548  1.00 52.49 ? 601  LYS A CE  1 
ATOM   4593 N  NZ  . LYS A 1 601 ? 33.719 61.623 64.572  1.00 56.88 ? 601  LYS A NZ  1 
ATOM   4594 N  N   . ALA A 1 602 ? 35.902 56.989 67.435  1.00 18.03 ? 602  ALA A N   1 
ATOM   4595 C  CA  . ALA A 1 602 ? 36.488 55.852 68.142  1.00 16.94 ? 602  ALA A CA  1 
ATOM   4596 C  C   . ALA A 1 602 ? 37.873 56.252 68.701  1.00 17.48 ? 602  ALA A C   1 
ATOM   4597 O  O   . ALA A 1 602 ? 38.672 56.928 68.050  1.00 15.06 ? 602  ALA A O   1 
ATOM   4598 C  CB  . ALA A 1 602 ? 36.674 54.660 67.188  1.00 17.32 ? 602  ALA A CB  1 
ATOM   4599 N  N   . ASN A 1 603 ? 38.177 55.860 69.928  1.00 15.45 ? 603  ASN A N   1 
ATOM   4600 C  CA  . ASN A 1 603 ? 39.411 56.181 70.611  1.00 17.46 ? 603  ASN A CA  1 
ATOM   4601 C  C   . ASN A 1 603 ? 39.811 57.667 70.722  1.00 21.95 ? 603  ASN A C   1 
ATOM   4602 O  O   . ASN A 1 603 ? 41.004 58.021 70.630  1.00 24.35 ? 603  ASN A O   1 
ATOM   4603 C  CB  . ASN A 1 603 ? 40.539 55.380 69.937  1.00 15.98 ? 603  ASN A CB  1 
ATOM   4604 C  CG  . ASN A 1 603 ? 41.712 55.131 70.877  1.00 14.11 ? 603  ASN A CG  1 
ATOM   4605 O  OD1 . ASN A 1 603 ? 41.631 55.203 72.117  1.00 13.83 ? 603  ASN A OD1 1 
ATOM   4606 N  ND2 . ASN A 1 603 ? 42.851 54.793 70.312  1.00 15.83 ? 603  ASN A ND2 1 
ATOM   4607 N  N   . SER A 1 604 ? 38.864 58.599 70.960  1.00 21.29 ? 604  SER A N   1 
ATOM   4608 C  CA  . SER A 1 604 ? 39.189 60.000 71.106  1.00 18.59 ? 604  SER A CA  1 
ATOM   4609 C  C   . SER A 1 604 ? 38.279 60.619 72.143  1.00 16.94 ? 604  SER A C   1 
ATOM   4610 O  O   . SER A 1 604 ? 37.145 61.019 71.877  1.00 16.49 ? 604  SER A O   1 
ATOM   4611 C  CB  . SER A 1 604 ? 39.030 60.697 69.763  1.00 19.65 ? 604  SER A CB  1 
ATOM   4612 O  OG  . SER A 1 604 ? 39.547 62.022 69.848  1.00 20.05 ? 604  SER A OG  1 
ATOM   4613 N  N   . VAL A 1 605 ? 38.757 60.685 73.376  1.00 14.24 ? 605  VAL A N   1 
ATOM   4614 C  CA  . VAL A 1 605 ? 37.984 61.268 74.437  1.00 14.02 ? 605  VAL A CA  1 
ATOM   4615 C  C   . VAL A 1 605 ? 38.781 62.416 75.023  1.00 18.26 ? 605  VAL A C   1 
ATOM   4616 O  O   . VAL A 1 605 ? 40.014 62.517 74.940  1.00 20.77 ? 605  VAL A O   1 
ATOM   4617 C  CB  . VAL A 1 605 ? 37.646 60.242 75.586  1.00 12.57 ? 605  VAL A CB  1 
ATOM   4618 C  CG1 . VAL A 1 605 ? 36.605 59.249 75.103  1.00 9.60  ? 605  VAL A CG1 1 
ATOM   4619 C  CG2 . VAL A 1 605 ? 38.899 59.499 76.035  1.00 13.90 ? 605  VAL A CG2 1 
ATOM   4620 N  N   . ARG A 1 606 ? 38.024 63.313 75.646  1.00 18.34 ? 606  ARG A N   1 
ATOM   4621 C  CA  . ARG A 1 606 ? 38.530 64.496 76.281  1.00 15.11 ? 606  ARG A CA  1 
ATOM   4622 C  C   . ARG A 1 606 ? 39.068 64.149 77.653  1.00 16.26 ? 606  ARG A C   1 
ATOM   4623 O  O   . ARG A 1 606 ? 38.357 63.712 78.556  1.00 14.13 ? 606  ARG A O   1 
ATOM   4624 C  CB  . ARG A 1 606 ? 37.407 65.499 76.416  1.00 13.20 ? 606  ARG A CB  1 
ATOM   4625 C  CG  . ARG A 1 606 ? 37.833 66.847 76.977  1.00 16.98 ? 606  ARG A CG  1 
ATOM   4626 C  CD  . ARG A 1 606 ? 36.633 67.651 77.495  1.00 19.36 ? 606  ARG A CD  1 
ATOM   4627 N  NE  . ARG A 1 606 ? 35.684 68.039 76.426  1.00 17.78 ? 606  ARG A NE  1 
ATOM   4628 C  CZ  . ARG A 1 606 ? 35.642 69.269 75.891  1.00 19.36 ? 606  ARG A CZ  1 
ATOM   4629 N  NH1 . ARG A 1 606 ? 36.447 70.282 76.260  1.00 19.04 ? 606  ARG A NH1 1 
ATOM   4630 N  NH2 . ARG A 1 606 ? 34.766 69.460 74.926  1.00 20.71 ? 606  ARG A NH2 1 
ATOM   4631 N  N   . ASN A 1 607 ? 40.349 64.442 77.871  1.00 15.79 ? 607  ASN A N   1 
ATOM   4632 C  CA  . ASN A 1 607 ? 40.925 64.371 79.205  1.00 15.52 ? 607  ASN A CA  1 
ATOM   4633 C  C   . ASN A 1 607 ? 40.432 65.611 79.967  1.00 19.25 ? 607  ASN A C   1 
ATOM   4634 O  O   . ASN A 1 607 ? 40.730 66.752 79.584  1.00 18.32 ? 607  ASN A O   1 
ATOM   4635 C  CB  . ASN A 1 607 ? 42.436 64.391 79.116  1.00 16.98 ? 607  ASN A CB  1 
ATOM   4636 C  CG  . ASN A 1 607 ? 43.104 64.201 80.457  1.00 16.62 ? 607  ASN A CG  1 
ATOM   4637 O  OD1 . ASN A 1 607 ? 42.822 64.894 81.434  1.00 16.86 ? 607  ASN A OD1 1 
ATOM   4638 N  ND2 . ASN A 1 607 ? 44.074 63.321 80.586  1.00 16.15 ? 607  ASN A ND2 1 
ATOM   4639 N  N   . ALA A 1 608 ? 39.715 65.399 81.079  1.00 20.16 ? 608  ALA A N   1 
ATOM   4640 C  CA  . ALA A 1 608 ? 39.115 66.425 81.925  1.00 23.23 ? 608  ALA A CA  1 
ATOM   4641 C  C   . ALA A 1 608 ? 40.113 67.396 82.532  1.00 24.35 ? 608  ALA A C   1 
ATOM   4642 O  O   . ALA A 1 608 ? 39.778 68.559 82.764  1.00 23.67 ? 608  ALA A O   1 
ATOM   4643 C  CB  . ALA A 1 608 ? 38.352 65.779 83.083  1.00 22.51 ? 608  ALA A CB  1 
ATOM   4644 N  N   . VAL A 1 609 ? 41.344 66.936 82.776  1.00 24.75 ? 609  VAL A N   1 
ATOM   4645 C  CA  . VAL A 1 609 ? 42.324 67.792 83.410  1.00 23.23 ? 609  VAL A CA  1 
ATOM   4646 C  C   . VAL A 1 609 ? 43.078 68.647 82.426  1.00 19.60 ? 609  VAL A C   1 
ATOM   4647 O  O   . VAL A 1 609 ? 43.215 69.842 82.640  1.00 17.13 ? 609  VAL A O   1 
ATOM   4648 C  CB  . VAL A 1 609 ? 43.271 66.911 84.211  1.00 25.07 ? 609  VAL A CB  1 
ATOM   4649 C  CG1 . VAL A 1 609 ? 44.344 67.773 84.890  1.00 24.84 ? 609  VAL A CG1 1 
ATOM   4650 C  CG2 . VAL A 1 609 ? 42.430 66.138 85.233  1.00 22.11 ? 609  VAL A CG2 1 
ATOM   4651 N  N   . THR A 1 610 ? 43.497 68.022 81.333  1.00 18.71 ? 610  THR A N   1 
ATOM   4652 C  CA  . THR A 1 610 ? 44.339 68.660 80.340  1.00 15.21 ? 610  THR A CA  1 
ATOM   4653 C  C   . THR A 1 610 ? 43.568 69.273 79.204  1.00 16.52 ? 610  THR A C   1 
ATOM   4654 O  O   . THR A 1 610 ? 44.107 70.026 78.404  1.00 16.61 ? 610  THR A O   1 
ATOM   4655 C  CB  . THR A 1 610 ? 45.364 67.646 79.739  1.00 13.27 ? 610  THR A CB  1 
ATOM   4656 O  OG1 . THR A 1 610 ? 44.695 66.707 78.922  1.00 15.06 ? 610  THR A OG1 1 
ATOM   4657 C  CG2 . THR A 1 610 ? 46.037 66.831 80.820  1.00 14.04 ? 610  THR A CG2 1 
ATOM   4658 N  N   . GLN A 1 611 ? 42.323 68.848 79.018  1.00 12.81 ? 611  GLN A N   1 
ATOM   4659 C  CA  . GLN A 1 611 ? 41.493 69.331 77.945  1.00 14.50 ? 611  GLN A CA  1 
ATOM   4660 C  C   . GLN A 1 611 ? 41.997 69.059 76.552  1.00 14.51 ? 611  GLN A C   1 
ATOM   4661 O  O   . GLN A 1 611 ? 41.657 69.726 75.563  1.00 14.46 ? 611  GLN A O   1 
ATOM   4662 C  CB  . GLN A 1 611 ? 41.227 70.836 78.118  1.00 12.01 ? 611  GLN A CB  1 
ATOM   4663 C  CG  . GLN A 1 611 ? 40.363 71.073 79.364  1.00 16.08 ? 611  GLN A CG  1 
ATOM   4664 C  CD  . GLN A 1 611 ? 38.938 70.546 79.229  1.00 15.18 ? 611  GLN A CD  1 
ATOM   4665 O  OE1 . GLN A 1 611 ? 38.372 70.507 78.136  1.00 16.06 ? 611  GLN A OE1 1 
ATOM   4666 N  NE2 . GLN A 1 611 ? 38.327 70.121 80.320  1.00 16.14 ? 611  GLN A NE2 1 
ATOM   4667 N  N   . GLU A 1 612 ? 42.704 67.946 76.479  1.00 13.31 ? 612  GLU A N   1 
ATOM   4668 C  CA  . GLU A 1 612 ? 43.159 67.487 75.196  1.00 19.45 ? 612  GLU A CA  1 
ATOM   4669 C  C   . GLU A 1 612 ? 42.407 66.217 74.856  1.00 17.27 ? 612  GLU A C   1 
ATOM   4670 O  O   . GLU A 1 612 ? 42.095 65.438 75.771  1.00 18.94 ? 612  GLU A O   1 
ATOM   4671 C  CB  . GLU A 1 612 ? 44.655 67.192 75.229  1.00 24.25 ? 612  GLU A CB  1 
ATOM   4672 C  CG  . GLU A 1 612 ? 45.538 68.456 75.235  1.00 34.78 ? 612  GLU A CG  1 
ATOM   4673 C  CD  . GLU A 1 612 ? 45.825 69.157 73.891  1.00 40.91 ? 612  GLU A CD  1 
ATOM   4674 O  OE1 . GLU A 1 612 ? 44.970 69.212 72.980  1.00 42.49 ? 612  GLU A OE1 1 
ATOM   4675 O  OE2 . GLU A 1 612 ? 46.957 69.620 73.738  1.00 42.33 ? 612  GLU A OE2 1 
ATOM   4676 N  N   . PHE A 1 613 ? 42.053 65.989 73.598  1.00 13.69 ? 613  PHE A N   1 
ATOM   4677 C  CA  . PHE A 1 613 ? 41.433 64.733 73.213  1.00 18.84 ? 613  PHE A CA  1 
ATOM   4678 C  C   . PHE A 1 613 ? 42.519 63.708 72.926  1.00 19.03 ? 613  PHE A C   1 
ATOM   4679 O  O   . PHE A 1 613 ? 43.515 64.023 72.278  1.00 19.67 ? 613  PHE A O   1 
ATOM   4680 C  CB  . PHE A 1 613 ? 40.542 64.888 71.966  1.00 16.04 ? 613  PHE A CB  1 
ATOM   4681 C  CG  . PHE A 1 613 ? 39.166 65.422 72.341  1.00 20.06 ? 613  PHE A CG  1 
ATOM   4682 C  CD1 . PHE A 1 613 ? 38.991 66.768 72.595  1.00 20.35 ? 613  PHE A CD1 1 
ATOM   4683 C  CD2 . PHE A 1 613 ? 38.097 64.563 72.378  1.00 18.75 ? 613  PHE A CD2 1 
ATOM   4684 C  CE1 . PHE A 1 613 ? 37.745 67.245 72.914  1.00 21.80 ? 613  PHE A CE1 1 
ATOM   4685 C  CE2 . PHE A 1 613 ? 36.860 65.047 72.701  1.00 19.29 ? 613  PHE A CE2 1 
ATOM   4686 C  CZ  . PHE A 1 613 ? 36.671 66.379 72.953  1.00 21.67 ? 613  PHE A CZ  1 
ATOM   4687 N  N   . GLY A 1 614 ? 42.378 62.488 73.433  1.00 20.85 ? 614  GLY A N   1 
ATOM   4688 C  CA  . GLY A 1 614 ? 43.375 61.461 73.270  1.00 20.39 ? 614  GLY A CA  1 
ATOM   4689 C  C   . GLY A 1 614 ? 42.776 60.068 73.317  1.00 20.01 ? 614  GLY A C   1 
ATOM   4690 O  O   . GLY A 1 614 ? 41.562 59.898 73.437  1.00 20.14 ? 614  GLY A O   1 
ATOM   4691 N  N   . PRO A 1 615 ? 43.615 59.049 73.203  1.00 19.36 ? 615  PRO A N   1 
ATOM   4692 C  CA  . PRO A 1 615 ? 43.212 57.674 73.342  1.00 17.26 ? 615  PRO A CA  1 
ATOM   4693 C  C   . PRO A 1 615 ? 42.593 57.362 74.678  1.00 16.81 ? 615  PRO A C   1 
ATOM   4694 O  O   . PRO A 1 615 ? 42.993 57.845 75.749  1.00 15.76 ? 615  PRO A O   1 
ATOM   4695 C  CB  . PRO A 1 615 ? 44.470 56.899 73.090  1.00 16.48 ? 615  PRO A CB  1 
ATOM   4696 C  CG  . PRO A 1 615 ? 45.235 57.784 72.157  1.00 17.20 ? 615  PRO A CG  1 
ATOM   4697 C  CD  . PRO A 1 615 ? 45.031 59.143 72.843  1.00 17.70 ? 615  PRO A CD  1 
ATOM   4698 N  N   . VAL A 1 616 ? 41.647 56.431 74.606  1.00 16.44 ? 616  VAL A N   1 
ATOM   4699 C  CA  . VAL A 1 616 ? 40.946 56.022 75.808  1.00 15.24 ? 616  VAL A CA  1 
ATOM   4700 C  C   . VAL A 1 616 ? 41.843 55.329 76.832  1.00 12.18 ? 616  VAL A C   1 
ATOM   4701 O  O   . VAL A 1 616 ? 41.783 55.748 78.003  1.00 15.01 ? 616  VAL A O   1 
ATOM   4702 C  CB  . VAL A 1 616 ? 39.726 55.104 75.383  1.00 13.68 ? 616  VAL A CB  1 
ATOM   4703 C  CG1 . VAL A 1 616 ? 38.944 54.713 76.636  1.00 13.00 ? 616  VAL A CG1 1 
ATOM   4704 C  CG2 . VAL A 1 616 ? 38.818 55.818 74.399  1.00 11.33 ? 616  VAL A CG2 1 
ATOM   4705 N  N   . PRO A 1 617 ? 42.679 54.306 76.508  1.00 14.43 ? 617  PRO A N   1 
ATOM   4706 C  CA  . PRO A 1 617 ? 43.593 53.638 77.462  1.00 16.06 ? 617  PRO A CA  1 
ATOM   4707 C  C   . PRO A 1 617 ? 44.508 54.622 78.199  1.00 14.56 ? 617  PRO A C   1 
ATOM   4708 O  O   . PRO A 1 617 ? 44.671 54.549 79.423  1.00 15.57 ? 617  PRO A O   1 
ATOM   4709 C  CB  . PRO A 1 617 ? 44.399 52.659 76.635  1.00 15.16 ? 617  PRO A CB  1 
ATOM   4710 C  CG  . PRO A 1 617 ? 43.624 52.485 75.357  1.00 14.18 ? 617  PRO A CG  1 
ATOM   4711 C  CD  . PRO A 1 617 ? 42.947 53.809 75.157  1.00 13.27 ? 617  PRO A CD  1 
ATOM   4712 N  N   . ASP A 1 618 ? 45.049 55.578 77.436  1.00 14.73 ? 618  ASP A N   1 
ATOM   4713 C  CA  . ASP A 1 618 ? 45.940 56.598 77.963  1.00 19.48 ? 618  ASP A CA  1 
ATOM   4714 C  C   . ASP A 1 618 ? 45.233 57.530 78.887  1.00 17.40 ? 618  ASP A C   1 
ATOM   4715 O  O   . ASP A 1 618 ? 45.800 57.880 79.936  1.00 16.89 ? 618  ASP A O   1 
ATOM   4716 C  CB  . ASP A 1 618 ? 46.542 57.479 76.901  1.00 24.28 ? 618  ASP A CB  1 
ATOM   4717 C  CG  . ASP A 1 618 ? 47.273 56.755 75.776  1.00 34.19 ? 618  ASP A CG  1 
ATOM   4718 O  OD1 . ASP A 1 618 ? 47.081 55.541 75.577  1.00 37.60 ? 618  ASP A OD1 1 
ATOM   4719 O  OD2 . ASP A 1 618 ? 47.997 57.440 75.049  1.00 40.06 ? 618  ASP A OD2 1 
ATOM   4720 N  N   . THR A 1 619 ? 43.992 57.913 78.535  1.00 16.97 ? 619  THR A N   1 
ATOM   4721 C  CA  . THR A 1 619 ? 43.230 58.764 79.442  1.00 13.65 ? 619  THR A CA  1 
ATOM   4722 C  C   . THR A 1 619 ? 42.853 58.018 80.710  1.00 13.26 ? 619  THR A C   1 
ATOM   4723 O  O   . THR A 1 619 ? 42.949 58.585 81.811  1.00 14.15 ? 619  THR A O   1 
ATOM   4724 C  CB  . THR A 1 619 ? 41.990 59.274 78.697  1.00 14.81 ? 619  THR A CB  1 
ATOM   4725 O  OG1 . THR A 1 619 ? 42.471 59.741 77.443  1.00 12.77 ? 619  THR A OG1 1 
ATOM   4726 C  CG2 . THR A 1 619 ? 41.231 60.340 79.449  1.00 12.09 ? 619  THR A CG2 1 
ATOM   4727 N  N   . ALA A 1 620 ? 42.485 56.733 80.624  1.00 14.28 ? 620  ALA A N   1 
ATOM   4728 C  CA  . ALA A 1 620 ? 42.165 55.979 81.837  1.00 10.91 ? 620  ALA A CA  1 
ATOM   4729 C  C   . ALA A 1 620 ? 43.413 55.848 82.689  1.00 10.47 ? 620  ALA A C   1 
ATOM   4730 O  O   . ALA A 1 620 ? 43.364 55.996 83.904  1.00 13.82 ? 620  ALA A O   1 
ATOM   4731 C  CB  . ALA A 1 620 ? 41.666 54.573 81.483  1.00 10.38 ? 620  ALA A CB  1 
ATOM   4732 N  N   . ARG A 1 621 ? 44.588 55.576 82.111  1.00 14.76 ? 621  ARG A N   1 
ATOM   4733 C  CA  . ARG A 1 621 ? 45.809 55.487 82.906  1.00 15.93 ? 621  ARG A CA  1 
ATOM   4734 C  C   . ARG A 1 621 ? 46.103 56.836 83.556  1.00 16.56 ? 621  ARG A C   1 
ATOM   4735 O  O   . ARG A 1 621 ? 46.463 56.891 84.734  1.00 15.54 ? 621  ARG A O   1 
ATOM   4736 C  CB  . ARG A 1 621 ? 46.978 55.072 82.025  1.00 17.01 ? 621  ARG A CB  1 
ATOM   4737 C  CG  . ARG A 1 621 ? 46.952 53.598 81.564  1.00 19.43 ? 621  ARG A CG  1 
ATOM   4738 C  CD  . ARG A 1 621 ? 48.280 53.186 80.914  1.00 15.94 ? 621  ARG A CD  1 
ATOM   4739 N  NE  . ARG A 1 621 ? 48.238 51.903 80.216  1.00 18.88 ? 621  ARG A NE  1 
ATOM   4740 C  CZ  . ARG A 1 621 ? 48.435 50.718 80.808  1.00 16.73 ? 621  ARG A CZ  1 
ATOM   4741 N  NH1 . ARG A 1 621 ? 48.654 50.642 82.116  1.00 15.67 ? 621  ARG A NH1 1 
ATOM   4742 N  NH2 . ARG A 1 621 ? 48.396 49.599 80.070  1.00 15.12 ? 621  ARG A NH2 1 
ATOM   4743 N  N   . TYR A 1 622 ? 45.896 57.959 82.860  1.00 15.46 ? 622  TYR A N   1 
ATOM   4744 C  CA  . TYR A 1 622 ? 46.139 59.265 83.450  1.00 15.27 ? 622  TYR A CA  1 
ATOM   4745 C  C   . TYR A 1 622 ? 45.232 59.463 84.642  1.00 16.76 ? 622  TYR A C   1 
ATOM   4746 O  O   . TYR A 1 622 ? 45.695 59.902 85.701  1.00 17.94 ? 622  TYR A O   1 
ATOM   4747 C  CB  . TYR A 1 622 ? 45.897 60.343 82.402  1.00 18.09 ? 622  TYR A CB  1 
ATOM   4748 C  CG  . TYR A 1 622 ? 46.131 61.757 82.922  1.00 21.34 ? 622  TYR A CG  1 
ATOM   4749 C  CD1 . TYR A 1 622 ? 45.147 62.412 83.645  1.00 22.14 ? 622  TYR A CD1 1 
ATOM   4750 C  CD2 . TYR A 1 622 ? 47.353 62.377 82.686  1.00 24.16 ? 622  TYR A CD2 1 
ATOM   4751 C  CE1 . TYR A 1 622 ? 45.376 63.679 84.143  1.00 24.08 ? 622  TYR A CE1 1 
ATOM   4752 C  CE2 . TYR A 1 622 ? 47.591 63.654 83.173  1.00 24.87 ? 622  TYR A CE2 1 
ATOM   4753 C  CZ  . TYR A 1 622 ? 46.598 64.295 83.901  1.00 25.71 ? 622  TYR A CZ  1 
ATOM   4754 O  OH  . TYR A 1 622 ? 46.836 65.568 84.401  1.00 27.43 ? 622  TYR A OH  1 
ATOM   4755 N  N   . TYR A 1 623 ? 43.936 59.140 84.543  1.00 16.44 ? 623  TYR A N   1 
ATOM   4756 C  CA  . TYR A 1 623 ? 43.052 59.313 85.675  1.00 13.69 ? 623  TYR A CA  1 
ATOM   4757 C  C   . TYR A 1 623 ? 43.487 58.399 86.770  1.00 12.09 ? 623  TYR A C   1 
ATOM   4758 O  O   . TYR A 1 623 ? 43.564 58.850 87.911  1.00 15.20 ? 623  TYR A O   1 
ATOM   4759 C  CB  . TYR A 1 623 ? 41.587 58.985 85.330  1.00 16.82 ? 623  TYR A CB  1 
ATOM   4760 C  CG  . TYR A 1 623 ? 40.897 59.915 84.356  1.00 16.08 ? 623  TYR A CG  1 
ATOM   4761 C  CD1 . TYR A 1 623 ? 41.284 61.245 84.268  1.00 17.33 ? 623  TYR A CD1 1 
ATOM   4762 C  CD2 . TYR A 1 623 ? 39.898 59.381 83.557  1.00 15.73 ? 623  TYR A CD2 1 
ATOM   4763 C  CE1 . TYR A 1 623 ? 40.667 62.062 83.367  1.00 14.38 ? 623  TYR A CE1 1 
ATOM   4764 C  CE2 . TYR A 1 623 ? 39.277 60.194 82.651  1.00 13.89 ? 623  TYR A CE2 1 
ATOM   4765 C  CZ  . TYR A 1 623 ? 39.681 61.518 82.586  1.00 14.60 ? 623  TYR A CZ  1 
ATOM   4766 O  OH  . TYR A 1 623 ? 39.060 62.378 81.742  1.00 14.64 ? 623  TYR A OH  1 
ATOM   4767 N  N   . LYS A 1 624 ? 43.853 57.152 86.470  1.00 15.69 ? 624  LYS A N   1 
ATOM   4768 C  CA  . LYS A 1 624 ? 44.320 56.239 87.507  1.00 19.27 ? 624  LYS A CA  1 
ATOM   4769 C  C   . LYS A 1 624 ? 45.567 56.755 88.241  1.00 20.43 ? 624  LYS A C   1 
ATOM   4770 O  O   . LYS A 1 624 ? 45.660 56.701 89.466  1.00 18.74 ? 624  LYS A O   1 
ATOM   4771 C  CB  . LYS A 1 624 ? 44.635 54.899 86.884  1.00 20.60 ? 624  LYS A CB  1 
ATOM   4772 C  CG  . LYS A 1 624 ? 44.846 53.822 87.929  1.00 22.70 ? 624  LYS A CG  1 
ATOM   4773 C  CD  . LYS A 1 624 ? 45.563 52.712 87.201  1.00 25.26 ? 624  LYS A CD  1 
ATOM   4774 C  CE  . LYS A 1 624 ? 45.740 51.583 88.198  1.00 30.18 ? 624  LYS A CE  1 
ATOM   4775 N  NZ  . LYS A 1 624 ? 46.343 50.427 87.545  1.00 32.10 ? 624  LYS A NZ  1 
ATOM   4776 N  N   . GLN A 1 625 ? 46.519 57.277 87.469  1.00 24.08 ? 625  GLN A N   1 
ATOM   4777 C  CA  . GLN A 1 625 ? 47.776 57.851 87.940  1.00 29.47 ? 625  GLN A CA  1 
ATOM   4778 C  C   . GLN A 1 625 ? 47.454 59.010 88.880  1.00 28.12 ? 625  GLN A C   1 
ATOM   4779 O  O   . GLN A 1 625 ? 48.050 59.214 89.930  1.00 29.56 ? 625  GLN A O   1 
ATOM   4780 C  CB  . GLN A 1 625 ? 48.549 58.325 86.717  1.00 35.75 ? 625  GLN A CB  1 
ATOM   4781 C  CG  . GLN A 1 625 ? 50.014 58.683 86.906  1.00 48.20 ? 625  GLN A CG  1 
ATOM   4782 C  CD  . GLN A 1 625 ? 50.577 59.821 86.027  1.00 54.85 ? 625  GLN A CD  1 
ATOM   4783 O  OE1 . GLN A 1 625 ? 49.963 60.374 85.097  1.00 59.01 ? 625  GLN A OE1 1 
ATOM   4784 N  NE2 . GLN A 1 625 ? 51.782 60.291 86.339  1.00 57.13 ? 625  GLN A NE2 1 
ATOM   4785 N  N   . HIS A 1 626 ? 46.448 59.804 88.556  1.00 27.42 ? 626  HIS A N   1 
ATOM   4786 C  CA  . HIS A 1 626 ? 46.135 60.926 89.395  1.00 26.11 ? 626  HIS A CA  1 
ATOM   4787 C  C   . HIS A 1 626 ? 45.054 60.677 90.425  1.00 26.91 ? 626  HIS A C   1 
ATOM   4788 O  O   . HIS A 1 626 ? 44.579 61.653 91.003  1.00 29.18 ? 626  HIS A O   1 
ATOM   4789 C  CB  . HIS A 1 626 ? 45.782 62.078 88.478  1.00 26.38 ? 626  HIS A CB  1 
ATOM   4790 C  CG  . HIS A 1 626 ? 47.016 62.450 87.683  1.00 29.38 ? 626  HIS A CG  1 
ATOM   4791 N  ND1 . HIS A 1 626 ? 47.999 63.284 88.001  1.00 32.29 ? 626  HIS A ND1 1 
ATOM   4792 C  CD2 . HIS A 1 626 ? 47.323 61.938 86.461  1.00 32.25 ? 626  HIS A CD2 1 
ATOM   4793 C  CE1 . HIS A 1 626 ? 48.868 63.285 87.011  1.00 33.42 ? 626  HIS A CE1 1 
ATOM   4794 N  NE2 . HIS A 1 626 ? 48.446 62.463 86.083  1.00 34.33 ? 626  HIS A NE2 1 
ATOM   4795 N  N   . GLY A 1 627 ? 44.615 59.438 90.697  1.00 26.60 ? 627  GLY A N   1 
ATOM   4796 C  CA  . GLY A 1 627 ? 43.572 59.169 91.688  1.00 23.21 ? 627  GLY A CA  1 
ATOM   4797 C  C   . GLY A 1 627 ? 42.157 59.567 91.254  1.00 23.26 ? 627  GLY A C   1 
ATOM   4798 O  O   . GLY A 1 627 ? 41.299 59.809 92.098  1.00 26.17 ? 627  GLY A O   1 
ATOM   4799 N  N   . ILE A 1 628 ? 41.827 59.664 89.970  1.00 22.45 ? 628  ILE A N   1 
ATOM   4800 C  CA  . ILE A 1 628 ? 40.481 60.001 89.512  1.00 20.29 ? 628  ILE A CA  1 
ATOM   4801 C  C   . ILE A 1 628 ? 39.752 58.666 89.178  1.00 19.62 ? 628  ILE A C   1 
ATOM   4802 O  O   . ILE A 1 628 ? 40.104 57.967 88.227  1.00 18.96 ? 628  ILE A O   1 
ATOM   4803 C  CB  . ILE A 1 628 ? 40.634 60.928 88.279  1.00 17.63 ? 628  ILE A CB  1 
ATOM   4804 C  CG1 . ILE A 1 628 ? 41.314 62.218 88.663  1.00 14.80 ? 628  ILE A CG1 1 
ATOM   4805 C  CG2 . ILE A 1 628 ? 39.262 61.248 87.695  1.00 18.36 ? 628  ILE A CG2 1 
ATOM   4806 C  CD1 . ILE A 1 628 ? 41.791 62.944 87.412  1.00 14.88 ? 628  ILE A CD1 1 
ATOM   4807 N  N   . ARG A 1 629 ? 38.745 58.272 89.955  1.00 20.71 ? 629  ARG A N   1 
ATOM   4808 C  CA  . ARG A 1 629 ? 37.920 57.074 89.755  1.00 20.32 ? 629  ARG A CA  1 
ATOM   4809 C  C   . ARG A 1 629 ? 36.927 57.377 88.636  1.00 17.76 ? 629  ARG A C   1 
ATOM   4810 O  O   . ARG A 1 629 ? 36.338 58.454 88.572  1.00 17.44 ? 629  ARG A O   1 
ATOM   4811 C  CB  . ARG A 1 629 ? 37.248 56.751 91.108  1.00 24.40 ? 629  ARG A CB  1 
ATOM   4812 C  CG  . ARG A 1 629 ? 38.277 56.254 92.126  1.00 29.11 ? 629  ARG A CG  1 
ATOM   4813 C  CD  . ARG A 1 629 ? 38.083 56.679 93.582  1.00 39.26 ? 629  ARG A CD  1 
ATOM   4814 N  NE  . ARG A 1 629 ? 36.949 56.097 94.341  1.00 48.04 ? 629  ARG A NE  1 
ATOM   4815 C  CZ  . ARG A 1 629 ? 37.055 55.146 95.325  1.00 51.80 ? 629  ARG A CZ  1 
ATOM   4816 N  NH1 . ARG A 1 629 ? 38.230 54.531 95.628  1.00 52.31 ? 629  ARG A NH1 1 
ATOM   4817 N  NH2 . ARG A 1 629 ? 35.949 54.767 96.017  1.00 55.60 ? 629  ARG A NH2 1 
ATOM   4818 N  N   . TRP A 1 630 ? 36.729 56.477 87.700  1.00 14.88 ? 630  TRP A N   1 
ATOM   4819 C  CA  . TRP A 1 630 ? 35.904 56.754 86.564  1.00 12.50 ? 630  TRP A CA  1 
ATOM   4820 C  C   . TRP A 1 630 ? 34.855 55.689 86.305  1.00 12.40 ? 630  TRP A C   1 
ATOM   4821 O  O   . TRP A 1 630 ? 34.840 54.600 86.880  1.00 12.36 ? 630  TRP A O   1 
ATOM   4822 C  CB  . TRP A 1 630 ? 36.782 56.931 85.319  1.00 11.16 ? 630  TRP A CB  1 
ATOM   4823 C  CG  . TRP A 1 630 ? 37.746 55.787 84.985  1.00 13.69 ? 630  TRP A CG  1 
ATOM   4824 C  CD1 . TRP A 1 630 ? 39.060 55.880 85.373  1.00 12.76 ? 630  TRP A CD1 1 
ATOM   4825 C  CD2 . TRP A 1 630 ? 37.487 54.637 84.243  1.00 13.33 ? 630  TRP A CD2 1 
ATOM   4826 N  NE1 . TRP A 1 630 ? 39.638 54.809 84.872  1.00 13.95 ? 630  TRP A NE1 1 
ATOM   4827 C  CE2 . TRP A 1 630 ? 38.744 54.051 84.191  1.00 13.37 ? 630  TRP A CE2 1 
ATOM   4828 C  CE3 . TRP A 1 630 ? 36.416 54.022 83.617  1.00 12.99 ? 630  TRP A CE3 1 
ATOM   4829 C  CZ2 . TRP A 1 630 ? 38.948 52.865 83.520  1.00 12.24 ? 630  TRP A CZ2 1 
ATOM   4830 C  CZ3 . TRP A 1 630 ? 36.619 52.832 82.946  1.00 13.70 ? 630  TRP A CZ3 1 
ATOM   4831 C  CH2 . TRP A 1 630 ? 37.874 52.255 82.892  1.00 13.47 ? 630  TRP A CH2 1 
ATOM   4832 N  N   . VAL A 1 631 ? 34.018 56.012 85.332  1.00 11.71 ? 631  VAL A N   1 
ATOM   4833 C  CA  . VAL A 1 631 ? 32.787 55.286 85.031  1.00 13.39 ? 631  VAL A CA  1 
ATOM   4834 C  C   . VAL A 1 631 ? 32.641 55.231 83.521  1.00 10.71 ? 631  VAL A C   1 
ATOM   4835 O  O   . VAL A 1 631 ? 33.182 56.103 82.824  1.00 14.20 ? 631  VAL A O   1 
ATOM   4836 C  CB  . VAL A 1 631 ? 31.683 56.122 85.799  1.00 16.27 ? 631  VAL A CB  1 
ATOM   4837 C  CG1 . VAL A 1 631 ? 30.548 56.561 84.909  1.00 15.84 ? 631  VAL A CG1 1 
ATOM   4838 C  CG2 . VAL A 1 631 ? 31.255 55.303 87.001  1.00 16.95 ? 631  VAL A CG2 1 
ATOM   4839 N  N   . VAL A 1 632 ? 31.975 54.215 82.983  1.00 10.86 ? 632  VAL A N   1 
ATOM   4840 C  CA  . VAL A 1 632 ? 31.619 54.178 81.563  1.00 11.73 ? 632  VAL A CA  1 
ATOM   4841 C  C   . VAL A 1 632 ? 30.091 54.230 81.572  1.00 13.95 ? 632  VAL A C   1 
ATOM   4842 O  O   . VAL A 1 632 ? 29.474 53.618 82.460  1.00 12.70 ? 632  VAL A O   1 
ATOM   4843 C  CB  . VAL A 1 632 ? 32.100 52.860 80.890  1.00 13.24 ? 632  VAL A CB  1 
ATOM   4844 C  CG1 . VAL A 1 632 ? 31.593 52.742 79.461  1.00 11.26 ? 632  VAL A CG1 1 
ATOM   4845 C  CG2 . VAL A 1 632 ? 33.619 52.866 80.795  1.00 13.69 ? 632  VAL A CG2 1 
ATOM   4846 N  N   . ILE A 1 633 ? 29.482 54.968 80.624  1.00 15.20 ? 633  ILE A N   1 
ATOM   4847 C  CA  . ILE A 1 633 ? 28.029 55.084 80.497  1.00 13.52 ? 633  ILE A CA  1 
ATOM   4848 C  C   . ILE A 1 633 ? 27.781 54.433 79.153  1.00 14.99 ? 633  ILE A C   1 
ATOM   4849 O  O   . ILE A 1 633 ? 28.378 54.847 78.148  1.00 12.74 ? 633  ILE A O   1 
ATOM   4850 C  CB  . ILE A 1 633 ? 27.517 56.580 80.424  1.00 14.30 ? 633  ILE A CB  1 
ATOM   4851 C  CG1 . ILE A 1 633 ? 27.945 57.372 81.662  1.00 11.49 ? 633  ILE A CG1 1 
ATOM   4852 C  CG2 . ILE A 1 633 ? 25.978 56.596 80.258  1.00 12.96 ? 633  ILE A CG2 1 
ATOM   4853 C  CD1 . ILE A 1 633 ? 27.392 56.937 83.015  1.00 10.98 ? 633  ILE A CD1 1 
ATOM   4854 N  N   . GLY A 1 634 ? 26.956 53.394 79.068  1.00 12.95 ? 634  GLY A N   1 
ATOM   4855 C  CA  . GLY A 1 634 ? 26.730 52.774 77.793  1.00 12.31 ? 634  GLY A CA  1 
ATOM   4856 C  C   . GLY A 1 634 ? 25.242 52.731 77.506  1.00 13.37 ? 634  GLY A C   1 
ATOM   4857 O  O   . GLY A 1 634 ? 24.386 53.044 78.348  1.00 14.37 ? 634  GLY A O   1 
ATOM   4858 N  N   . ASP A 1 635 ? 24.999 52.251 76.298  1.00 14.37 ? 635  ASP A N   1 
ATOM   4859 C  CA  . ASP A 1 635 ? 23.668 52.173 75.740  1.00 17.20 ? 635  ASP A CA  1 
ATOM   4860 C  C   . ASP A 1 635 ? 23.010 50.789 75.904  1.00 14.69 ? 635  ASP A C   1 
ATOM   4861 O  O   . ASP A 1 635 ? 23.037 50.216 76.994  1.00 15.40 ? 635  ASP A O   1 
ATOM   4862 C  CB  . ASP A 1 635 ? 23.858 52.620 74.299  1.00 20.56 ? 635  ASP A CB  1 
ATOM   4863 C  CG  . ASP A 1 635 ? 22.637 53.169 73.568  1.00 25.53 ? 635  ASP A CG  1 
ATOM   4864 O  OD1 . ASP A 1 635 ? 21.495 52.923 73.962  1.00 27.92 ? 635  ASP A OD1 1 
ATOM   4865 O  OD2 . ASP A 1 635 ? 22.822 53.876 72.574  1.00 31.71 ? 635  ASP A OD2 1 
ATOM   4866 N  N   . GLU A 1 636 ? 22.347 50.190 74.936  1.00 18.56 ? 636  GLU A N   1 
ATOM   4867 C  CA  . GLU A 1 636 ? 21.676 48.897 75.051  1.00 20.56 ? 636  GLU A CA  1 
ATOM   4868 C  C   . GLU A 1 636 ? 22.581 47.709 74.724  1.00 18.06 ? 636  GLU A C   1 
ATOM   4869 O  O   . GLU A 1 636 ? 23.433 47.809 73.844  1.00 14.29 ? 636  GLU A O   1 
ATOM   4870 C  CB  . GLU A 1 636 ? 20.507 48.846 74.098  1.00 26.60 ? 636  GLU A CB  1 
ATOM   4871 C  CG  . GLU A 1 636 ? 19.272 49.533 74.612  1.00 37.36 ? 636  GLU A CG  1 
ATOM   4872 C  CD  . GLU A 1 636 ? 18.219 48.466 74.815  1.00 45.77 ? 636  GLU A CD  1 
ATOM   4873 O  OE1 . GLU A 1 636 ? 17.565 48.051 73.849  1.00 48.87 ? 636  GLU A OE1 1 
ATOM   4874 O  OE2 . GLU A 1 636 ? 18.058 47.933 75.921  1.00 48.01 ? 636  GLU A OE2 1 
ATOM   4875 N  N   . ASN A 1 637 ? 22.407 46.572 75.402  1.00 16.06 ? 637  ASN A N   1 
ATOM   4876 C  CA  . ASN A 1 637 ? 23.122 45.342 75.145  1.00 13.16 ? 637  ASN A CA  1 
ATOM   4877 C  C   . ASN A 1 637 ? 24.650 45.489 75.218  1.00 13.67 ? 637  ASN A C   1 
ATOM   4878 O  O   . ASN A 1 637 ? 25.423 44.950 74.415  1.00 11.21 ? 637  ASN A O   1 
ATOM   4879 C  CB  . ASN A 1 637 ? 22.680 44.837 73.773  1.00 10.45 ? 637  ASN A CB  1 
ATOM   4880 C  CG  . ASN A 1 637 ? 22.894 43.332 73.687  1.00 10.08 ? 637  ASN A CG  1 
ATOM   4881 O  OD1 . ASN A 1 637 ? 23.023 42.737 72.616  1.00 10.77 ? 637  ASN A OD1 1 
ATOM   4882 N  ND2 . ASN A 1 637 ? 22.805 42.582 74.746  1.00 10.70 ? 637  ASN A ND2 1 
ATOM   4883 N  N   . TYR A 1 638 ? 25.090 46.179 76.254  1.00 12.99 ? 638  TYR A N   1 
ATOM   4884 C  CA  . TYR A 1 638 ? 26.495 46.481 76.396  1.00 15.51 ? 638  TYR A CA  1 
ATOM   4885 C  C   . TYR A 1 638 ? 27.225 45.178 76.706  1.00 12.08 ? 638  TYR A C   1 
ATOM   4886 O  O   . TYR A 1 638 ? 26.818 44.396 77.563  1.00 13.13 ? 638  TYR A O   1 
ATOM   4887 C  CB  . TYR A 1 638 ? 26.679 47.523 77.519  1.00 14.30 ? 638  TYR A CB  1 
ATOM   4888 C  CG  . TYR A 1 638 ? 28.125 47.957 77.800  1.00 15.10 ? 638  TYR A CG  1 
ATOM   4889 C  CD1 . TYR A 1 638 ? 28.878 47.231 78.698  1.00 17.01 ? 638  TYR A CD1 1 
ATOM   4890 C  CD2 . TYR A 1 638 ? 28.682 49.045 77.163  1.00 14.07 ? 638  TYR A CD2 1 
ATOM   4891 C  CE1 . TYR A 1 638 ? 30.184 47.590 78.956  1.00 18.82 ? 638  TYR A CE1 1 
ATOM   4892 C  CE2 . TYR A 1 638 ? 29.994 49.411 77.420  1.00 16.27 ? 638  TYR A CE2 1 
ATOM   4893 C  CZ  . TYR A 1 638 ? 30.738 48.679 78.317  1.00 15.99 ? 638  TYR A CZ  1 
ATOM   4894 O  OH  . TYR A 1 638 ? 32.048 49.007 78.601  1.00 12.75 ? 638  TYR A OH  1 
ATOM   4895 N  N   . GLY A 1 639 ? 28.305 44.917 75.995  1.00 10.75 ? 639  GLY A N   1 
ATOM   4896 C  CA  . GLY A 1 639 ? 29.080 43.720 76.223  1.00 12.19 ? 639  GLY A CA  1 
ATOM   4897 C  C   . GLY A 1 639 ? 28.621 42.581 75.338  1.00 12.72 ? 639  GLY A C   1 
ATOM   4898 O  O   . GLY A 1 639 ? 29.025 41.439 75.571  1.00 13.57 ? 639  GLY A O   1 
ATOM   4899 N  N   . GLU A 1 640 ? 27.832 42.843 74.289  1.00 14.12 ? 640  GLU A N   1 
ATOM   4900 C  CA  . GLU A 1 640 ? 27.394 41.830 73.342  1.00 13.77 ? 640  GLU A CA  1 
ATOM   4901 C  C   . GLU A 1 640 ? 28.608 41.087 72.801  1.00 15.19 ? 640  GLU A C   1 
ATOM   4902 O  O   . GLU A 1 640 ? 29.679 41.668 72.560  1.00 17.99 ? 640  GLU A O   1 
ATOM   4903 C  CB  . GLU A 1 640 ? 26.689 42.491 72.190  1.00 13.48 ? 640  GLU A CB  1 
ATOM   4904 C  CG  . GLU A 1 640 ? 26.250 41.626 71.007  1.00 14.91 ? 640  GLU A CG  1 
ATOM   4905 C  CD  . GLU A 1 640 ? 25.732 42.430 69.826  1.00 17.31 ? 640  GLU A CD  1 
ATOM   4906 O  OE1 . GLU A 1 640 ? 25.520 43.643 69.883  1.00 20.03 ? 640  GLU A OE1 1 
ATOM   4907 O  OE2 . GLU A 1 640 ? 25.607 41.868 68.747  1.00 20.11 ? 640  GLU A OE2 1 
ATOM   4908 N  N   . GLY A 1 641 ? 28.499 39.786 72.630  1.00 13.32 ? 641  GLY A N   1 
ATOM   4909 C  CA  . GLY A 1 641 ? 29.559 39.043 72.030  1.00 14.69 ? 641  GLY A CA  1 
ATOM   4910 C  C   . GLY A 1 641 ? 30.184 37.996 72.915  1.00 16.22 ? 641  GLY A C   1 
ATOM   4911 O  O   . GLY A 1 641 ? 29.579 37.107 73.522  1.00 14.61 ? 641  GLY A O   1 
ATOM   4912 N  N   . SER A 1 642 ? 31.473 37.971 72.598  1.00 16.13 ? 642  SER A N   1 
ATOM   4913 C  CA  . SER A 1 642 ? 32.412 37.064 73.178  1.00 14.68 ? 642  SER A CA  1 
ATOM   4914 C  C   . SER A 1 642 ? 32.383 37.120 74.672  1.00 10.68 ? 642  SER A C   1 
ATOM   4915 O  O   . SER A 1 642 ? 32.336 38.223 75.237  1.00 13.82 ? 642  SER A O   1 
ATOM   4916 C  CB  . SER A 1 642 ? 33.780 37.463 72.579  1.00 19.57 ? 642  SER A CB  1 
ATOM   4917 O  OG  . SER A 1 642 ? 34.978 37.149 73.289  1.00 22.73 ? 642  SER A OG  1 
ATOM   4918 N  N   . SER A 1 643 ? 32.656 35.976 75.284  1.00 9.36  ? 643  SER A N   1 
ATOM   4919 C  CA  . SER A 1 643 ? 32.704 35.895 76.745  1.00 10.17 ? 643  SER A CA  1 
ATOM   4920 C  C   . SER A 1 643 ? 34.021 36.403 77.365  1.00 10.04 ? 643  SER A C   1 
ATOM   4921 O  O   . SER A 1 643 ? 34.148 36.360 78.590  1.00 8.98  ? 643  SER A O   1 
ATOM   4922 C  CB  . SER A 1 643 ? 32.500 34.436 77.160  1.00 12.39 ? 643  SER A CB  1 
ATOM   4923 O  OG  . SER A 1 643 ? 33.486 33.759 76.401  1.00 16.76 ? 643  SER A OG  1 
ATOM   4924 N  N   . ARG A 1 644 ? 35.027 36.845 76.600  1.00 10.79 ? 644  ARG A N   1 
ATOM   4925 C  CA  . ARG A 1 644 ? 36.345 37.220 77.129  1.00 11.01 ? 644  ARG A CA  1 
ATOM   4926 C  C   . ARG A 1 644 ? 36.291 38.103 78.381  1.00 11.22 ? 644  ARG A C   1 
ATOM   4927 O  O   . ARG A 1 644 ? 35.871 39.269 78.370  1.00 16.65 ? 644  ARG A O   1 
ATOM   4928 C  CB  . ARG A 1 644 ? 37.158 37.877 75.967  1.00 10.29 ? 644  ARG A CB  1 
ATOM   4929 C  CG  . ARG A 1 644 ? 36.627 39.209 75.486  1.00 10.51 ? 644  ARG A CG  1 
ATOM   4930 C  CD  . ARG A 1 644 ? 37.287 39.693 74.229  1.00 7.11  ? 644  ARG A CD  1 
ATOM   4931 N  NE  . ARG A 1 644 ? 37.036 38.824 73.095  1.00 9.94  ? 644  ARG A NE  1 
ATOM   4932 C  CZ  . ARG A 1 644 ? 36.973 39.289 71.846  1.00 5.72  ? 644  ARG A CZ  1 
ATOM   4933 N  NH1 . ARG A 1 644 ? 37.168 40.577 71.615  1.00 9.35  ? 644  ARG A NH1 1 
ATOM   4934 N  NH2 . ARG A 1 644 ? 36.705 38.450 70.835  1.00 4.74  ? 644  ARG A NH2 1 
ATOM   4935 N  N   . GLU A 1 645 ? 36.707 37.543 79.536  1.00 10.95 ? 645  GLU A N   1 
ATOM   4936 C  CA  . GLU A 1 645 ? 36.701 38.344 80.758  1.00 11.59 ? 645  GLU A CA  1 
ATOM   4937 C  C   . GLU A 1 645 ? 37.654 39.539 80.766  1.00 10.06 ? 645  GLU A C   1 
ATOM   4938 O  O   . GLU A 1 645 ? 37.553 40.406 81.624  1.00 7.15  ? 645  GLU A O   1 
ATOM   4939 C  CB  . GLU A 1 645 ? 37.018 37.491 81.984  1.00 11.04 ? 645  GLU A CB  1 
ATOM   4940 C  CG  . GLU A 1 645 ? 38.398 36.841 81.970  1.00 13.92 ? 645  GLU A CG  1 
ATOM   4941 C  CD  . GLU A 1 645 ? 38.651 35.859 83.091  1.00 13.88 ? 645  GLU A CD  1 
ATOM   4942 O  OE1 . GLU A 1 645 ? 37.940 35.935 84.098  1.00 9.71  ? 645  GLU A OE1 1 
ATOM   4943 O  OE2 . GLU A 1 645 ? 39.494 34.956 82.898  1.00 12.76 ? 645  GLU A OE2 1 
ATOM   4944 N  N   . HIS A 1 646 ? 38.490 39.694 79.729  1.00 10.35 ? 646  HIS A N   1 
ATOM   4945 C  CA  . HIS A 1 646 ? 39.461 40.809 79.637  1.00 11.39 ? 646  HIS A CA  1 
ATOM   4946 C  C   . HIS A 1 646 ? 38.664 42.111 79.528  1.00 9.86  ? 646  HIS A C   1 
ATOM   4947 O  O   . HIS A 1 646 ? 39.095 43.142 80.031  1.00 8.23  ? 646  HIS A O   1 
ATOM   4948 C  CB  . HIS A 1 646 ? 40.387 40.553 78.406  1.00 11.02 ? 646  HIS A CB  1 
ATOM   4949 C  CG  . HIS A 1 646 ? 41.193 39.251 78.577  1.00 12.94 ? 646  HIS A CG  1 
ATOM   4950 N  ND1 . HIS A 1 646 ? 40.770 37.983 78.448  1.00 11.34 ? 646  HIS A ND1 1 
ATOM   4951 C  CD2 . HIS A 1 646 ? 42.502 39.204 79.014  1.00 11.56 ? 646  HIS A CD2 1 
ATOM   4952 C  CE1 . HIS A 1 646 ? 41.755 37.188 78.801  1.00 12.35 ? 646  HIS A CE1 1 
ATOM   4953 N  NE2 . HIS A 1 646 ? 42.780 37.934 79.134  1.00 12.78 ? 646  HIS A NE2 1 
ATOM   4954 N  N   . SER A 1 647 ? 37.423 42.077 79.010  1.00 10.69 ? 647  SER A N   1 
ATOM   4955 C  CA  . SER A 1 647 ? 36.643 43.290 78.936  1.00 8.92  ? 647  SER A CA  1 
ATOM   4956 C  C   . SER A 1 647 ? 36.202 43.785 80.266  1.00 7.35  ? 647  SER A C   1 
ATOM   4957 O  O   . SER A 1 647 ? 35.699 44.910 80.356  1.00 10.69 ? 647  SER A O   1 
ATOM   4958 C  CB  . SER A 1 647 ? 35.419 43.076 78.133  1.00 13.28 ? 647  SER A CB  1 
ATOM   4959 O  OG  . SER A 1 647 ? 35.732 42.660 76.826  1.00 26.85 ? 647  SER A OG  1 
ATOM   4960 N  N   . ALA A 1 648 ? 36.260 42.927 81.276  1.00 7.34  ? 648  ALA A N   1 
ATOM   4961 C  CA  . ALA A 1 648 ? 35.970 43.361 82.635  1.00 7.90  ? 648  ALA A CA  1 
ATOM   4962 C  C   . ALA A 1 648 ? 37.252 43.572 83.465  1.00 10.42 ? 648  ALA A C   1 
ATOM   4963 O  O   . ALA A 1 648 ? 37.303 44.471 84.319  1.00 10.10 ? 648  ALA A O   1 
ATOM   4964 C  CB  . ALA A 1 648 ? 35.097 42.319 83.334  1.00 5.36  ? 648  ALA A CB  1 
ATOM   4965 N  N   . LEU A 1 649 ? 38.304 42.745 83.260  1.00 10.23 ? 649  LEU A N   1 
ATOM   4966 C  CA  . LEU A 1 649 ? 39.566 42.879 83.970  1.00 8.81  ? 649  LEU A CA  1 
ATOM   4967 C  C   . LEU A 1 649 ? 40.257 44.173 83.570  1.00 7.42  ? 649  LEU A C   1 
ATOM   4968 O  O   . LEU A 1 649 ? 40.763 44.886 84.437  1.00 6.65  ? 649  LEU A O   1 
ATOM   4969 C  CB  . LEU A 1 649 ? 40.497 41.702 83.631  1.00 12.60 ? 649  LEU A CB  1 
ATOM   4970 C  CG  . LEU A 1 649 ? 40.165 40.342 84.238  1.00 11.92 ? 649  LEU A CG  1 
ATOM   4971 C  CD1 . LEU A 1 649 ? 40.766 39.274 83.363  1.00 14.93 ? 649  LEU A CD1 1 
ATOM   4972 C  CD2 . LEU A 1 649 ? 40.652 40.267 85.667  1.00 8.75  ? 649  LEU A CD2 1 
ATOM   4973 N  N   . GLU A 1 650 ? 40.276 44.534 82.289  1.00 8.56  ? 650  GLU A N   1 
ATOM   4974 C  CA  . GLU A 1 650 ? 40.926 45.765 81.872  1.00 10.08 ? 650  GLU A CA  1 
ATOM   4975 C  C   . GLU A 1 650 ? 40.343 47.024 82.488  1.00 13.00 ? 650  GLU A C   1 
ATOM   4976 O  O   . GLU A 1 650 ? 41.166 47.765 83.066  1.00 12.76 ? 650  GLU A O   1 
ATOM   4977 C  CB  . GLU A 1 650 ? 40.884 45.948 80.368  1.00 7.67  ? 650  GLU A CB  1 
ATOM   4978 C  CG  . GLU A 1 650 ? 41.690 44.867 79.737  1.00 5.67  ? 650  GLU A CG  1 
ATOM   4979 C  CD  . GLU A 1 650 ? 41.591 44.917 78.229  1.00 8.85  ? 650  GLU A CD  1 
ATOM   4980 O  OE1 . GLU A 1 650 ? 41.543 45.993 77.641  1.00 8.86  ? 650  GLU A OE1 1 
ATOM   4981 O  OE2 . GLU A 1 650 ? 41.549 43.850 77.619  1.00 7.88  ? 650  GLU A OE2 1 
ATOM   4982 N  N   . PRO A 1 651 ? 39.011 47.343 82.509  1.00 13.43 ? 651  PRO A N   1 
ATOM   4983 C  CA  . PRO A 1 651 ? 38.530 48.514 83.199  1.00 11.46 ? 651  PRO A CA  1 
ATOM   4984 C  C   . PRO A 1 651 ? 38.842 48.455 84.681  1.00 12.33 ? 651  PRO A C   1 
ATOM   4985 O  O   . PRO A 1 651 ? 39.129 49.511 85.263  1.00 12.58 ? 651  PRO A O   1 
ATOM   4986 C  CB  . PRO A 1 651 ? 37.026 48.602 82.862  1.00 11.40 ? 651  PRO A CB  1 
ATOM   4987 C  CG  . PRO A 1 651 ? 36.662 47.219 82.469  1.00 13.25 ? 651  PRO A CG  1 
ATOM   4988 C  CD  . PRO A 1 651 ? 37.917 46.745 81.736  1.00 12.90 ? 651  PRO A CD  1 
ATOM   4989 N  N   . ARG A 1 652 ? 38.866 47.283 85.321  1.00 11.96 ? 652  ARG A N   1 
ATOM   4990 C  CA  . ARG A 1 652 ? 39.175 47.231 86.738  1.00 8.94  ? 652  ARG A CA  1 
ATOM   4991 C  C   . ARG A 1 652 ? 40.643 47.623 86.946  1.00 12.97 ? 652  ARG A C   1 
ATOM   4992 O  O   . ARG A 1 652 ? 40.939 48.405 87.854  1.00 11.57 ? 652  ARG A O   1 
ATOM   4993 C  CB  . ARG A 1 652 ? 38.964 45.858 87.257  1.00 7.06  ? 652  ARG A CB  1 
ATOM   4994 C  CG  . ARG A 1 652 ? 39.165 45.736 88.759  1.00 5.79  ? 652  ARG A CG  1 
ATOM   4995 C  CD  . ARG A 1 652 ? 38.159 46.539 89.511  1.00 6.48  ? 652  ARG A CD  1 
ATOM   4996 N  NE  . ARG A 1 652 ? 38.102 45.967 90.844  1.00 12.43 ? 652  ARG A NE  1 
ATOM   4997 C  CZ  . ARG A 1 652 ? 38.519 46.614 91.929  1.00 10.96 ? 652  ARG A CZ  1 
ATOM   4998 N  NH1 . ARG A 1 652 ? 38.956 47.869 91.850  1.00 14.39 ? 652  ARG A NH1 1 
ATOM   4999 N  NH2 . ARG A 1 652 ? 38.464 45.990 93.105  1.00 13.70 ? 652  ARG A NH2 1 
ATOM   5000 N  N   . HIS A 1 653 ? 41.559 47.156 86.104  1.00 15.19 ? 653  HIS A N   1 
ATOM   5001 C  CA  . HIS A 1 653 ? 42.979 47.466 86.203  1.00 13.86 ? 653  HIS A CA  1 
ATOM   5002 C  C   . HIS A 1 653 ? 43.249 48.943 85.984  1.00 12.68 ? 653  HIS A C   1 
ATOM   5003 O  O   . HIS A 1 653 ? 44.078 49.528 86.678  1.00 13.58 ? 653  HIS A O   1 
ATOM   5004 C  CB  . HIS A 1 653 ? 43.699 46.611 85.163  1.00 13.73 ? 653  HIS A CB  1 
ATOM   5005 C  CG  . HIS A 1 653 ? 45.208 46.798 85.081  1.00 13.64 ? 653  HIS A CG  1 
ATOM   5006 N  ND1 . HIS A 1 653 ? 45.879 47.244 84.025  1.00 16.89 ? 653  HIS A ND1 1 
ATOM   5007 C  CD2 . HIS A 1 653 ? 46.100 46.512 86.068  1.00 11.53 ? 653  HIS A CD2 1 
ATOM   5008 C  CE1 . HIS A 1 653 ? 47.131 47.226 84.365  1.00 13.52 ? 653  HIS A CE1 1 
ATOM   5009 N  NE2 . HIS A 1 653 ? 47.267 46.791 85.575  1.00 14.01 ? 653  HIS A NE2 1 
ATOM   5010 N  N   . LEU A 1 654 ? 42.629 49.582 85.009  1.00 13.47 ? 654  LEU A N   1 
ATOM   5011 C  CA  . LEU A 1 654 ? 42.846 50.985 84.759  1.00 10.72 ? 654  LEU A CA  1 
ATOM   5012 C  C   . LEU A 1 654 ? 42.027 51.971 85.593  1.00 10.75 ? 654  LEU A C   1 
ATOM   5013 O  O   . LEU A 1 654 ? 41.925 53.155 85.267  1.00 11.18 ? 654  LEU A O   1 
ATOM   5014 C  CB  . LEU A 1 654 ? 42.642 51.214 83.257  1.00 10.92 ? 654  LEU A CB  1 
ATOM   5015 C  CG  . LEU A 1 654 ? 43.646 50.512 82.355  1.00 13.12 ? 654  LEU A CG  1 
ATOM   5016 C  CD1 . LEU A 1 654 ? 43.562 51.136 80.982  1.00 12.95 ? 654  LEU A CD1 1 
ATOM   5017 C  CD2 . LEU A 1 654 ? 45.078 50.706 82.853  1.00 12.61 ? 654  LEU A CD2 1 
ATOM   5018 N  N   . GLY A 1 655 ? 41.485 51.526 86.724  1.00 10.74 ? 655  GLY A N   1 
ATOM   5019 C  CA  . GLY A 1 655 ? 40.862 52.407 87.685  1.00 12.72 ? 655  GLY A CA  1 
ATOM   5020 C  C   . GLY A 1 655 ? 39.351 52.625 87.578  1.00 14.45 ? 655  GLY A C   1 
ATOM   5021 O  O   . GLY A 1 655 ? 38.819 53.475 88.309  1.00 16.21 ? 655  GLY A O   1 
ATOM   5022 N  N   . GLY A 1 656 ? 38.667 51.869 86.724  1.00 16.58 ? 656  GLY A N   1 
ATOM   5023 C  CA  . GLY A 1 656 ? 37.225 51.929 86.564  1.00 16.78 ? 656  GLY A CA  1 
ATOM   5024 C  C   . GLY A 1 656 ? 36.514 51.369 87.764  1.00 16.19 ? 656  GLY A C   1 
ATOM   5025 O  O   . GLY A 1 656 ? 36.989 50.446 88.423  1.00 18.04 ? 656  GLY A O   1 
ATOM   5026 N  N   . ARG A 1 657 ? 35.368 51.950 88.033  1.00 17.08 ? 657  ARG A N   1 
ATOM   5027 C  CA  . ARG A 1 657 ? 34.575 51.596 89.203  1.00 18.28 ? 657  ARG A CA  1 
ATOM   5028 C  C   . ARG A 1 657 ? 33.191 51.008 88.875  1.00 18.00 ? 657  ARG A C   1 
ATOM   5029 O  O   . ARG A 1 657 ? 32.711 50.077 89.527  1.00 17.16 ? 657  ARG A O   1 
ATOM   5030 C  CB  . ARG A 1 657 ? 34.446 52.868 89.997  1.00 20.76 ? 657  ARG A CB  1 
ATOM   5031 C  CG  . ARG A 1 657 ? 35.182 52.960 91.272  1.00 25.86 ? 657  ARG A CG  1 
ATOM   5032 C  CD  . ARG A 1 657 ? 36.595 52.558 91.137  1.00 31.58 ? 657  ARG A CD  1 
ATOM   5033 N  NE  . ARG A 1 657 ? 36.828 51.695 92.271  1.00 38.65 ? 657  ARG A NE  1 
ATOM   5034 C  CZ  . ARG A 1 657 ? 38.021 51.585 92.880  1.00 44.67 ? 657  ARG A CZ  1 
ATOM   5035 N  NH1 . ARG A 1 657 ? 39.093 52.293 92.431  1.00 45.77 ? 657  ARG A NH1 1 
ATOM   5036 N  NH2 . ARG A 1 657 ? 38.118 50.725 93.922  1.00 46.10 ? 657  ARG A NH2 1 
ATOM   5037 N  N   . ALA A 1 658 ? 32.517 51.534 87.838  1.00 14.14 ? 658  ALA A N   1 
ATOM   5038 C  CA  . ALA A 1 658 ? 31.161 51.134 87.533  1.00 15.79 ? 658  ALA A CA  1 
ATOM   5039 C  C   . ALA A 1 658 ? 30.925 51.328 86.050  1.00 15.54 ? 658  ALA A C   1 
ATOM   5040 O  O   . ALA A 1 658 ? 31.679 52.093 85.428  1.00 13.82 ? 658  ALA A O   1 
ATOM   5041 C  CB  . ALA A 1 658 ? 30.182 51.996 88.346  1.00 11.33 ? 658  ALA A CB  1 
ATOM   5042 N  N   . ILE A 1 659 ? 29.947 50.609 85.479  1.00 12.17 ? 659  ILE A N   1 
ATOM   5043 C  CA  . ILE A 1 659 ? 29.614 50.688 84.069  1.00 12.17 ? 659  ILE A CA  1 
ATOM   5044 C  C   . ILE A 1 659 ? 28.104 50.847 84.165  1.00 12.67 ? 659  ILE A C   1 
ATOM   5045 O  O   . ILE A 1 659 ? 27.445 49.983 84.732  1.00 13.77 ? 659  ILE A O   1 
ATOM   5046 C  CB  . ILE A 1 659 ? 29.922 49.384 83.297  1.00 13.22 ? 659  ILE A CB  1 
ATOM   5047 C  CG1 . ILE A 1 659 ? 31.357 48.898 83.540  1.00 13.51 ? 659  ILE A CG1 1 
ATOM   5048 C  CG2 . ILE A 1 659 ? 29.670 49.655 81.810  1.00 10.87 ? 659  ILE A CG2 1 
ATOM   5049 C  CD1 . ILE A 1 659 ? 32.465 49.642 82.778  1.00 14.42 ? 659  ILE A CD1 1 
ATOM   5050 N  N   . ILE A 1 660 ? 27.508 51.925 83.678  1.00 14.49 ? 660  ILE A N   1 
ATOM   5051 C  CA  . ILE A 1 660 ? 26.096 52.205 83.830  1.00 13.72 ? 660  ILE A CA  1 
ATOM   5052 C  C   . ILE A 1 660 ? 25.566 52.232 82.415  1.00 13.67 ? 660  ILE A C   1 
ATOM   5053 O  O   . ILE A 1 660 ? 26.030 53.035 81.604  1.00 11.89 ? 660  ILE A O   1 
ATOM   5054 C  CB  . ILE A 1 660 ? 25.914 53.564 84.544  1.00 14.34 ? 660  ILE A CB  1 
ATOM   5055 C  CG1 . ILE A 1 660 ? 26.570 53.510 85.926  1.00 12.08 ? 660  ILE A CG1 1 
ATOM   5056 C  CG2 . ILE A 1 660 ? 24.403 53.873 84.657  1.00 13.67 ? 660  ILE A CG2 1 
ATOM   5057 C  CD1 . ILE A 1 660 ? 26.772 54.879 86.577  1.00 15.94 ? 660  ILE A CD1 1 
ATOM   5058 N  N   . THR A 1 661 ? 24.622 51.309 82.116  1.00 12.46 ? 661  THR A N   1 
ATOM   5059 C  CA  . THR A 1 661 ? 24.063 51.118 80.771  1.00 9.44  ? 661  THR A CA  1 
ATOM   5060 C  C   . THR A 1 661 ? 22.515 50.977 80.755  1.00 10.92 ? 661  THR A C   1 
ATOM   5061 O  O   . THR A 1 661 ? 21.856 50.887 81.811  1.00 9.74  ? 661  THR A O   1 
ATOM   5062 C  CB  . THR A 1 661 ? 24.686 49.836 80.127  1.00 9.56  ? 661  THR A CB  1 
ATOM   5063 O  OG1 . THR A 1 661 ? 24.110 48.717 80.808  1.00 9.19  ? 661  THR A OG1 1 
ATOM   5064 C  CG2 . THR A 1 661 ? 26.198 49.709 80.296  1.00 6.46  ? 661  THR A CG2 1 
ATOM   5065 N  N   . LYS A 1 662 ? 21.905 50.987 79.571  1.00 8.75  ? 662  LYS A N   1 
ATOM   5066 C  CA  . LYS A 1 662 ? 20.483 50.659 79.446  1.00 12.44 ? 662  LYS A CA  1 
ATOM   5067 C  C   . LYS A 1 662 ? 20.331 49.156 79.605  1.00 12.68 ? 662  LYS A C   1 
ATOM   5068 O  O   . LYS A 1 662 ? 19.450 48.719 80.338  1.00 12.97 ? 662  LYS A O   1 
ATOM   5069 C  CB  . LYS A 1 662 ? 19.967 51.089 78.107  1.00 10.18 ? 662  LYS A CB  1 
ATOM   5070 C  CG  . LYS A 1 662 ? 19.882 52.593 78.101  1.00 11.45 ? 662  LYS A CG  1 
ATOM   5071 C  CD  . LYS A 1 662 ? 19.634 52.820 76.660  1.00 13.12 ? 662  LYS A CD  1 
ATOM   5072 C  CE  . LYS A 1 662 ? 19.501 54.288 76.472  1.00 15.95 ? 662  LYS A CE  1 
ATOM   5073 N  NZ  . LYS A 1 662 ? 19.516 54.546 75.053  1.00 20.04 ? 662  LYS A NZ  1 
ATOM   5074 N  N   . SER A 1 663 ? 21.165 48.314 78.998  1.00 11.07 ? 663  SER A N   1 
ATOM   5075 C  CA  . SER A 1 663 ? 21.125 46.905 79.354  1.00 10.37 ? 663  SER A CA  1 
ATOM   5076 C  C   . SER A 1 663 ? 22.474 46.237 79.139  1.00 9.78  ? 663  SER A C   1 
ATOM   5077 O  O   . SER A 1 663 ? 23.317 46.767 78.400  1.00 11.93 ? 663  SER A O   1 
ATOM   5078 C  CB  . SER A 1 663 ? 20.072 46.197 78.526  1.00 6.78  ? 663  SER A CB  1 
ATOM   5079 O  OG  . SER A 1 663 ? 20.323 46.430 77.144  1.00 10.63 ? 663  SER A OG  1 
ATOM   5080 N  N   . PHE A 1 664 ? 22.702 45.030 79.652  1.00 9.60  ? 664  PHE A N   1 
ATOM   5081 C  CA  . PHE A 1 664 ? 23.938 44.274 79.497  1.00 12.97 ? 664  PHE A CA  1 
ATOM   5082 C  C   . PHE A 1 664 ? 23.640 42.950 78.850  1.00 15.31 ? 664  PHE A C   1 
ATOM   5083 O  O   . PHE A 1 664 ? 22.562 42.362 79.016  1.00 13.25 ? 664  PHE A O   1 
ATOM   5084 C  CB  . PHE A 1 664 ? 24.591 43.866 80.801  1.00 9.76  ? 664  PHE A CB  1 
ATOM   5085 C  CG  . PHE A 1 664 ? 25.195 45.019 81.542  1.00 13.25 ? 664  PHE A CG  1 
ATOM   5086 C  CD1 . PHE A 1 664 ? 26.464 45.437 81.182  1.00 11.42 ? 664  PHE A CD1 1 
ATOM   5087 C  CD2 . PHE A 1 664 ? 24.479 45.632 82.570  1.00 14.49 ? 664  PHE A CD2 1 
ATOM   5088 C  CE1 . PHE A 1 664 ? 27.013 46.495 81.879  1.00 13.27 ? 664  PHE A CE1 1 
ATOM   5089 C  CE2 . PHE A 1 664 ? 25.051 46.686 83.250  1.00 12.02 ? 664  PHE A CE2 1 
ATOM   5090 C  CZ  . PHE A 1 664 ? 26.319 47.120 82.908  1.00 10.81 ? 664  PHE A CZ  1 
ATOM   5091 N  N   . ALA A 1 665 ? 24.631 42.478 78.103  1.00 13.61 ? 665  ALA A N   1 
ATOM   5092 C  CA  . ALA A 1 665 ? 24.599 41.091 77.691  1.00 12.15 ? 665  ALA A CA  1 
ATOM   5093 C  C   . ALA A 1 665 ? 25.015 40.306 78.938  1.00 11.23 ? 665  ALA A C   1 
ATOM   5094 O  O   . ALA A 1 665 ? 25.818 40.784 79.757  1.00 15.19 ? 665  ALA A O   1 
ATOM   5095 C  CB  . ALA A 1 665 ? 25.567 40.908 76.555  1.00 8.16  ? 665  ALA A CB  1 
ATOM   5096 N  N   . ARG A 1 666 ? 24.503 39.083 79.098  1.00 11.53 ? 666  ARG A N   1 
ATOM   5097 C  CA  . ARG A 1 666 ? 24.678 38.248 80.274  1.00 12.51 ? 666  ARG A CA  1 
ATOM   5098 C  C   . ARG A 1 666 ? 26.092 37.938 80.675  1.00 10.19 ? 666  ARG A C   1 
ATOM   5099 O  O   . ARG A 1 666 ? 26.427 38.120 81.847  1.00 9.81  ? 666  ARG A O   1 
ATOM   5100 C  CB  . ARG A 1 666 ? 23.932 36.936 80.064  1.00 9.27  ? 666  ARG A CB  1 
ATOM   5101 C  CG  . ARG A 1 666 ? 23.919 35.825 81.135  1.00 14.19 ? 666  ARG A CG  1 
ATOM   5102 C  CD  . ARG A 1 666 ? 23.728 34.491 80.316  1.00 16.34 ? 666  ARG A CD  1 
ATOM   5103 N  NE  . ARG A 1 666 ? 24.658 33.585 80.897  1.00 20.48 ? 666  ARG A NE  1 
ATOM   5104 C  CZ  . ARG A 1 666 ? 25.680 32.950 80.316  1.00 16.78 ? 666  ARG A CZ  1 
ATOM   5105 N  NH1 . ARG A 1 666 ? 25.772 32.646 79.015  1.00 14.76 ? 666  ARG A NH1 1 
ATOM   5106 N  NH2 . ARG A 1 666 ? 26.527 32.388 81.165  1.00 15.91 ? 666  ARG A NH2 1 
ATOM   5107 N  N   . ILE A 1 667 ? 26.924 37.445 79.761  1.00 8.57  ? 667  ILE A N   1 
ATOM   5108 C  CA  . ILE A 1 667 ? 28.241 36.980 80.251  1.00 11.14 ? 667  ILE A CA  1 
ATOM   5109 C  C   . ILE A 1 667 ? 29.069 38.180 80.694  1.00 11.98 ? 667  ILE A C   1 
ATOM   5110 O  O   . ILE A 1 667 ? 29.667 38.139 81.767  1.00 17.47 ? 667  ILE A O   1 
ATOM   5111 C  CB  . ILE A 1 667 ? 29.010 36.172 79.163  1.00 10.49 ? 667  ILE A CB  1 
ATOM   5112 C  CG1 . ILE A 1 667 ? 28.220 34.926 78.803  1.00 8.60  ? 667  ILE A CG1 1 
ATOM   5113 C  CG2 . ILE A 1 667 ? 30.389 35.758 79.676  1.00 9.87  ? 667  ILE A CG2 1 
ATOM   5114 C  CD1 . ILE A 1 667 ? 28.609 34.342 77.404  1.00 10.68 ? 667  ILE A CD1 1 
ATOM   5115 N  N   . HIS A 1 668 ? 29.016 39.311 79.997  1.00 13.31 ? 668  HIS A N   1 
ATOM   5116 C  CA  . HIS A 1 668 ? 29.779 40.471 80.379  1.00 9.95  ? 668  HIS A CA  1 
ATOM   5117 C  C   . HIS A 1 668 ? 29.347 41.014 81.711  1.00 12.18 ? 668  HIS A C   1 
ATOM   5118 O  O   . HIS A 1 668 ? 30.218 41.404 82.495  1.00 10.81 ? 668  HIS A O   1 
ATOM   5119 C  CB  . HIS A 1 668 ? 29.649 41.508 79.296  1.00 11.54 ? 668  HIS A CB  1 
ATOM   5120 C  CG  . HIS A 1 668 ? 30.631 42.627 79.584  1.00 12.31 ? 668  HIS A CG  1 
ATOM   5121 N  ND1 . HIS A 1 668 ? 31.933 42.498 79.790  1.00 14.07 ? 668  HIS A ND1 1 
ATOM   5122 C  CD2 . HIS A 1 668 ? 30.312 43.947 79.759  1.00 13.09 ? 668  HIS A CD2 1 
ATOM   5123 C  CE1 . HIS A 1 668 ? 32.391 43.685 80.087  1.00 13.50 ? 668  HIS A CE1 1 
ATOM   5124 N  NE2 . HIS A 1 668 ? 31.429 44.554 80.068  1.00 13.30 ? 668  HIS A NE2 1 
ATOM   5125 N  N   . GLU A 1 669 ? 28.045 41.016 82.007  1.00 10.86 ? 669  GLU A N   1 
ATOM   5126 C  CA  . GLU A 1 669 ? 27.573 41.465 83.287  1.00 11.62 ? 669  GLU A CA  1 
ATOM   5127 C  C   . GLU A 1 669 ? 28.080 40.571 84.411  1.00 8.83  ? 669  GLU A C   1 
ATOM   5128 O  O   . GLU A 1 669 ? 28.466 41.059 85.479  1.00 9.40  ? 669  GLU A O   1 
ATOM   5129 C  CB  . GLU A 1 669 ? 26.064 41.470 83.299  1.00 11.37 ? 669  GLU A CB  1 
ATOM   5130 C  CG  . GLU A 1 669 ? 25.578 42.082 84.616  1.00 15.67 ? 669  GLU A CG  1 
ATOM   5131 C  CD  . GLU A 1 669 ? 24.076 42.013 84.874  1.00 18.88 ? 669  GLU A CD  1 
ATOM   5132 O  OE1 . GLU A 1 669 ? 23.332 41.525 84.036  1.00 21.81 ? 669  GLU A OE1 1 
ATOM   5133 O  OE2 . GLU A 1 669 ? 23.628 42.427 85.942  1.00 17.28 ? 669  GLU A OE2 1 
ATOM   5134 N  N   . THR A 1 670 ? 28.060 39.247 84.232  1.00 8.11  ? 670  THR A N   1 
ATOM   5135 C  CA  . THR A 1 670 ? 28.637 38.370 85.225  1.00 11.41 ? 670  THR A CA  1 
ATOM   5136 C  C   . THR A 1 670 ? 30.145 38.613 85.374  1.00 9.88  ? 670  THR A C   1 
ATOM   5137 O  O   . THR A 1 670 ? 30.614 38.689 86.508  1.00 10.38 ? 670  THR A O   1 
ATOM   5138 C  CB  . THR A 1 670 ? 28.363 36.875 84.852  1.00 12.36 ? 670  THR A CB  1 
ATOM   5139 O  OG1 . THR A 1 670 ? 26.948 36.704 84.791  1.00 14.36 ? 670  THR A OG1 1 
ATOM   5140 C  CG2 . THR A 1 670 ? 28.965 35.917 85.873  1.00 10.62 ? 670  THR A CG2 1 
ATOM   5141 N  N   . ASN A 1 671 ? 30.923 38.749 84.304  1.00 9.56  ? 671  ASN A N   1 
ATOM   5142 C  CA  . ASN A 1 671 ? 32.365 39.026 84.354  1.00 10.32 ? 671  ASN A CA  1 
ATOM   5143 C  C   . ASN A 1 671 ? 32.623 40.317 85.084  1.00 12.15 ? 671  ASN A C   1 
ATOM   5144 O  O   . ASN A 1 671 ? 33.535 40.337 85.898  1.00 13.26 ? 671  ASN A O   1 
ATOM   5145 C  CB  . ASN A 1 671 ? 32.931 39.106 82.932  1.00 9.68  ? 671  ASN A CB  1 
ATOM   5146 C  CG  . ASN A 1 671 ? 32.936 37.760 82.234  1.00 10.25 ? 671  ASN A CG  1 
ATOM   5147 O  OD1 . ASN A 1 671 ? 33.129 37.666 81.016  1.00 14.76 ? 671  ASN A OD1 1 
ATOM   5148 N  ND2 . ASN A 1 671 ? 32.738 36.647 82.930  1.00 7.37  ? 671  ASN A ND2 1 
ATOM   5149 N  N   . LEU A 1 672 ? 31.796 41.373 84.901  1.00 12.38 ? 672  LEU A N   1 
ATOM   5150 C  CA  . LEU A 1 672 ? 31.940 42.629 85.595  1.00 10.32 ? 672  LEU A CA  1 
ATOM   5151 C  C   . LEU A 1 672 ? 31.753 42.466 87.077  1.00 9.57  ? 672  LEU A C   1 
ATOM   5152 O  O   . LEU A 1 672 ? 32.590 42.980 87.827  1.00 11.17 ? 672  LEU A O   1 
ATOM   5153 C  CB  . LEU A 1 672 ? 30.938 43.661 85.099  1.00 10.26 ? 672  LEU A CB  1 
ATOM   5154 C  CG  . LEU A 1 672 ? 31.147 44.247 83.733  1.00 11.17 ? 672  LEU A CG  1 
ATOM   5155 C  CD1 . LEU A 1 672 ? 29.985 45.147 83.415  1.00 9.96  ? 672  LEU A CD1 1 
ATOM   5156 C  CD2 . LEU A 1 672 ? 32.449 45.042 83.698  1.00 5.82  ? 672  LEU A CD2 1 
ATOM   5157 N  N   . LYS A 1 673 ? 30.739 41.736 87.555  1.00 10.14 ? 673  LYS A N   1 
ATOM   5158 C  CA  . LYS A 1 673 ? 30.567 41.504 88.991  1.00 6.94  ? 673  LYS A CA  1 
ATOM   5159 C  C   . LYS A 1 673 ? 31.715 40.653 89.534  1.00 8.31  ? 673  LYS A C   1 
ATOM   5160 O  O   . LYS A 1 673 ? 32.175 40.828 90.672  1.00 11.35 ? 673  LYS A O   1 
ATOM   5161 C  CB  . LYS A 1 673 ? 29.257 40.758 89.283  1.00 8.56  ? 673  LYS A CB  1 
ATOM   5162 C  CG  . LYS A 1 673 ? 27.966 41.440 88.886  1.00 11.79 ? 673  LYS A CG  1 
ATOM   5163 C  CD  . LYS A 1 673 ? 26.917 40.376 89.128  1.00 8.90  ? 673  LYS A CD  1 
ATOM   5164 C  CE  . LYS A 1 673 ? 25.592 40.874 88.621  1.00 15.85 ? 673  LYS A CE  1 
ATOM   5165 N  NZ  . LYS A 1 673 ? 24.561 39.874 88.726  1.00 13.73 ? 673  LYS A NZ  1 
ATOM   5166 N  N   . LYS A 1 674 ? 32.203 39.673 88.768  1.00 9.21  ? 674  LYS A N   1 
ATOM   5167 C  CA  . LYS A 1 674 ? 33.306 38.814 89.172  1.00 11.62 ? 674  LYS A CA  1 
ATOM   5168 C  C   . LYS A 1 674 ? 34.611 39.563 89.496  1.00 13.44 ? 674  LYS A C   1 
ATOM   5169 O  O   . LYS A 1 674 ? 35.374 39.172 90.395  1.00 15.37 ? 674  LYS A O   1 
ATOM   5170 C  CB  . LYS A 1 674 ? 33.602 37.813 88.069  1.00 13.13 ? 674  LYS A CB  1 
ATOM   5171 C  CG  . LYS A 1 674 ? 32.773 36.556 88.029  1.00 14.07 ? 674  LYS A CG  1 
ATOM   5172 C  CD  . LYS A 1 674 ? 32.932 35.765 89.319  1.00 12.34 ? 674  LYS A CD  1 
ATOM   5173 C  CE  . LYS A 1 674 ? 32.408 34.349 89.132  1.00 13.47 ? 674  LYS A CE  1 
ATOM   5174 N  NZ  . LYS A 1 674 ? 32.646 33.507 90.280  1.00 15.37 ? 674  LYS A NZ  1 
ATOM   5175 N  N   . GLN A 1 675 ? 34.851 40.674 88.779  1.00 13.63 ? 675  GLN A N   1 
ATOM   5176 C  CA  . GLN A 1 675 ? 36.058 41.484 88.925  1.00 11.51 ? 675  GLN A CA  1 
ATOM   5177 C  C   . GLN A 1 675 ? 35.862 42.669 89.838  1.00 14.96 ? 675  GLN A C   1 
ATOM   5178 O  O   . GLN A 1 675 ? 36.676 43.595 89.826  1.00 14.41 ? 675  GLN A O   1 
ATOM   5179 C  CB  . GLN A 1 675 ? 36.545 41.966 87.535  1.00 8.81  ? 675  GLN A CB  1 
ATOM   5180 C  CG  . GLN A 1 675 ? 36.853 40.765 86.607  1.00 9.55  ? 675  GLN A CG  1 
ATOM   5181 C  CD  . GLN A 1 675 ? 37.736 39.702 87.334  1.00 14.09 ? 675  GLN A CD  1 
ATOM   5182 O  OE1 . GLN A 1 675 ? 37.692 38.500 87.043  1.00 14.08 ? 675  GLN A OE1 1 
ATOM   5183 N  NE2 . GLN A 1 675 ? 38.573 40.028 88.320  1.00 11.22 ? 675  GLN A NE2 1 
ATOM   5184 N  N   . GLY A 1 676 ? 34.786 42.649 90.649  1.00 15.24 ? 676  GLY A N   1 
ATOM   5185 C  CA  . GLY A 1 676 ? 34.555 43.697 91.630  1.00 15.11 ? 676  GLY A CA  1 
ATOM   5186 C  C   . GLY A 1 676 ? 34.102 45.074 91.107  1.00 15.04 ? 676  GLY A C   1 
ATOM   5187 O  O   . GLY A 1 676 ? 34.208 46.087 91.840  1.00 14.97 ? 676  GLY A O   1 
ATOM   5188 N  N   . LEU A 1 677 ? 33.600 45.147 89.863  1.00 14.03 ? 677  LEU A N   1 
ATOM   5189 C  CA  . LEU A 1 677 ? 33.016 46.380 89.319  1.00 12.14 ? 677  LEU A CA  1 
ATOM   5190 C  C   . LEU A 1 677 ? 31.512 46.373 89.565  1.00 11.66 ? 677  LEU A C   1 
ATOM   5191 O  O   . LEU A 1 677 ? 30.921 45.337 89.885  1.00 13.18 ? 677  LEU A O   1 
ATOM   5192 C  CB  . LEU A 1 677 ? 33.296 46.470 87.819  1.00 13.40 ? 677  LEU A CB  1 
ATOM   5193 C  CG  . LEU A 1 677 ? 34.767 46.686 87.482  1.00 12.93 ? 677  LEU A CG  1 
ATOM   5194 C  CD1 . LEU A 1 677 ? 35.129 46.067 86.183  1.00 14.40 ? 677  LEU A CD1 1 
ATOM   5195 C  CD2 . LEU A 1 677 ? 35.022 48.131 87.260  1.00 14.32 ? 677  LEU A CD2 1 
ATOM   5196 N  N   . LEU A 1 678 ? 30.864 47.525 89.450  1.00 12.89 ? 678  LEU A N   1 
ATOM   5197 C  CA  . LEU A 1 678 ? 29.438 47.631 89.625  1.00 10.62 ? 678  LEU A CA  1 
ATOM   5198 C  C   . LEU A 1 678 ? 28.736 47.710 88.293  1.00 10.85 ? 678  LEU A C   1 
ATOM   5199 O  O   . LEU A 1 678 ? 28.714 48.816 87.747  1.00 10.97 ? 678  LEU A O   1 
ATOM   5200 C  CB  . LEU A 1 678 ? 29.139 48.863 90.392  1.00 9.84  ? 678  LEU A CB  1 
ATOM   5201 C  CG  . LEU A 1 678 ? 29.345 48.800 91.863  1.00 11.62 ? 678  LEU A CG  1 
ATOM   5202 C  CD1 . LEU A 1 678 ? 29.131 50.196 92.405  1.00 10.58 ? 678  LEU A CD1 1 
ATOM   5203 C  CD2 . LEU A 1 678 ? 28.440 47.753 92.470  1.00 9.49  ? 678  LEU A CD2 1 
ATOM   5204 N  N   . PRO A 1 679 ? 28.141 46.669 87.680  1.00 10.20 ? 679  PRO A N   1 
ATOM   5205 C  CA  . PRO A 1 679 ? 27.339 46.826 86.478  1.00 11.03 ? 679  PRO A CA  1 
ATOM   5206 C  C   . PRO A 1 679 ? 25.935 47.275 86.893  1.00 13.49 ? 679  PRO A C   1 
ATOM   5207 O  O   . PRO A 1 679 ? 25.214 46.538 87.596  1.00 14.86 ? 679  PRO A O   1 
ATOM   5208 C  CB  . PRO A 1 679 ? 27.442 45.469 85.837  1.00 8.75  ? 679  PRO A CB  1 
ATOM   5209 C  CG  . PRO A 1 679 ? 27.496 44.510 86.983  1.00 9.77  ? 679  PRO A CG  1 
ATOM   5210 C  CD  . PRO A 1 679 ? 28.224 45.274 88.074  1.00 9.17  ? 679  PRO A CD  1 
ATOM   5211 N  N   . LEU A 1 680 ? 25.537 48.496 86.496  1.00 14.28 ? 680  LEU A N   1 
ATOM   5212 C  CA  . LEU A 1 680 ? 24.251 49.060 86.920  1.00 14.34 ? 680  LEU A CA  1 
ATOM   5213 C  C   . LEU A 1 680 ? 23.410 49.440 85.705  1.00 13.00 ? 680  LEU A C   1 
ATOM   5214 O  O   . LEU A 1 680 ? 23.977 49.795 84.663  1.00 13.02 ? 680  LEU A O   1 
ATOM   5215 C  CB  . LEU A 1 680 ? 24.512 50.284 87.804  1.00 11.32 ? 680  LEU A CB  1 
ATOM   5216 C  CG  . LEU A 1 680 ? 25.370 49.978 89.043  1.00 12.53 ? 680  LEU A CG  1 
ATOM   5217 C  CD1 . LEU A 1 680 ? 25.787 51.258 89.726  1.00 9.26  ? 680  LEU A CD1 1 
ATOM   5218 C  CD2 . LEU A 1 680 ? 24.617 49.059 89.970  1.00 11.37 ? 680  LEU A CD2 1 
ATOM   5219 N  N   . THR A 1 681 ? 22.086 49.280 85.718  1.00 11.13 ? 681  THR A N   1 
ATOM   5220 C  CA  . THR A 1 681 ? 21.286 49.750 84.587  1.00 13.47 ? 681  THR A CA  1 
ATOM   5221 C  C   . THR A 1 681 ? 20.390 50.921 85.019  1.00 13.07 ? 681  THR A C   1 
ATOM   5222 O  O   . THR A 1 681 ? 20.030 51.036 86.204  1.00 13.15 ? 681  THR A O   1 
ATOM   5223 C  CB  . THR A 1 681 ? 20.425 48.587 84.048  1.00 9.74  ? 681  THR A CB  1 
ATOM   5224 O  OG1 . THR A 1 681 ? 19.729 48.051 85.189  1.00 12.59 ? 681  THR A OG1 1 
ATOM   5225 C  CG2 . THR A 1 681 ? 21.264 47.561 83.317  1.00 9.53  ? 681  THR A CG2 1 
ATOM   5226 N  N   . PHE A 1 682 ? 20.015 51.793 84.100  1.00 12.86 ? 682  PHE A N   1 
ATOM   5227 C  CA  . PHE A 1 682 ? 19.093 52.892 84.396  1.00 14.51 ? 682  PHE A CA  1 
ATOM   5228 C  C   . PHE A 1 682 ? 17.738 52.294 84.770  1.00 15.85 ? 682  PHE A C   1 
ATOM   5229 O  O   . PHE A 1 682 ? 17.244 51.405 84.054  1.00 15.72 ? 682  PHE A O   1 
ATOM   5230 C  CB  . PHE A 1 682 ? 18.944 53.748 83.164  1.00 9.70  ? 682  PHE A CB  1 
ATOM   5231 C  CG  . PHE A 1 682 ? 20.236 54.443 82.782  1.00 14.15 ? 682  PHE A CG  1 
ATOM   5232 C  CD1 . PHE A 1 682 ? 20.698 55.513 83.543  1.00 12.14 ? 682  PHE A CD1 1 
ATOM   5233 C  CD2 . PHE A 1 682 ? 20.901 54.023 81.646  1.00 12.06 ? 682  PHE A CD2 1 
ATOM   5234 C  CE1 . PHE A 1 682 ? 21.835 56.164 83.144  1.00 13.81 ? 682  PHE A CE1 1 
ATOM   5235 C  CE2 . PHE A 1 682 ? 22.041 54.682 81.261  1.00 13.15 ? 682  PHE A CE2 1 
ATOM   5236 C  CZ  . PHE A 1 682 ? 22.505 55.753 82.005  1.00 12.51 ? 682  PHE A CZ  1 
ATOM   5237 N  N   . ALA A 1 683 ? 17.125 52.734 85.866  1.00 15.41 ? 683  ALA A N   1 
ATOM   5238 C  CA  . ALA A 1 683 ? 15.760 52.339 86.176  1.00 16.04 ? 683  ALA A CA  1 
ATOM   5239 C  C   . ALA A 1 683 ? 14.882 52.950 85.088  1.00 17.71 ? 683  ALA A C   1 
ATOM   5240 O  O   . ALA A 1 683 ? 13.863 52.351 84.744  1.00 23.13 ? 683  ALA A O   1 
ATOM   5241 C  CB  . ALA A 1 683 ? 15.292 52.886 87.531  1.00 13.27 ? 683  ALA A CB  1 
ATOM   5242 N  N   . ASP A 1 684 ? 15.189 54.112 84.498  1.00 18.31 ? 684  ASP A N   1 
ATOM   5243 C  CA  . ASP A 1 684 ? 14.462 54.658 83.371  1.00 18.06 ? 684  ASP A CA  1 
ATOM   5244 C  C   . ASP A 1 684 ? 15.491 54.913 82.307  1.00 17.49 ? 684  ASP A C   1 
ATOM   5245 O  O   . ASP A 1 684 ? 16.274 55.854 82.414  1.00 19.86 ? 684  ASP A O   1 
ATOM   5246 C  CB  . ASP A 1 684 ? 13.779 55.999 83.677  1.00 19.90 ? 684  ASP A CB  1 
ATOM   5247 C  CG  . ASP A 1 684 ? 13.138 56.795 82.510  1.00 21.29 ? 684  ASP A CG  1 
ATOM   5248 O  OD1 . ASP A 1 684 ? 13.168 56.397 81.336  1.00 23.06 ? 684  ASP A OD1 1 
ATOM   5249 O  OD2 . ASP A 1 684 ? 12.618 57.880 82.764  1.00 24.17 ? 684  ASP A OD2 1 
ATOM   5250 N  N   . PRO A 1 685 ? 15.587 54.113 81.256  1.00 18.82 ? 685  PRO A N   1 
ATOM   5251 C  CA  . PRO A 1 685 ? 16.518 54.340 80.160  1.00 18.73 ? 685  PRO A CA  1 
ATOM   5252 C  C   . PRO A 1 685 ? 16.592 55.722 79.551  1.00 21.36 ? 685  PRO A C   1 
ATOM   5253 O  O   . PRO A 1 685 ? 17.603 56.018 78.902  1.00 19.10 ? 685  PRO A O   1 
ATOM   5254 C  CB  . PRO A 1 685 ? 16.165 53.316 79.131  1.00 19.09 ? 685  PRO A CB  1 
ATOM   5255 C  CG  . PRO A 1 685 ? 14.754 52.943 79.497  1.00 19.22 ? 685  PRO A CG  1 
ATOM   5256 C  CD  . PRO A 1 685 ? 14.724 52.963 81.015  1.00 16.93 ? 685  PRO A CD  1 
ATOM   5257 N  N   . ALA A 1 686 ? 15.601 56.599 79.730  1.00 20.40 ? 686  ALA A N   1 
ATOM   5258 C  CA  . ALA A 1 686 ? 15.680 57.936 79.197  1.00 20.30 ? 686  ALA A CA  1 
ATOM   5259 C  C   . ALA A 1 686 ? 16.670 58.763 79.997  1.00 19.66 ? 686  ALA A C   1 
ATOM   5260 O  O   . ALA A 1 686 ? 17.181 59.776 79.500  1.00 21.16 ? 686  ALA A O   1 
ATOM   5261 C  CB  . ALA A 1 686 ? 14.325 58.607 79.263  1.00 22.88 ? 686  ALA A CB  1 
ATOM   5262 N  N   . ASP A 1 687 ? 17.007 58.356 81.214  1.00 18.25 ? 687  ASP A N   1 
ATOM   5263 C  CA  . ASP A 1 687 ? 18.038 59.015 81.970  1.00 17.00 ? 687  ASP A CA  1 
ATOM   5264 C  C   . ASP A 1 687 ? 19.439 58.993 81.376  1.00 16.65 ? 687  ASP A C   1 
ATOM   5265 O  O   . ASP A 1 687 ? 20.310 59.784 81.731  1.00 16.65 ? 687  ASP A O   1 
ATOM   5266 C  CB  . ASP A 1 687 ? 18.013 58.413 83.355  1.00 18.31 ? 687  ASP A CB  1 
ATOM   5267 C  CG  . ASP A 1 687 ? 16.826 58.867 84.161  1.00 18.96 ? 687  ASP A CG  1 
ATOM   5268 O  OD1 . ASP A 1 687 ? 16.169 59.841 83.760  1.00 24.90 ? 687  ASP A OD1 1 
ATOM   5269 O  OD2 . ASP A 1 687 ? 16.592 58.242 85.207  1.00 17.76 ? 687  ASP A OD2 1 
ATOM   5270 N  N   . TYR A 1 688 ? 19.665 58.187 80.360  1.00 15.75 ? 688  TYR A N   1 
ATOM   5271 C  CA  . TYR A 1 688 ? 20.912 58.193 79.648  1.00 17.20 ? 688  TYR A CA  1 
ATOM   5272 C  C   . TYR A 1 688 ? 21.108 59.574 79.021  1.00 21.32 ? 688  TYR A C   1 
ATOM   5273 O  O   . TYR A 1 688 ? 22.242 60.042 78.821  1.00 20.48 ? 688  TYR A O   1 
ATOM   5274 C  CB  . TYR A 1 688 ? 20.817 57.102 78.627  1.00 12.36 ? 688  TYR A CB  1 
ATOM   5275 C  CG  . TYR A 1 688 ? 21.903 57.067 77.569  1.00 17.04 ? 688  TYR A CG  1 
ATOM   5276 C  CD1 . TYR A 1 688 ? 21.701 57.794 76.421  1.00 16.59 ? 688  TYR A CD1 1 
ATOM   5277 C  CD2 . TYR A 1 688 ? 23.044 56.281 77.716  1.00 15.15 ? 688  TYR A CD2 1 
ATOM   5278 C  CE1 . TYR A 1 688 ? 22.621 57.737 75.406  1.00 17.32 ? 688  TYR A CE1 1 
ATOM   5279 C  CE2 . TYR A 1 688 ? 23.972 56.227 76.690  1.00 15.12 ? 688  TYR A CE2 1 
ATOM   5280 C  CZ  . TYR A 1 688 ? 23.744 56.955 75.543  1.00 18.06 ? 688  TYR A CZ  1 
ATOM   5281 O  OH  . TYR A 1 688 ? 24.618 56.917 74.484  1.00 20.64 ? 688  TYR A OH  1 
ATOM   5282 N  N   . ASN A 1 689 ? 20.012 60.251 78.681  1.00 23.07 ? 689  ASN A N   1 
ATOM   5283 C  CA  . ASN A 1 689 ? 20.060 61.567 78.053  1.00 22.54 ? 689  ASN A CA  1 
ATOM   5284 C  C   . ASN A 1 689 ? 20.313 62.734 78.977  1.00 19.17 ? 689  ASN A C   1 
ATOM   5285 O  O   . ASN A 1 689 ? 20.657 63.832 78.532  1.00 21.94 ? 689  ASN A O   1 
ATOM   5286 C  CB  . ASN A 1 689 ? 18.772 61.810 77.308  1.00 26.10 ? 689  ASN A CB  1 
ATOM   5287 C  CG  . ASN A 1 689 ? 18.593 60.760 76.220  1.00 30.69 ? 689  ASN A CG  1 
ATOM   5288 O  OD1 . ASN A 1 689 ? 19.487 60.504 75.417  1.00 33.20 ? 689  ASN A OD1 1 
ATOM   5289 N  ND2 . ASN A 1 689 ? 17.482 60.037 76.203  1.00 34.76 ? 689  ASN A ND2 1 
ATOM   5290 N  N   . LYS A 1 690 ? 20.214 62.495 80.279  1.00 18.78 ? 690  LYS A N   1 
ATOM   5291 C  CA  . LYS A 1 690 ? 20.475 63.473 81.327  1.00 21.98 ? 690  LYS A CA  1 
ATOM   5292 C  C   . LYS A 1 690 ? 21.941 63.622 81.728  1.00 22.79 ? 690  LYS A C   1 
ATOM   5293 O  O   . LYS A 1 690 ? 22.323 64.559 82.437  1.00 22.42 ? 690  LYS A O   1 
ATOM   5294 C  CB  . LYS A 1 690 ? 19.742 63.119 82.598  1.00 23.09 ? 690  LYS A CB  1 
ATOM   5295 C  CG  . LYS A 1 690 ? 18.251 63.295 82.520  1.00 29.22 ? 690  LYS A CG  1 
ATOM   5296 C  CD  . LYS A 1 690 ? 17.738 62.821 83.875  1.00 34.61 ? 690  LYS A CD  1 
ATOM   5297 C  CE  . LYS A 1 690 ? 16.233 63.094 84.008  1.00 39.04 ? 690  LYS A CE  1 
ATOM   5298 N  NZ  . LYS A 1 690 ? 15.627 62.213 85.010  1.00 42.62 ? 690  LYS A NZ  1 
ATOM   5299 N  N   . ILE A 1 691 ? 22.731 62.634 81.313  1.00 23.29 ? 691  ILE A N   1 
ATOM   5300 C  CA  . ILE A 1 691 ? 24.129 62.542 81.627  1.00 21.84 ? 691  ILE A CA  1 
ATOM   5301 C  C   . ILE A 1 691 ? 24.912 62.934 80.382  1.00 22.06 ? 691  ILE A C   1 
ATOM   5302 O  O   . ILE A 1 691 ? 24.770 62.378 79.283  1.00 24.00 ? 691  ILE A O   1 
ATOM   5303 C  CB  . ILE A 1 691 ? 24.478 61.093 82.053  1.00 22.13 ? 691  ILE A CB  1 
ATOM   5304 C  CG1 . ILE A 1 691 ? 23.684 60.691 83.275  1.00 21.47 ? 691  ILE A CG1 1 
ATOM   5305 C  CG2 . ILE A 1 691 ? 25.939 61.006 82.411  1.00 21.61 ? 691  ILE A CG2 1 
ATOM   5306 C  CD1 . ILE A 1 691 ? 23.964 59.295 83.870  1.00 20.75 ? 691  ILE A CD1 1 
ATOM   5307 N  N   . HIS A 1 692 ? 25.748 63.940 80.596  1.00 23.36 ? 692  HIS A N   1 
ATOM   5308 C  CA  . HIS A 1 692 ? 26.660 64.528 79.622  1.00 23.76 ? 692  HIS A CA  1 
ATOM   5309 C  C   . HIS A 1 692 ? 28.054 64.130 80.074  1.00 20.95 ? 692  HIS A C   1 
ATOM   5310 O  O   . HIS A 1 692 ? 28.296 64.032 81.288  1.00 16.14 ? 692  HIS A O   1 
ATOM   5311 C  CB  . HIS A 1 692 ? 26.596 66.037 79.636  1.00 30.54 ? 692  HIS A CB  1 
ATOM   5312 C  CG  . HIS A 1 692 ? 25.146 66.446 79.686  1.00 39.62 ? 692  HIS A CG  1 
ATOM   5313 N  ND1 . HIS A 1 692 ? 24.522 66.905 80.776  1.00 42.68 ? 692  HIS A ND1 1 
ATOM   5314 C  CD2 . HIS A 1 692 ? 24.254 66.271 78.656  1.00 40.78 ? 692  HIS A CD2 1 
ATOM   5315 C  CE1 . HIS A 1 692 ? 23.251 67.001 80.426  1.00 43.77 ? 692  HIS A CE1 1 
ATOM   5316 N  NE2 . HIS A 1 692 ? 23.115 66.621 79.164  1.00 42.85 ? 692  HIS A NE2 1 
ATOM   5317 N  N   . PRO A 1 693 ? 29.007 63.968 79.132  1.00 20.56 ? 693  PRO A N   1 
ATOM   5318 C  CA  . PRO A 1 693 ? 30.433 63.692 79.385  1.00 20.02 ? 693  PRO A CA  1 
ATOM   5319 C  C   . PRO A 1 693 ? 31.084 64.512 80.499  1.00 20.02 ? 693  PRO A C   1 
ATOM   5320 O  O   . PRO A 1 693 ? 31.962 64.039 81.221  1.00 25.11 ? 693  PRO A O   1 
ATOM   5321 C  CB  . PRO A 1 693 ? 31.085 63.932 78.053  1.00 17.90 ? 693  PRO A CB  1 
ATOM   5322 C  CG  . PRO A 1 693 ? 30.053 63.542 77.039  1.00 19.70 ? 693  PRO A CG  1 
ATOM   5323 C  CD  . PRO A 1 693 ? 28.784 64.072 77.688  1.00 19.24 ? 693  PRO A CD  1 
ATOM   5324 N  N   . VAL A 1 694 ? 30.631 65.761 80.673  1.00 21.27 ? 694  VAL A N   1 
ATOM   5325 C  CA  . VAL A 1 694 ? 31.191 66.704 81.625  1.00 22.21 ? 694  VAL A CA  1 
ATOM   5326 C  C   . VAL A 1 694 ? 30.694 66.555 83.054  1.00 23.94 ? 694  VAL A C   1 
ATOM   5327 O  O   . VAL A 1 694 ? 31.359 67.033 83.997  1.00 21.72 ? 694  VAL A O   1 
ATOM   5328 C  CB  . VAL A 1 694 ? 30.911 68.109 81.009  1.00 25.42 ? 694  VAL A CB  1 
ATOM   5329 C  CG1 . VAL A 1 694 ? 29.464 68.572 81.208  1.00 25.15 ? 694  VAL A CG1 1 
ATOM   5330 C  CG2 . VAL A 1 694 ? 31.906 69.051 81.618  1.00 27.47 ? 694  VAL A CG2 1 
ATOM   5331 N  N   . ASP A 1 695 ? 29.589 65.808 83.235  1.00 25.62 ? 695  ASP A N   1 
ATOM   5332 C  CA  . ASP A 1 695 ? 28.968 65.669 84.541  1.00 25.31 ? 695  ASP A CA  1 
ATOM   5333 C  C   . ASP A 1 695 ? 29.785 64.735 85.441  1.00 23.42 ? 695  ASP A C   1 
ATOM   5334 O  O   . ASP A 1 695 ? 30.598 63.931 84.974  1.00 26.63 ? 695  ASP A O   1 
ATOM   5335 C  CB  . ASP A 1 695 ? 27.513 65.142 84.346  1.00 25.38 ? 695  ASP A CB  1 
ATOM   5336 C  CG  . ASP A 1 695 ? 26.530 65.997 83.546  1.00 25.16 ? 695  ASP A CG  1 
ATOM   5337 O  OD1 . ASP A 1 695 ? 26.621 67.217 83.475  1.00 24.96 ? 695  ASP A OD1 1 
ATOM   5338 O  OD2 . ASP A 1 695 ? 25.594 65.494 82.930  1.00 26.31 ? 695  ASP A OD2 1 
ATOM   5339 N  N   . LYS A 1 696 ? 29.718 64.853 86.764  1.00 25.19 ? 696  LYS A N   1 
ATOM   5340 C  CA  . LYS A 1 696 ? 30.386 63.922 87.682  1.00 26.10 ? 696  LYS A CA  1 
ATOM   5341 C  C   . LYS A 1 696 ? 29.284 63.146 88.378  1.00 25.13 ? 696  LYS A C   1 
ATOM   5342 O  O   . LYS A 1 696 ? 28.190 63.709 88.522  1.00 22.71 ? 696  LYS A O   1 
ATOM   5343 C  CB  . LYS A 1 696 ? 31.191 64.601 88.786  1.00 30.02 ? 696  LYS A CB  1 
ATOM   5344 C  CG  . LYS A 1 696 ? 32.331 65.469 88.271  1.00 37.93 ? 696  LYS A CG  1 
ATOM   5345 C  CD  . LYS A 1 696 ? 33.446 64.700 87.535  1.00 42.21 ? 696  LYS A CD  1 
ATOM   5346 C  CE  . LYS A 1 696 ? 34.350 65.660 86.708  1.00 46.55 ? 696  LYS A CE  1 
ATOM   5347 N  NZ  . LYS A 1 696 ? 34.008 65.729 85.285  1.00 47.55 ? 696  LYS A NZ  1 
ATOM   5348 N  N   . LEU A 1 697 ? 29.493 61.904 88.836  1.00 21.29 ? 697  LEU A N   1 
ATOM   5349 C  CA  . LEU A 1 697 ? 28.397 61.130 89.414  1.00 19.02 ? 697  LEU A CA  1 
ATOM   5350 C  C   . LEU A 1 697 ? 28.753 60.634 90.787  1.00 19.48 ? 697  LEU A C   1 
ATOM   5351 O  O   . LEU A 1 697 ? 29.924 60.357 91.053  1.00 21.26 ? 697  LEU A O   1 
ATOM   5352 C  CB  . LEU A 1 697 ? 28.044 59.911 88.533  1.00 16.50 ? 697  LEU A CB  1 
ATOM   5353 C  CG  . LEU A 1 697 ? 27.868 60.159 87.022  1.00 18.07 ? 697  LEU A CG  1 
ATOM   5354 C  CD1 . LEU A 1 697 ? 27.575 58.849 86.344  1.00 19.09 ? 697  LEU A CD1 1 
ATOM   5355 C  CD2 . LEU A 1 697 ? 26.701 61.079 86.726  1.00 18.27 ? 697  LEU A CD2 1 
ATOM   5356 N  N   . THR A 1 698 ? 27.799 60.601 91.695  1.00 18.04 ? 698  THR A N   1 
ATOM   5357 C  CA  . THR A 1 698 ? 27.986 59.914 92.958  1.00 19.94 ? 698  THR A CA  1 
ATOM   5358 C  C   . THR A 1 698 ? 27.012 58.714 93.047  1.00 20.14 ? 698  THR A C   1 
ATOM   5359 O  O   . THR A 1 698 ? 25.804 58.882 92.810  1.00 19.38 ? 698  THR A O   1 
ATOM   5360 C  CB  . THR A 1 698 ? 27.756 60.909 94.116  1.00 19.11 ? 698  THR A CB  1 
ATOM   5361 O  OG1 . THR A 1 698 ? 28.764 61.926 93.981  1.00 21.38 ? 698  THR A OG1 1 
ATOM   5362 C  CG2 . THR A 1 698 ? 27.805 60.213 95.487  1.00 17.91 ? 698  THR A CG2 1 
ATOM   5363 N  N   . ILE A 1 699 ? 27.520 57.499 93.297  1.00 17.53 ? 699  ILE A N   1 
ATOM   5364 C  CA  . ILE A 1 699 ? 26.686 56.328 93.463  1.00 19.88 ? 699  ILE A CA  1 
ATOM   5365 C  C   . ILE A 1 699 ? 26.563 56.308 94.985  1.00 21.64 ? 699  ILE A C   1 
ATOM   5366 O  O   . ILE A 1 699 ? 27.556 56.241 95.717  1.00 20.58 ? 699  ILE A O   1 
ATOM   5367 C  CB  . ILE A 1 699 ? 27.322 54.940 93.022  1.00 21.16 ? 699  ILE A CB  1 
ATOM   5368 C  CG1 . ILE A 1 699 ? 27.836 54.881 91.576  1.00 19.94 ? 699  ILE A CG1 1 
ATOM   5369 C  CG2 . ILE A 1 699 ? 26.227 53.883 93.226  1.00 16.74 ? 699  ILE A CG2 1 
ATOM   5370 C  CD1 . ILE A 1 699 ? 26.890 55.366 90.501  1.00 24.64 ? 699  ILE A CD1 1 
ATOM   5371 N  N   . GLN A 1 700 ? 25.353 56.282 95.501  1.00 22.90 ? 700  GLN A N   1 
ATOM   5372 C  CA  . GLN A 1 700 ? 25.138 56.378 96.911  1.00 25.17 ? 700  GLN A CA  1 
ATOM   5373 C  C   . GLN A 1 700 ? 24.364 55.170 97.388  1.00 24.98 ? 700  GLN A C   1 
ATOM   5374 O  O   . GLN A 1 700 ? 23.597 54.537 96.642  1.00 25.89 ? 700  GLN A O   1 
ATOM   5375 C  CB  . GLN A 1 700 ? 24.417 57.676 97.066  1.00 30.90 ? 700  GLN A CB  1 
ATOM   5376 C  CG  . GLN A 1 700 ? 24.032 58.154 98.443  1.00 37.20 ? 700  GLN A CG  1 
ATOM   5377 C  CD  . GLN A 1 700 ? 23.378 59.516 98.266  1.00 40.03 ? 700  GLN A CD  1 
ATOM   5378 O  OE1 . GLN A 1 700 ? 22.160 59.625 98.029  1.00 43.67 ? 700  GLN A OE1 1 
ATOM   5379 N  NE2 . GLN A 1 700 ? 24.136 60.597 98.185  1.00 41.54 ? 700  GLN A NE2 1 
ATOM   5380 N  N   . GLY A 1 701 ? 24.588 54.819 98.641  1.00 24.34 ? 701  GLY A N   1 
ATOM   5381 C  CA  . GLY A 1 701 ? 23.873 53.705 99.246  1.00 29.11 ? 701  GLY A CA  1 
ATOM   5382 C  C   . GLY A 1 701 ? 24.569 52.350 99.132  1.00 32.15 ? 701  GLY A C   1 
ATOM   5383 O  O   . GLY A 1 701 ? 23.917 51.285 99.184  1.00 32.95 ? 701  GLY A O   1 
ATOM   5384 N  N   . LEU A 1 702 ? 25.899 52.353 98.978  1.00 31.63 ? 702  LEU A N   1 
ATOM   5385 C  CA  . LEU A 1 702 ? 26.640 51.111 98.865  1.00 28.12 ? 702  LEU A CA  1 
ATOM   5386 C  C   . LEU A 1 702 ? 26.708 50.420 100.207 1.00 28.12 ? 702  LEU A C   1 
ATOM   5387 O  O   . LEU A 1 702 ? 26.821 49.200 100.235 1.00 26.97 ? 702  LEU A O   1 
ATOM   5388 C  CB  . LEU A 1 702 ? 28.070 51.332 98.363  1.00 27.17 ? 702  LEU A CB  1 
ATOM   5389 C  CG  . LEU A 1 702 ? 28.413 51.422 96.876  1.00 25.97 ? 702  LEU A CG  1 
ATOM   5390 C  CD1 . LEU A 1 702 ? 27.658 50.388 96.105  1.00 25.73 ? 702  LEU A CD1 1 
ATOM   5391 C  CD2 . LEU A 1 702 ? 27.994 52.731 96.329  1.00 29.38 ? 702  LEU A CD2 1 
ATOM   5392 N  N   . LYS A 1 703 ? 26.542 51.138 101.312 1.00 28.38 ? 703  LYS A N   1 
ATOM   5393 C  CA  . LYS A 1 703 ? 26.582 50.553 102.650 1.00 35.22 ? 703  LYS A CA  1 
ATOM   5394 C  C   . LYS A 1 703 ? 25.492 49.547 102.958 1.00 34.76 ? 703  LYS A C   1 
ATOM   5395 O  O   . LYS A 1 703 ? 25.659 48.644 103.783 1.00 33.97 ? 703  LYS A O   1 
ATOM   5396 C  CB  . LYS A 1 703 ? 26.443 51.567 103.749 1.00 42.19 ? 703  LYS A CB  1 
ATOM   5397 C  CG  . LYS A 1 703 ? 27.621 52.504 103.932 1.00 49.83 ? 703  LYS A CG  1 
ATOM   5398 C  CD  . LYS A 1 703 ? 27.612 53.616 102.915 1.00 53.29 ? 703  LYS A CD  1 
ATOM   5399 C  CE  . LYS A 1 703 ? 28.753 54.479 103.236 1.00 57.44 ? 703  LYS A CE  1 
ATOM   5400 N  NZ  . LYS A 1 703 ? 28.642 55.689 102.426 1.00 62.39 ? 703  LYS A NZ  1 
ATOM   5401 N  N   . ASP A 1 704 ? 24.327 49.772 102.370 1.00 34.50 ? 704  ASP A N   1 
ATOM   5402 C  CA  . ASP A 1 704 ? 23.246 48.832 102.565 1.00 35.87 ? 704  ASP A CA  1 
ATOM   5403 C  C   . ASP A 1 704 ? 22.779 48.371 101.204 1.00 31.46 ? 704  ASP A C   1 
ATOM   5404 O  O   . ASP A 1 704 ? 21.600 48.320 100.836 1.00 30.42 ? 704  ASP A O   1 
ATOM   5405 C  CB  . ASP A 1 704 ? 22.115 49.496 103.359 1.00 40.93 ? 704  ASP A CB  1 
ATOM   5406 C  CG  . ASP A 1 704 ? 21.940 50.934 102.960 1.00 44.17 ? 704  ASP A CG  1 
ATOM   5407 O  OD1 . ASP A 1 704 ? 21.631 51.190 101.782 1.00 49.89 ? 704  ASP A OD1 1 
ATOM   5408 O  OD2 . ASP A 1 704 ? 22.192 51.780 103.808 1.00 44.40 ? 704  ASP A OD2 1 
ATOM   5409 N  N   . PHE A 1 705 ? 23.788 48.047 100.405 1.00 26.72 ? 705  PHE A N   1 
ATOM   5410 C  CA  . PHE A 1 705 ? 23.640 47.464 99.074  1.00 25.74 ? 705  PHE A CA  1 
ATOM   5411 C  C   . PHE A 1 705 ? 22.833 46.171 99.283  1.00 22.01 ? 705  PHE A C   1 
ATOM   5412 O  O   . PHE A 1 705 ? 23.126 45.409 100.198 1.00 21.96 ? 705  PHE A O   1 
ATOM   5413 C  CB  . PHE A 1 705 ? 25.079 47.240 98.569  1.00 23.99 ? 705  PHE A CB  1 
ATOM   5414 C  CG  . PHE A 1 705 ? 25.285 46.775 97.139  1.00 23.67 ? 705  PHE A CG  1 
ATOM   5415 C  CD1 . PHE A 1 705 ? 24.260 46.771 96.221  1.00 20.18 ? 705  PHE A CD1 1 
ATOM   5416 C  CD2 . PHE A 1 705 ? 26.542 46.339 96.776  1.00 22.75 ? 705  PHE A CD2 1 
ATOM   5417 C  CE1 . PHE A 1 705 ? 24.496 46.317 94.947  1.00 18.58 ? 705  PHE A CE1 1 
ATOM   5418 C  CE2 . PHE A 1 705 ? 26.761 45.886 95.490  1.00 21.51 ? 705  PHE A CE2 1 
ATOM   5419 C  CZ  . PHE A 1 705 ? 25.738 45.880 94.579  1.00 19.83 ? 705  PHE A CZ  1 
ATOM   5420 N  N   . ALA A 1 706 ? 21.787 45.883 98.524  1.00 20.82 ? 706  ALA A N   1 
ATOM   5421 C  CA  . ALA A 1 706 ? 20.959 44.722 98.831  1.00 20.57 ? 706  ALA A CA  1 
ATOM   5422 C  C   . ALA A 1 706 ? 20.296 44.203 97.579  1.00 16.78 ? 706  ALA A C   1 
ATOM   5423 O  O   . ALA A 1 706 ? 20.009 45.018 96.689  1.00 16.40 ? 706  ALA A O   1 
ATOM   5424 C  CB  . ALA A 1 706 ? 19.839 45.073 99.818  1.00 20.51 ? 706  ALA A CB  1 
ATOM   5425 N  N   . PRO A 1 707 ? 20.054 42.884 97.455  1.00 16.63 ? 707  PRO A N   1 
ATOM   5426 C  CA  . PRO A 1 707 ? 19.291 42.299 96.348  1.00 18.59 ? 707  PRO A CA  1 
ATOM   5427 C  C   . PRO A 1 707 ? 17.923 42.998 96.217  1.00 21.71 ? 707  PRO A C   1 
ATOM   5428 O  O   . PRO A 1 707 ? 17.212 43.220 97.218  1.00 23.84 ? 707  PRO A O   1 
ATOM   5429 C  CB  . PRO A 1 707 ? 19.181 40.835 96.713  1.00 17.63 ? 707  PRO A CB  1 
ATOM   5430 C  CG  . PRO A 1 707 ? 20.375 40.594 97.611  1.00 15.39 ? 707  PRO A CG  1 
ATOM   5431 C  CD  . PRO A 1 707 ? 20.417 41.862 98.442  1.00 15.32 ? 707  PRO A CD  1 
ATOM   5432 N  N   . GLY A 1 708 ? 17.634 43.531 95.034  1.00 22.13 ? 708  GLY A N   1 
ATOM   5433 C  CA  . GLY A 1 708 ? 16.322 44.092 94.781  1.00 24.33 ? 708  GLY A CA  1 
ATOM   5434 C  C   . GLY A 1 708 ? 16.201 45.560 95.145  1.00 25.59 ? 708  GLY A C   1 
ATOM   5435 O  O   . GLY A 1 708 ? 15.246 46.174 94.688  1.00 29.89 ? 708  GLY A O   1 
ATOM   5436 N  N   . LYS A 1 709 ? 17.088 46.173 95.923  1.00 25.25 ? 709  LYS A N   1 
ATOM   5437 C  CA  . LYS A 1 709 ? 16.997 47.582 96.256  1.00 25.05 ? 709  LYS A CA  1 
ATOM   5438 C  C   . LYS A 1 709 ? 17.843 48.380 95.240  1.00 26.05 ? 709  LYS A C   1 
ATOM   5439 O  O   . LYS A 1 709 ? 19.060 48.108 95.145  1.00 29.54 ? 709  LYS A O   1 
ATOM   5440 C  CB  . LYS A 1 709 ? 17.502 47.711 97.706  1.00 27.15 ? 709  LYS A CB  1 
ATOM   5441 C  CG  . LYS A 1 709 ? 17.564 49.124 98.319  1.00 34.62 ? 709  LYS A CG  1 
ATOM   5442 C  CD  . LYS A 1 709 ? 18.819 49.427 99.172  1.00 38.92 ? 709  LYS A CD  1 
ATOM   5443 C  CE  . LYS A 1 709 ? 20.130 49.628 98.341  1.00 42.41 ? 709  LYS A CE  1 
ATOM   5444 N  NZ  . LYS A 1 709 ? 21.112 50.427 99.091  1.00 40.42 ? 709  LYS A NZ  1 
ATOM   5445 N  N   . PRO A 1 710 ? 17.313 49.355 94.475  1.00 25.22 ? 710  PRO A N   1 
ATOM   5446 C  CA  . PRO A 1 710 ? 18.093 50.224 93.598  1.00 22.75 ? 710  PRO A CA  1 
ATOM   5447 C  C   . PRO A 1 710 ? 19.076 51.151 94.337  1.00 22.29 ? 710  PRO A C   1 
ATOM   5448 O  O   . PRO A 1 710 ? 18.994 51.366 95.562  1.00 21.53 ? 710  PRO A O   1 
ATOM   5449 C  CB  . PRO A 1 710 ? 17.031 50.989 92.763  1.00 24.04 ? 710  PRO A CB  1 
ATOM   5450 C  CG  . PRO A 1 710 ? 15.794 51.002 93.617  1.00 23.67 ? 710  PRO A CG  1 
ATOM   5451 C  CD  . PRO A 1 710 ? 15.882 49.625 94.315  1.00 24.96 ? 710  PRO A CD  1 
ATOM   5452 N  N   . LEU A 1 711 ? 20.047 51.677 93.586  1.00 19.73 ? 711  LEU A N   1 
ATOM   5453 C  CA  . LEU A 1 711 ? 21.063 52.583 94.098  1.00 18.56 ? 711  LEU A CA  1 
ATOM   5454 C  C   . LEU A 1 711 ? 20.755 53.942 93.558  1.00 15.57 ? 711  LEU A C   1 
ATOM   5455 O  O   . LEU A 1 711 ? 20.257 54.065 92.441  1.00 18.30 ? 711  LEU A O   1 
ATOM   5456 C  CB  . LEU A 1 711 ? 22.489 52.142 93.655  1.00 19.38 ? 711  LEU A CB  1 
ATOM   5457 C  CG  . LEU A 1 711 ? 23.038 50.797 94.274  1.00 18.05 ? 711  LEU A CG  1 
ATOM   5458 C  CD1 . LEU A 1 711 ? 24.387 50.474 93.660  1.00 21.38 ? 711  LEU A CD1 1 
ATOM   5459 C  CD2 . LEU A 1 711 ? 23.238 50.901 95.788  1.00 18.50 ? 711  LEU A CD2 1 
ATOM   5460 N  N   . LYS A 1 712 ? 21.010 54.949 94.372  1.00 18.14 ? 712  LYS A N   1 
ATOM   5461 C  CA  . LYS A 1 712 ? 20.804 56.343 94.009  1.00 21.74 ? 712  LYS A CA  1 
ATOM   5462 C  C   . LYS A 1 712 ? 22.024 56.909 93.320  1.00 22.53 ? 712  LYS A C   1 
ATOM   5463 O  O   . LYS A 1 712 ? 23.129 56.769 93.844  1.00 21.96 ? 712  LYS A O   1 
ATOM   5464 C  CB  . LYS A 1 712 ? 20.548 57.199 95.219  1.00 24.22 ? 712  LYS A CB  1 
ATOM   5465 C  CG  . LYS A 1 712 ? 19.095 57.165 95.615  1.00 34.87 ? 712  LYS A CG  1 
ATOM   5466 C  CD  . LYS A 1 712 ? 18.802 57.978 96.884  1.00 42.68 ? 712  LYS A CD  1 
ATOM   5467 C  CE  . LYS A 1 712 ? 18.802 59.520 96.733  1.00 48.52 ? 712  LYS A CE  1 
ATOM   5468 N  NZ  . LYS A 1 712 ? 20.093 60.117 96.373  1.00 53.44 ? 712  LYS A NZ  1 
ATOM   5469 N  N   . CYS A 1 713 ? 21.857 57.551 92.176  1.00 19.47 ? 713  CYS A N   1 
ATOM   5470 C  CA  . CYS A 1 713 ? 22.954 58.141 91.473  1.00 19.61 ? 713  CYS A CA  1 
ATOM   5471 C  C   . CYS A 1 713 ? 22.664 59.644 91.467  1.00 21.33 ? 713  CYS A C   1 
ATOM   5472 O  O   . CYS A 1 713 ? 21.587 60.034 91.008  1.00 19.34 ? 713  CYS A O   1 
ATOM   5473 C  CB  . CYS A 1 713 ? 22.997 57.612 90.064  1.00 18.44 ? 713  CYS A CB  1 
ATOM   5474 S  SG  . CYS A 1 713 ? 24.315 58.397 89.082  1.00 25.22 ? 713  CYS A SG  1 
ATOM   5475 N  N   . ILE A 1 714 ? 23.531 60.505 92.017  1.00 22.52 ? 714  ILE A N   1 
ATOM   5476 C  CA  . ILE A 1 714 ? 23.414 61.968 91.970  1.00 21.23 ? 714  ILE A CA  1 
ATOM   5477 C  C   . ILE A 1 714 ? 24.214 62.474 90.770  1.00 20.31 ? 714  ILE A C   1 
ATOM   5478 O  O   . ILE A 1 714 ? 25.431 62.277 90.734  1.00 22.39 ? 714  ILE A O   1 
ATOM   5479 C  CB  . ILE A 1 714 ? 23.978 62.601 93.266  1.00 24.21 ? 714  ILE A CB  1 
ATOM   5480 C  CG1 . ILE A 1 714 ? 23.069 62.311 94.433  1.00 26.87 ? 714  ILE A CG1 1 
ATOM   5481 C  CG2 . ILE A 1 714 ? 24.091 64.111 93.110  1.00 25.49 ? 714  ILE A CG2 1 
ATOM   5482 C  CD1 . ILE A 1 714 ? 23.226 60.908 95.028  1.00 33.77 ? 714  ILE A CD1 1 
ATOM   5483 N  N   . ILE A 1 715 ? 23.607 63.045 89.749  1.00 17.42 ? 715  ILE A N   1 
ATOM   5484 C  CA  . ILE A 1 715 ? 24.301 63.620 88.626  1.00 18.88 ? 715  ILE A CA  1 
ATOM   5485 C  C   . ILE A 1 715 ? 24.654 65.047 89.022  1.00 23.91 ? 715  ILE A C   1 
ATOM   5486 O  O   . ILE A 1 715 ? 23.761 65.860 89.273  1.00 22.49 ? 715  ILE A O   1 
ATOM   5487 C  CB  . ILE A 1 715 ? 23.385 63.610 87.383  1.00 19.25 ? 715  ILE A CB  1 
ATOM   5488 C  CG1 . ILE A 1 715 ? 22.877 62.195 87.045  1.00 16.14 ? 715  ILE A CG1 1 
ATOM   5489 C  CG2 . ILE A 1 715 ? 24.188 64.182 86.217  1.00 17.78 ? 715  ILE A CG2 1 
ATOM   5490 C  CD1 . ILE A 1 715 ? 21.690 62.227 86.072  1.00 16.32 ? 715  ILE A CD1 1 
ATOM   5491 N  N   . LYS A 1 716 ? 25.937 65.383 89.121  1.00 25.89 ? 716  LYS A N   1 
ATOM   5492 C  CA  . LYS A 1 716 ? 26.382 66.729 89.435  1.00 27.81 ? 716  LYS A CA  1 
ATOM   5493 C  C   . LYS A 1 716 ? 26.739 67.485 88.150  1.00 28.11 ? 716  LYS A C   1 
ATOM   5494 O  O   . LYS A 1 716 ? 27.716 67.180 87.458  1.00 28.18 ? 716  LYS A O   1 
ATOM   5495 C  CB  . LYS A 1 716 ? 27.577 66.620 90.366  1.00 30.94 ? 716  LYS A CB  1 
ATOM   5496 C  CG  . LYS A 1 716 ? 27.147 66.314 91.783  1.00 35.26 ? 716  LYS A CG  1 
ATOM   5497 C  CD  . LYS A 1 716 ? 28.140 65.366 92.405  1.00 41.31 ? 716  LYS A CD  1 
ATOM   5498 C  CE  . LYS A 1 716 ? 28.232 65.582 93.924  1.00 44.73 ? 716  LYS A CE  1 
ATOM   5499 N  NZ  . LYS A 1 716 ? 29.228 64.704 94.538  1.00 48.88 ? 716  LYS A NZ  1 
ATOM   5500 N  N   . HIS A 1 717 ? 25.918 68.455 87.753  1.00 29.13 ? 717  HIS A N   1 
ATOM   5501 C  CA  . HIS A 1 717 ? 26.162 69.266 86.565  1.00 31.38 ? 717  HIS A CA  1 
ATOM   5502 C  C   . HIS A 1 717 ? 27.115 70.418 86.919  1.00 35.47 ? 717  HIS A C   1 
ATOM   5503 O  O   . HIS A 1 717 ? 27.188 70.853 88.085  1.00 32.15 ? 717  HIS A O   1 
ATOM   5504 C  CB  . HIS A 1 717 ? 24.859 69.843 86.013  1.00 29.18 ? 717  HIS A CB  1 
ATOM   5505 C  CG  . HIS A 1 717 ? 23.905 68.757 85.541  1.00 31.80 ? 717  HIS A CG  1 
ATOM   5506 N  ND1 . HIS A 1 717 ? 23.999 67.996 84.445  1.00 32.87 ? 717  HIS A ND1 1 
ATOM   5507 C  CD2 . HIS A 1 717 ? 22.757 68.388 86.213  1.00 31.33 ? 717  HIS A CD2 1 
ATOM   5508 C  CE1 . HIS A 1 717 ? 22.957 67.197 84.431  1.00 30.96 ? 717  HIS A CE1 1 
ATOM   5509 N  NE2 . HIS A 1 717 ? 22.223 67.440 85.490  1.00 32.21 ? 717  HIS A NE2 1 
ATOM   5510 N  N   . PRO A 1 718 ? 27.859 70.949 85.931  1.00 38.89 ? 718  PRO A N   1 
ATOM   5511 C  CA  . PRO A 1 718 ? 28.934 71.934 86.114  1.00 43.58 ? 718  PRO A CA  1 
ATOM   5512 C  C   . PRO A 1 718 ? 28.495 73.266 86.744  1.00 46.33 ? 718  PRO A C   1 
ATOM   5513 O  O   . PRO A 1 718 ? 29.154 73.866 87.598  1.00 46.88 ? 718  PRO A O   1 
ATOM   5514 C  CB  . PRO A 1 718 ? 29.505 72.077 84.721  1.00 43.48 ? 718  PRO A CB  1 
ATOM   5515 C  CG  . PRO A 1 718 ? 29.284 70.707 84.164  1.00 43.24 ? 718  PRO A CG  1 
ATOM   5516 C  CD  . PRO A 1 718 ? 27.843 70.507 84.545  1.00 40.85 ? 718  PRO A CD  1 
ATOM   5517 N  N   . ASN A 1 719 ? 27.301 73.656 86.328  1.00 47.74 ? 719  ASN A N   1 
ATOM   5518 C  CA  . ASN A 1 719 ? 26.600 74.802 86.875  1.00 49.64 ? 719  ASN A CA  1 
ATOM   5519 C  C   . ASN A 1 719 ? 26.094 74.552 88.295  1.00 48.73 ? 719  ASN A C   1 
ATOM   5520 O  O   . ASN A 1 719 ? 25.214 75.289 88.724  1.00 50.24 ? 719  ASN A O   1 
ATOM   5521 C  CB  . ASN A 1 719 ? 25.414 75.142 85.968  1.00 51.75 ? 719  ASN A CB  1 
ATOM   5522 C  CG  . ASN A 1 719 ? 24.499 73.947 85.707  1.00 54.65 ? 719  ASN A CG  1 
ATOM   5523 O  OD1 . ASN A 1 719 ? 24.435 72.990 86.483  1.00 56.36 ? 719  ASN A OD1 1 
ATOM   5524 N  ND2 . ASN A 1 719 ? 23.790 73.893 84.596  1.00 56.15 ? 719  ASN A ND2 1 
ATOM   5525 N  N   . GLY A 1 720 ? 26.471 73.533 89.069  1.00 48.57 ? 720  GLY A N   1 
ATOM   5526 C  CA  . GLY A 1 720 ? 25.961 73.381 90.429  1.00 47.93 ? 720  GLY A CA  1 
ATOM   5527 C  C   . GLY A 1 720 ? 24.654 72.596 90.513  1.00 47.24 ? 720  GLY A C   1 
ATOM   5528 O  O   . GLY A 1 720 ? 24.339 72.038 91.566  1.00 49.15 ? 720  GLY A O   1 
ATOM   5529 N  N   . THR A 1 721 ? 23.881 72.512 89.428  1.00 46.07 ? 721  THR A N   1 
ATOM   5530 C  CA  . THR A 1 721 ? 22.629 71.749 89.368  1.00 45.11 ? 721  THR A CA  1 
ATOM   5531 C  C   . THR A 1 721 ? 22.882 70.273 89.633  1.00 42.78 ? 721  THR A C   1 
ATOM   5532 O  O   . THR A 1 721 ? 23.784 69.703 89.022  1.00 42.83 ? 721  THR A O   1 
ATOM   5533 C  CB  . THR A 1 721 ? 21.997 71.857 87.974  1.00 45.72 ? 721  THR A CB  1 
ATOM   5534 O  OG1 . THR A 1 721 ? 21.860 73.245 87.767  1.00 49.82 ? 721  THR A OG1 1 
ATOM   5535 C  CG2 . THR A 1 721 ? 20.649 71.152 87.793  1.00 48.95 ? 721  THR A CG2 1 
ATOM   5536 N  N   . GLN A 1 722 ? 22.134 69.620 90.502  1.00 40.78 ? 722  GLN A N   1 
ATOM   5537 C  CA  . GLN A 1 722 ? 22.242 68.185 90.700  1.00 39.39 ? 722  GLN A CA  1 
ATOM   5538 C  C   . GLN A 1 722 ? 20.936 67.551 90.293  1.00 36.73 ? 722  GLN A C   1 
ATOM   5539 O  O   . GLN A 1 722 ? 19.957 68.284 90.204  1.00 38.61 ? 722  GLN A O   1 
ATOM   5540 C  CB  . GLN A 1 722 ? 22.450 67.842 92.113  1.00 40.67 ? 722  GLN A CB  1 
ATOM   5541 C  CG  . GLN A 1 722 ? 23.738 68.451 92.530  1.00 46.37 ? 722  GLN A CG  1 
ATOM   5542 C  CD  . GLN A 1 722 ? 24.065 68.102 93.960  1.00 49.61 ? 722  GLN A CD  1 
ATOM   5543 O  OE1 . GLN A 1 722 ? 23.321 67.411 94.667  1.00 50.07 ? 722  GLN A OE1 1 
ATOM   5544 N  NE2 . GLN A 1 722 ? 25.204 68.611 94.409  1.00 52.92 ? 722  GLN A NE2 1 
ATOM   5545 N  N   . GLU A 1 723 ? 20.869 66.239 90.054  1.00 34.12 ? 723  GLU A N   1 
ATOM   5546 C  CA  . GLU A 1 723 ? 19.652 65.507 89.703  1.00 31.15 ? 723  GLU A CA  1 
ATOM   5547 C  C   . GLU A 1 723 ? 19.875 64.117 90.288  1.00 30.56 ? 723  GLU A C   1 
ATOM   5548 O  O   . GLU A 1 723 ? 20.985 63.608 90.133  1.00 27.89 ? 723  GLU A O   1 
ATOM   5549 C  CB  . GLU A 1 723 ? 19.454 65.282 88.211  1.00 31.91 ? 723  GLU A CB  1 
ATOM   5550 C  CG  . GLU A 1 723 ? 19.396 66.472 87.302  1.00 36.64 ? 723  GLU A CG  1 
ATOM   5551 C  CD  . GLU A 1 723 ? 18.926 66.139 85.902  1.00 40.67 ? 723  GLU A CD  1 
ATOM   5552 O  OE1 . GLU A 1 723 ? 17.890 65.478 85.768  1.00 44.52 ? 723  GLU A OE1 1 
ATOM   5553 O  OE2 . GLU A 1 723 ? 19.597 66.541 84.944  1.00 42.69 ? 723  GLU A OE2 1 
ATOM   5554 N  N   . THR A 1 724 ? 18.949 63.484 91.018  1.00 27.31 ? 724  THR A N   1 
ATOM   5555 C  CA  . THR A 1 724 ? 19.119 62.122 91.472  1.00 27.95 ? 724  THR A CA  1 
ATOM   5556 C  C   . THR A 1 724 ? 18.328 61.218 90.533  1.00 27.01 ? 724  THR A C   1 
ATOM   5557 O  O   . THR A 1 724 ? 17.250 61.600 90.069  1.00 30.48 ? 724  THR A O   1 
ATOM   5558 C  CB  . THR A 1 724 ? 18.615 61.965 92.912  1.00 27.66 ? 724  THR A CB  1 
ATOM   5559 O  OG1 . THR A 1 724 ? 19.561 62.655 93.730  1.00 32.81 ? 724  THR A OG1 1 
ATOM   5560 C  CG2 . THR A 1 724 ? 18.541 60.519 93.394  1.00 29.65 ? 724  THR A CG2 1 
ATOM   5561 N  N   . ILE A 1 725 ? 18.914 60.090 90.125  1.00 25.53 ? 725  ILE A N   1 
ATOM   5562 C  CA  . ILE A 1 725 ? 18.239 59.080 89.359  1.00 20.32 ? 725  ILE A CA  1 
ATOM   5563 C  C   . ILE A 1 725 ? 18.476 57.780 90.118  1.00 20.08 ? 725  ILE A C   1 
ATOM   5564 O  O   . ILE A 1 725 ? 19.299 57.721 91.043  1.00 17.15 ? 725  ILE A O   1 
ATOM   5565 C  CB  . ILE A 1 725 ? 18.783 58.990 87.905  1.00 20.07 ? 725  ILE A CB  1 
ATOM   5566 C  CG1 . ILE A 1 725 ? 20.237 58.587 87.826  1.00 20.70 ? 725  ILE A CG1 1 
ATOM   5567 C  CG2 . ILE A 1 725 ? 18.503 60.339 87.253  1.00 19.63 ? 725  ILE A CG2 1 
ATOM   5568 C  CD1 . ILE A 1 725 ? 20.684 58.365 86.363  1.00 20.17 ? 725  ILE A CD1 1 
ATOM   5569 N  N   . LEU A 1 726 ? 17.697 56.744 89.800  1.00 19.53 ? 726  LEU A N   1 
ATOM   5570 C  CA  . LEU A 1 726 ? 17.826 55.405 90.401  1.00 18.63 ? 726  LEU A CA  1 
ATOM   5571 C  C   . LEU A 1 726 ? 18.422 54.394 89.421  1.00 15.20 ? 726  LEU A C   1 
ATOM   5572 O  O   . LEU A 1 726 ? 18.152 54.440 88.207  1.00 15.20 ? 726  LEU A O   1 
ATOM   5573 C  CB  . LEU A 1 726 ? 16.474 54.846 90.861  1.00 19.09 ? 726  LEU A CB  1 
ATOM   5574 C  CG  . LEU A 1 726 ? 15.760 55.609 91.937  1.00 18.39 ? 726  LEU A CG  1 
ATOM   5575 C  CD1 . LEU A 1 726 ? 14.516 54.816 92.201  1.00 22.16 ? 726  LEU A CD1 1 
ATOM   5576 C  CD2 . LEU A 1 726 ? 16.552 55.768 93.209  1.00 18.80 ? 726  LEU A CD2 1 
ATOM   5577 N  N   . LEU A 1 727 ? 19.232 53.476 89.933  1.00 12.84 ? 727  LEU A N   1 
ATOM   5578 C  CA  . LEU A 1 727 ? 19.912 52.531 89.073  1.00 12.48 ? 727  LEU A CA  1 
ATOM   5579 C  C   . LEU A 1 727 ? 19.678 51.158 89.632  1.00 10.84 ? 727  LEU A C   1 
ATOM   5580 O  O   . LEU A 1 727 ? 19.800 50.887 90.832  1.00 11.99 ? 727  LEU A O   1 
ATOM   5581 C  CB  . LEU A 1 727 ? 21.401 52.837 89.048  1.00 12.46 ? 727  LEU A CB  1 
ATOM   5582 C  CG  . LEU A 1 727 ? 21.827 54.200 88.480  1.00 12.07 ? 727  LEU A CG  1 
ATOM   5583 C  CD1 . LEU A 1 727 ? 23.332 54.301 88.700  1.00 11.81 ? 727  LEU A CD1 1 
ATOM   5584 C  CD2 . LEU A 1 727 ? 21.487 54.370 86.994  1.00 8.99  ? 727  LEU A CD2 1 
ATOM   5585 N  N   . ASN A 1 728 ? 19.268 50.263 88.755  1.00 11.85 ? 728  ASN A N   1 
ATOM   5586 C  CA  . ASN A 1 728 ? 19.043 48.885 89.187  1.00 14.09 ? 728  ASN A CA  1 
ATOM   5587 C  C   . ASN A 1 728 ? 20.300 48.043 89.026  1.00 12.26 ? 728  ASN A C   1 
ATOM   5588 O  O   . ASN A 1 728 ? 21.221 48.369 88.266  1.00 11.24 ? 728  ASN A O   1 
ATOM   5589 C  CB  . ASN A 1 728 ? 17.878 48.245 88.380  1.00 14.39 ? 728  ASN A CB  1 
ATOM   5590 C  CG  . ASN A 1 728 ? 16.516 48.862 88.700  1.00 16.56 ? 728  ASN A CG  1 
ATOM   5591 O  OD1 . ASN A 1 728 ? 16.164 49.123 89.849  1.00 17.53 ? 728  ASN A OD1 1 
ATOM   5592 N  ND2 . ASN A 1 728 ? 15.697 49.203 87.740  1.00 14.75 ? 728  ASN A ND2 1 
ATOM   5593 N  N   . HIS A 1 729 ? 20.322 46.911 89.708  1.00 13.40 ? 729  HIS A N   1 
ATOM   5594 C  CA  . HIS A 1 729 ? 21.422 45.963 89.654  1.00 17.59 ? 729  HIS A CA  1 
ATOM   5595 C  C   . HIS A 1 729 ? 20.804 44.574 89.802  1.00 16.57 ? 729  HIS A C   1 
ATOM   5596 O  O   . HIS A 1 729 ? 19.721 44.495 90.388  1.00 15.99 ? 729  HIS A O   1 
ATOM   5597 C  CB  . HIS A 1 729 ? 22.376 46.131 90.812  1.00 16.34 ? 729  HIS A CB  1 
ATOM   5598 C  CG  . HIS A 1 729 ? 21.752 45.950 92.192  1.00 17.28 ? 729  HIS A CG  1 
ATOM   5599 N  ND1 . HIS A 1 729 ? 21.637 44.821 92.907  1.00 14.78 ? 729  HIS A ND1 1 
ATOM   5600 C  CD2 . HIS A 1 729 ? 21.225 46.969 92.961  1.00 16.28 ? 729  HIS A CD2 1 
ATOM   5601 C  CE1 . HIS A 1 729 ? 21.082 45.115 94.044  1.00 13.09 ? 729  HIS A CE1 1 
ATOM   5602 N  NE2 . HIS A 1 729 ? 20.837 46.385 94.077  1.00 16.19 ? 729  HIS A NE2 1 
ATOM   5603 N  N   . THR A 1 730 ? 21.447 43.439 89.440  1.00 15.07 ? 730  THR A N   1 
ATOM   5604 C  CA  . THR A 1 730 ? 20.853 42.129 89.648  1.00 12.24 ? 730  THR A CA  1 
ATOM   5605 C  C   . THR A 1 730 ? 21.694 41.276 90.622  1.00 14.17 ? 730  THR A C   1 
ATOM   5606 O  O   . THR A 1 730 ? 21.887 40.089 90.399  1.00 14.71 ? 730  THR A O   1 
ATOM   5607 C  CB  . THR A 1 730 ? 20.742 41.407 88.285  1.00 11.99 ? 730  THR A CB  1 
ATOM   5608 O  OG1 . THR A 1 730 ? 22.091 41.231 87.950  1.00 14.66 ? 730  THR A OG1 1 
ATOM   5609 C  CG2 . THR A 1 730 ? 19.977 42.077 87.179  1.00 9.64  ? 730  THR A CG2 1 
ATOM   5610 N  N   . PHE A 1 731 ? 22.395 41.876 91.570  1.00 15.00 ? 731  PHE A N   1 
ATOM   5611 C  CA  . PHE A 1 731 ? 23.215 41.208 92.561  1.00 14.49 ? 731  PHE A CA  1 
ATOM   5612 C  C   . PHE A 1 731 ? 22.368 40.443 93.595  1.00 17.09 ? 731  PHE A C   1 
ATOM   5613 O  O   . PHE A 1 731 ? 21.373 40.965 94.103  1.00 16.61 ? 731  PHE A O   1 
ATOM   5614 C  CB  . PHE A 1 731 ? 24.130 42.229 93.328  1.00 14.32 ? 731  PHE A CB  1 
ATOM   5615 C  CG  . PHE A 1 731 ? 25.361 42.866 92.625  1.00 14.55 ? 731  PHE A CG  1 
ATOM   5616 C  CD1 . PHE A 1 731 ? 25.258 43.763 91.577  1.00 13.38 ? 731  PHE A CD1 1 
ATOM   5617 C  CD2 . PHE A 1 731 ? 26.631 42.540 93.058  1.00 15.10 ? 731  PHE A CD2 1 
ATOM   5618 C  CE1 . PHE A 1 731 ? 26.372 44.318 90.977  1.00 12.75 ? 731  PHE A CE1 1 
ATOM   5619 C  CE2 . PHE A 1 731 ? 27.752 43.100 92.450  1.00 13.34 ? 731  PHE A CE2 1 
ATOM   5620 C  CZ  . PHE A 1 731 ? 27.631 43.987 91.413  1.00 11.09 ? 731  PHE A CZ  1 
ATOM   5621 N  N   . ASN A 1 732 ? 22.721 39.198 93.852  1.00 17.59 ? 732  ASN A N   1 
ATOM   5622 C  CA  . ASN A 1 732 ? 22.198 38.479 94.992  1.00 19.80 ? 732  ASN A CA  1 
ATOM   5623 C  C   . ASN A 1 732 ? 23.248 38.626 96.112  1.00 21.46 ? 732  ASN A C   1 
ATOM   5624 O  O   . ASN A 1 732 ? 24.275 39.302 95.907  1.00 20.82 ? 732  ASN A O   1 
ATOM   5625 C  CB  . ASN A 1 732 ? 21.959 37.039 94.569  1.00 19.18 ? 732  ASN A CB  1 
ATOM   5626 C  CG  . ASN A 1 732 ? 23.191 36.212 94.284  1.00 19.52 ? 732  ASN A CG  1 
ATOM   5627 O  OD1 . ASN A 1 732 ? 24.294 36.740 94.364  1.00 21.80 ? 732  ASN A OD1 1 
ATOM   5628 N  ND2 . ASN A 1 732 ? 23.091 34.913 94.012  1.00 17.05 ? 732  ASN A ND2 1 
ATOM   5629 N  N   . GLU A 1 733 ? 23.125 38.042 97.316  1.00 22.15 ? 733  GLU A N   1 
ATOM   5630 C  CA  . GLU A 1 733 ? 24.098 38.298 98.355  1.00 28.21 ? 733  GLU A CA  1 
ATOM   5631 C  C   . GLU A 1 733 ? 25.438 37.619 98.131  1.00 25.16 ? 733  GLU A C   1 
ATOM   5632 O  O   . GLU A 1 733 ? 26.447 38.139 98.564  1.00 25.00 ? 733  GLU A O   1 
ATOM   5633 C  CB  . GLU A 1 733 ? 23.512 37.912 99.728  1.00 34.38 ? 733  GLU A CB  1 
ATOM   5634 C  CG  . GLU A 1 733 ? 23.262 39.209 100.609 1.00 45.94 ? 733  GLU A CG  1 
ATOM   5635 C  CD  . GLU A 1 733 ? 24.441 40.125 101.118 1.00 51.04 ? 733  GLU A CD  1 
ATOM   5636 O  OE1 . GLU A 1 733 ? 25.635 39.895 100.862 1.00 50.62 ? 733  GLU A OE1 1 
ATOM   5637 O  OE2 . GLU A 1 733 ? 24.212 41.114 101.834 1.00 53.03 ? 733  GLU A OE2 1 
ATOM   5638 N  N   . THR A 1 734 ? 25.516 36.530 97.358  1.00 26.54 ? 734  THR A N   1 
ATOM   5639 C  CA  . THR A 1 734 ? 26.766 35.892 96.968  1.00 25.02 ? 734  THR A CA  1 
ATOM   5640 C  C   . THR A 1 734 ? 27.568 36.937 96.198  1.00 22.54 ? 734  THR A C   1 
ATOM   5641 O  O   . THR A 1 734 ? 28.713 37.207 96.541  1.00 23.92 ? 734  THR A O   1 
ATOM   5642 C  CB  . THR A 1 734 ? 26.448 34.649 96.077  1.00 25.82 ? 734  THR A CB  1 
ATOM   5643 O  OG1 . THR A 1 734 ? 25.891 33.680 96.971  1.00 28.22 ? 734  THR A OG1 1 
ATOM   5644 C  CG2 . THR A 1 734 ? 27.647 34.103 95.313  1.00 24.07 ? 734  THR A CG2 1 
ATOM   5645 N  N   . GLN A 1 735 ? 26.980 37.559 95.189  1.00 18.10 ? 735  GLN A N   1 
ATOM   5646 C  CA  . GLN A 1 735 ? 27.650 38.544 94.394  1.00 15.33 ? 735  GLN A CA  1 
ATOM   5647 C  C   . GLN A 1 735 ? 28.005 39.820 95.150  1.00 17.51 ? 735  GLN A C   1 
ATOM   5648 O  O   . GLN A 1 735 ? 29.053 40.419 94.844  1.00 16.63 ? 735  GLN A O   1 
ATOM   5649 C  CB  . GLN A 1 735 ? 26.760 38.814 93.225  1.00 15.57 ? 735  GLN A CB  1 
ATOM   5650 C  CG  . GLN A 1 735 ? 26.656 37.545 92.394  1.00 15.53 ? 735  GLN A CG  1 
ATOM   5651 C  CD  . GLN A 1 735 ? 25.516 37.560 91.387  1.00 16.42 ? 735  GLN A CD  1 
ATOM   5652 O  OE1 . GLN A 1 735 ? 24.863 38.575 91.154  1.00 19.13 ? 735  GLN A OE1 1 
ATOM   5653 N  NE2 . GLN A 1 735 ? 25.204 36.448 90.751  1.00 17.95 ? 735  GLN A NE2 1 
ATOM   5654 N  N   . ILE A 1 736 ? 27.219 40.276 96.142  1.00 16.39 ? 736  ILE A N   1 
ATOM   5655 C  CA  . ILE A 1 736 ? 27.598 41.458 96.896  1.00 17.53 ? 736  ILE A CA  1 
ATOM   5656 C  C   . ILE A 1 736 ? 28.872 41.138 97.692  1.00 18.91 ? 736  ILE A C   1 
ATOM   5657 O  O   . ILE A 1 736 ? 29.746 42.009 97.840  1.00 17.75 ? 736  ILE A O   1 
ATOM   5658 C  CB  . ILE A 1 736 ? 26.434 41.882 97.809  1.00 17.19 ? 736  ILE A CB  1 
ATOM   5659 C  CG1 . ILE A 1 736 ? 25.364 42.450 96.903  1.00 17.30 ? 736  ILE A CG1 1 
ATOM   5660 C  CG2 . ILE A 1 736 ? 26.832 42.957 98.827  1.00 18.34 ? 736  ILE A CG2 1 
ATOM   5661 C  CD1 . ILE A 1 736 ? 24.014 42.793 97.564  1.00 15.70 ? 736  ILE A CD1 1 
ATOM   5662 N  N   . GLU A 1 737 ? 29.046 39.919 98.175  1.00 16.50 ? 737  GLU A N   1 
ATOM   5663 C  CA  . GLU A 1 737 ? 30.314 39.534 98.749  1.00 19.72 ? 737  GLU A CA  1 
ATOM   5664 C  C   . GLU A 1 737 ? 31.502 39.686 97.782  1.00 17.25 ? 737  GLU A C   1 
ATOM   5665 O  O   . GLU A 1 737 ? 32.547 40.187 98.172  1.00 18.05 ? 737  GLU A O   1 
ATOM   5666 C  CB  . GLU A 1 737 ? 30.195 38.096 99.245  1.00 23.26 ? 737  GLU A CB  1 
ATOM   5667 C  CG  . GLU A 1 737 ? 29.431 37.993 100.557 1.00 31.34 ? 737  GLU A CG  1 
ATOM   5668 C  CD  . GLU A 1 737 ? 30.029 38.920 101.612 1.00 40.05 ? 737  GLU A CD  1 
ATOM   5669 O  OE1 . GLU A 1 737 ? 31.253 38.910 101.825 1.00 47.07 ? 737  GLU A OE1 1 
ATOM   5670 O  OE2 . GLU A 1 737 ? 29.283 39.662 102.244 1.00 42.19 ? 737  GLU A OE2 1 
ATOM   5671 N  N   . TRP A 1 738 ? 31.395 39.382 96.489  1.00 15.65 ? 738  TRP A N   1 
ATOM   5672 C  CA  . TRP A 1 738 ? 32.463 39.570 95.522  1.00 14.51 ? 738  TRP A CA  1 
ATOM   5673 C  C   . TRP A 1 738 ? 32.810 41.061 95.458  1.00 18.62 ? 738  TRP A C   1 
ATOM   5674 O  O   . TRP A 1 738 ? 33.981 41.453 95.508  1.00 18.90 ? 738  TRP A O   1 
ATOM   5675 C  CB  . TRP A 1 738 ? 32.037 39.130 94.129  1.00 9.28  ? 738  TRP A CB  1 
ATOM   5676 C  CG  . TRP A 1 738 ? 31.564 37.693 93.962  1.00 10.78 ? 738  TRP A CG  1 
ATOM   5677 C  CD1 . TRP A 1 738 ? 31.744 36.682 94.903  1.00 10.41 ? 738  TRP A CD1 1 
ATOM   5678 C  CD2 . TRP A 1 738 ? 30.926 37.240 92.828  1.00 10.51 ? 738  TRP A CD2 1 
ATOM   5679 N  NE1 . TRP A 1 738 ? 31.226 35.597 94.344  1.00 11.28 ? 738  TRP A NE1 1 
ATOM   5680 C  CE2 . TRP A 1 738 ? 30.727 35.892 93.124  1.00 9.90  ? 738  TRP A CE2 1 
ATOM   5681 C  CE3 . TRP A 1 738 ? 30.506 37.786 91.631  1.00 10.38 ? 738  TRP A CE3 1 
ATOM   5682 C  CZ2 . TRP A 1 738 ? 30.095 35.060 92.232  1.00 8.92  ? 738  TRP A CZ2 1 
ATOM   5683 C  CZ3 . TRP A 1 738 ? 29.870 36.945 90.731  1.00 12.21 ? 738  TRP A CZ3 1 
ATOM   5684 C  CH2 . TRP A 1 738 ? 29.664 35.593 91.033  1.00 9.72  ? 738  TRP A CH2 1 
ATOM   5685 N  N   . PHE A 1 739 ? 31.794 41.930 95.372  1.00 18.60 ? 739  PHE A N   1 
ATOM   5686 C  CA  . PHE A 1 739 ? 32.012 43.351 95.352  1.00 18.23 ? 739  PHE A CA  1 
ATOM   5687 C  C   . PHE A 1 739 ? 32.736 43.822 96.607  1.00 18.02 ? 739  PHE A C   1 
ATOM   5688 O  O   . PHE A 1 739 ? 33.723 44.542 96.467  1.00 19.89 ? 739  PHE A O   1 
ATOM   5689 C  CB  . PHE A 1 739 ? 30.676 44.100 95.232  1.00 19.65 ? 739  PHE A CB  1 
ATOM   5690 C  CG  . PHE A 1 739 ? 30.829 45.616 95.443  1.00 18.55 ? 739  PHE A CG  1 
ATOM   5691 C  CD1 . PHE A 1 739 ? 31.442 46.398 94.470  1.00 14.84 ? 739  PHE A CD1 1 
ATOM   5692 C  CD2 . PHE A 1 739 ? 30.415 46.179 96.644  1.00 17.99 ? 739  PHE A CD2 1 
ATOM   5693 C  CE1 . PHE A 1 739 ? 31.641 47.735 94.711  1.00 14.88 ? 739  PHE A CE1 1 
ATOM   5694 C  CE2 . PHE A 1 739 ? 30.627 47.526 96.865  1.00 18.11 ? 739  PHE A CE2 1 
ATOM   5695 C  CZ  . PHE A 1 739 ? 31.240 48.299 95.902  1.00 14.13 ? 739  PHE A CZ  1 
ATOM   5696 N  N   . ARG A 1 740 ? 32.291 43.470 97.816  1.00 17.84 ? 740  ARG A N   1 
ATOM   5697 C  CA  . ARG A 1 740 ? 32.888 43.940 99.059  1.00 19.10 ? 740  ARG A CA  1 
ATOM   5698 C  C   . ARG A 1 740 ? 34.346 43.489 99.172  1.00 18.62 ? 740  ARG A C   1 
ATOM   5699 O  O   . ARG A 1 740 ? 35.211 44.294 99.543  1.00 18.73 ? 740  ARG A O   1 
ATOM   5700 C  CB  . ARG A 1 740 ? 32.076 43.428 100.277 1.00 24.25 ? 740  ARG A CB  1 
ATOM   5701 C  CG  . ARG A 1 740 ? 30.636 43.954 100.328 1.00 32.50 ? 740  ARG A CG  1 
ATOM   5702 C  CD  . ARG A 1 740 ? 29.911 43.791 101.706 1.00 38.96 ? 740  ARG A CD  1 
ATOM   5703 N  NE  . ARG A 1 740 ? 29.179 42.532 102.034 1.00 47.99 ? 740  ARG A NE  1 
ATOM   5704 C  CZ  . ARG A 1 740 ? 27.838 42.454 102.269 1.00 50.61 ? 740  ARG A CZ  1 
ATOM   5705 N  NH1 . ARG A 1 740 ? 27.048 43.528 102.215 1.00 52.09 ? 740  ARG A NH1 1 
ATOM   5706 N  NH2 . ARG A 1 740 ? 27.236 41.280 102.549 1.00 53.83 ? 740  ARG A NH2 1 
ATOM   5707 N  N   . ALA A 1 741 ? 34.659 42.232 98.796  1.00 16.45 ? 741  ALA A N   1 
ATOM   5708 C  CA  . ALA A 1 741 ? 36.008 41.701 98.794  1.00 13.84 ? 741  ALA A CA  1 
ATOM   5709 C  C   . ALA A 1 741 ? 36.930 42.278 97.737  1.00 14.31 ? 741  ALA A C   1 
ATOM   5710 O  O   . ALA A 1 741 ? 38.139 42.076 97.818  1.00 17.49 ? 741  ALA A O   1 
ATOM   5711 C  CB  . ALA A 1 741 ? 35.968 40.199 98.583  1.00 10.04 ? 741  ALA A CB  1 
ATOM   5712 N  N   . GLY A 1 742 ? 36.473 42.956 96.699  1.00 14.32 ? 742  GLY A N   1 
ATOM   5713 C  CA  . GLY A 1 742 ? 37.365 43.437 95.668  1.00 11.99 ? 742  GLY A CA  1 
ATOM   5714 C  C   . GLY A 1 742 ? 37.247 42.595 94.412  1.00 10.21 ? 742  GLY A C   1 
ATOM   5715 O  O   . GLY A 1 742 ? 37.509 43.081 93.313  1.00 12.13 ? 742  GLY A O   1 
ATOM   5716 N  N   . SER A 1 743 ? 36.940 41.311 94.527  1.00 11.49 ? 743  SER A N   1 
ATOM   5717 C  CA  . SER A 1 743 ? 36.635 40.468 93.382  1.00 10.97 ? 743  SER A CA  1 
ATOM   5718 C  C   . SER A 1 743 ? 36.177 39.123 93.922  1.00 13.31 ? 743  SER A C   1 
ATOM   5719 O  O   . SER A 1 743 ? 36.323 38.855 95.134  1.00 13.24 ? 743  SER A O   1 
ATOM   5720 C  CB  . SER A 1 743 ? 37.842 40.228 92.470  1.00 12.47 ? 743  SER A CB  1 
ATOM   5721 O  OG  . SER A 1 743 ? 38.904 39.638 93.198  1.00 13.18 ? 743  SER A OG  1 
ATOM   5722 N  N   . ALA A 1 744 ? 35.683 38.249 93.035  1.00 12.75 ? 744  ALA A N   1 
ATOM   5723 C  CA  . ALA A 1 744 ? 35.273 36.896 93.431  1.00 13.50 ? 744  ALA A CA  1 
ATOM   5724 C  C   . ALA A 1 744 ? 36.432 36.033 93.917  1.00 13.67 ? 744  ALA A C   1 
ATOM   5725 O  O   . ALA A 1 744 ? 36.339 35.351 94.934  1.00 15.56 ? 744  ALA A O   1 
ATOM   5726 C  CB  . ALA A 1 744 ? 34.627 36.175 92.272  1.00 7.05  ? 744  ALA A CB  1 
ATOM   5727 N  N   . LEU A 1 745 ? 37.567 36.139 93.217  1.00 15.47 ? 745  LEU A N   1 
ATOM   5728 C  CA  . LEU A 1 745 ? 38.803 35.454 93.570  1.00 16.00 ? 745  LEU A CA  1 
ATOM   5729 C  C   . LEU A 1 745 ? 39.264 35.925 94.952  1.00 15.01 ? 745  LEU A C   1 
ATOM   5730 O  O   . LEU A 1 745 ? 39.657 35.068 95.743  1.00 14.28 ? 745  LEU A O   1 
ATOM   5731 C  CB  . LEU A 1 745 ? 39.887 35.761 92.548  1.00 15.97 ? 745  LEU A CB  1 
ATOM   5732 C  CG  . LEU A 1 745 ? 41.161 34.935 92.657  1.00 21.70 ? 745  LEU A CG  1 
ATOM   5733 C  CD1 . LEU A 1 745 ? 40.877 33.453 92.430  1.00 19.10 ? 745  LEU A CD1 1 
ATOM   5734 C  CD2 . LEU A 1 745 ? 42.149 35.431 91.617  1.00 22.37 ? 745  LEU A CD2 1 
ATOM   5735 N  N   . ASN A 1 746 ? 39.168 37.226 95.325  1.00 15.76 ? 746  ASN A N   1 
ATOM   5736 C  CA  . ASN A 1 746 ? 39.560 37.695 96.658  1.00 15.01 ? 746  ASN A CA  1 
ATOM   5737 C  C   . ASN A 1 746 ? 38.701 37.122 97.763  1.00 18.54 ? 746  ASN A C   1 
ATOM   5738 O  O   . ASN A 1 746 ? 39.140 36.926 98.905  1.00 23.26 ? 746  ASN A O   1 
ATOM   5739 C  CB  . ASN A 1 746 ? 39.478 39.217 96.811  1.00 14.96 ? 746  ASN A CB  1 
ATOM   5740 C  CG  . ASN A 1 746 ? 40.510 40.055 96.066  1.00 16.62 ? 746  ASN A CG  1 
ATOM   5741 O  OD1 . ASN A 1 746 ? 41.465 39.524 95.496  1.00 18.48 ? 746  ASN A OD1 1 
ATOM   5742 N  ND2 . ASN A 1 746 ? 40.346 41.370 96.027  1.00 16.71 ? 746  ASN A ND2 1 
ATOM   5743 N  N   . ARG A 1 747 ? 37.436 36.920 97.430  1.00 18.45 ? 747  ARG A N   1 
ATOM   5744 C  CA  . ARG A 1 747 ? 36.433 36.392 98.319  1.00 20.54 ? 747  ARG A CA  1 
ATOM   5745 C  C   . ARG A 1 747 ? 36.720 34.918 98.554  1.00 18.69 ? 747  ARG A C   1 
ATOM   5746 O  O   . ARG A 1 747 ? 36.630 34.436 99.687  1.00 17.09 ? 747  ARG A O   1 
ATOM   5747 C  CB  . ARG A 1 747 ? 35.077 36.590 97.642  1.00 22.17 ? 747  ARG A CB  1 
ATOM   5748 C  CG  . ARG A 1 747 ? 33.813 36.735 98.431  1.00 26.62 ? 747  ARG A CG  1 
ATOM   5749 C  CD  . ARG A 1 747 ? 33.441 35.593 99.319  1.00 27.12 ? 747  ARG A CD  1 
ATOM   5750 N  NE  . ARG A 1 747 ? 33.718 36.057 100.669 1.00 33.82 ? 747  ARG A NE  1 
ATOM   5751 C  CZ  . ARG A 1 747 ? 32.931 35.825 101.735 1.00 34.10 ? 747  ARG A CZ  1 
ATOM   5752 N  NH1 . ARG A 1 747 ? 31.801 35.118 101.615 1.00 34.41 ? 747  ARG A NH1 1 
ATOM   5753 N  NH2 . ARG A 1 747 ? 33.326 36.352 102.907 1.00 34.81 ? 747  ARG A NH2 1 
ATOM   5754 N  N   . MET A 1 748 ? 37.002 34.167 97.491  1.00 16.97 ? 748  MET A N   1 
ATOM   5755 C  CA  . MET A 1 748 ? 37.338 32.751 97.621  1.00 23.37 ? 748  MET A CA  1 
ATOM   5756 C  C   . MET A 1 748 ? 38.575 32.613 98.504  1.00 26.59 ? 748  MET A C   1 
ATOM   5757 O  O   . MET A 1 748 ? 38.671 31.740 99.369  1.00 28.30 ? 748  MET A O   1 
ATOM   5758 C  CB  . MET A 1 748 ? 37.628 32.162 96.261  1.00 25.58 ? 748  MET A CB  1 
ATOM   5759 C  CG  . MET A 1 748 ? 38.002 30.681 96.232  1.00 32.21 ? 748  MET A CG  1 
ATOM   5760 S  SD  . MET A 1 748 ? 38.665 30.153 94.622  1.00 36.56 ? 748  MET A SD  1 
ATOM   5761 C  CE  . MET A 1 748 ? 37.257 30.437 93.576  1.00 40.93 ? 748  MET A CE  1 
ATOM   5762 N  N   . LYS A 1 749 ? 39.540 33.515 98.341  1.00 29.28 ? 749  LYS A N   1 
ATOM   5763 C  CA  . LYS A 1 749 ? 40.709 33.453 99.163  1.00 32.30 ? 749  LYS A CA  1 
ATOM   5764 C  C   . LYS A 1 749 ? 40.381 33.801 100.582 1.00 32.17 ? 749  LYS A C   1 
ATOM   5765 O  O   . LYS A 1 749 ? 41.057 33.193 101.404 1.00 35.18 ? 749  LYS A O   1 
ATOM   5766 C  CB  . LYS A 1 749 ? 41.804 34.366 98.634  1.00 34.74 ? 749  LYS A CB  1 
ATOM   5767 C  CG  . LYS A 1 749 ? 42.301 33.742 97.312  1.00 38.78 ? 749  LYS A CG  1 
ATOM   5768 C  CD  . LYS A 1 749 ? 43.767 34.018 97.053  1.00 42.27 ? 749  LYS A CD  1 
ATOM   5769 C  CE  . LYS A 1 749 ? 44.651 33.234 98.052  1.00 47.47 ? 749  LYS A CE  1 
ATOM   5770 N  NZ  . LYS A 1 749 ? 44.612 31.786 97.847  1.00 50.51 ? 749  LYS A NZ  1 
ATOM   5771 N  N   . GLU A 1 750 ? 39.419 34.655 100.926 1.00 31.37 ? 750  GLU A N   1 
ATOM   5772 C  CA  . GLU A 1 750 ? 39.069 34.854 102.313 1.00 33.68 ? 750  GLU A CA  1 
ATOM   5773 C  C   . GLU A 1 750 ? 38.504 33.544 102.864 1.00 36.32 ? 750  GLU A C   1 
ATOM   5774 O  O   . GLU A 1 750 ? 38.896 33.086 103.937 1.00 37.82 ? 750  GLU A O   1 
ATOM   5775 C  CB  . GLU A 1 750 ? 38.001 35.899 102.494 1.00 34.35 ? 750  GLU A CB  1 
ATOM   5776 C  CG  . GLU A 1 750 ? 38.310 37.344 102.184 1.00 40.15 ? 750  GLU A CG  1 
ATOM   5777 C  CD  . GLU A 1 750 ? 37.064 38.246 102.081 1.00 45.88 ? 750  GLU A CD  1 
ATOM   5778 O  OE1 . GLU A 1 750 ? 35.920 37.773 102.212 1.00 46.37 ? 750  GLU A OE1 1 
ATOM   5779 O  OE2 . GLU A 1 750 ? 37.264 39.448 101.816 1.00 47.33 ? 750  GLU A OE2 1 
ATOM   5780 N  N   . LEU A 1 751 ? 37.610 32.842 102.162 1.00 37.48 ? 751  LEU A N   1 
ATOM   5781 C  CA  . LEU A 1 751 ? 37.055 31.584 102.657 1.00 40.39 ? 751  LEU A CA  1 
ATOM   5782 C  C   . LEU A 1 751 ? 38.073 30.485 102.924 1.00 45.60 ? 751  LEU A C   1 
ATOM   5783 O  O   . LEU A 1 751 ? 37.829 29.494 103.643 1.00 45.86 ? 751  LEU A O   1 
ATOM   5784 C  CB  . LEU A 1 751 ? 36.024 31.080 101.681 1.00 36.58 ? 751  LEU A CB  1 
ATOM   5785 C  CG  . LEU A 1 751 ? 34.794 31.959 101.729 1.00 35.41 ? 751  LEU A CG  1 
ATOM   5786 C  CD1 . LEU A 1 751 ? 33.847 31.577 100.615 1.00 33.25 ? 751  LEU A CD1 1 
ATOM   5787 C  CD2 . LEU A 1 751 ? 34.177 31.846 103.117 1.00 33.25 ? 751  LEU A CD2 1 
ATOM   5788 N  N   . GLN A 1 752 ? 39.286 30.618 102.398 1.00 53.02 ? 752  GLN A N   1 
ATOM   5789 C  CA  . GLN A 1 752 ? 40.393 29.727 102.738 1.00 60.32 ? 752  GLN A CA  1 
ATOM   5790 C  C   . GLN A 1 752 ? 41.010 30.239 104.042 1.00 64.26 ? 752  GLN A C   1 
ATOM   5791 O  O   . GLN A 1 752 ? 42.157 30.670 104.092 1.00 63.97 ? 752  GLN A O   1 
ATOM   5792 C  CB  . GLN A 1 752 ? 41.475 29.718 101.659 1.00 62.21 ? 752  GLN A CB  1 
ATOM   5793 C  CG  . GLN A 1 752 ? 41.004 29.320 100.268 1.00 64.74 ? 752  GLN A CG  1 
ATOM   5794 C  CD  . GLN A 1 752 ? 41.990 29.636 99.132  1.00 67.37 ? 752  GLN A CD  1 
ATOM   5795 O  OE1 . GLN A 1 752 ? 42.996 30.368 99.272  1.00 68.66 ? 752  GLN A OE1 1 
ATOM   5796 N  NE2 . GLN A 1 752 ? 41.726 29.110 97.937  1.00 67.28 ? 752  GLN A NE2 1 
ATOM   5797 N  N   . GLN A 1 753 ? 40.183 30.250 105.098 1.00 71.87 ? 753  GLN A N   1 
ATOM   5798 C  CA  . GLN A 1 753 ? 40.446 30.593 106.502 1.00 78.04 ? 753  GLN A CA  1 
ATOM   5799 C  C   . GLN A 1 753 ? 41.478 31.604 106.994 1.00 80.58 ? 753  GLN A C   1 
ATOM   5800 O  O   . GLN A 1 753 ? 41.768 31.695 108.197 1.00 82.01 ? 753  GLN A O   1 
ATOM   5801 C  CB  . GLN A 1 753 ? 40.679 29.281 107.250 1.00 79.88 ? 753  GLN A CB  1 
ATOM   5802 C  CG  . GLN A 1 753 ? 41.925 28.521 106.861 1.00 82.12 ? 753  GLN A CG  1 
ATOM   5803 C  CD  . GLN A 1 753 ? 41.850 27.101 107.378 1.00 83.68 ? 753  GLN A CD  1 
ATOM   5804 O  OE1 . GLN A 1 753 ? 40.825 26.422 107.255 1.00 84.51 ? 753  GLN A OE1 1 
ATOM   5805 N  NE2 . GLN A 1 753 ? 42.922 26.568 107.920 1.00 85.77 ? 753  GLN A NE2 1 
ATOM   5806 N  N   . LYS A 1 754 ? 41.950 32.404 106.053 1.00 82.34 ? 754  LYS A N   1 
ATOM   5807 C  CA  . LYS A 1 754 ? 42.949 33.426 106.274 1.00 84.37 ? 754  LYS A CA  1 
ATOM   5808 C  C   . LYS A 1 754 ? 42.798 34.426 105.120 1.00 84.44 ? 754  LYS A C   1 
ATOM   5809 O  O   . LYS A 1 754 ? 41.892 34.269 104.294 1.00 83.94 ? 754  LYS A O   1 
ATOM   5810 C  CB  . LYS A 1 754 ? 44.362 32.767 106.302 1.00 85.73 ? 754  LYS A CB  1 
ATOM   5811 C  CG  . LYS A 1 754 ? 44.836 31.893 105.120 1.00 86.64 ? 754  LYS A CG  1 
ATOM   5812 C  CD  . LYS A 1 754 ? 45.436 32.687 103.932 1.00 87.61 ? 754  LYS A CD  1 
ATOM   5813 C  CE  . LYS A 1 754 ? 44.685 32.462 102.596 1.00 87.48 ? 754  LYS A CE  1 
ATOM   5814 N  NZ  . LYS A 1 754 ? 43.285 32.840 102.706 1.00 87.67 ? 754  LYS A NZ  1 
ATOM   5815 O  OXT . LYS A 1 754 ? 43.642 35.300 104.962 1.00 84.87 ? 754  LYS A OXT 1 
HETATM 5816 FE FE1 . SF4 B 2 .   ? 34.577 29.607 66.909  1.00 14.42 ? 999  SF4 A FE1 1 
HETATM 5817 FE FE2 . SF4 B 2 .   ? 35.598 31.710 65.609  1.00 14.67 ? 999  SF4 A FE2 1 
HETATM 5818 FE FE3 . SF4 B 2 .   ? 37.158 30.166 67.068  1.00 13.98 ? 999  SF4 A FE3 1 
HETATM 5819 FE FE4 . SF4 B 2 .   ? 35.322 31.843 68.459  1.00 17.02 ? 999  SF4 A FE4 1 
HETATM 5820 S  S1  . SF4 B 2 .   ? 37.092 32.490 67.087  1.00 13.78 ? 999  SF4 A S1  1 
HETATM 5821 S  S2  . SF4 B 2 .   ? 35.786 29.556 68.837  1.00 11.56 ? 999  SF4 A S2  1 
HETATM 5822 S  S3  . SF4 B 2 .   ? 33.658 31.699 66.830  1.00 15.22 ? 999  SF4 A S3  1 
HETATM 5823 S  S4  . SF4 B 2 .   ? 36.039 29.495 65.138  1.00 12.05 ? 999  SF4 A S4  1 
HETATM 5824 C  C1  . ICT C 3 .   ? 35.381 34.840 69.664  1.00 16.61 ? 755  ICT A C1  1 
HETATM 5825 O  O1  . ICT C 3 .   ? 35.267 36.100 69.859  1.00 17.29 ? 755  ICT A O1  1 
HETATM 5826 O  O2  . ICT C 3 .   ? 34.759 34.253 68.751  1.00 14.45 ? 755  ICT A O2  1 
HETATM 5827 C  C2  . ICT C 3 .   ? 36.215 33.999 70.570  1.00 14.28 ? 755  ICT A C2  1 
HETATM 5828 O  O7  . ICT C 3 .   ? 36.115 32.581 70.321  1.00 14.09 ? 755  ICT A O7  1 
HETATM 5829 C  C3  . ICT C 3 .   ? 35.762 34.367 71.971  1.00 16.31 ? 755  ICT A C3  1 
HETATM 5830 C  C4  . ICT C 3 .   ? 36.841 34.176 73.004  1.00 18.89 ? 755  ICT A C4  1 
HETATM 5831 C  C5  . ICT C 3 .   ? 38.097 34.995 72.796  1.00 17.28 ? 755  ICT A C5  1 
HETATM 5832 O  O3  . ICT C 3 .   ? 39.123 34.311 72.960  1.00 18.64 ? 755  ICT A O3  1 
HETATM 5833 O  O4  . ICT C 3 .   ? 38.121 36.214 72.485  1.00 15.98 ? 755  ICT A O4  1 
HETATM 5834 C  C6  . ICT C 3 .   ? 34.378 34.005 72.479  1.00 13.74 ? 755  ICT A C6  1 
HETATM 5835 O  O5  . ICT C 3 .   ? 33.452 33.946 71.719  1.00 13.56 ? 755  ICT A O5  1 
HETATM 5836 O  O6  . ICT C 3 .   ? 34.085 33.877 73.667  1.00 13.32 ? 755  ICT A O6  1 
HETATM 5837 O  O   . HOH D 4 .   ? 33.650 31.688 69.895  1.00 15.89 ? 1000 HOH A O   1 
HETATM 5838 O  O   . HOH D 4 .   ? 27.665 5.126  83.972  1.00 17.76 ? 1001 HOH A O   1 
HETATM 5839 O  O   . HOH D 4 .   ? 31.704 11.618 75.416  1.00 12.65 ? 1002 HOH A O   1 
HETATM 5840 O  O   . HOH D 4 .   ? 40.293 14.489 78.544  1.00 16.72 ? 1003 HOH A O   1 
HETATM 5841 O  O   . HOH D 4 .   ? 33.256 3.128  79.841  1.00 42.41 ? 1004 HOH A O   1 
HETATM 5842 O  O   . HOH D 4 .   ? 12.748 32.004 54.182  1.00 16.99 ? 1005 HOH A O   1 
HETATM 5843 O  O   . HOH D 4 .   ? 14.912 27.195 83.432  1.00 19.34 ? 1006 HOH A O   1 
HETATM 5844 O  O   . HOH D 4 .   ? 19.921 45.581 86.279  1.00 23.77 ? 1007 HOH A O   1 
HETATM 5845 O  O   . HOH D 4 .   ? 20.659 44.397 81.349  1.00 23.62 ? 1008 HOH A O   1 
HETATM 5846 O  O   . HOH D 4 .   ? 10.952 27.307 94.007  1.00 34.41 ? 1009 HOH A O   1 
HETATM 5847 O  O   . HOH D 4 .   ? 51.004 31.945 64.186  1.00 33.11 ? 1010 HOH A O   1 
HETATM 5848 O  O   . HOH D 4 .   ? 32.786 21.787 90.894  1.00 24.56 ? 1011 HOH A O   1 
HETATM 5849 O  O   . HOH D 4 .   ? 31.106 11.028 87.610  1.00 35.24 ? 1012 HOH A O   1 
HETATM 5850 O  O   . HOH D 4 .   ? 43.632 34.429 78.514  1.00 12.13 ? 1013 HOH A O   1 
HETATM 5851 O  O   . HOH D 4 .   ? 40.218 34.337 80.243  1.00 17.75 ? 1014 HOH A O   1 
HETATM 5852 O  O   . HOH D 4 .   ? 49.418 36.088 76.281  1.00 15.44 ? 1015 HOH A O   1 
HETATM 5853 O  O   . HOH D 4 .   ? 48.349 34.869 89.099  1.00 14.26 ? 1016 HOH A O   1 
HETATM 5854 O  O   . HOH D 4 .   ? 40.322 38.031 89.434  1.00 17.79 ? 1017 HOH A O   1 
HETATM 5855 O  O   . HOH D 4 .   ? 40.810 16.949 84.230  1.00 13.77 ? 1018 HOH A O   1 
HETATM 5856 O  O   . HOH D 4 .   ? 41.426 21.456 70.474  1.00 12.58 ? 1019 HOH A O   1 
HETATM 5857 O  O   . HOH D 4 .   ? 44.377 23.733 66.893  1.00 8.28  ? 1020 HOH A O   1 
HETATM 5858 O  O   . HOH D 4 .   ? 42.576 28.278 60.427  1.00 18.52 ? 1021 HOH A O   1 
HETATM 5859 O  O   . HOH D 4 .   ? 16.597 48.926 85.099  1.00 28.22 ? 1022 HOH A O   1 
HETATM 5860 O  O   . HOH D 4 .   ? 45.147 29.422 60.782  1.00 16.04 ? 1023 HOH A O   1 
HETATM 5861 O  O   . HOH D 4 .   ? 23.552 27.846 39.469  1.00 19.85 ? 1024 HOH A O   1 
HETATM 5862 O  O   . HOH D 4 .   ? 47.911 17.463 80.301  1.00 10.94 ? 1025 HOH A O   1 
HETATM 5863 O  O   . HOH D 4 .   ? 30.559 21.115 70.810  1.00 11.18 ? 1026 HOH A O   1 
HETATM 5864 O  O   . HOH D 4 .   ? 31.961 16.049 61.292  1.00 20.06 ? 1027 HOH A O   1 
HETATM 5865 O  O   . HOH D 4 .   ? 40.560 15.403 65.995  1.00 23.57 ? 1028 HOH A O   1 
HETATM 5866 O  O   . HOH D 4 .   ? 36.170 10.808 67.974  1.00 40.33 ? 1029 HOH A O   1 
HETATM 5867 O  O   . HOH D 4 .   ? 32.574 13.924 78.592  1.00 10.94 ? 1030 HOH A O   1 
HETATM 5868 O  O   . HOH D 4 .   ? 27.229 12.580 83.958  1.00 34.34 ? 1031 HOH A O   1 
HETATM 5869 O  O   . HOH D 4 .   ? 23.981 13.788 85.798  1.00 30.21 ? 1032 HOH A O   1 
HETATM 5870 O  O   . HOH D 4 .   ? 26.744 32.056 74.461  1.00 14.17 ? 1033 HOH A O   1 
HETATM 5871 O  O   . HOH D 4 .   ? 31.082 23.127 72.759  1.00 7.91  ? 1034 HOH A O   1 
HETATM 5872 O  O   . HOH D 4 .   ? 32.492 16.637 63.935  1.00 19.65 ? 1035 HOH A O   1 
HETATM 5873 O  O   . HOH D 4 .   ? 19.153 15.108 75.255  1.00 21.15 ? 1036 HOH A O   1 
HETATM 5874 O  O   . HOH D 4 .   ? 26.677 30.584 76.693  1.00 7.61  ? 1037 HOH A O   1 
HETATM 5875 O  O   . HOH D 4 .   ? 35.504 33.034 78.287  1.00 8.63  ? 1038 HOH A O   1 
HETATM 5876 O  O   . HOH D 4 .   ? 30.688 34.293 83.147  1.00 18.23 ? 1039 HOH A O   1 
HETATM 5877 O  O   . HOH D 4 .   ? 37.423 34.570 79.758  1.00 2.00  ? 1040 HOH A O   1 
HETATM 5878 O  O   . HOH D 4 .   ? 35.600 32.990 90.801  1.00 24.30 ? 1041 HOH A O   1 
HETATM 5879 O  O   . HOH D 4 .   ? 33.571 35.110 85.074  1.00 20.26 ? 1042 HOH A O   1 
HETATM 5880 O  O   . HOH D 4 .   ? 29.362 31.136 90.384  1.00 21.72 ? 1043 HOH A O   1 
HETATM 5881 O  O   . HOH D 4 .   ? 30.768 20.167 89.781  1.00 24.68 ? 1044 HOH A O   1 
HETATM 5882 O  O   . HOH D 4 .   ? 18.497 39.603 89.939  1.00 46.70 ? 1045 HOH A O   1 
HETATM 5883 O  O   . HOH D 4 .   ? 23.680 34.149 85.009  1.00 16.50 ? 1046 HOH A O   1 
HETATM 5884 O  O   . HOH D 4 .   ? 26.074 14.373 61.707  1.00 17.83 ? 1047 HOH A O   1 
HETATM 5885 O  O   . HOH D 4 .   ? 14.242 23.276 52.780  1.00 25.59 ? 1048 HOH A O   1 
HETATM 5886 O  O   . HOH D 4 .   ? 24.970 24.442 57.621  1.00 18.08 ? 1049 HOH A O   1 
HETATM 5887 O  O   . HOH D 4 .   ? 38.582 29.778 56.768  1.00 20.46 ? 1050 HOH A O   1 
HETATM 5888 O  O   . HOH D 4 .   ? 12.327 38.456 72.857  1.00 43.03 ? 1051 HOH A O   1 
HETATM 5889 O  O   . HOH D 4 .   ? 15.983 51.283 76.263  1.00 39.10 ? 1052 HOH A O   1 
HETATM 5890 O  O   . HOH D 4 .   ? 21.537 34.811 78.283  1.00 8.65  ? 1053 HOH A O   1 
HETATM 5891 O  O   . HOH D 4 .   ? 20.098 28.481 68.573  1.00 7.44  ? 1054 HOH A O   1 
HETATM 5892 O  O   . HOH D 4 .   ? 21.819 14.960 57.065  1.00 50.06 ? 1055 HOH A O   1 
HETATM 5893 O  O   . HOH D 4 .   ? 29.468 15.913 59.913  1.00 17.45 ? 1056 HOH A O   1 
HETATM 5894 O  O   . HOH D 4 .   ? 26.020 22.153 59.252  1.00 13.41 ? 1057 HOH A O   1 
HETATM 5895 O  O   . HOH D 4 .   ? 23.030 28.982 71.795  1.00 6.43  ? 1058 HOH A O   1 
HETATM 5896 O  O   . HOH D 4 .   ? 27.595 37.701 69.945  1.00 32.17 ? 1059 HOH A O   1 
HETATM 5897 O  O   . HOH D 4 .   ? 24.589 33.907 77.259  1.00 15.87 ? 1060 HOH A O   1 
HETATM 5898 O  O   . HOH D 4 .   ? 20.470 32.780 82.191  1.00 20.69 ? 1061 HOH A O   1 
HETATM 5899 O  O   . HOH D 4 .   ? 13.599 12.156 70.045  1.00 38.84 ? 1062 HOH A O   1 
HETATM 5900 O  O   . HOH D 4 .   ? 31.060 2.665  69.000  1.00 31.96 ? 1063 HOH A O   1 
HETATM 5901 O  O   . HOH D 4 .   ? 20.348 0.641  73.134  1.00 28.07 ? 1064 HOH A O   1 
HETATM 5902 O  O   . HOH D 4 .   ? 6.568  18.519 74.723  1.00 24.18 ? 1065 HOH A O   1 
HETATM 5903 O  O   . HOH D 4 .   ? 24.107 12.586 62.373  1.00 23.86 ? 1066 HOH A O   1 
HETATM 5904 O  O   . HOH D 4 .   ? 12.063 35.069 77.302  1.00 53.95 ? 1067 HOH A O   1 
HETATM 5905 O  O   . HOH D 4 .   ? 41.215 31.339 44.285  1.00 40.88 ? 1068 HOH A O   1 
HETATM 5906 O  O   . HOH D 4 .   ? 11.830 12.857 82.640  1.00 25.12 ? 1069 HOH A O   1 
HETATM 5907 O  O   . HOH D 4 .   ? 5.087  15.910 83.665  1.00 35.81 ? 1070 HOH A O   1 
HETATM 5908 O  O   . HOH D 4 .   ? 12.942 39.931 69.671  1.00 36.26 ? 1071 HOH A O   1 
HETATM 5909 O  O   . HOH D 4 .   ? 38.663 14.394 67.736  1.00 26.33 ? 1072 HOH A O   1 
HETATM 5910 O  O   . HOH D 4 .   ? 17.402 33.044 48.744  1.00 26.08 ? 1073 HOH A O   1 
HETATM 5911 O  O   . HOH D 4 .   ? 38.018 29.394 60.763  1.00 20.92 ? 1074 HOH A O   1 
HETATM 5912 O  O   . HOH D 4 .   ? 26.785 32.538 85.433  1.00 25.45 ? 1075 HOH A O   1 
HETATM 5913 O  O   . HOH D 4 .   ? 45.820 17.846 55.260  1.00 31.20 ? 1076 HOH A O   1 
HETATM 5914 O  O   . HOH D 4 .   ? 44.444 21.782 58.184  1.00 18.48 ? 1077 HOH A O   1 
HETATM 5915 O  O   . HOH D 4 .   ? 46.181 22.226 62.121  1.00 23.86 ? 1078 HOH A O   1 
HETATM 5916 O  O   . HOH D 4 .   ? 47.528 21.652 59.298  1.00 37.19 ? 1079 HOH A O   1 
HETATM 5917 O  O   . HOH D 4 .   ? 33.948 36.113 62.803  1.00 35.73 ? 1080 HOH A O   1 
HETATM 5918 O  O   . HOH D 4 .   ? 45.855 43.486 62.221  1.00 47.29 ? 1081 HOH A O   1 
HETATM 5919 O  O   . HOH D 4 .   ? 31.404 43.578 58.626  1.00 17.83 ? 1082 HOH A O   1 
HETATM 5920 O  O   . HOH D 4 .   ? 30.848 15.647 47.858  1.00 45.76 ? 1083 HOH A O   1 
HETATM 5921 O  O   . HOH D 4 .   ? 20.276 16.814 53.356  1.00 49.06 ? 1084 HOH A O   1 
HETATM 5922 O  O   . HOH D 4 .   ? 45.600 9.487  77.563  1.00 48.43 ? 1085 HOH A O   1 
HETATM 5923 O  O   . HOH D 4 .   ? 34.254 61.458 77.486  1.00 16.19 ? 1086 HOH A O   1 
HETATM 5924 O  O   . HOH D 4 .   ? 19.262 42.995 92.982  1.00 30.07 ? 1087 HOH A O   1 
HETATM 5925 O  O   . HOH D 4 .   ? 45.181 9.655  67.521  1.00 50.08 ? 1088 HOH A O   1 
HETATM 5926 O  O   . HOH D 4 .   ? 48.918 34.937 73.741  1.00 13.12 ? 1089 HOH A O   1 
HETATM 5927 O  O   . HOH D 4 .   ? 18.065 47.031 91.886  1.00 32.35 ? 1090 HOH A O   1 
HETATM 5928 O  O   . HOH D 4 .   ? 37.206 48.364 95.051  1.00 38.54 ? 1091 HOH A O   1 
HETATM 5929 O  O   . HOH D 4 .   ? 37.636 61.302 79.582  1.00 18.71 ? 1092 HOH A O   1 
HETATM 5930 O  O   . HOH D 4 .   ? 32.073 60.631 76.279  1.00 7.97  ? 1093 HOH A O   1 
HETATM 5931 O  O   . HOH D 4 .   ? 25.462 63.499 75.936  1.00 28.98 ? 1094 HOH A O   1 
HETATM 5932 O  O   . HOH D 4 .   ? 30.181 52.036 70.274  1.00 12.81 ? 1095 HOH A O   1 
HETATM 5933 O  O   . HOH D 4 .   ? 26.277 49.687 74.217  1.00 24.91 ? 1096 HOH A O   1 
HETATM 5934 O  O   . HOH D 4 .   ? 39.405 47.116 71.949  1.00 14.22 ? 1097 HOH A O   1 
HETATM 5935 O  O   . HOH D 4 .   ? 32.584 39.933 70.779  1.00 14.66 ? 1098 HOH A O   1 
HETATM 5936 O  O   . HOH D 4 .   ? 36.721 54.793 72.034  1.00 16.05 ? 1099 HOH A O   1 
HETATM 5937 O  O   . HOH D 4 .   ? 34.953 62.875 75.349  1.00 16.14 ? 1100 HOH A O   1 
HETATM 5938 O  O   . HOH D 4 .   ? 37.085 65.999 69.568  1.00 48.99 ? 1101 HOH A O   1 
HETATM 5939 O  O   . HOH D 4 .   ? 36.347 57.535 71.677  1.00 12.17 ? 1102 HOH A O   1 
HETATM 5940 O  O   . HOH D 4 .   ? 42.765 68.122 71.806  1.00 18.49 ? 1103 HOH A O   1 
HETATM 5941 O  O   . HOH D 4 .   ? 13.810 14.424 67.827  1.00 54.91 ? 1104 HOH A O   1 
HETATM 5942 O  O   . HOH D 4 .   ? 41.019 55.322 89.511  1.00 24.04 ? 1105 HOH A O   1 
HETATM 5943 O  O   . HOH D 4 .   ? 23.475 39.430 72.804  1.00 22.73 ? 1106 HOH A O   1 
HETATM 5944 O  O   . HOH D 4 .   ? 33.375 46.781 80.110  1.00 15.19 ? 1107 HOH A O   1 
HETATM 5945 O  O   . HOH D 4 .   ? 28.308 39.058 76.885  1.00 14.69 ? 1108 HOH A O   1 
HETATM 5946 O  O   . HOH D 4 .   ? 25.460 39.133 68.509  1.00 15.78 ? 1109 HOH A O   1 
HETATM 5947 O  O   . HOH D 4 .   ? 35.699 37.174 84.807  1.00 18.26 ? 1110 HOH A O   1 
HETATM 5948 O  O   . HOH D 4 .   ? 39.287 49.660 89.748  1.00 12.43 ? 1111 HOH A O   1 
HETATM 5949 O  O   . HOH D 4 .   ? 34.280 48.968 91.831  1.00 25.57 ? 1112 HOH A O   1 
HETATM 5950 O  O   . HOH D 4 .   ? 17.514 50.711 81.419  1.00 20.89 ? 1113 HOH A O   1 
HETATM 5951 O  O   . HOH D 4 .   ? 25.831 36.740 77.059  1.00 13.15 ? 1114 HOH A O   1 
HETATM 5952 O  O   . HOH D 4 .   ? 17.091 34.240 83.033  1.00 35.20 ? 1115 HOH A O   1 
HETATM 5953 O  O   . HOH D 4 .   ? 23.660 44.295 87.981  1.00 18.88 ? 1116 HOH A O   1 
HETATM 5954 O  O   . HOH D 4 .   ? 31.447 43.220 92.039  1.00 14.96 ? 1117 HOH A O   1 
HETATM 5955 O  O   . HOH D 4 .   ? 37.554 37.268 90.414  1.00 13.30 ? 1118 HOH A O   1 
HETATM 5956 O  O   . HOH D 4 .   ? 35.160 46.191 94.600  1.00 20.45 ? 1119 HOH A O   1 
HETATM 5957 O  O   . HOH D 4 .   ? 17.410 55.483 85.796  1.00 18.40 ? 1120 HOH A O   1 
HETATM 5958 O  O   . HOH D 4 .   ? 25.753 69.400 82.054  1.00 33.58 ? 1121 HOH A O   1 
HETATM 5959 O  O   . HOH D 4 .   ? 19.599 38.766 100.921 1.00 51.70 ? 1122 HOH A O   1 
HETATM 5960 O  O   . HOH D 4 .   ? 38.521 41.986 67.764  1.00 25.36 ? 1123 HOH A O   1 
HETATM 5961 O  O   . HOH D 4 .   ? 24.794 47.144 59.490  1.00 37.76 ? 1124 HOH A O   1 
HETATM 5962 O  O   . HOH D 4 .   ? 31.359 0.787  78.463  1.00 27.30 ? 1125 HOH A O   1 
HETATM 5963 O  O   . HOH D 4 .   ? 24.181 6.395  84.526  1.00 23.36 ? 1126 HOH A O   1 
HETATM 5964 O  O   . HOH D 4 .   ? 37.908 20.632 95.878  1.00 57.16 ? 1127 HOH A O   1 
HETATM 5965 O  O   . HOH D 4 .   ? 36.383 19.185 78.954  1.00 14.74 ? 1128 HOH A O   1 
HETATM 5966 O  O   . HOH D 4 .   ? 46.587 28.118 69.079  1.00 7.67  ? 1129 HOH A O   1 
HETATM 5967 O  O   . HOH D 4 .   ? 47.282 19.179 62.148  1.00 26.84 ? 1130 HOH A O   1 
HETATM 5968 O  O   . HOH D 4 .   ? 43.927 30.847 65.195  1.00 9.55  ? 1131 HOH A O   1 
HETATM 5969 O  O   . HOH D 4 .   ? 60.359 22.829 81.504  1.00 58.21 ? 1132 HOH A O   1 
HETATM 5970 O  O   . HOH D 4 .   ? 23.749 23.156 74.975  1.00 10.86 ? 1133 HOH A O   1 
HETATM 5971 O  O   . HOH D 4 .   ? 26.229 34.147 83.281  1.00 28.38 ? 1134 HOH A O   1 
HETATM 5972 O  O   . HOH D 4 .   ? 25.006 37.785 86.909  1.00 27.29 ? 1135 HOH A O   1 
HETATM 5973 O  O   . HOH D 4 .   ? 25.275 35.227 87.539  1.00 35.26 ? 1136 HOH A O   1 
HETATM 5974 O  O   . HOH D 4 .   ? 18.616 41.200 83.972  1.00 45.27 ? 1137 HOH A O   1 
HETATM 5975 O  O   . HOH D 4 .   ? 26.829 19.536 59.448  1.00 17.87 ? 1138 HOH A O   1 
HETATM 5976 O  O   . HOH D 4 .   ? 23.400 37.742 76.638  1.00 14.50 ? 1139 HOH A O   1 
HETATM 5977 O  O   . HOH D 4 .   ? 24.252 30.914 73.383  1.00 9.84  ? 1140 HOH A O   1 
HETATM 5978 O  O   . HOH D 4 .   ? 8.587  20.121 72.693  1.00 30.08 ? 1141 HOH A O   1 
HETATM 5979 O  O   . HOH D 4 .   ? 16.254 25.485 81.613  1.00 25.07 ? 1142 HOH A O   1 
HETATM 5980 O  O   . HOH D 4 .   ? 30.465 20.769 65.535  1.00 17.29 ? 1143 HOH A O   1 
HETATM 5981 O  O   . HOH D 4 .   ? 30.509 14.835 53.470  1.00 18.25 ? 1144 HOH A O   1 
HETATM 5982 O  O   . HOH D 4 .   ? 42.329 31.170 47.205  1.00 27.36 ? 1145 HOH A O   1 
HETATM 5983 O  O   . HOH D 4 .   ? 41.456 14.805 49.068  1.00 24.60 ? 1146 HOH A O   1 
HETATM 5984 O  O   . HOH D 4 .   ? 40.758 14.960 82.178  1.00 33.86 ? 1147 HOH A O   1 
HETATM 5985 O  O   . HOH D 4 .   ? 49.809 23.248 97.681  1.00 44.11 ? 1148 HOH A O   1 
HETATM 5986 O  O   . HOH D 4 .   ? 31.195 22.764 62.413  1.00 13.39 ? 1149 HOH A O   1 
HETATM 5987 O  O   . HOH D 4 .   ? 28.485 33.127 88.124  1.00 34.22 ? 1150 HOH A O   1 
HETATM 5988 O  O   . HOH D 4 .   ? 22.442 27.282 52.551  1.00 29.66 ? 1151 HOH A O   1 
HETATM 5989 O  O   . HOH D 4 .   ? 9.592  12.294 78.952  1.00 36.43 ? 1152 HOH A O   1 
HETATM 5990 O  O   . HOH D 4 .   ? 6.255  20.175 54.625  1.00 48.55 ? 1153 HOH A O   1 
HETATM 5991 O  O   . HOH D 4 .   ? 44.690 26.236 45.104  1.00 44.14 ? 1154 HOH A O   1 
HETATM 5992 O  O   . HOH D 4 .   ? 11.943 8.343  87.124  1.00 49.50 ? 1155 HOH A O   1 
HETATM 5993 O  O   . HOH D 4 .   ? 53.709 45.649 81.037  1.00 50.11 ? 1156 HOH A O   1 
HETATM 5994 O  O   . HOH D 4 .   ? 30.155 45.873 64.983  1.00 21.61 ? 1157 HOH A O   1 
HETATM 5995 O  O   . HOH D 4 .   ? 34.370 41.524 60.446  1.00 36.46 ? 1158 HOH A O   1 
HETATM 5996 O  O   . HOH D 4 .   ? 32.775 36.973 59.587  1.00 30.16 ? 1159 HOH A O   1 
HETATM 5997 O  O   . HOH D 4 .   ? 26.180 23.198 55.347  1.00 18.44 ? 1160 HOH A O   1 
HETATM 5998 O  O   . HOH D 4 .   ? 34.204 7.237  54.035  1.00 34.95 ? 1161 HOH A O   1 
HETATM 5999 O  O   . HOH D 4 .   ? 46.523 13.192 56.390  1.00 45.15 ? 1162 HOH A O   1 
HETATM 6000 O  O   . HOH D 4 .   ? 59.950 43.950 83.759  1.00 54.52 ? 1163 HOH A O   1 
HETATM 6001 O  O   . HOH D 4 .   ? 48.324 39.381 83.873  1.00 16.36 ? 1164 HOH A O   1 
HETATM 6002 O  O   . HOH D 4 .   ? 48.139 42.661 88.254  1.00 39.65 ? 1165 HOH A O   1 
HETATM 6003 O  O   . HOH D 4 .   ? 41.482 40.393 92.930  1.00 13.75 ? 1166 HOH A O   1 
HETATM 6004 O  O   . HOH D 4 .   ? 30.835 57.222 102.220 1.00 39.87 ? 1167 HOH A O   1 
HETATM 6005 O  O   . HOH D 4 .   ? 37.623 44.513 66.476  1.00 36.75 ? 1168 HOH A O   1 
HETATM 6006 O  O   . HOH D 4 .   ? 57.255 33.038 80.980  1.00 33.99 ? 1169 HOH A O   1 
HETATM 6007 O  O   . HOH D 4 .   ? 44.853 61.821 78.394  1.00 31.13 ? 1170 HOH A O   1 
HETATM 6008 O  O   . HOH D 4 .   ? 20.384 43.118 76.478  1.00 35.68 ? 1171 HOH A O   1 
HETATM 6009 O  O   . HOH D 4 .   ? 25.676 38.296 72.998  1.00 16.91 ? 1172 HOH A O   1 
HETATM 6010 O  O   . HOH D 4 .   ? 11.702 6.927  83.724  1.00 49.75 ? 1173 HOH A O   1 
HETATM 6011 O  O   . HOH D 4 .   ? 20.517 33.825 95.125  1.00 29.46 ? 1174 HOH A O   1 
HETATM 6012 O  O   . HOH D 4 .   ? 25.117 27.426 99.403  1.00 34.77 ? 1175 HOH A O   1 
HETATM 6013 O  O   . HOH D 4 .   ? 42.626 39.152 90.832  1.00 18.68 ? 1176 HOH A O   1 
HETATM 6014 O  O   . HOH D 4 .   ? 34.389 33.106 95.064  1.00 43.29 ? 1177 HOH A O   1 
HETATM 6015 O  O   . HOH D 4 .   ? 44.517 37.734 92.566  1.00 41.67 ? 1178 HOH A O   1 
HETATM 6016 O  O   . HOH D 4 .   ? 25.205 17.225 89.435  1.00 35.89 ? 1179 HOH A O   1 
HETATM 6017 O  O   . HOH D 4 .   ? 33.280 40.135 79.301  1.00 17.52 ? 1180 HOH A O   1 
HETATM 6018 O  O   . HOH D 4 .   ? 31.186 38.829 77.700  1.00 12.32 ? 1181 HOH A O   1 
HETATM 6019 O  O   . HOH D 4 .   ? 26.186 34.901 73.789  1.00 24.23 ? 1182 HOH A O   1 
HETATM 6020 O  O   . HOH D 4 .   ? 28.794 23.316 64.566  1.00 13.59 ? 1183 HOH A O   1 
HETATM 6021 O  O   . HOH D 4 .   ? 35.607 10.226 74.048  1.00 18.53 ? 1184 HOH A O   1 
HETATM 6022 O  O   . HOH D 4 .   ? 32.174 15.292 86.513  1.00 23.38 ? 1185 HOH A O   1 
HETATM 6023 O  O   . HOH D 4 .   ? 24.189 13.773 82.959  1.00 28.74 ? 1186 HOH A O   1 
HETATM 6024 O  O   . HOH D 4 .   ? 23.211 15.512 87.959  1.00 24.21 ? 1187 HOH A O   1 
HETATM 6025 O  O   . HOH D 4 .   ? 3.524  16.602 94.579  1.00 41.89 ? 1188 HOH A O   1 
HETATM 6026 O  O   . HOH D 4 .   ? 7.223  25.952 88.333  1.00 53.95 ? 1189 HOH A O   1 
HETATM 6027 O  O   . HOH D 4 .   ? 28.716 21.597 61.621  1.00 26.57 ? 1190 HOH A O   1 
HETATM 6028 O  O   . HOH D 4 .   ? 55.539 38.313 84.100  1.00 29.32 ? 1191 HOH A O   1 
HETATM 6029 O  O   . HOH D 4 .   ? 54.715 37.769 86.516  1.00 23.01 ? 1192 HOH A O   1 
HETATM 6030 O  O   . HOH D 4 .   ? 26.182 46.007 71.877  1.00 23.62 ? 1193 HOH A O   1 
HETATM 6031 O  O   . HOH D 4 .   ? 46.270 28.232 58.725  1.00 13.16 ? 1194 HOH A O   1 
HETATM 6032 O  O   . HOH D 4 .   ? 41.095 42.391 64.511  1.00 26.24 ? 1195 HOH A O   1 
HETATM 6033 O  O   . HOH D 4 .   ? 57.340 37.577 76.163  1.00 31.91 ? 1196 HOH A O   1 
HETATM 6034 O  O   . HOH D 4 .   ? 55.523 24.957 70.901  1.00 36.47 ? 1197 HOH A O   1 
HETATM 6035 O  O   . HOH D 4 .   ? 52.572 27.089 89.925  1.00 47.49 ? 1198 HOH A O   1 
HETATM 6036 O  O   . HOH D 4 .   ? 32.651 23.149 66.224  1.00 24.61 ? 1199 HOH A O   1 
HETATM 6037 O  O   . HOH D 4 .   ? 38.633 34.124 90.122  1.00 40.49 ? 1200 HOH A O   1 
HETATM 6038 O  O   . HOH D 4 .   ? 40.357 1.314  81.562  1.00 48.36 ? 1201 HOH A O   1 
HETATM 6039 O  O   . HOH D 4 .   ? 39.307 3.729  85.881  1.00 35.57 ? 1202 HOH A O   1 
HETATM 6040 O  O   . HOH D 4 .   ? 10.739 16.484 96.156  1.00 30.31 ? 1203 HOH A O   1 
HETATM 6041 O  O   . HOH D 4 .   ? 20.461 28.012 96.029  1.00 41.78 ? 1204 HOH A O   1 
HETATM 6042 O  O   . HOH D 4 .   ? 9.316  29.176 86.701  1.00 29.49 ? 1205 HOH A O   1 
HETATM 6043 O  O   . HOH D 4 .   ? 14.623 36.175 82.036  1.00 48.31 ? 1206 HOH A O   1 
HETATM 6044 O  O   . HOH D 4 .   ? 20.619 35.425 82.485  1.00 20.52 ? 1207 HOH A O   1 
HETATM 6045 O  O   . HOH D 4 .   ? 17.828 33.405 93.692  1.00 35.64 ? 1208 HOH A O   1 
HETATM 6046 O  O   . HOH D 4 .   ? 20.595 36.362 97.885  1.00 41.70 ? 1209 HOH A O   1 
HETATM 6047 O  O   . HOH D 4 .   ? 20.880 24.035 94.209  1.00 17.68 ? 1210 HOH A O   1 
HETATM 6048 O  O   . HOH D 4 .   ? 42.874 15.008 86.341  1.00 50.34 ? 1211 HOH A O   1 
HETATM 6049 O  O   . HOH D 4 .   ? 50.275 34.068 66.324  1.00 42.88 ? 1212 HOH A O   1 
HETATM 6050 O  O   . HOH D 4 .   ? 51.316 31.093 61.583  1.00 24.25 ? 1213 HOH A O   1 
HETATM 6051 O  O   . HOH D 4 .   ? 56.612 27.678 58.807  1.00 34.12 ? 1214 HOH A O   1 
HETATM 6052 O  O   . HOH D 4 .   ? 11.996 42.582 67.195  1.00 49.94 ? 1215 HOH A O   1 
HETATM 6053 O  O   . HOH D 4 .   ? 14.815 9.527  67.337  1.00 35.77 ? 1216 HOH A O   1 
HETATM 6054 O  O   . HOH D 4 .   ? 21.104 18.318 57.693  1.00 41.69 ? 1217 HOH A O   1 
HETATM 6055 O  O   . HOH D 4 .   ? 14.061 2.399  77.608  1.00 48.55 ? 1218 HOH A O   1 
HETATM 6056 O  O   . HOH D 4 .   ? 17.327 41.838 52.568  1.00 42.12 ? 1219 HOH A O   1 
HETATM 6057 O  O   . HOH D 4 .   ? 38.028 30.041 36.041  1.00 31.63 ? 1220 HOH A O   1 
HETATM 6058 O  O   . HOH D 4 .   ? 32.841 38.501 39.761  1.00 43.06 ? 1221 HOH A O   1 
HETATM 6059 O  O   . HOH D 4 .   ? 44.598 10.817 55.886  1.00 41.44 ? 1222 HOH A O   1 
HETATM 6060 O  O   . HOH D 4 .   ? 29.248 12.780 50.123  1.00 43.89 ? 1223 HOH A O   1 
HETATM 6061 O  O   . HOH D 4 .   ? 46.162 23.942 50.681  1.00 23.11 ? 1224 HOH A O   1 
HETATM 6062 O  O   . HOH D 4 .   ? 43.467 41.233 62.466  1.00 24.33 ? 1225 HOH A O   1 
HETATM 6063 O  O   . HOH D 4 .   ? 47.833 45.706 49.351  1.00 38.75 ? 1226 HOH A O   1 
HETATM 6064 O  O   . HOH D 4 .   ? 37.206 42.709 59.660  1.00 21.14 ? 1227 HOH A O   1 
HETATM 6065 O  O   . HOH D 4 .   ? 50.316 18.751 79.486  1.00 19.63 ? 1228 HOH A O   1 
HETATM 6066 O  O   . HOH D 4 .   ? 45.194 46.833 88.768  1.00 45.26 ? 1229 HOH A O   1 
HETATM 6067 O  O   . HOH D 4 .   ? 23.057 47.626 70.683  1.00 34.00 ? 1230 HOH A O   1 
HETATM 6068 O  O   . HOH D 4 .   ? 50.309 46.850 74.477  1.00 35.47 ? 1231 HOH A O   1 
HETATM 6069 O  O   . HOH D 4 .   ? 36.155 57.190 64.512  1.00 41.22 ? 1232 HOH A O   1 
HETATM 6070 O  O   . HOH D 4 .   ? 27.157 37.112 74.748  1.00 28.50 ? 1233 HOH A O   1 
HETATM 6071 O  O   . HOH D 4 .   ? 18.364 45.621 81.877  1.00 50.95 ? 1234 HOH A O   1 
HETATM 6072 O  O   . HOH D 4 .   ? 22.269 36.544 85.148  1.00 34.24 ? 1235 HOH A O   1 
HETATM 6073 O  O   . HOH D 4 .   ? 22.405 61.418 74.975  1.00 28.27 ? 1236 HOH A O   1 
HETATM 6074 O  O   . HOH D 4 .   ? 29.050 67.551 78.252  1.00 37.38 ? 1237 HOH A O   1 
HETATM 6075 O  O   . HOH D 4 .   ? 16.895 44.971 88.595  1.00 46.19 ? 1238 HOH A O   1 
HETATM 6076 O  O   . HOH D 4 .   ? 20.678 39.171 85.830  1.00 49.09 ? 1239 HOH A O   1 
HETATM 6077 O  O   . HOH D 4 .   ? 24.367 38.209 83.885  1.00 24.68 ? 1240 HOH A O   1 
HETATM 6078 O  O   . HOH D 4 .   ? 50.703 46.593 70.990  1.00 51.81 ? 1241 HOH A O   1 
HETATM 6079 O  O   . HOH D 4 .   ? 50.145 44.620 86.748  1.00 36.84 ? 1242 HOH A O   1 
HETATM 6080 O  O   . HOH D 4 .   ? 14.474 2.407  80.638  1.00 36.88 ? 1243 HOH A O   1 
HETATM 6081 O  O   . HOH D 4 .   ? 47.568 61.020 76.224  1.00 45.96 ? 1244 HOH A O   1 
HETATM 6082 O  O   . HOH D 4 .   ? 22.565 39.920 75.226  1.00 18.74 ? 1245 HOH A O   1 
HETATM 6083 O  O   . HOH D 4 .   ? 21.043 43.864 84.189  1.00 24.83 ? 1246 HOH A O   1 
HETATM 6084 O  O   . HOH D 4 .   ? 4.359  15.747 80.946  1.00 20.55 ? 1247 HOH A O   1 
HETATM 6085 O  O   . HOH D 4 .   ? 7.621  12.633 81.788  1.00 46.80 ? 1248 HOH A O   1 
HETATM 6086 O  O   . HOH D 4 .   ? 40.892 40.593 73.649  1.00 14.85 ? 1249 HOH A O   1 
HETATM 6087 O  O   . HOH D 4 .   ? 57.211 28.395 52.134  1.00 40.10 ? 1250 HOH A O   1 
HETATM 6088 O  O   . HOH D 4 .   ? 32.996 5.637  76.960  1.00 47.13 ? 1251 HOH A O   1 
HETATM 6089 O  O   . HOH D 4 .   ? 50.119 28.886 93.573  1.00 59.34 ? 1252 HOH A O   1 
HETATM 6090 O  O   . HOH D 4 .   ? 56.961 35.102 73.579  1.00 41.65 ? 1253 HOH A O   1 
HETATM 6091 O  O   . HOH D 4 .   ? 16.408 41.317 88.649  1.00 62.14 ? 1254 HOH A O   1 
HETATM 6092 O  O   . HOH D 4 .   ? 11.676 14.853 71.609  1.00 46.50 ? 1255 HOH A O   1 
HETATM 6093 O  O   . HOH D 4 .   ? 35.120 13.869 46.597  1.00 44.81 ? 1256 HOH A O   1 
HETATM 6094 O  O   . HOH D 4 .   ? 27.381 9.149  94.598  1.00 49.76 ? 1257 HOH A O   1 
HETATM 6095 O  O   . HOH D 4 .   ? 18.382 6.984  90.296  1.00 41.69 ? 1258 HOH A O   1 
HETATM 6096 O  O   . HOH D 4 .   ? 20.242 15.330 95.632  1.00 46.51 ? 1259 HOH A O   1 
HETATM 6097 O  O   . HOH D 4 .   ? 8.939  24.001 97.674  1.00 38.85 ? 1260 HOH A O   1 
HETATM 6098 O  O   . HOH D 4 .   ? 26.461 14.412 87.245  1.00 43.80 ? 1261 HOH A O   1 
HETATM 6099 O  O   . HOH D 4 .   ? 23.450 25.259 97.542  1.00 53.02 ? 1262 HOH A O   1 
HETATM 6100 O  O   . HOH D 4 .   ? 18.290 18.055 97.784  1.00 33.43 ? 1263 HOH A O   1 
HETATM 6101 O  O   . HOH D 4 .   ? 17.135 28.998 96.422  1.00 34.28 ? 1264 HOH A O   1 
HETATM 6102 O  O   . HOH D 4 .   ? 8.795  33.402 85.932  1.00 60.61 ? 1265 HOH A O   1 
HETATM 6103 O  O   . HOH D 4 .   ? 30.408 23.122 91.575  1.00 33.15 ? 1266 HOH A O   1 
HETATM 6104 O  O   . HOH D 4 .   ? 49.529 34.547 91.767  1.00 43.37 ? 1267 HOH A O   1 
HETATM 6105 O  O   . HOH D 4 .   ? 49.702 37.874 95.922  1.00 53.50 ? 1268 HOH A O   1 
HETATM 6106 O  O   . HOH D 4 .   ? 33.018 19.274 92.699  1.00 54.41 ? 1269 HOH A O   1 
HETATM 6107 O  O   . HOH D 4 .   ? 56.758 33.995 57.269  1.00 48.73 ? 1270 HOH A O   1 
HETATM 6108 O  O   . HOH D 4 .   ? 58.038 24.617 64.368  1.00 39.30 ? 1271 HOH A O   1 
HETATM 6109 O  O   . HOH D 4 .   ? 50.190 35.617 69.145  1.00 48.02 ? 1272 HOH A O   1 
HETATM 6110 O  O   . HOH D 4 .   ? 54.168 23.452 74.031  1.00 49.18 ? 1273 HOH A O   1 
HETATM 6111 O  O   . HOH D 4 .   ? 58.113 21.931 79.438  1.00 55.86 ? 1274 HOH A O   1 
HETATM 6112 O  O   . HOH D 4 .   ? 50.816 16.921 68.318  1.00 53.79 ? 1275 HOH A O   1 
HETATM 6113 O  O   . HOH D 4 .   ? 60.807 25.225 63.999  1.00 44.17 ? 1276 HOH A O   1 
HETATM 6114 O  O   . HOH D 4 .   ? 56.144 28.805 79.666  1.00 48.69 ? 1277 HOH A O   1 
HETATM 6115 O  O   . HOH D 4 .   ? 36.083 9.409  71.101  1.00 43.27 ? 1278 HOH A O   1 
HETATM 6116 O  O   . HOH D 4 .   ? 31.167 22.176 97.317  1.00 41.54 ? 1279 HOH A O   1 
HETATM 6117 O  O   . HOH D 4 .   ? 22.176 31.344 95.351  1.00 43.29 ? 1280 HOH A O   1 
HETATM 6118 O  O   . HOH D 4 .   ? 10.362 37.500 79.129  1.00 51.55 ? 1281 HOH A O   1 
HETATM 6119 O  O   . HOH D 4 .   ? 20.790 20.103 54.130  1.00 41.92 ? 1282 HOH A O   1 
HETATM 6120 O  O   . HOH D 4 .   ? 10.682 21.720 49.881  1.00 54.65 ? 1283 HOH A O   1 
HETATM 6121 O  O   . HOH D 4 .   ? 14.286 36.420 59.573  1.00 45.36 ? 1284 HOH A O   1 
HETATM 6122 O  O   . HOH D 4 .   ? 7.258  29.357 56.333  1.00 52.94 ? 1285 HOH A O   1 
HETATM 6123 O  O   . HOH D 4 .   ? 16.775 41.785 62.482  1.00 44.48 ? 1286 HOH A O   1 
HETATM 6124 O  O   . HOH D 4 .   ? 9.286  38.752 64.700  1.00 40.61 ? 1287 HOH A O   1 
HETATM 6125 O  O   . HOH D 4 .   ? 11.403 16.665 67.834  1.00 48.46 ? 1288 HOH A O   1 
HETATM 6126 O  O   . HOH D 4 .   ? 14.078 6.265  79.856  1.00 24.83 ? 1289 HOH A O   1 
HETATM 6127 O  O   . HOH D 4 .   ? 7.527  30.607 82.850  1.00 43.11 ? 1290 HOH A O   1 
HETATM 6128 O  O   . HOH D 4 .   ? 10.503 37.860 70.835  1.00 37.90 ? 1291 HOH A O   1 
HETATM 6129 O  O   . HOH D 4 .   ? 10.923 30.332 56.191  1.00 50.09 ? 1292 HOH A O   1 
HETATM 6130 O  O   . HOH D 4 .   ? 28.959 48.530 65.081  1.00 43.96 ? 1293 HOH A O   1 
HETATM 6131 O  O   . HOH D 4 .   ? 20.964 47.258 60.953  1.00 52.75 ? 1294 HOH A O   1 
HETATM 6132 O  O   . HOH D 4 .   ? 17.506 35.561 42.674  1.00 48.66 ? 1295 HOH A O   1 
HETATM 6133 O  O   . HOH D 4 .   ? 30.475 47.714 43.993  1.00 42.66 ? 1296 HOH A O   1 
HETATM 6134 O  O   . HOH D 4 .   ? 34.924 44.095 47.666  1.00 28.93 ? 1297 HOH A O   1 
HETATM 6135 O  O   . HOH D 4 .   ? 41.001 38.386 45.743  1.00 56.90 ? 1298 HOH A O   1 
HETATM 6136 O  O   . HOH D 4 .   ? 39.396 16.673 42.444  1.00 41.01 ? 1299 HOH A O   1 
HETATM 6137 O  O   . HOH D 4 .   ? 48.246 18.258 58.049  1.00 49.22 ? 1300 HOH A O   1 
HETATM 6138 O  O   . HOH D 4 .   ? 39.907 14.295 44.746  1.00 50.67 ? 1301 HOH A O   1 
HETATM 6139 O  O   . HOH D 4 .   ? 46.202 21.261 51.479  1.00 39.11 ? 1302 HOH A O   1 
HETATM 6140 O  O   . HOH D 4 .   ? 39.493 40.089 65.888  1.00 33.71 ? 1303 HOH A O   1 
HETATM 6141 O  O   . HOH D 4 .   ? 34.803 44.814 59.581  1.00 26.36 ? 1304 HOH A O   1 
HETATM 6142 O  O   . HOH D 4 .   ? 34.280 51.126 66.028  1.00 36.10 ? 1305 HOH A O   1 
HETATM 6143 O  O   . HOH D 4 .   ? 42.300 50.296 62.452  1.00 53.77 ? 1306 HOH A O   1 
HETATM 6144 O  O   . HOH D 4 .   ? 39.817 48.223 67.117  1.00 50.02 ? 1307 HOH A O   1 
HETATM 6145 O  O   . HOH D 4 .   ? 18.963 31.135 47.177  1.00 41.76 ? 1308 HOH A O   1 
HETATM 6146 O  O   . HOH D 4 .   ? 31.773 35.529 31.874  1.00 54.98 ? 1309 HOH A O   1 
HETATM 6147 O  O   . HOH D 4 .   ? 38.793 27.390 25.950  1.00 50.45 ? 1310 HOH A O   1 
HETATM 6148 O  O   . HOH D 4 .   ? 23.308 22.466 30.066  1.00 54.50 ? 1311 HOH A O   1 
HETATM 6149 O  O   . HOH D 4 .   ? 26.219 21.175 32.718  1.00 52.77 ? 1312 HOH A O   1 
HETATM 6150 O  O   . HOH D 4 .   ? 48.891 15.860 59.400  1.00 50.59 ? 1313 HOH A O   1 
HETATM 6151 O  O   . HOH D 4 .   ? 47.039 10.794 72.256  1.00 52.20 ? 1314 HOH A O   1 
HETATM 6152 O  O   . HOH D 4 .   ? 56.358 15.740 91.934  1.00 47.26 ? 1315 HOH A O   1 
HETATM 6153 O  O   . HOH D 4 .   ? 55.479 41.139 83.512  1.00 39.18 ? 1316 HOH A O   1 
HETATM 6154 O  O   . HOH D 4 .   ? 48.831 40.945 85.996  1.00 26.12 ? 1317 HOH A O   1 
HETATM 6155 O  O   . HOH D 4 .   ? 27.280 46.202 102.170 1.00 48.74 ? 1318 HOH A O   1 
HETATM 6156 O  O   . HOH D 4 .   ? 27.066 60.109 98.823  1.00 55.77 ? 1319 HOH A O   1 
HETATM 6157 O  O   . HOH D 4 .   ? 25.698 51.850 66.714  1.00 46.76 ? 1320 HOH A O   1 
HETATM 6158 O  O   . HOH D 4 .   ? 37.876 47.722 69.369  1.00 32.89 ? 1321 HOH A O   1 
HETATM 6159 O  O   . HOH D 4 .   ? 45.819 51.200 71.277  1.00 50.22 ? 1322 HOH A O   1 
HETATM 6160 O  O   . HOH D 4 .   ? 45.755 54.238 71.582  1.00 40.47 ? 1323 HOH A O   1 
HETATM 6161 O  O   . HOH D 4 .   ? 33.872 65.757 78.214  1.00 43.31 ? 1324 HOH A O   1 
HETATM 6162 O  O   . HOH D 4 .   ? 29.219 57.901 64.646  1.00 57.65 ? 1325 HOH A O   1 
HETATM 6163 O  O   . HOH D 4 .   ? 43.256 54.738 67.209  1.00 54.19 ? 1326 HOH A O   1 
HETATM 6164 O  O   . HOH D 4 .   ? 42.490 62.367 76.647  1.00 42.21 ? 1327 HOH A O   1 
HETATM 6165 O  O   . HOH D 4 .   ? 46.275 64.659 77.557  1.00 47.90 ? 1328 HOH A O   1 
HETATM 6166 O  O   . HOH D 4 .   ? 39.239 66.581 88.599  1.00 54.79 ? 1329 HOH A O   1 
HETATM 6167 O  O   . HOH D 4 .   ? 48.483 52.027 85.178  1.00 53.51 ? 1330 HOH A O   1 
HETATM 6168 O  O   . HOH D 4 .   ? 37.242 60.115 91.595  1.00 43.28 ? 1331 HOH A O   1 
HETATM 6169 O  O   . HOH D 4 .   ? 15.259 57.399 88.147  1.00 44.22 ? 1332 HOH A O   1 
HETATM 6170 O  O   . HOH D 4 .   ? 20.547 67.015 78.932  1.00 54.09 ? 1333 HOH A O   1 
HETATM 6171 O  O   . HOH D 4 .   ? 18.715 47.986 102.371 1.00 54.45 ? 1334 HOH A O   1 
HETATM 6172 O  O   . HOH D 4 .   ? 22.208 71.323 94.248  1.00 44.07 ? 1335 HOH A O   1 
HETATM 6173 O  O   . HOH D 4 .   ? 26.049 74.284 94.292  1.00 57.55 ? 1336 HOH A O   1 
HETATM 6174 O  O   . HOH D 4 .   ? 14.392 59.031 92.943  1.00 58.59 ? 1337 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PCA 1   1   ?   ?   ?   A . n 
A 1 2   ARG 2   2   2   ARG ARG A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ALA 6   6   6   ALA ALA A . n 
A 1 7   MET 7   7   7   MET MET A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   HIS 9   9   9   HIS HIS A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  HIS 13  13  13  HIS HIS A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  TYR 15  15  15  TYR TYR A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ARG 17  17  17  ARG ARG A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  ASP 19  19  19  ASP ASP A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  ILE 25  25  25  ILE ILE A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  PRO 35  35  35  PRO PRO A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  TYR 44  44  44  TYR TYR A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  HIS 46  46  46  HIS HIS A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  TYR 61  61  61  TYR TYR A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  ARG 63  63  63  ARG ARG A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  PRO 66  66  66  PRO PRO A . n 
A 1 67  ASP 67  67  67  ASP ASP A . n 
A 1 68  ARG 68  68  68  ARG ARG A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  MET 71  71  71  MET MET A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  GLN 77  77  77  GLN GLN A . n 
A 1 78  MET 78  78  78  MET MET A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  MET 80  80  80  MET MET A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  PRO 89  89  89  PRO PRO A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  HIS 98  98  98  HIS HIS A . n 
A 1 99  CYS 99  99  99  CYS CYS A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 GLU 110 110 110 GLU GLU A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ARG 114 114 114 ARG ARG A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 LYS 117 117 117 LYS LYS A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 ASN 120 120 120 ASN ASN A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 ASN 125 125 125 ASN ASN A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 GLY 131 131 131 GLY GLY A . n 
A 1 132 ALA 132 132 132 ALA ALA A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 PHE 138 138 138 PHE PHE A . n 
A 1 139 TRP 139 139 139 TRP TRP A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 HIS 147 147 147 HIS HIS A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 TYR 156 156 156 TYR TYR A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 ILE 162 162 162 ILE ILE A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 ASP 165 165 165 ASP ASP A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 HIS 167 167 167 HIS HIS A . n 
A 1 168 THR 168 168 168 THR THR A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 CYS 178 178 178 CYS CYS A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 GLY 180 180 180 GLY GLY A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 GLY 183 183 183 GLY GLY A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 ASP 188 188 188 ASP ASP A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ILE 193 193 193 ILE ILE A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 TRP 195 195 195 TRP TRP A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 CYS 199 199 199 CYS CYS A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 LYS 206 206 206 LYS LYS A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 THR 208 208 208 THR THR A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 SER 210 210 210 SER SER A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 TRP 214 214 214 TRP TRP A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 LYS 218 218 218 LYS LYS A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 VAL 230 230 230 VAL VAL A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 GLU 239 239 239 GLU GLU A . n 
A 1 240 TYR 240 240 240 TYR TYR A . n 
A 1 241 HIS 241 241 241 HIS HIS A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 PRO 243 243 243 PRO PRO A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 ASP 246 246 246 ASP ASP A . n 
A 1 247 SER 247 247 247 SER SER A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 CYS 250 250 250 CYS CYS A . n 
A 1 251 THR 251 251 251 THR THR A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 MET 253 253 253 MET MET A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 THR 255 255 255 THR THR A . n 
A 1 256 ILE 256 256 256 ILE ILE A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 ASN 258 258 258 ASN ASN A . n 
A 1 259 MET 259 259 259 MET MET A . n 
A 1 260 GLY 260 260 260 GLY GLY A . n 
A 1 261 ALA 261 261 261 ALA ALA A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 THR 266 266 266 THR THR A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 VAL 269 269 269 VAL VAL A . n 
A 1 270 PHE 270 270 270 PHE PHE A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 TYR 272 272 272 TYR TYR A . n 
A 1 273 ASN 273 273 273 ASN ASN A . n 
A 1 274 HIS 274 274 274 HIS HIS A . n 
A 1 275 ARG 275 275 275 ARG ARG A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 LYS 277 277 277 LYS LYS A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 TYR 279 279 279 TYR TYR A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 LYS 282 282 282 LYS LYS A . n 
A 1 283 THR 283 283 283 THR THR A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 ASP 287 287 287 ASP ASP A . n 
A 1 288 ILE 288 288 288 ILE ILE A . n 
A 1 289 ALA 289 289 289 ALA ALA A . n 
A 1 290 ASN 290 290 290 ASN ASN A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 ASP 293 293 293 ASP ASP A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 HIS 298 298 298 HIS HIS A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 ASP 302 302 302 ASP ASP A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 CYS 305 305 305 CYS CYS A . n 
A 1 306 HIS 306 306 306 HIS HIS A . n 
A 1 307 TYR 307 307 307 TYR TYR A . n 
A 1 308 ASP 308 308 308 ASP ASP A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 VAL 310 310 310 VAL VAL A . n 
A 1 311 ILE 311 311 311 ILE ILE A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 ILE 313 313 313 ILE ILE A . n 
A 1 314 ASN 314 314 314 ASN ASN A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 SER 316 316 316 SER SER A . n 
A 1 317 GLU 317 317 317 GLU GLU A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 LYS 319 319 319 LYS LYS A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 HIS 321 321 321 HIS HIS A . n 
A 1 322 ILE 322 322 322 ILE ILE A . n 
A 1 323 ASN 323 323 323 ASN ASN A . n 
A 1 324 GLY 324 324 324 GLY GLY A . n 
A 1 325 PRO 325 325 325 PRO PRO A . n 
A 1 326 PHE 326 326 326 PHE PHE A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 PRO 328 328 328 PRO PRO A . n 
A 1 329 ASP 329 329 329 ASP ASP A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 ALA 331 331 331 ALA ALA A . n 
A 1 332 HIS 332 332 332 HIS HIS A . n 
A 1 333 PRO 333 333 333 PRO PRO A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 ALA 335 335 335 ALA ALA A . n 
A 1 336 GLU 336 336 336 GLU GLU A . n 
A 1 337 VAL 337 337 337 VAL VAL A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 SER 339 339 339 SER SER A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 GLU 342 342 342 GLU GLU A . n 
A 1 343 LYS 343 343 343 LYS LYS A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 TRP 346 346 346 TRP TRP A . n 
A 1 347 PRO 347 347 347 PRO PRO A . n 
A 1 348 LEU 348 348 348 LEU LEU A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ILE 350 350 350 ILE ILE A . n 
A 1 351 ARG 351 351 351 ARG ARG A . n 
A 1 352 VAL 352 352 352 VAL VAL A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 ILE 355 355 355 ILE ILE A . n 
A 1 356 GLY 356 356 356 GLY GLY A . n 
A 1 357 SER 357 357 357 SER SER A . n 
A 1 358 CYS 358 358 358 CYS CYS A . n 
A 1 359 THR 359 359 359 THR THR A . n 
A 1 360 ASN 360 360 360 ASN ASN A . n 
A 1 361 SER 361 361 361 SER SER A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 TYR 363 363 363 TYR TYR A . n 
A 1 364 GLU 364 364 364 GLU GLU A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 MET 366 366 366 MET MET A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 ARG 368 368 368 ARG ARG A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 VAL 372 372 372 VAL VAL A . n 
A 1 373 ALA 373 373 373 ALA ALA A . n 
A 1 374 LYS 374 374 374 LYS LYS A . n 
A 1 375 GLN 375 375 375 GLN GLN A . n 
A 1 376 ALA 376 376 376 ALA ALA A . n 
A 1 377 LEU 377 377 377 LEU LEU A . n 
A 1 378 ALA 378 378 378 ALA ALA A . n 
A 1 379 HIS 379 379 379 HIS HIS A . n 
A 1 380 GLY 380 380 380 GLY GLY A . n 
A 1 381 LEU 381 381 381 LEU LEU A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 CYS 383 383 383 CYS CYS A . n 
A 1 384 LYS 384 384 384 LYS LYS A . n 
A 1 385 SER 385 385 385 SER SER A . n 
A 1 386 GLN 386 386 386 GLN GLN A . n 
A 1 387 PHE 387 387 387 PHE PHE A . n 
A 1 388 THR 388 388 388 THR THR A . n 
A 1 389 ILE 389 389 389 ILE ILE A . n 
A 1 390 THR 390 390 390 THR THR A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 GLY 392 392 392 GLY GLY A . n 
A 1 393 SER 393 393 393 SER SER A . n 
A 1 394 GLU 394 394 394 GLU GLU A . n 
A 1 395 GLN 395 395 395 GLN GLN A . n 
A 1 396 ILE 396 396 396 ILE ILE A . n 
A 1 397 ARG 397 397 397 ARG ARG A . n 
A 1 398 ALA 398 398 398 ALA ALA A . n 
A 1 399 THR 399 399 399 THR THR A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 GLU 401 401 401 GLU GLU A . n 
A 1 402 ARG 402 402 402 ARG ARG A . n 
A 1 403 ASP 403 403 403 ASP ASP A . n 
A 1 404 GLY 404 404 404 GLY GLY A . n 
A 1 405 TYR 405 405 405 TYR TYR A . n 
A 1 406 ALA 406 406 406 ALA ALA A . n 
A 1 407 GLN 407 407 407 GLN GLN A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 LEU 409 409 409 LEU LEU A . n 
A 1 410 ARG 410 410 410 ARG ARG A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 VAL 412 412 412 VAL VAL A . n 
A 1 413 GLY 413 413 413 GLY GLY A . n 
A 1 414 GLY 414 414 414 GLY GLY A . n 
A 1 415 ILE 415 415 415 ILE ILE A . n 
A 1 416 VAL 416 416 416 VAL VAL A . n 
A 1 417 LEU 417 417 417 LEU LEU A . n 
A 1 418 ALA 418 418 418 ALA ALA A . n 
A 1 419 ASN 419 419 419 ASN ASN A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 CYS 421 421 421 CYS CYS A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 CYS 424 424 424 CYS CYS A . n 
A 1 425 ILE 425 425 425 ILE ILE A . n 
A 1 426 GLY 426 426 426 GLY GLY A . n 
A 1 427 GLN 427 427 427 GLN GLN A . n 
A 1 428 TRP 428 428 428 TRP TRP A . n 
A 1 429 ASP 429 429 429 ASP ASP A . n 
A 1 430 ARG 430 430 430 ARG ARG A . n 
A 1 431 LYS 431 431 431 LYS LYS A . n 
A 1 432 ASP 432 432 432 ASP ASP A . n 
A 1 433 ILE 433 433 433 ILE ILE A . n 
A 1 434 LYS 434 434 434 LYS LYS A . n 
A 1 435 LYS 435 435 435 LYS LYS A . n 
A 1 436 GLY 436 436 436 GLY GLY A . n 
A 1 437 GLU 437 437 437 GLU GLU A . n 
A 1 438 LYS 438 438 438 LYS LYS A . n 
A 1 439 ASN 439 439 439 ASN ASN A . n 
A 1 440 THR 440 440 440 THR THR A . n 
A 1 441 ILE 441 441 441 ILE ILE A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 THR 443 443 443 THR THR A . n 
A 1 444 SER 444 444 444 SER SER A . n 
A 1 445 TYR 445 445 445 TYR TYR A . n 
A 1 446 ASN 446 446 446 ASN ASN A . n 
A 1 447 ARG 447 447 447 ARG ARG A . n 
A 1 448 ASN 448 448 448 ASN ASN A . n 
A 1 449 PHE 449 449 449 PHE PHE A . n 
A 1 450 THR 450 450 450 THR THR A . n 
A 1 451 GLY 451 451 451 GLY GLY A . n 
A 1 452 ARG 452 452 452 ARG ARG A . n 
A 1 453 ASN 453 453 453 ASN ASN A . n 
A 1 454 ASP 454 454 454 ASP ASP A . n 
A 1 455 ALA 455 455 455 ALA ALA A . n 
A 1 456 ASN 456 456 456 ASN ASN A . n 
A 1 457 PRO 457 457 457 PRO PRO A . n 
A 1 458 GLU 458 458 458 GLU GLU A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 HIS 460 460 460 HIS HIS A . n 
A 1 461 ALA 461 461 461 ALA ALA A . n 
A 1 462 PHE 462 462 462 PHE PHE A . n 
A 1 463 VAL 463 463 463 VAL VAL A . n 
A 1 464 THR 464 464 464 THR THR A . n 
A 1 465 SER 465 465 465 SER SER A . n 
A 1 466 PRO 466 466 466 PRO PRO A . n 
A 1 467 GLU 467 467 467 GLU GLU A . n 
A 1 468 ILE 468 468 468 ILE ILE A . n 
A 1 469 VAL 469 469 469 VAL VAL A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ALA 471 471 471 ALA ALA A . n 
A 1 472 LEU 472 472 472 LEU LEU A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 ILE 474 474 474 ILE ILE A . n 
A 1 475 ALA 475 475 475 ALA ALA A . n 
A 1 476 GLY 476 476 476 GLY GLY A . n 
A 1 477 THR 477 477 477 THR THR A . n 
A 1 478 LEU 478 478 478 LEU LEU A . n 
A 1 479 LYS 479 479 479 LYS LYS A . n 
A 1 480 PHE 480 480 480 PHE PHE A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 GLU 483 483 483 GLU GLU A . n 
A 1 484 THR 484 484 484 THR THR A . n 
A 1 485 ASP 485 485 485 ASP ASP A . n 
A 1 486 PHE 486 486 486 PHE PHE A . n 
A 1 487 LEU 487 487 487 LEU LEU A . n 
A 1 488 THR 488 488 488 THR THR A . n 
A 1 489 GLY 489 489 489 GLY GLY A . n 
A 1 490 LYS 490 490 490 LYS LYS A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 GLY 492 492 492 GLY GLY A . n 
A 1 493 LYS 493 493 493 LYS LYS A . n 
A 1 494 LYS 494 494 494 LYS LYS A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 LYS 496 496 496 LYS LYS A . n 
A 1 497 LEU 497 497 497 LEU LEU A . n 
A 1 498 GLU 498 498 498 GLU GLU A . n 
A 1 499 ALA 499 499 499 ALA ALA A . n 
A 1 500 PRO 500 500 500 PRO PRO A . n 
A 1 501 ASP 501 501 501 ASP ASP A . n 
A 1 502 ALA 502 502 502 ALA ALA A . n 
A 1 503 ASP 503 503 503 ASP ASP A . n 
A 1 504 GLU 504 504 504 GLU GLU A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 PRO 506 506 506 PRO PRO A . n 
A 1 507 ARG 507 507 507 ARG ARG A . n 
A 1 508 ALA 508 508 508 ALA ALA A . n 
A 1 509 GLU 509 509 509 GLU GLU A . n 
A 1 510 PHE 510 510 510 PHE PHE A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 PRO 512 512 512 PRO PRO A . n 
A 1 513 GLY 513 513 513 GLY GLY A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ASP 515 515 515 ASP ASP A . n 
A 1 516 THR 516 516 516 THR THR A . n 
A 1 517 TYR 517 517 517 TYR TYR A . n 
A 1 518 GLN 518 518 518 GLN GLN A . n 
A 1 519 HIS 519 519 519 HIS HIS A . n 
A 1 520 PRO 520 520 520 PRO PRO A . n 
A 1 521 PRO 521 521 521 PRO PRO A . n 
A 1 522 LYS 522 522 522 LYS LYS A . n 
A 1 523 ASP 523 523 523 ASP ASP A . n 
A 1 524 SER 524 524 524 SER SER A . n 
A 1 525 SER 525 525 525 SER SER A . n 
A 1 526 GLY 526 526 526 GLY GLY A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 ARG 528 528 528 ARG ARG A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
A 1 530 ASP 530 530 530 ASP ASP A . n 
A 1 531 VAL 531 531 531 VAL VAL A . n 
A 1 532 SER 532 532 532 SER SER A . n 
A 1 533 PRO 533 533 533 PRO PRO A . n 
A 1 534 THR 534 534 534 THR THR A . n 
A 1 535 SER 535 535 535 SER SER A . n 
A 1 536 GLN 536 536 536 GLN GLN A . n 
A 1 537 ARG 537 537 537 ARG ARG A . n 
A 1 538 LEU 538 538 538 LEU LEU A . n 
A 1 539 GLN 539 539 539 GLN GLN A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 LEU 541 541 541 LEU LEU A . n 
A 1 542 GLU 542 542 542 GLU GLU A . n 
A 1 543 PRO 543 543 543 PRO PRO A . n 
A 1 544 PHE 544 544 544 PHE PHE A . n 
A 1 545 ASP 545 545 545 ASP ASP A . n 
A 1 546 LYS 546 546 546 LYS LYS A . n 
A 1 547 TRP 547 547 547 TRP TRP A . n 
A 1 548 ASP 548 548 548 ASP ASP A . n 
A 1 549 GLY 549 549 549 GLY GLY A . n 
A 1 550 LYS 550 550 550 LYS LYS A . n 
A 1 551 ASP 551 551 551 ASP ASP A . n 
A 1 552 LEU 552 552 552 LEU LEU A . n 
A 1 553 GLU 553 553 553 GLU GLU A . n 
A 1 554 ASP 554 554 554 ASP ASP A . n 
A 1 555 LEU 555 555 555 LEU LEU A . n 
A 1 556 GLN 556 556 556 GLN GLN A . n 
A 1 557 ILE 557 557 557 ILE ILE A . n 
A 1 558 LEU 558 558 558 LEU LEU A . n 
A 1 559 ILE 559 559 559 ILE ILE A . n 
A 1 560 LYS 560 560 560 LYS LYS A . n 
A 1 561 VAL 561 561 561 VAL VAL A . n 
A 1 562 LYS 562 562 562 LYS LYS A . n 
A 1 563 GLY 563 563 563 GLY GLY A . n 
A 1 564 LYS 564 564 564 LYS LYS A . n 
A 1 565 CYS 565 565 565 CYS CYS A . n 
A 1 566 THR 566 566 566 THR THR A . n 
A 1 567 THR 567 567 567 THR THR A . n 
A 1 568 ASP 568 568 568 ASP ASP A . n 
A 1 569 HIS 569 569 569 HIS HIS A . n 
A 1 570 ILE 570 570 570 ILE ILE A . n 
A 1 571 SER 571 571 571 SER SER A . n 
A 1 572 ALA 572 572 572 ALA ALA A . n 
A 1 573 ALA 573 573 573 ALA ALA A . n 
A 1 574 GLY 574 574 574 GLY GLY A . n 
A 1 575 PRO 575 575 575 PRO PRO A . n 
A 1 576 TRP 576 576 576 TRP TRP A . n 
A 1 577 LEU 577 577 577 LEU LEU A . n 
A 1 578 LYS 578 578 578 LYS LYS A . n 
A 1 579 PHE 579 579 579 PHE PHE A . n 
A 1 580 ARG 580 580 580 ARG ARG A . n 
A 1 581 GLY 581 581 581 GLY GLY A . n 
A 1 582 HIS 582 582 582 HIS HIS A . n 
A 1 583 LEU 583 583 583 LEU LEU A . n 
A 1 584 ASP 584 584 584 ASP ASP A . n 
A 1 585 ASN 585 585 585 ASN ASN A . n 
A 1 586 ILE 586 586 586 ILE ILE A . n 
A 1 587 SER 587 587 587 SER SER A . n 
A 1 588 ASN 588 588 588 ASN ASN A . n 
A 1 589 ASN 589 589 589 ASN ASN A . n 
A 1 590 LEU 590 590 590 LEU LEU A . n 
A 1 591 LEU 591 591 591 LEU LEU A . n 
A 1 592 ILE 592 592 592 ILE ILE A . n 
A 1 593 GLY 593 593 593 GLY GLY A . n 
A 1 594 ALA 594 594 594 ALA ALA A . n 
A 1 595 ILE 595 595 595 ILE ILE A . n 
A 1 596 ASN 596 596 596 ASN ASN A . n 
A 1 597 ILE 597 597 597 ILE ILE A . n 
A 1 598 GLU 598 598 598 GLU GLU A . n 
A 1 599 ASN 599 599 599 ASN ASN A . n 
A 1 600 ARG 600 600 600 ARG ARG A . n 
A 1 601 LYS 601 601 601 LYS LYS A . n 
A 1 602 ALA 602 602 602 ALA ALA A . n 
A 1 603 ASN 603 603 603 ASN ASN A . n 
A 1 604 SER 604 604 604 SER SER A . n 
A 1 605 VAL 605 605 605 VAL VAL A . n 
A 1 606 ARG 606 606 606 ARG ARG A . n 
A 1 607 ASN 607 607 607 ASN ASN A . n 
A 1 608 ALA 608 608 608 ALA ALA A . n 
A 1 609 VAL 609 609 609 VAL VAL A . n 
A 1 610 THR 610 610 610 THR THR A . n 
A 1 611 GLN 611 611 611 GLN GLN A . n 
A 1 612 GLU 612 612 612 GLU GLU A . n 
A 1 613 PHE 613 613 613 PHE PHE A . n 
A 1 614 GLY 614 614 614 GLY GLY A . n 
A 1 615 PRO 615 615 615 PRO PRO A . n 
A 1 616 VAL 616 616 616 VAL VAL A . n 
A 1 617 PRO 617 617 617 PRO PRO A . n 
A 1 618 ASP 618 618 618 ASP ASP A . n 
A 1 619 THR 619 619 619 THR THR A . n 
A 1 620 ALA 620 620 620 ALA ALA A . n 
A 1 621 ARG 621 621 621 ARG ARG A . n 
A 1 622 TYR 622 622 622 TYR TYR A . n 
A 1 623 TYR 623 623 623 TYR TYR A . n 
A 1 624 LYS 624 624 624 LYS LYS A . n 
A 1 625 GLN 625 625 625 GLN GLN A . n 
A 1 626 HIS 626 626 626 HIS HIS A . n 
A 1 627 GLY 627 627 627 GLY GLY A . n 
A 1 628 ILE 628 628 628 ILE ILE A . n 
A 1 629 ARG 629 629 629 ARG ARG A . n 
A 1 630 TRP 630 630 630 TRP TRP A . n 
A 1 631 VAL 631 631 631 VAL VAL A . n 
A 1 632 VAL 632 632 632 VAL VAL A . n 
A 1 633 ILE 633 633 633 ILE ILE A . n 
A 1 634 GLY 634 634 634 GLY GLY A . n 
A 1 635 ASP 635 635 635 ASP ASP A . n 
A 1 636 GLU 636 636 636 GLU GLU A . n 
A 1 637 ASN 637 637 637 ASN ASN A . n 
A 1 638 TYR 638 638 638 TYR TYR A . n 
A 1 639 GLY 639 639 639 GLY GLY A . n 
A 1 640 GLU 640 640 640 GLU GLU A . n 
A 1 641 GLY 641 641 641 GLY GLY A . n 
A 1 642 SER 642 642 642 SER SER A . n 
A 1 643 SER 643 643 643 SER SER A . n 
A 1 644 ARG 644 644 644 ARG ARG A . n 
A 1 645 GLU 645 645 645 GLU GLU A . n 
A 1 646 HIS 646 646 646 HIS HIS A . n 
A 1 647 SER 647 647 647 SER SER A . n 
A 1 648 ALA 648 648 648 ALA ALA A . n 
A 1 649 LEU 649 649 649 LEU LEU A . n 
A 1 650 GLU 650 650 650 GLU GLU A . n 
A 1 651 PRO 651 651 651 PRO PRO A . n 
A 1 652 ARG 652 652 652 ARG ARG A . n 
A 1 653 HIS 653 653 653 HIS HIS A . n 
A 1 654 LEU 654 654 654 LEU LEU A . n 
A 1 655 GLY 655 655 655 GLY GLY A . n 
A 1 656 GLY 656 656 656 GLY GLY A . n 
A 1 657 ARG 657 657 657 ARG ARG A . n 
A 1 658 ALA 658 658 658 ALA ALA A . n 
A 1 659 ILE 659 659 659 ILE ILE A . n 
A 1 660 ILE 660 660 660 ILE ILE A . n 
A 1 661 THR 661 661 661 THR THR A . n 
A 1 662 LYS 662 662 662 LYS LYS A . n 
A 1 663 SER 663 663 663 SER SER A . n 
A 1 664 PHE 664 664 664 PHE PHE A . n 
A 1 665 ALA 665 665 665 ALA ALA A . n 
A 1 666 ARG 666 666 666 ARG ARG A . n 
A 1 667 ILE 667 667 667 ILE ILE A . n 
A 1 668 HIS 668 668 668 HIS HIS A . n 
A 1 669 GLU 669 669 669 GLU GLU A . n 
A 1 670 THR 670 670 670 THR THR A . n 
A 1 671 ASN 671 671 671 ASN ASN A . n 
A 1 672 LEU 672 672 672 LEU LEU A . n 
A 1 673 LYS 673 673 673 LYS LYS A . n 
A 1 674 LYS 674 674 674 LYS LYS A . n 
A 1 675 GLN 675 675 675 GLN GLN A . n 
A 1 676 GLY 676 676 676 GLY GLY A . n 
A 1 677 LEU 677 677 677 LEU LEU A . n 
A 1 678 LEU 678 678 678 LEU LEU A . n 
A 1 679 PRO 679 679 679 PRO PRO A . n 
A 1 680 LEU 680 680 680 LEU LEU A . n 
A 1 681 THR 681 681 681 THR THR A . n 
A 1 682 PHE 682 682 682 PHE PHE A . n 
A 1 683 ALA 683 683 683 ALA ALA A . n 
A 1 684 ASP 684 684 684 ASP ASP A . n 
A 1 685 PRO 685 685 685 PRO PRO A . n 
A 1 686 ALA 686 686 686 ALA ALA A . n 
A 1 687 ASP 687 687 687 ASP ASP A . n 
A 1 688 TYR 688 688 688 TYR TYR A . n 
A 1 689 ASN 689 689 689 ASN ASN A . n 
A 1 690 LYS 690 690 690 LYS LYS A . n 
A 1 691 ILE 691 691 691 ILE ILE A . n 
A 1 692 HIS 692 692 692 HIS HIS A . n 
A 1 693 PRO 693 693 693 PRO PRO A . n 
A 1 694 VAL 694 694 694 VAL VAL A . n 
A 1 695 ASP 695 695 695 ASP ASP A . n 
A 1 696 LYS 696 696 696 LYS LYS A . n 
A 1 697 LEU 697 697 697 LEU LEU A . n 
A 1 698 THR 698 698 698 THR THR A . n 
A 1 699 ILE 699 699 699 ILE ILE A . n 
A 1 700 GLN 700 700 700 GLN GLN A . n 
A 1 701 GLY 701 701 701 GLY GLY A . n 
A 1 702 LEU 702 702 702 LEU LEU A . n 
A 1 703 LYS 703 703 703 LYS LYS A . n 
A 1 704 ASP 704 704 704 ASP ASP A . n 
A 1 705 PHE 705 705 705 PHE PHE A . n 
A 1 706 ALA 706 706 706 ALA ALA A . n 
A 1 707 PRO 707 707 707 PRO PRO A . n 
A 1 708 GLY 708 708 708 GLY GLY A . n 
A 1 709 LYS 709 709 709 LYS LYS A . n 
A 1 710 PRO 710 710 710 PRO PRO A . n 
A 1 711 LEU 711 711 711 LEU LEU A . n 
A 1 712 LYS 712 712 712 LYS LYS A . n 
A 1 713 CYS 713 713 713 CYS CYS A . n 
A 1 714 ILE 714 714 714 ILE ILE A . n 
A 1 715 ILE 715 715 715 ILE ILE A . n 
A 1 716 LYS 716 716 716 LYS LYS A . n 
A 1 717 HIS 717 717 717 HIS HIS A . n 
A 1 718 PRO 718 718 718 PRO PRO A . n 
A 1 719 ASN 719 719 719 ASN ASN A . n 
A 1 720 GLY 720 720 720 GLY GLY A . n 
A 1 721 THR 721 721 721 THR THR A . n 
A 1 722 GLN 722 722 722 GLN GLN A . n 
A 1 723 GLU 723 723 723 GLU GLU A . n 
A 1 724 THR 724 724 724 THR THR A . n 
A 1 725 ILE 725 725 725 ILE ILE A . n 
A 1 726 LEU 726 726 726 LEU LEU A . n 
A 1 727 LEU 727 727 727 LEU LEU A . n 
A 1 728 ASN 728 728 728 ASN ASN A . n 
A 1 729 HIS 729 729 729 HIS HIS A . n 
A 1 730 THR 730 730 730 THR THR A . n 
A 1 731 PHE 731 731 731 PHE PHE A . n 
A 1 732 ASN 732 732 732 ASN ASN A . n 
A 1 733 GLU 733 733 733 GLU GLU A . n 
A 1 734 THR 734 734 734 THR THR A . n 
A 1 735 GLN 735 735 735 GLN GLN A . n 
A 1 736 ILE 736 736 736 ILE ILE A . n 
A 1 737 GLU 737 737 737 GLU GLU A . n 
A 1 738 TRP 738 738 738 TRP TRP A . n 
A 1 739 PHE 739 739 739 PHE PHE A . n 
A 1 740 ARG 740 740 740 ARG ARG A . n 
A 1 741 ALA 741 741 741 ALA ALA A . n 
A 1 742 GLY 742 742 742 GLY GLY A . n 
A 1 743 SER 743 743 743 SER SER A . n 
A 1 744 ALA 744 744 744 ALA ALA A . n 
A 1 745 LEU 745 745 745 LEU LEU A . n 
A 1 746 ASN 746 746 746 ASN ASN A . n 
A 1 747 ARG 747 747 747 ARG ARG A . n 
A 1 748 MET 748 748 748 MET MET A . n 
A 1 749 LYS 749 749 749 LYS LYS A . n 
A 1 750 GLU 750 750 750 GLU GLU A . n 
A 1 751 LEU 751 751 751 LEU LEU A . n 
A 1 752 GLN 752 752 752 GLN GLN A . n 
A 1 753 GLN 753 753 753 GLN GLN A . n 
A 1 754 LYS 754 754 754 LYS LYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SF4 1   999  999 SF4 FS4 A . 
C 3 ICT 1   755  755 ICT ICT A . 
D 4 HOH 1   1000 998 HOH HOH A . 
D 4 HOH 2   1001 1   HOH HOH A . 
D 4 HOH 3   1002 2   HOH HOH A . 
D 4 HOH 4   1003 3   HOH HOH A . 
D 4 HOH 5   1004 4   HOH HOH A . 
D 4 HOH 6   1005 5   HOH HOH A . 
D 4 HOH 7   1006 6   HOH HOH A . 
D 4 HOH 8   1007 7   HOH HOH A . 
D 4 HOH 9   1008 8   HOH HOH A . 
D 4 HOH 10  1009 9   HOH HOH A . 
D 4 HOH 11  1010 10  HOH HOH A . 
D 4 HOH 12  1011 11  HOH HOH A . 
D 4 HOH 13  1012 12  HOH HOH A . 
D 4 HOH 14  1013 13  HOH HOH A . 
D 4 HOH 15  1014 14  HOH HOH A . 
D 4 HOH 16  1015 15  HOH HOH A . 
D 4 HOH 17  1016 16  HOH HOH A . 
D 4 HOH 18  1017 17  HOH HOH A . 
D 4 HOH 19  1018 18  HOH HOH A . 
D 4 HOH 20  1019 19  HOH HOH A . 
D 4 HOH 21  1020 20  HOH HOH A . 
D 4 HOH 22  1021 21  HOH HOH A . 
D 4 HOH 23  1022 22  HOH HOH A . 
D 4 HOH 24  1023 23  HOH HOH A . 
D 4 HOH 25  1024 24  HOH HOH A . 
D 4 HOH 26  1025 25  HOH HOH A . 
D 4 HOH 27  1026 26  HOH HOH A . 
D 4 HOH 28  1027 27  HOH HOH A . 
D 4 HOH 29  1028 28  HOH HOH A . 
D 4 HOH 30  1029 29  HOH HOH A . 
D 4 HOH 31  1030 30  HOH HOH A . 
D 4 HOH 32  1031 31  HOH HOH A . 
D 4 HOH 33  1032 32  HOH HOH A . 
D 4 HOH 34  1033 33  HOH HOH A . 
D 4 HOH 35  1034 34  HOH HOH A . 
D 4 HOH 36  1035 35  HOH HOH A . 
D 4 HOH 37  1036 36  HOH HOH A . 
D 4 HOH 38  1037 37  HOH HOH A . 
D 4 HOH 39  1038 38  HOH HOH A . 
D 4 HOH 40  1039 39  HOH HOH A . 
D 4 HOH 41  1040 40  HOH HOH A . 
D 4 HOH 42  1041 41  HOH HOH A . 
D 4 HOH 43  1042 42  HOH HOH A . 
D 4 HOH 44  1043 43  HOH HOH A . 
D 4 HOH 45  1044 44  HOH HOH A . 
D 4 HOH 46  1045 45  HOH HOH A . 
D 4 HOH 47  1046 46  HOH HOH A . 
D 4 HOH 48  1047 47  HOH HOH A . 
D 4 HOH 49  1048 48  HOH HOH A . 
D 4 HOH 50  1049 49  HOH HOH A . 
D 4 HOH 51  1050 50  HOH HOH A . 
D 4 HOH 52  1051 51  HOH HOH A . 
D 4 HOH 53  1052 52  HOH HOH A . 
D 4 HOH 54  1053 53  HOH HOH A . 
D 4 HOH 55  1054 54  HOH HOH A . 
D 4 HOH 56  1055 55  HOH HOH A . 
D 4 HOH 57  1056 56  HOH HOH A . 
D 4 HOH 58  1057 57  HOH HOH A . 
D 4 HOH 59  1058 58  HOH HOH A . 
D 4 HOH 60  1059 59  HOH HOH A . 
D 4 HOH 61  1060 60  HOH HOH A . 
D 4 HOH 62  1061 61  HOH HOH A . 
D 4 HOH 63  1062 62  HOH HOH A . 
D 4 HOH 64  1063 63  HOH HOH A . 
D 4 HOH 65  1064 64  HOH HOH A . 
D 4 HOH 66  1065 65  HOH HOH A . 
D 4 HOH 67  1066 66  HOH HOH A . 
D 4 HOH 68  1067 67  HOH HOH A . 
D 4 HOH 69  1068 68  HOH HOH A . 
D 4 HOH 70  1069 69  HOH HOH A . 
D 4 HOH 71  1070 70  HOH HOH A . 
D 4 HOH 72  1071 71  HOH HOH A . 
D 4 HOH 73  1072 72  HOH HOH A . 
D 4 HOH 74  1073 73  HOH HOH A . 
D 4 HOH 75  1074 74  HOH HOH A . 
D 4 HOH 76  1075 75  HOH HOH A . 
D 4 HOH 77  1076 76  HOH HOH A . 
D 4 HOH 78  1077 77  HOH HOH A . 
D 4 HOH 79  1078 78  HOH HOH A . 
D 4 HOH 80  1079 79  HOH HOH A . 
D 4 HOH 81  1080 80  HOH HOH A . 
D 4 HOH 82  1081 81  HOH HOH A . 
D 4 HOH 83  1082 82  HOH HOH A . 
D 4 HOH 84  1083 83  HOH HOH A . 
D 4 HOH 85  1084 84  HOH HOH A . 
D 4 HOH 86  1085 85  HOH HOH A . 
D 4 HOH 87  1086 86  HOH HOH A . 
D 4 HOH 88  1087 87  HOH HOH A . 
D 4 HOH 89  1088 88  HOH HOH A . 
D 4 HOH 90  1089 89  HOH HOH A . 
D 4 HOH 91  1090 90  HOH HOH A . 
D 4 HOH 92  1091 91  HOH HOH A . 
D 4 HOH 93  1092 92  HOH HOH A . 
D 4 HOH 94  1093 93  HOH HOH A . 
D 4 HOH 95  1094 94  HOH HOH A . 
D 4 HOH 96  1095 95  HOH HOH A . 
D 4 HOH 97  1096 96  HOH HOH A . 
D 4 HOH 98  1097 97  HOH HOH A . 
D 4 HOH 99  1098 98  HOH HOH A . 
D 4 HOH 100 1099 99  HOH HOH A . 
D 4 HOH 101 1100 100 HOH HOH A . 
D 4 HOH 102 1101 101 HOH HOH A . 
D 4 HOH 103 1102 102 HOH HOH A . 
D 4 HOH 104 1103 103 HOH HOH A . 
D 4 HOH 105 1104 104 HOH HOH A . 
D 4 HOH 106 1105 105 HOH HOH A . 
D 4 HOH 107 1106 106 HOH HOH A . 
D 4 HOH 108 1107 107 HOH HOH A . 
D 4 HOH 109 1108 108 HOH HOH A . 
D 4 HOH 110 1109 109 HOH HOH A . 
D 4 HOH 111 1110 110 HOH HOH A . 
D 4 HOH 112 1111 111 HOH HOH A . 
D 4 HOH 113 1112 112 HOH HOH A . 
D 4 HOH 114 1113 113 HOH HOH A . 
D 4 HOH 115 1114 114 HOH HOH A . 
D 4 HOH 116 1115 115 HOH HOH A . 
D 4 HOH 117 1116 116 HOH HOH A . 
D 4 HOH 118 1117 117 HOH HOH A . 
D 4 HOH 119 1118 118 HOH HOH A . 
D 4 HOH 120 1119 119 HOH HOH A . 
D 4 HOH 121 1120 120 HOH HOH A . 
D 4 HOH 122 1121 121 HOH HOH A . 
D 4 HOH 123 1122 122 HOH HOH A . 
D 4 HOH 124 1123 123 HOH HOH A . 
D 4 HOH 125 1124 124 HOH HOH A . 
D 4 HOH 126 1125 125 HOH HOH A . 
D 4 HOH 127 1126 126 HOH HOH A . 
D 4 HOH 128 1127 127 HOH HOH A . 
D 4 HOH 129 1128 128 HOH HOH A . 
D 4 HOH 130 1129 129 HOH HOH A . 
D 4 HOH 131 1130 130 HOH HOH A . 
D 4 HOH 132 1131 131 HOH HOH A . 
D 4 HOH 133 1132 132 HOH HOH A . 
D 4 HOH 134 1133 133 HOH HOH A . 
D 4 HOH 135 1134 134 HOH HOH A . 
D 4 HOH 136 1135 135 HOH HOH A . 
D 4 HOH 137 1136 136 HOH HOH A . 
D 4 HOH 138 1137 137 HOH HOH A . 
D 4 HOH 139 1138 138 HOH HOH A . 
D 4 HOH 140 1139 139 HOH HOH A . 
D 4 HOH 141 1140 140 HOH HOH A . 
D 4 HOH 142 1141 141 HOH HOH A . 
D 4 HOH 143 1142 142 HOH HOH A . 
D 4 HOH 144 1143 143 HOH HOH A . 
D 4 HOH 145 1144 144 HOH HOH A . 
D 4 HOH 146 1145 145 HOH HOH A . 
D 4 HOH 147 1146 146 HOH HOH A . 
D 4 HOH 148 1147 147 HOH HOH A . 
D 4 HOH 149 1148 148 HOH HOH A . 
D 4 HOH 150 1149 149 HOH HOH A . 
D 4 HOH 151 1150 150 HOH HOH A . 
D 4 HOH 152 1151 151 HOH HOH A . 
D 4 HOH 153 1152 152 HOH HOH A . 
D 4 HOH 154 1153 153 HOH HOH A . 
D 4 HOH 155 1154 154 HOH HOH A . 
D 4 HOH 156 1155 155 HOH HOH A . 
D 4 HOH 157 1156 156 HOH HOH A . 
D 4 HOH 158 1157 157 HOH HOH A . 
D 4 HOH 159 1158 158 HOH HOH A . 
D 4 HOH 160 1159 159 HOH HOH A . 
D 4 HOH 161 1160 160 HOH HOH A . 
D 4 HOH 162 1161 161 HOH HOH A . 
D 4 HOH 163 1162 162 HOH HOH A . 
D 4 HOH 164 1163 163 HOH HOH A . 
D 4 HOH 165 1164 164 HOH HOH A . 
D 4 HOH 166 1165 165 HOH HOH A . 
D 4 HOH 167 1166 166 HOH HOH A . 
D 4 HOH 168 1167 167 HOH HOH A . 
D 4 HOH 169 1168 168 HOH HOH A . 
D 4 HOH 170 1169 169 HOH HOH A . 
D 4 HOH 171 1170 170 HOH HOH A . 
D 4 HOH 172 1171 171 HOH HOH A . 
D 4 HOH 173 1172 172 HOH HOH A . 
D 4 HOH 174 1173 173 HOH HOH A . 
D 4 HOH 175 1174 174 HOH HOH A . 
D 4 HOH 176 1175 175 HOH HOH A . 
D 4 HOH 177 1176 176 HOH HOH A . 
D 4 HOH 178 1177 177 HOH HOH A . 
D 4 HOH 179 1178 178 HOH HOH A . 
D 4 HOH 180 1179 179 HOH HOH A . 
D 4 HOH 181 1180 180 HOH HOH A . 
D 4 HOH 182 1181 181 HOH HOH A . 
D 4 HOH 183 1182 182 HOH HOH A . 
D 4 HOH 184 1183 183 HOH HOH A . 
D 4 HOH 185 1184 184 HOH HOH A . 
D 4 HOH 186 1185 185 HOH HOH A . 
D 4 HOH 187 1186 186 HOH HOH A . 
D 4 HOH 188 1187 187 HOH HOH A . 
D 4 HOH 189 1188 188 HOH HOH A . 
D 4 HOH 190 1189 189 HOH HOH A . 
D 4 HOH 191 1190 190 HOH HOH A . 
D 4 HOH 192 1191 191 HOH HOH A . 
D 4 HOH 193 1192 192 HOH HOH A . 
D 4 HOH 194 1193 193 HOH HOH A . 
D 4 HOH 195 1194 194 HOH HOH A . 
D 4 HOH 196 1195 195 HOH HOH A . 
D 4 HOH 197 1196 196 HOH HOH A . 
D 4 HOH 198 1197 197 HOH HOH A . 
D 4 HOH 199 1198 198 HOH HOH A . 
D 4 HOH 200 1199 199 HOH HOH A . 
D 4 HOH 201 1200 200 HOH HOH A . 
D 4 HOH 202 1201 201 HOH HOH A . 
D 4 HOH 203 1202 202 HOH HOH A . 
D 4 HOH 204 1203 203 HOH HOH A . 
D 4 HOH 205 1204 204 HOH HOH A . 
D 4 HOH 206 1205 205 HOH HOH A . 
D 4 HOH 207 1206 206 HOH HOH A . 
D 4 HOH 208 1207 207 HOH HOH A . 
D 4 HOH 209 1208 208 HOH HOH A . 
D 4 HOH 210 1209 209 HOH HOH A . 
D 4 HOH 211 1210 210 HOH HOH A . 
D 4 HOH 212 1211 211 HOH HOH A . 
D 4 HOH 213 1212 212 HOH HOH A . 
D 4 HOH 214 1213 213 HOH HOH A . 
D 4 HOH 215 1214 214 HOH HOH A . 
D 4 HOH 216 1215 215 HOH HOH A . 
D 4 HOH 217 1216 216 HOH HOH A . 
D 4 HOH 218 1217 217 HOH HOH A . 
D 4 HOH 219 1218 218 HOH HOH A . 
D 4 HOH 220 1219 219 HOH HOH A . 
D 4 HOH 221 1220 220 HOH HOH A . 
D 4 HOH 222 1221 221 HOH HOH A . 
D 4 HOH 223 1222 222 HOH HOH A . 
D 4 HOH 224 1223 223 HOH HOH A . 
D 4 HOH 225 1224 224 HOH HOH A . 
D 4 HOH 226 1225 225 HOH HOH A . 
D 4 HOH 227 1226 226 HOH HOH A . 
D 4 HOH 228 1227 227 HOH HOH A . 
D 4 HOH 229 1228 228 HOH HOH A . 
D 4 HOH 230 1229 229 HOH HOH A . 
D 4 HOH 231 1230 230 HOH HOH A . 
D 4 HOH 232 1231 231 HOH HOH A . 
D 4 HOH 233 1232 232 HOH HOH A . 
D 4 HOH 234 1233 233 HOH HOH A . 
D 4 HOH 235 1234 234 HOH HOH A . 
D 4 HOH 236 1235 235 HOH HOH A . 
D 4 HOH 237 1236 236 HOH HOH A . 
D 4 HOH 238 1237 237 HOH HOH A . 
D 4 HOH 239 1238 238 HOH HOH A . 
D 4 HOH 240 1239 239 HOH HOH A . 
D 4 HOH 241 1240 240 HOH HOH A . 
D 4 HOH 242 1241 241 HOH HOH A . 
D 4 HOH 243 1242 242 HOH HOH A . 
D 4 HOH 244 1243 243 HOH HOH A . 
D 4 HOH 245 1244 244 HOH HOH A . 
D 4 HOH 246 1245 245 HOH HOH A . 
D 4 HOH 247 1246 246 HOH HOH A . 
D 4 HOH 248 1247 247 HOH HOH A . 
D 4 HOH 249 1248 248 HOH HOH A . 
D 4 HOH 250 1249 249 HOH HOH A . 
D 4 HOH 251 1250 250 HOH HOH A . 
D 4 HOH 252 1251 251 HOH HOH A . 
D 4 HOH 253 1252 252 HOH HOH A . 
D 4 HOH 254 1253 253 HOH HOH A . 
D 4 HOH 255 1254 254 HOH HOH A . 
D 4 HOH 256 1255 255 HOH HOH A . 
D 4 HOH 257 1256 256 HOH HOH A . 
D 4 HOH 258 1257 257 HOH HOH A . 
D 4 HOH 259 1258 258 HOH HOH A . 
D 4 HOH 260 1259 259 HOH HOH A . 
D 4 HOH 261 1260 260 HOH HOH A . 
D 4 HOH 262 1261 261 HOH HOH A . 
D 4 HOH 263 1262 262 HOH HOH A . 
D 4 HOH 264 1263 263 HOH HOH A . 
D 4 HOH 265 1264 264 HOH HOH A . 
D 4 HOH 266 1265 265 HOH HOH A . 
D 4 HOH 267 1266 266 HOH HOH A . 
D 4 HOH 268 1267 267 HOH HOH A . 
D 4 HOH 269 1268 268 HOH HOH A . 
D 4 HOH 270 1269 269 HOH HOH A . 
D 4 HOH 271 1270 270 HOH HOH A . 
D 4 HOH 272 1271 271 HOH HOH A . 
D 4 HOH 273 1272 272 HOH HOH A . 
D 4 HOH 274 1273 273 HOH HOH A . 
D 4 HOH 275 1274 274 HOH HOH A . 
D 4 HOH 276 1275 275 HOH HOH A . 
D 4 HOH 277 1276 276 HOH HOH A . 
D 4 HOH 278 1277 277 HOH HOH A . 
D 4 HOH 279 1278 278 HOH HOH A . 
D 4 HOH 280 1279 279 HOH HOH A . 
D 4 HOH 281 1280 280 HOH HOH A . 
D 4 HOH 282 1281 281 HOH HOH A . 
D 4 HOH 283 1282 282 HOH HOH A . 
D 4 HOH 284 1283 283 HOH HOH A . 
D 4 HOH 285 1284 284 HOH HOH A . 
D 4 HOH 286 1285 285 HOH HOH A . 
D 4 HOH 287 1286 286 HOH HOH A . 
D 4 HOH 288 1287 287 HOH HOH A . 
D 4 HOH 289 1288 288 HOH HOH A . 
D 4 HOH 290 1289 289 HOH HOH A . 
D 4 HOH 291 1290 290 HOH HOH A . 
D 4 HOH 292 1291 291 HOH HOH A . 
D 4 HOH 293 1292 292 HOH HOH A . 
D 4 HOH 294 1293 293 HOH HOH A . 
D 4 HOH 295 1294 294 HOH HOH A . 
D 4 HOH 296 1295 295 HOH HOH A . 
D 4 HOH 297 1296 296 HOH HOH A . 
D 4 HOH 298 1297 297 HOH HOH A . 
D 4 HOH 299 1298 298 HOH HOH A . 
D 4 HOH 300 1299 299 HOH HOH A . 
D 4 HOH 301 1300 300 HOH HOH A . 
D 4 HOH 302 1301 301 HOH HOH A . 
D 4 HOH 303 1302 302 HOH HOH A . 
D 4 HOH 304 1303 303 HOH HOH A . 
D 4 HOH 305 1304 304 HOH HOH A . 
D 4 HOH 306 1305 305 HOH HOH A . 
D 4 HOH 307 1306 306 HOH HOH A . 
D 4 HOH 308 1307 307 HOH HOH A . 
D 4 HOH 309 1308 308 HOH HOH A . 
D 4 HOH 310 1309 309 HOH HOH A . 
D 4 HOH 311 1310 310 HOH HOH A . 
D 4 HOH 312 1311 311 HOH HOH A . 
D 4 HOH 313 1312 312 HOH HOH A . 
D 4 HOH 314 1313 313 HOH HOH A . 
D 4 HOH 315 1314 314 HOH HOH A . 
D 4 HOH 316 1315 315 HOH HOH A . 
D 4 HOH 317 1316 316 HOH HOH A . 
D 4 HOH 318 1317 317 HOH HOH A . 
D 4 HOH 319 1318 318 HOH HOH A . 
D 4 HOH 320 1319 319 HOH HOH A . 
D 4 HOH 321 1320 320 HOH HOH A . 
D 4 HOH 322 1321 321 HOH HOH A . 
D 4 HOH 323 1322 322 HOH HOH A . 
D 4 HOH 324 1323 323 HOH HOH A . 
D 4 HOH 325 1324 324 HOH HOH A . 
D 4 HOH 326 1325 325 HOH HOH A . 
D 4 HOH 327 1326 326 HOH HOH A . 
D 4 HOH 328 1327 327 HOH HOH A . 
D 4 HOH 329 1328 328 HOH HOH A . 
D 4 HOH 330 1329 329 HOH HOH A . 
D 4 HOH 331 1330 330 HOH HOH A . 
D 4 HOH 332 1331 331 HOH HOH A . 
D 4 HOH 333 1332 332 HOH HOH A . 
D 4 HOH 334 1333 333 HOH HOH A . 
D 4 HOH 335 1334 334 HOH HOH A . 
D 4 HOH 336 1335 335 HOH HOH A . 
D 4 HOH 337 1336 336 HOH HOH A . 
D 4 HOH 338 1337 337 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 358 ? A CYS 358  ? 1_555 FE1 ? B SF4 . ? A SF4 999 ? 1_555 S2 ? B SF4 . ? A SF4 999  ? 1_555 118.1 ? 
2  SG ? A CYS 358 ? A CYS 358  ? 1_555 FE1 ? B SF4 . ? A SF4 999 ? 1_555 S3 ? B SF4 . ? A SF4 999  ? 1_555 104.2 ? 
3  S2 ? B SF4 .   ? A SF4 999  ? 1_555 FE1 ? B SF4 . ? A SF4 999 ? 1_555 S3 ? B SF4 . ? A SF4 999  ? 1_555 105.3 ? 
4  SG ? A CYS 358 ? A CYS 358  ? 1_555 FE1 ? B SF4 . ? A SF4 999 ? 1_555 S4 ? B SF4 . ? A SF4 999  ? 1_555 113.9 ? 
5  S2 ? B SF4 .   ? A SF4 999  ? 1_555 FE1 ? B SF4 . ? A SF4 999 ? 1_555 S4 ? B SF4 . ? A SF4 999  ? 1_555 108.3 ? 
6  S3 ? B SF4 .   ? A SF4 999  ? 1_555 FE1 ? B SF4 . ? A SF4 999 ? 1_555 S4 ? B SF4 . ? A SF4 999  ? 1_555 105.9 ? 
7  SG ? A CYS 421 ? A CYS 421  ? 1_555 FE3 ? B SF4 . ? A SF4 999 ? 1_555 S1 ? B SF4 . ? A SF4 999  ? 1_555 106.8 ? 
8  SG ? A CYS 421 ? A CYS 421  ? 1_555 FE3 ? B SF4 . ? A SF4 999 ? 1_555 S2 ? B SF4 . ? A SF4 999  ? 1_555 120.8 ? 
9  S1 ? B SF4 .   ? A SF4 999  ? 1_555 FE3 ? B SF4 . ? A SF4 999 ? 1_555 S2 ? B SF4 . ? A SF4 999  ? 1_555 103.9 ? 
10 SG ? A CYS 421 ? A CYS 421  ? 1_555 FE3 ? B SF4 . ? A SF4 999 ? 1_555 S4 ? B SF4 . ? A SF4 999  ? 1_555 112.2 ? 
11 S1 ? B SF4 .   ? A SF4 999  ? 1_555 FE3 ? B SF4 . ? A SF4 999 ? 1_555 S4 ? B SF4 . ? A SF4 999  ? 1_555 106.3 ? 
12 S2 ? B SF4 .   ? A SF4 999  ? 1_555 FE3 ? B SF4 . ? A SF4 999 ? 1_555 S4 ? B SF4 . ? A SF4 999  ? 1_555 105.8 ? 
13 SG ? A CYS 424 ? A CYS 424  ? 1_555 FE2 ? B SF4 . ? A SF4 999 ? 1_555 S1 ? B SF4 . ? A SF4 999  ? 1_555 119.1 ? 
14 SG ? A CYS 424 ? A CYS 424  ? 1_555 FE2 ? B SF4 . ? A SF4 999 ? 1_555 S3 ? B SF4 . ? A SF4 999  ? 1_555 110.7 ? 
15 S1 ? B SF4 .   ? A SF4 999  ? 1_555 FE2 ? B SF4 . ? A SF4 999 ? 1_555 S3 ? B SF4 . ? A SF4 999  ? 1_555 102.4 ? 
16 SG ? A CYS 424 ? A CYS 424  ? 1_555 FE2 ? B SF4 . ? A SF4 999 ? 1_555 S4 ? B SF4 . ? A SF4 999  ? 1_555 108.4 ? 
17 S1 ? B SF4 .   ? A SF4 999  ? 1_555 FE2 ? B SF4 . ? A SF4 999 ? 1_555 S4 ? B SF4 . ? A SF4 999  ? 1_555 110.0 ? 
18 S3 ? B SF4 .   ? A SF4 999  ? 1_555 FE2 ? B SF4 . ? A SF4 999 ? 1_555 S4 ? B SF4 . ? A SF4 999  ? 1_555 105.4 ? 
19 O7 ? C ICT .   ? A ICT 755  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 S1 ? B SF4 . ? A SF4 999  ? 1_555 97.7  ? 
20 O7 ? C ICT .   ? A ICT 755  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 S2 ? B SF4 . ? A SF4 999  ? 1_555 96.9  ? 
21 S1 ? B SF4 .   ? A SF4 999  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 S2 ? B SF4 . ? A SF4 999  ? 1_555 102.3 ? 
22 O7 ? C ICT .   ? A ICT 755  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 S3 ? B SF4 . ? A SF4 999  ? 1_555 152.5 ? 
23 S1 ? B SF4 .   ? A SF4 999  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 S3 ? B SF4 . ? A SF4 999  ? 1_555 98.5  ? 
24 S2 ? B SF4 .   ? A SF4 999  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 S3 ? B SF4 . ? A SF4 999  ? 1_555 101.1 ? 
25 O7 ? C ICT .   ? A ICT 755  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 O  ? D HOH . ? A HOH 1000 ? 1_555 75.0  ? 
26 S1 ? B SF4 .   ? A SF4 999  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 O  ? D HOH . ? A HOH 1000 ? 1_555 167.6 ? 
27 S2 ? B SF4 .   ? A SF4 999  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 O  ? D HOH . ? A HOH 1000 ? 1_555 88.7  ? 
28 S3 ? B SF4 .   ? A SF4 999  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 O  ? D HOH . ? A HOH 1000 ? 1_555 84.8  ? 
29 O7 ? C ICT .   ? A ICT 755  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 O2 ? C ICT . ? A ICT 755  ? 1_555 69.5  ? 
30 S1 ? B SF4 .   ? A SF4 999  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 O2 ? C ICT . ? A ICT 755  ? 1_555 88.4  ? 
31 S2 ? B SF4 .   ? A SF4 999  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 O2 ? C ICT . ? A ICT 755  ? 1_555 164.0 ? 
32 S3 ? B SF4 .   ? A SF4 999  ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 O2 ? C ICT . ? A ICT 755  ? 1_555 88.9  ? 
33 O  ? D HOH .   ? A HOH 1000 ? 1_555 FE4 ? B SF4 . ? A SF4 999 ? 1_555 O2 ? C ICT . ? A ICT 755  ? 1_555 79.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1993-10-31 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 NE2 A HIS 9   ? ? CD2 A HIS 9   ? ? 1.306 1.373 -0.067 0.011 N 
2  1 NE2 A HIS 13  ? ? CD2 A HIS 13  ? ? 1.300 1.373 -0.073 0.011 N 
3  1 NE2 A HIS 46  ? ? CD2 A HIS 46  ? ? 1.300 1.373 -0.073 0.011 N 
4  1 NE2 A HIS 101 ? ? CD2 A HIS 101 ? ? 1.288 1.373 -0.085 0.011 N 
5  1 NE2 A HIS 147 ? ? CD2 A HIS 147 ? ? 1.303 1.373 -0.070 0.011 N 
6  1 NE2 A HIS 167 ? ? CD2 A HIS 167 ? ? 1.296 1.373 -0.077 0.011 N 
7  1 NE2 A HIS 321 ? ? CD2 A HIS 321 ? ? 1.294 1.373 -0.079 0.011 N 
8  1 NE2 A HIS 332 ? ? CD2 A HIS 332 ? ? 1.305 1.373 -0.068 0.011 N 
9  1 NE2 A HIS 379 ? ? CD2 A HIS 379 ? ? 1.304 1.373 -0.069 0.011 N 
10 1 NE2 A HIS 569 ? ? CD2 A HIS 569 ? ? 1.301 1.373 -0.072 0.011 N 
11 1 NE2 A HIS 582 ? ? CD2 A HIS 582 ? ? 1.302 1.373 -0.071 0.011 N 
12 1 NE2 A HIS 626 ? ? CD2 A HIS 626 ? ? 1.296 1.373 -0.077 0.011 N 
13 1 NE2 A HIS 646 ? ? CD2 A HIS 646 ? ? 1.306 1.373 -0.067 0.011 N 
14 1 NE2 A HIS 653 ? ? CD2 A HIS 653 ? ? 1.297 1.373 -0.076 0.011 N 
15 1 NE2 A HIS 692 ? ? CD2 A HIS 692 ? ? 1.295 1.373 -0.078 0.011 N 
16 1 NE2 A HIS 717 ? ? CD2 A HIS 717 ? ? 1.306 1.373 -0.067 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB  A TYR 18  ? ? CG  A TYR 18  ? ? CD2 A TYR 18  ? ? 117.08 121.00 -3.92  0.60 N 
2  1 CB  A TYR 44  ? ? CG  A TYR 44  ? ? CD2 A TYR 44  ? ? 116.94 121.00 -4.06  0.60 N 
3  1 NE  A ARG 57  ? ? CZ  A ARG 57  ? ? NH1 A ARG 57  ? ? 123.56 120.30 3.26   0.50 N 
4  1 NE  A ARG 63  ? ? CZ  A ARG 63  ? ? NH1 A ARG 63  ? ? 123.48 120.30 3.18   0.50 N 
5  1 NE  A ARG 63  ? ? CZ  A ARG 63  ? ? NH2 A ARG 63  ? ? 115.74 120.30 -4.56  0.50 N 
6  1 NE  A ARG 115 ? ? CZ  A ARG 115 ? ? NH2 A ARG 115 ? ? 116.41 120.30 -3.89  0.50 N 
7  1 CD1 A TRP 139 ? ? CG  A TRP 139 ? ? CD2 A TRP 139 ? ? 113.51 106.30 7.21   0.80 N 
8  1 CE2 A TRP 139 ? ? CD2 A TRP 139 ? ? CG  A TRP 139 ? ? 101.54 107.30 -5.76  0.80 N 
9  1 CE1 A HIS 147 ? ? NE2 A HIS 147 ? ? CD2 A HIS 147 ? ? 113.50 109.00 4.50   0.70 N 
10 1 CB  A ASP 165 ? ? CG  A ASP 165 ? ? OD2 A ASP 165 ? ? 125.34 118.30 7.04   0.90 N 
11 1 CD1 A TRP 195 ? ? CG  A TRP 195 ? ? CD2 A TRP 195 ? ? 113.78 106.30 7.48   0.80 N 
12 1 CG  A TRP 195 ? ? CD1 A TRP 195 ? ? NE1 A TRP 195 ? ? 103.47 110.10 -6.63  1.00 N 
13 1 CE2 A TRP 195 ? ? CD2 A TRP 195 ? ? CG  A TRP 195 ? ? 101.01 107.30 -6.29  0.80 N 
14 1 CD1 A TRP 214 ? ? CG  A TRP 214 ? ? CD2 A TRP 214 ? ? 112.12 106.30 5.82   0.80 N 
15 1 CE2 A TRP 214 ? ? CD2 A TRP 214 ? ? CG  A TRP 214 ? ? 101.97 107.30 -5.33  0.80 N 
16 1 CB  A TYR 240 ? ? CG  A TYR 240 ? ? CD2 A TYR 240 ? ? 117.01 121.00 -3.99  0.60 N 
17 1 NE  A ARG 275 ? ? CZ  A ARG 275 ? ? NH1 A ARG 275 ? ? 124.17 120.30 3.87   0.50 N 
18 1 CA  A PRO 325 ? ? C   A PRO 325 ? ? N   A PHE 326 ? ? 136.62 117.20 19.42  2.20 Y 
19 1 CD1 A TRP 346 ? ? CG  A TRP 346 ? ? CD2 A TRP 346 ? ? 113.91 106.30 7.61   0.80 N 
20 1 CE2 A TRP 346 ? ? CD2 A TRP 346 ? ? CG  A TRP 346 ? ? 101.25 107.30 -6.05  0.80 N 
21 1 NE  A ARG 402 ? ? CZ  A ARG 402 ? ? NH1 A ARG 402 ? ? 126.24 120.30 5.94   0.50 N 
22 1 NE  A ARG 402 ? ? CZ  A ARG 402 ? ? NH2 A ARG 402 ? ? 110.91 120.30 -9.39  0.50 N 
23 1 CB  A ASP 403 ? ? CG  A ASP 403 ? ? OD2 A ASP 403 ? ? 124.14 118.30 5.84   0.90 N 
24 1 CB  A TYR 405 ? ? CG  A TYR 405 ? ? CD2 A TYR 405 ? ? 115.38 121.00 -5.62  0.60 N 
25 1 NE  A ARG 410 ? ? CZ  A ARG 410 ? ? NH1 A ARG 410 ? ? 126.50 120.30 6.20   0.50 N 
26 1 NE  A ARG 410 ? ? CZ  A ARG 410 ? ? NH2 A ARG 410 ? ? 114.53 120.30 -5.77  0.50 N 
27 1 CD1 A TRP 428 ? ? CG  A TRP 428 ? ? CD2 A TRP 428 ? ? 112.46 106.30 6.16   0.80 N 
28 1 CE2 A TRP 428 ? ? CD2 A TRP 428 ? ? CG  A TRP 428 ? ? 101.80 107.30 -5.50  0.80 N 
29 1 NE  A ARG 430 ? ? CZ  A ARG 430 ? ? NH1 A ARG 430 ? ? 127.37 120.30 7.07   0.50 N 
30 1 NE  A ARG 430 ? ? CZ  A ARG 430 ? ? NH2 A ARG 430 ? ? 111.13 120.30 -9.17  0.50 N 
31 1 NE  A ARG 447 ? ? CZ  A ARG 447 ? ? NH2 A ARG 447 ? ? 113.44 120.30 -6.86  0.50 N 
32 1 NE  A ARG 452 ? ? CZ  A ARG 452 ? ? NH2 A ARG 452 ? ? 116.25 120.30 -4.05  0.50 N 
33 1 OE1 A GLU 458 ? ? CD  A GLU 458 ? ? OE2 A GLU 458 ? ? 114.73 123.30 -8.57  1.20 N 
34 1 CB  A TYR 517 ? ? CG  A TYR 517 ? ? CD1 A TYR 517 ? ? 117.05 121.00 -3.95  0.60 N 
35 1 CA  A LYS 522 ? ? C   A LYS 522 ? ? N   A ASP 523 ? ? 101.32 117.20 -15.88 2.20 Y 
36 1 CD1 A TRP 547 ? ? CG  A TRP 547 ? ? CD2 A TRP 547 ? ? 111.19 106.30 4.89   0.80 N 
37 1 CE2 A TRP 547 ? ? CD2 A TRP 547 ? ? CG  A TRP 547 ? ? 102.28 107.30 -5.02  0.80 N 
38 1 N   A THR 566 ? ? CA  A THR 566 ? ? CB  A THR 566 ? ? 98.14  110.30 -12.16 1.90 N 
39 1 CD1 A TRP 576 ? ? CG  A TRP 576 ? ? CD2 A TRP 576 ? ? 113.21 106.30 6.91   0.80 N 
40 1 CE2 A TRP 576 ? ? CD2 A TRP 576 ? ? CG  A TRP 576 ? ? 101.50 107.30 -5.80  0.80 N 
41 1 NE  A ARG 580 ? ? CZ  A ARG 580 ? ? NH1 A ARG 580 ? ? 133.89 120.30 13.59  0.50 N 
42 1 NE  A ARG 580 ? ? CZ  A ARG 580 ? ? NH2 A ARG 580 ? ? 109.03 120.30 -11.27 0.50 N 
43 1 NE  A ARG 606 ? ? CZ  A ARG 606 ? ? NH1 A ARG 606 ? ? 124.19 120.30 3.89   0.50 N 
44 1 NE  A ARG 606 ? ? CZ  A ARG 606 ? ? NH2 A ARG 606 ? ? 116.47 120.30 -3.83  0.50 N 
45 1 CD1 A TRP 630 ? ? CG  A TRP 630 ? ? CD2 A TRP 630 ? ? 112.60 106.30 6.30   0.80 N 
46 1 CE2 A TRP 630 ? ? CD2 A TRP 630 ? ? CG  A TRP 630 ? ? 101.55 107.30 -5.75  0.80 N 
47 1 NE  A ARG 666 ? ? CZ  A ARG 666 ? ? NH1 A ARG 666 ? ? 125.65 120.30 5.35   0.50 N 
48 1 NE  A ARG 666 ? ? CZ  A ARG 666 ? ? NH2 A ARG 666 ? ? 114.34 120.30 -5.96  0.50 N 
49 1 CD1 A TRP 738 ? ? CG  A TRP 738 ? ? CD2 A TRP 738 ? ? 112.16 106.30 5.86   0.80 N 
50 1 CE2 A TRP 738 ? ? CD2 A TRP 738 ? ? CG  A TRP 738 ? ? 102.08 107.30 -5.22  0.80 N 
51 1 NE  A ARG 747 ? ? CZ  A ARG 747 ? ? NH2 A ARG 747 ? ? 116.83 120.30 -3.47  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 17  ? ? -104.07 66.57   
2  1 LYS A 59  ? ? -131.43 -41.69  
3  1 GLN A 106 ? ? -156.63 -63.84  
4  1 ASP A 165 ? ? -170.51 133.15  
5  1 PRO A 169 ? ? -46.56  -17.66  
6  1 THR A 229 ? ? 72.54   171.62  
7  1 THR A 267 ? ? -176.99 -179.33 
8  1 SER A 357 ? ? 69.30   171.98  
9  1 ASN A 360 ? ? -153.88 64.20   
10 1 TYR A 445 ? ? -92.58  -147.32 
11 1 ASN A 446 ? ? -136.91 -57.65  
12 1 ASN A 448 ? ? -153.37 34.60   
13 1 ASP A 454 ? ? -150.20 18.67   
14 1 ALA A 455 ? ? 52.71   14.20   
15 1 LYS A 479 ? ? -76.91  45.00   
16 1 THR A 516 ? ? -142.05 -3.90   
17 1 LYS A 522 ? ? -113.59 60.42   
18 1 ASP A 523 ? ? -162.78 -111.08 
19 1 SER A 524 ? ? -20.61  -83.72  
20 1 SER A 525 ? ? 44.91   13.66   
21 1 SER A 571 ? ? -150.65 88.74   
22 1 ALA A 573 ? ? -108.71 -126.57 
23 1 SER A 587 ? ? -58.82  -9.65   
24 1 ASP A 635 ? ? -96.73  -136.08 
25 1 PRO A 685 ? ? -48.02  -18.65  
26 1 GLN A 753 ? ? 30.78   14.48   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 580 ? ? 0.103 'SIDE CHAIN' 
2 1 ARG A 666 ? ? 0.072 'SIDE CHAIN' 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     PCA 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      1 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    PCA 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'IRON/SULFUR CLUSTER' SF4 
3 'ISOCITRIC ACID'      ICT 
4 water                 HOH 
#