EPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLLELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKGEYVNIEF
Search OCA for entries with sequence similar to this one (with E=10)

ATOM 283 N GLU A 995 3.147 4.566 52.702 1.00 55.41 N ATOM 284 CA GLU A 995 4.403 3.893 52.404 1.00 54.70 C ATOM 285 C GLU A 995 5.076 3.466 53.706 1.00 54.06 C ATOM 286 O GLU A 995 5.589 4.302 54.451 1.00 54.34 O ATOM 287 CB GLU A 995 5.304 4.841 51.606 1.00 55.09 C ATOM 288 CG GLU A 995 6.446 4.174 50.865 1.00 55.71 C ATOM 289 CD GLU A 995 7.075 5.092 49.824 1.00 56.21 C ATOM 290 OE1 GLU A 995 6.359 5.511 48.888 1.00 56.04 O ATOM 291 OE2 GLU A 995 8.281 5.397 49.941 1.00 55.75 O ATOM 292 N PRO A 996 5.069 2.151 54.002 1.00 53.12 N ATOM 293 CA PRO A 996 5.674 1.594 55.219 1.00 51.72 C ATOM 294 C PRO A 996 7.099 2.092 55.421 1.00 50.02 C ATOM 295 O PRO A 996 7.408 2.740 56.423 1.00 50.22 O ATOM 296 CB PRO A 996 5.616 0.088 54.971 1.00 51.90 C ATOM 297 CG PRO A 996 4.364 -0.061 54.169 1.00 52.61 C ATOM 298 CD PRO A 996 4.482 1.078 53.178 1.00 53.04 C ATOM 299 N GLU A 997 7.963 1.783 54.462 1.00 47.90 N ATOM 300 CA GLU A 997 9.351 2.214 54.522 1.00 45.91 C ATOM 301 C GLU A 997 9.720 2.860 53.191 1.00 43.19 C ATOM 302 O GLU A 997 9.071 2.611 52.178 1.00 43.01 O ATOM 303 CB GLU A 997 10.265 1.023 54.817 1.00 47.52 C ATOM 304 CG GLU A 997 10.274 -0.047 53.742 1.00 49.68 C ATOM 305 CD GLU A 997 11.183 -1.212 54.099 1.00 51.52 C ATOM 306 OE1 GLU A 997 11.441 -2.064 53.219 1.00 51.66 O ATOM 307 OE2 GLU A 997 11.635 -1.274 55.265 1.00 52.37 O ATOM 308 N THR A 998 10.759 3.688 53.194 1.00 40.04 N ATOM 309 CA THR A 998 11.183 4.383 51.983 1.00 36.94 C ATOM 310 C THR A 998 12.705 4.402 51.848 1.00 35.09 C ATOM 311 O THR A 998 13.419 4.554 52.834 1.00 34.34 O ATOM 312 CB THR A 998 10.679 5.852 51.993 1.00 36.96 C ATOM 313 OG1 THR A 998 9.257 5.876 52.193 1.00 35.71 O ATOM 314 CG2 THR A 998 11.024 6.557 50.678 1.00 35.95 C ATOM 315 N ARG A 999 13.195 4.241 50.623 1.00 33.08 N ATOM 316 CA ARG A 999 14.628 4.282 50.375 1.00 31.04 C ATOM 317 C ARG A 999 15.019 5.748 50.472 1.00 30.15 C ATOM 318 O ARG A 999 14.330 6.619 49.938 1.00 30.07 O ATOM 319 CB ARG A 999 14.951 3.734 48.991 1.00 30.92 C ATOM 320 CG ARG A 999 14.590 2.259 48.825 1.00 30.29 C ATOM 321 CD ARG A 999 15.050 1.751 47.479 1.00 28.63 C ATOM 322 NE ARG A 999 16.503 1.802 47.337 1.00 26.75 N ATOM 323 CZ ARG A 999 17.137 1.633 46.180 1.00 27.18 C ATOM 324 NH1 ARG A 999 16.437 1.405 45.074 1.00 27.39 N ATOM 325 NH2 ARG A 999 18.463 1.702 46.122 1.00 26.05 N ATOM 326 N VAL A1000 16.123 6.026 51.148 1.00 28.18 N ATOM 327 CA VAL A1000 16.531 7.403 51.335 1.00 26.85 C ATOM 328 C VAL A1000 18.030 7.618 51.271 1.00 26.53 C ATOM 329 O VAL A1000 18.820 6.676 51.341 1.00 25.04 O ATOM 330 CB VAL A1000 16.056 7.918 52.714 1.00 25.84 C ATOM 331 CG1 VAL A1000 14.544 7.838 52.816 1.00 25.72 C ATOM 332 CG2 VAL A1000 16.701 7.081 53.824 1.00 26.38 C ATOM 333 N ALA A1001 18.401 8.885 51.129 1.00 25.56 N ATOM 334 CA ALA A1001 19.788 9.293 51.131 1.00 26.45 C ATOM 335 C ALA A1001 19.913 9.884 52.537 1.00 27.13 C ATOM 336 O ALA A1001 19.026 10.607 52.992 1.00 28.04 O ATOM 337 CB ALA A1001 20.035 10.355 50.069 1.00 26.46 C ATOM 338 N ILE A1002 20.994 9.575 53.235 1.00 27.93 N ATOM 339 CA ILE A1002 21.163 10.076 54.594 1.00 28.34 C ATOM 340 C ILE A1002 22.404 10.941 54.690 1.00 28.81 C ATOM 341 O ILE A1002 23.526 10.434 54.632 1.00 28.83 O ATOM 342 CB ILE A1002 21.282 8.913 55.604 1.00 28.26 C ATOM 343 CG1 ILE A1002 20.051 8.012 55.499 1.00 27.61 C ATOM 344 CG2 ILE A1002 21.418 9.460 57.022 1.00 28.65 C ATOM 345 CD1 ILE A1002 20.205 6.670 56.181 1.00 28.21 C ATOM 346 N LYS A1003 22.193 12.247 54.829 1.00 27.96 N ATOM 347 CA LYS A1003 23.292 13.195 54.952 1.00 29.44 C ATOM 348 C LYS A1003 23.563 13.427 56.433 1.00 29.61 C ATOM 349 O LYS A1003 22.646 13.722 57.201 1.00 28.96 O ATOM 350 CB LYS A1003 22.925 14.514 54.280 1.00 30.74 C ATOM 351 CG LYS A1003 22.380 14.347 52.869 1.00 33.46 C ATOM 352 CD LYS A1003 22.359 15.669 52.130 1.00 35.48 C ATOM 353 CE LYS A1003 23.769 16.215 51.972 1.00 36.55 C ATOM 354 NZ LYS A1003 23.797 17.520 51.249 1.00 37.55 N ATOM 355 N THR A1004 24.824 13.299 56.829 1.00 29.25 N ATOM 356 CA THR A1004 25.199 13.476 58.225 1.00 31.12 C ATOM 357 C THR A1004 26.189 14.623 58.442 1.00 33.55 C ATOM 358 O THR A1004 26.832 15.105 57.505 1.00 32.47 O ATOM 359 CB THR A1004 25.858 12.198 58.780 1.00 30.01 C ATOM 360 OG1 THR A1004 27.206 12.118 58.303 1.00 27.44 O ATOM 361 CG2 THR A1004 25.110 10.963 58.310 1.00 28.47 C ATOM 362 N VAL A1005 26.302 15.053 59.696 1.00 36.03 N ATOM 363 CA VAL A1005 27.241 16.102 60.068 1.00 38.67 C ATOM 364 C VAL A1005 28.238 15.463 61.029 1.00 40.30 C ATOM 365 O VAL A1005 27.836 14.841 62.010 1.00 41.08 O ATOM 366 CB VAL A1005 26.560 17.261 60.815 1.00 39.07 C ATOM 367 CG1 VAL A1005 27.571 18.364 61.095 1.00 38.86 C ATOM 368 CG2 VAL A1005 25.423 17.796 60.007 1.00 39.63 C ATOM 369 N ASN A1006 29.529 15.612 60.746 1.00 42.46 N ATOM 370 CA ASN A1006 30.560 15.050 61.612 1.00 44.36 C ATOM 371 C ASN A1006 30.299 15.509 63.048 1.00 45.44 C ATOM 372 O ASN A1006 30.086 16.698 63.300 1.00 46.18 O ATOM 373 CB ASN A1006 31.946 15.516 61.158 1.00 44.37 C ATOM 374 N GLU A1007 30.310 14.565 63.984 1.00 45.88 N ATOM 375 CA GLU A1007 30.067 14.876 65.388 1.00 46.50 C ATOM 376 C GLU A1007 31.098 15.867 65.918 1.00 46.58 C ATOM 377 O GLU A1007 30.961 16.390 67.028 1.00 47.16 O ATOM 378 CB GLU A1007 30.110 13.594 66.224 1.00 47.14 C ATOM 379 N ALA A1008 32.128 16.120 65.117 1.00 45.76 N ATOM 380 CA ALA A1008 33.187 17.043 65.498 1.00 44.89 C ATOM 381 C ALA A1008 33.037 18.395 64.811 1.00 44.18 C ATOM 382 O ALA A1008 33.836 19.304 65.038 1.00 44.39 O ATOM 383 CB ALA A1008 34.542 16.439 65.163 1.00 45.31 C ATOM 384 N ALA A1009 32.015 18.528 63.972 1.00 42.56 N ATOM 385 CA ALA A1009 31.782 19.776 63.253 1.00 40.75 C ATOM 386 C ALA A1009 31.551 20.937 64.211 1.00 39.88 C ATOM 387 O ALA A1009 31.125 20.743 65.351 1.00 39.38 O ATOM 388 CB ALA A1009 30.582 19.627 62.322 1.00 41.33 C ATOM 389 N SER A1010 31.832 22.144 63.735 1.00 38.35 N ATOM 390 CA SER A1010 31.659 23.348 64.538 1.00 37.55 C ATOM 391 C SER A1010 30.210 23.804 64.520 1.00 36.97 C ATOM 392 O SER A1010 29.409 23.342 63.707 1.00 35.60 O ATOM 393 CB SER A1010 32.535 24.475 63.992 1.00 37.35 C ATOM 394 OG SER A1010 32.130 24.842 62.684 1.00 37.89 O ATOM 395 N MET A1011 29.883 24.719 65.425 1.00 36.72 N ATOM 396 CA MET A1011 28.540 25.263 65.505 1.00 36.44 C ATOM 397 C MET A1011 28.231 25.935 64.175 1.00 35.51 C ATOM 398 O MET A1011 27.119 25.824 63.647 1.00 34.89 O ATOM 399 CB MET A1011 28.458 26.284 66.642 1.00 38.74 C ATOM 400 CG MET A1011 27.121 26.996 66.749 1.00 39.78 C ATOM 401 SD MET A1011 27.083 28.091 68.184 1.00 43.32 S ATOM 402 CE MET A1011 26.780 26.880 69.449 1.00 40.68 C ATOM 403 N ARG A1012 29.227 26.631 63.635 1.00 33.97 N ATOM 404 CA ARG A1012 29.073 27.317 62.359 1.00 33.88 C ATOM 405 C ARG A1012 28.614 26.351 61.265 1.00 33.25 C ATOM 406 O ARG A1012 27.675 26.637 60.525 1.00 31.65 O ATOM 407 CB ARG A1012 30.399 27.963 61.941 1.00 34.27 C ATOM 408 N GLU A1013 29.286 25.210 61.170 1.00 33.17 N ATOM 409 CA GLU A1013 28.952 24.211 60.166 1.00 34.41 C ATOM 410 C GLU A1013 27.591 23.582 60.428 1.00 33.95 C ATOM 411 O GLU A1013 26.789 23.404 59.504 1.00 34.15 O ATOM 412 CB GLU A1013 30.039 23.134 60.121 1.00 35.87 C ATOM 413 CG GLU A1013 31.376 23.674 59.634 1.00 40.38 C ATOM 414 CD GLU A1013 32.504 22.669 59.750 1.00 43.12 C ATOM 415 OE1 GLU A1013 32.845 22.274 60.888 1.00 44.34 O ATOM 416 OE2 GLU A1013 33.052 22.275 58.698 1.00 45.74 O ATOM 417 N ARG A1014 27.329 23.247 61.687 1.00 33.08 N ATOM 418 CA ARG A1014 26.056 22.646 62.052 1.00 31.81 C ATOM 419 C ARG A1014 24.908 23.582 61.709 1.00 29.76 C ATOM 420 O ARG A1014 23.851 23.141 61.263 1.00 28.31 O ATOM 421 CB ARG A1014 26.041 22.280 63.544 1.00 33.29 C ATOM 422 CG ARG A1014 26.353 20.805 63.784 1.00 36.77 C ATOM 423 CD ARG A1014 26.325 20.391 65.254 1.00 37.69 C ATOM 424 NE ARG A1014 27.518 20.821 65.979 1.00 39.41 N ATOM 425 CZ ARG A1014 27.577 21.883 66.776 1.00 40.59 C ATOM 426 NH1 ARG A1014 26.504 22.642 66.966 1.00 40.66 N ATOM 427 NH2 ARG A1014 28.716 22.189 67.384 1.00 41.03 N ATOM 428 N ILE A1015 25.115 24.877 61.911 1.00 28.79 N ATOM 429 CA ILE A1015 24.083 25.856 61.595 1.00 28.64 C ATOM 430 C ILE A1015 23.818 25.888 60.083 1.00 28.72 C ATOM 431 O ILE A1015 22.666 25.889 59.647 1.00 29.03 O ATOM 432 CB ILE A1015 24.489 27.268 62.090 1.00 28.51 C ATOM 433 CG1 ILE A1015 24.441 27.306 63.623 1.00 29.00 C ATOM 434 CG2 ILE A1015 23.572 28.330 61.483 1.00 28.32 C ATOM 435 CD1 ILE A1015 24.747 28.671 64.224 1.00 29.26 C ATOM 436 N GLU A1016 24.882 25.914 59.283 1.00 28.77 N ATOM 437 CA GLU A1016 24.731 25.929 57.828 1.00 29.65 C ATOM 438 C GLU A1016 24.030 24.654 57.365 1.00 28.59 C ATOM 439 O GLU A1016 23.146 24.688 56.513 1.00 28.32 O ATOM 440 CB GLU A1016 26.101 26.038 57.150 1.00 30.99 C ATOM 441 CG GLU A1016 26.725 27.424 57.230 1.00 34.54 C ATOM 442 CD GLU A1016 28.135 27.457 56.662 1.00 37.56 C ATOM 443 OE1 GLU A1016 28.673 28.570 56.480 1.00 38.68 O ATOM 444 OE2 GLU A1016 28.707 26.369 56.405 1.00 37.28 O ATOM 445 N PHE A1017 24.430 23.525 57.933 1.00 28.67 N ATOM 446 CA PHE A1017 23.816 22.253 57.577 1.00 28.83 C ATOM 447 C PHE A1017 22.305 22.284 57.822 1.00 28.43 C ATOM 448 O PHE A1017 21.509 21.950 56.939 1.00 28.30 O ATOM 449 CB PHE A1017 24.427 21.135 58.407 1.00 29.50 C ATOM 450 CG PHE A1017 23.870 19.780 58.098 1.00 30.85 C ATOM 451 CD1 PHE A1017 24.367 19.036 57.034 1.00 31.10 C ATOM 452 CD2 PHE A1017 22.865 19.232 58.890 1.00 30.55 C ATOM 453 CE1 PHE A1017 23.879 17.760 56.767 1.00 32.40 C ATOM 454 CE2 PHE A1017 22.372 17.961 58.632 1.00 32.09 C ATOM 455 CZ PHE A1017 22.881 17.221 57.567 1.00 32.24 C ATOM 456 N LEU A1018 21.914 22.687 59.028 1.00 27.78 N ATOM 457 CA LEU A1018 20.506 22.741 59.395 1.00 28.40 C ATOM 458 C LEU A1018 19.736 23.815 58.633 1.00 28.48 C ATOM 459 O LEU A1018 18.550 23.635 58.333 1.00 28.25 O ATOM 460 CB LEU A1018 20.360 22.945 60.910 1.00 28.52 C ATOM 461 CG LEU A1018 20.819 21.755 61.772 1.00 28.64 C ATOM 462 CD1 LEU A1018 20.736 22.106 63.258 1.00 29.37 C ATOM 463 CD2 LEU A1018 19.946 20.547 61.474 1.00 28.69 C ATOM 464 N ASN A1019 20.399 24.925 58.315 1.00 27.61 N ATOM 465 CA ASN A1019 19.738 25.992 57.565 1.00 28.10 C ATOM 466 C ASN A1019 19.342 25.482 56.180 1.00 27.59 C ATOM 467 O ASN A1019 18.292 25.849 55.662 1.00 28.59 O ATOM 468 CB ASN A1019 20.652 27.220 57.429 1.00 28.83 C ATOM 469 CG ASN A1019 20.615 28.130 58.657 1.00 30.96 C ATOM 470 OD1 ASN A1019 21.354 29.114 58.735 1.00 33.38 O ATOM 471 ND2 ASN A1019 19.751 27.813 59.610 1.00 30.20 N ATOM 472 N GLU A1020 20.174 24.636 55.577 1.00 28.93 N ATOM 473 CA GLU A1020 19.840 24.107 54.257 1.00 29.91 C ATOM 474 C GLU A1020 18.603 23.226 54.368 1.00 29.33 C ATOM 475 O GLU A1020 17.754 23.221 53.479 1.00 28.45 O ATOM 476 CB GLU A1020 20.989 23.286 53.652 1.00 31.26 C ATOM 477 CG GLU A1020 20.929 23.267 52.118 1.00 34.52 C ATOM 478 CD GLU A1020 21.895 22.290 51.461 1.00 35.77 C ATOM 479 OE1 GLU A1020 23.046 22.172 51.941 1.00 36.35 O ATOM 480 OE2 GLU A1020 21.499 21.657 50.448 1.00 34.94 O ATOM 481 N ALA A1021 18.503 22.480 55.464 1.00 29.92 N ATOM 482 CA ALA A1021 17.352 21.605 55.672 1.00 28.63 C ATOM 483 C ALA A1021 16.105 22.454 55.847 1.00 28.13 C ATOM 484 O ALA A1021 15.050 22.145 55.292 1.00 27.78 O ATOM 485 CB ALA A1021 17.561 20.736 56.897 1.00 28.54 C ATOM 486 N SER A1022 16.229 23.531 56.619 1.00 28.33 N ATOM 487 CA SER A1022 15.095 24.408 56.863 1.00 30.00 C ATOM 488 C SER A1022 14.537 24.967 55.572 1.00 29.19 C ATOM 489 O SER A1022 13.322 24.987 55.377 1.00 29.95 O ATOM 490 CB SER A1022 15.486 25.554 57.796 1.00 30.68 C ATOM 491 OG SER A1022 15.634 25.072 59.118 1.00 35.71 O ATOM 492 N VAL A1023 15.422 25.426 54.694 1.00 28.82 N ATOM 493 CA VAL A1023 14.996 25.971 53.410 1.00 29.04 C ATOM 494 C VAL A1023 14.229 24.909 52.616 1.00 28.36 C ATOM 495 O VAL A1023 13.214 25.205 51.988 1.00 27.63 O ATOM 496 CB VAL A1023 16.212 26.450 52.574 1.00 30.40 C ATOM 497 CG1 VAL A1023 15.757 26.926 51.211 1.00 32.10 C ATOM 498 CG2 VAL A1023 16.923 27.585 53.295 1.00 32.26 C ATOM 499 N MET A1024 14.719 23.673 52.650 1.00 27.76 N ATOM 500 CA MET A1024 14.086 22.578 51.919 1.00 27.18 C ATOM 501 C MET A1024 12.689 22.221 52.419 1.00 26.74 C ATOM 502 O MET A1024 11.880 21.680 51.664 1.00 26.51 O ATOM 503 CB MET A1024 14.978 21.330 51.960 1.00 27.59 C ATOM 504 CG MET A1024 16.279 21.473 51.183 1.00 29.37 C ATOM 505 SD MET A1024 17.257 19.952 51.179 1.00 31.09 S ATOM 506 CE MET A1024 16.304 18.975 50.036 1.00 32.26 C ATOM 507 N LYS A1025 12.401 22.518 53.684 1.00 26.06 N ATOM 508 CA LYS A1025 11.086 22.213 54.247 1.00 26.22 C ATOM 509 C LYS A1025 9.986 22.947 53.480 1.00 26.76 C ATOM 510 O LYS A1025 8.817 22.558 53.519 1.00 26.79 O ATOM 511 CB LYS A1025 11.016 22.629 55.719 1.00 24.68 C ATOM 512 CG LYS A1025 11.914 21.848 56.651 1.00 25.83 C ATOM 513 CD LYS A1025 11.798 22.354 58.084 1.00 25.80 C ATOM 514 CE LYS A1025 12.712 21.561 59.006 1.00 26.79 C ATOM 515 NZ LYS A1025 12.829 22.161 60.369 1.00 27.33 N ATOM 516 N GLU A1026 10.370 24.009 52.784 1.00 27.26 N ATOM 517 CA GLU A1026 9.418 24.816 52.027 1.00 28.93 C ATOM 518 C GLU A1026 9.116 24.278 50.632 1.00 28.15 C ATOM 519 O GLU A1026 8.174 24.732 49.987 1.00 29.37 O ATOM 520 CB GLU A1026 9.953 26.242 51.883 1.00 29.97 C ATOM 521 CG GLU A1026 10.406 26.876 53.184 1.00 34.59 C ATOM 522 CD GLU A1026 9.246 27.289 54.063 1.00 35.61 C ATOM 523 OE1 GLU A1026 9.481 27.635 55.237 1.00 38.33 O ATOM 524 OE2 GLU A1026 8.097 27.277 53.578 1.00 38.45 O ATOM 525 N PHE A1027 9.900 23.317 50.160 1.00 27.46 N ATOM 526 CA PHE A1027 9.693 22.806 48.813 1.00 27.10 C ATOM 527 C PHE A1027 8.897 21.518 48.673 1.00 27.81 C ATOM 528 O PHE A1027 9.106 20.554 49.406 1.00 27.51 O ATOM 529 CB PHE A1027 11.034 22.606 48.098 1.00 26.07 C ATOM 530 CG PHE A1027 11.996 23.749 48.255 1.00 26.22 C ATOM 531 CD1 PHE A1027 11.542 25.059 48.338 1.00 26.62 C ATOM 532 CD2 PHE A1027 13.369 23.512 48.295 1.00 25.86 C ATOM 533 CE1 PHE A1027 12.443 26.123 48.459 1.00 26.38 C ATOM 534 CE2 PHE A1027 14.274 24.569 48.416 1.00 24.98 C ATOM 535 CZ PHE A1027 13.811 25.872 48.498 1.00 25.20 C ATOM 536 N ASN A1028 7.984 21.524 47.706 1.00 27.62 N ATOM 537 CA ASN A1028 7.169 20.363 47.387 1.00 29.09 C ATOM 538 C ASN A1028 6.992 20.369 45.876 1.00 28.59 C ATOM 539 O ASN A1028 5.976 20.839 45.350 1.00 28.57 O ATOM 540 CB ASN A1028 5.802 20.429 48.070 1.00 31.22 C ATOM 541 CG ASN A1028 4.955 19.212 47.764 1.00 33.69 C ATOM 542 OD1 ASN A1028 5.448 18.086 47.784 1.00 35.80 O ATOM 543 ND2 ASN A1028 3.673 19.429 47.482 1.00 34.25 N ATOM 544 N CYS A1029 7.994 19.850 45.180 1.00 26.02 N ATOM 545 CA CYS A1029 7.959 19.817 43.726 1.00 25.87 C ATOM 546 C CYS A1029 8.617 18.559 43.201 1.00 24.25 C ATOM 547 O CYS A1029 9.654 18.138 43.705 1.00 23.96 O ATOM 548 CB CYS A1029 8.671 21.050 43.151 1.00 24.18 C ATOM 549 SG CYS A1029 8.765 21.083 41.349 1.00 25.38 S ATOM 550 N HIS A1030 8.005 17.967 42.181 1.00 24.43 N ATOM 551 CA HIS A1030 8.513 16.744 41.569 1.00 24.24 C ATOM 552 C HIS A1030 9.927 16.911 41.014 1.00 23.18 C ATOM 553 O HIS A1030 10.683 15.945 40.933 1.00 23.16 O ATOM 554 CB HIS A1030 7.574 16.301 40.439 1.00 24.97 C ATOM 555 CG HIS A1030 7.961 15.003 39.801 1.00 25.96 C ATOM 556 ND1 HIS A1030 7.805 13.787 40.432 1.00 26.64 N ATOM 557 CD2 HIS A1030 8.511 14.732 38.593 1.00 25.58 C ATOM 558 CE1 HIS A1030 8.242 12.823 39.640 1.00 25.98 C ATOM 559 NE2 HIS A1030 8.675 13.369 38.519 1.00 26.10 N ATOM 560 N HIS A1031 10.288 18.131 40.627 1.00 22.43 N ATOM 561 CA HIS A1031 11.616 18.363 40.072 1.00 21.21 C ATOM 562 C HIS A1031 12.609 19.036 41.021 1.00 21.42 C ATOM 563 O HIS A1031 13.580 19.658 40.593 1.00 20.37 O ATOM 564 CB HIS A1031 11.494 19.138 38.764 1.00 22.26 C ATOM 565 CG HIS A1031 10.789 18.370 37.687 1.00 22.62 C ATOM 566 ND1 HIS A1031 9.572 18.754 37.169 1.00 23.92 N ATOM 567 CD2 HIS A1031 11.129 17.228 37.046 1.00 22.82 C ATOM 568 CE1 HIS A1031 9.193 17.884 36.250 1.00 21.64 C ATOM 569 NE2 HIS A1031 10.119 16.949 36.156 1.00 23.81 N ATOM 570 N VAL A1032 12.348 18.903 42.317 1.00 20.99 N ATOM 571 CA VAL A1032 13.242 19.413 43.349 1.00 20.52 C ATOM 572 C VAL A1032 13.423 18.241 44.311 1.00 20.81 C ATOM 573 O VAL A1032 12.435 17.655 44.759 1.00 20.38 O ATOM 574 CB VAL A1032 12.638 20.614 44.104 1.00 20.38 C ATOM 575 CG1 VAL A1032 13.562 21.017 45.241 1.00 20.77 C ATOM 576 CG2 VAL A1032 12.444 21.793 43.142 1.00 19.61 C ATOM 577 N VAL A1033 14.670 17.887 44.621 1.00 21.12 N ATOM 578 CA VAL A1033 14.932 16.769 45.530 1.00 21.57 C ATOM 579 C VAL A1033 14.212 17.030 46.847 1.00 22.51 C ATOM 580 O VAL A1033 14.377 18.076 47.473 1.00 21.03 O ATOM 581 CB VAL A1033 16.434 16.587 45.765 1.00 22.42 C ATOM 582 CG1 VAL A1033 16.678 15.404 46.685 1.00 23.80 C ATOM 583 CG2 VAL A1033 17.130 16.352 44.423 1.00 23.48 C ATOM 584 N ARG A1034 13.407 16.063 47.265 1.00 23.91 N ATOM 585 CA ARG A1034 12.587 16.216 48.460 1.00 25.04 C ATOM 586 C ARG A1034 13.176 15.898 49.836 1.00 24.63 C ATOM 587 O ARG A1034 13.800 14.853 50.039 1.00 23.93 O ATOM 588 CB ARG A1034 11.292 15.427 48.230 1.00 28.33 C ATOM 589 CG ARG A1034 10.480 15.112 49.464 1.00 34.98 C ATOM 590 CD ARG A1034 9.022 14.864 49.091 1.00 39.09 C ATOM 591 NE ARG A1034 8.257 16.105 49.172 1.00 43.55 N ATOM 592 CZ ARG A1034 8.023 16.758 50.309 1.00 45.73 C ATOM 593 NH1 ARG A1034 8.490 16.278 51.458 1.00 46.48 N ATOM 594 NH2 ARG A1034 7.343 17.900 50.301 1.00 46.67 N ATOM 595 N LEU A1035 12.970 16.816 50.781 1.00 23.82 N ATOM 596 CA LEU A1035 13.428 16.624 52.158 1.00 23.93 C ATOM 597 C LEU A1035 12.399 15.684 52.751 1.00 24.00 C ATOM 598 O LEU A1035 11.201 15.870 52.540 1.00 23.93 O ATOM 599 CB LEU A1035 13.408 17.938 52.951 1.00 22.50 C ATOM 600 CG LEU A1035 13.690 17.765 54.451 1.00 20.93 C ATOM 601 CD1 LEU A1035 15.119 17.250 54.651 1.00 18.95 C ATOM 602 CD2 LEU A1035 13.490 19.092 55.178 1.00 20.02 C ATOM 603 N LEU A1036 12.846 14.678 53.493 1.00 23.70 N ATOM 604 CA LEU A1036 11.903 13.725 54.058 1.00 23.90 C ATOM 605 C LEU A1036 11.888 13.713 55.575 1.00 24.15 C ATOM 606 O LEU A1036 10.951 13.208 56.185 1.00 24.10 O ATOM 607 CB LEU A1036 12.201 12.321 53.526 1.00 24.31 C ATOM 608 CG LEU A1036 11.856 12.106 52.047 1.00 23.87 C ATOM 609 CD1 LEU A1036 12.400 10.777 51.571 1.00 23.51 C ATOM 610 CD2 LEU A1036 10.346 12.157 51.871 1.00 23.91 C ATOM 611 N GLY A1037 12.921 14.271 56.189 1.00 24.11 N ATOM 612 CA GLY A1037 12.964 14.285 57.634 1.00 23.68 C ATOM 613 C GLY A1037 14.289 14.757 58.180 1.00 23.53 C ATOM 614 O GLY A1037 15.282 14.851 57.451 1.00 21.14 O ATOM 615 N VAL A1038 14.291 15.054 59.474 1.00 23.62 N ATOM 616 CA VAL A1038 15.474 15.534 60.162 1.00 25.35 C ATOM 617 C VAL A1038 15.597 14.839 61.506 1.00 25.98 C ATOM 618 O VAL A1038 14.603 14.627 62.199 1.00 26.60 O ATOM 619 CB VAL A1038 15.379 17.052 60.443 1.00 26.56 C ATOM 620 CG1 VAL A1038 16.673 17.545 61.096 1.00 27.10 C ATOM 621 CG2 VAL A1038 15.091 17.805 59.157 1.00 27.73 C ATOM 622 N VAL A1039 16.819 14.481 61.875 1.00 25.95 N ATOM 623 CA VAL A1039 17.056 13.852 63.165 1.00 26.21 C ATOM 624 C VAL A1039 17.957 14.825 63.916 1.00 26.51 C ATOM 625 O VAL A1039 19.171 14.816 63.731 1.00 25.71 O ATOM 626 CB VAL A1039 17.765 12.493 63.011 1.00 25.90 C ATOM 627 CG1 VAL A1039 18.037 11.891 64.386 1.00 28.75 C ATOM 628 CG2 VAL A1039 16.904 11.548 62.200 1.00 27.03 C ATOM 629 N SER A1040 17.365 15.671 64.755 1.00 27.50 N ATOM 630 CA SER A1040 18.152 16.662 65.488 1.00 28.61 C ATOM 631 C SER A1040 18.339 16.337 66.964 1.00 29.07 C ATOM 632 O SER A1040 18.714 17.203 67.756 1.00 29.61 O ATOM 633 CB SER A1040 17.539 18.060 65.327 1.00 28.79 C ATOM 634 OG SER A1040 16.192 18.101 65.761 1.00 29.64 O ATOM 635 N GLN A1041 18.074 15.086 67.321 1.00 28.85 N ATOM 636 CA GLN A1041 18.249 14.608 68.685 1.00 28.59 C ATOM 637 C GLN A1041 19.326 13.532 68.620 1.00 29.49 C ATOM 638 O GLN A1041 19.235 12.603 67.813 1.00 28.65 O ATOM 639 CB GLN A1041 16.953 13.998 69.227 1.00 28.47 C ATOM 640 CG GLN A1041 15.878 14.999 69.645 1.00 28.81 C ATOM 641 CD GLN A1041 16.233 15.767 70.914 1.00 29.03 C ATOM 642 OE1 GLN A1041 16.658 15.180 71.912 1.00 27.92 O ATOM 643 NE2 GLN A1041 16.042 17.084 70.885 1.00 28.40 N ATOM 644 N GLY A1042 20.346 13.660 69.461 1.00 29.78 N ATOM 645 CA GLY A1042 21.416 12.681 69.473 1.00 30.56 C ATOM 646 C GLY A1042 22.450 12.906 68.390 1.00 30.69 C ATOM 647 O GLY A1042 22.362 13.873 67.633 1.00 30.15 O ATOM 648 N GLN A1043 23.429 12.006 68.323 1.00 31.46 N ATOM 649 CA GLN A1043 24.515 12.079 67.346 1.00 32.43 C ATOM 650 C GLN A1043 24.522 10.850 66.440 1.00 32.77 C ATOM 651 O GLN A1043 24.241 9.743 66.891 1.00 33.12 O ATOM 652 CB GLN A1043 25.866 12.151 68.059 1.00 34.00 C ATOM 653 CG GLN A1043 26.148 13.442 68.812 1.00 37.12 C ATOM 654 CD GLN A1043 26.205 14.644 67.900 1.00 39.01 C ATOM 655 OE1 GLN A1043 26.735 14.571 66.790 1.00 40.86 O ATOM 656 NE2 GLN A1043 25.669 15.766 68.367 1.00 40.27 N ATOM 657 N PRO A1044 24.846 11.031 65.149 1.00 32.54 N ATOM 658 CA PRO A1044 25.186 12.322 64.549 1.00 32.39 C ATOM 659 C PRO A1044 23.914 13.000 64.050 1.00 32.36 C ATOM 660 O PRO A1044 22.865 12.363 63.955 1.00 33.32 O ATOM 661 CB PRO A1044 26.110 11.928 63.408 1.00 33.13 C ATOM 662 CG PRO A1044 25.473 10.668 62.920 1.00 32.65 C ATOM 663 CD PRO A1044 25.155 9.930 64.215 1.00 32.82 C ATOM 664 N THR A1045 24.001 14.287 63.736 1.00 31.62 N ATOM 665 CA THR A1045 22.838 15.007 63.235 1.00 31.95 C ATOM 666 C THR A1045 22.611 14.528 61.807 1.00 32.04 C ATOM 667 O THR A1045 23.544 14.512 61.009 1.00 31.50 O ATOM 668 CB THR A1045 23.078 16.527 63.238 1.00 30.98 C ATOM 669 OG1 THR A1045 23.368 16.951 64.574 1.00 32.60 O ATOM 670 CG2 THR A1045 21.843 17.267 62.734 1.00 30.05 C ATOM 671 N LEU A1046 21.375 14.142 61.494 1.00 31.79 N ATOM 672 CA LEU A1046 21.040 13.620 60.171 1.00 31.21 C ATOM 673 C LEU A1046 19.897 14.355 59.488 1.00 30.26 C ATOM 674 O LEU A1046 19.038 14.962 60.129 1.00 29.16 O ATOM 675 CB LEU A1046 20.624 12.146 60.268 1.00 31.56 C ATOM 676 CG LEU A1046 21.428 11.113 61.055 1.00 32.73 C ATOM 677 CD1 LEU A1046 20.616 9.840 61.169 1.00 33.67 C ATOM 678 CD2 LEU A1046 22.744 10.833 60.371 1.00 34.70 C ATOM 679 N VAL A1047 19.907 14.270 58.167 1.00 29.24 N ATOM 680 CA VAL A1047 18.879 14.842 57.320 1.00 28.54 C ATOM 681 C VAL A1047 18.614 13.725 56.315 1.00 27.82 C ATOM 682 O VAL A1047 19.549 13.207 55.709 1.00 26.31 O ATOM 683 CB VAL A1047 19.396 16.111 56.609 1.00 29.50 C ATOM 684 CG1 VAL A1047 18.489 16.476 55.459 1.00 30.23 C ATOM 685 CG2 VAL A1047 19.447 17.267 57.605 1.00 31.02 C ATOM 686 N ILE A1048 17.355 13.336 56.151 1.00 26.75 N ATOM 687 CA ILE A1048 17.027 12.276 55.206 1.00 27.52 C ATOM 688 C ILE A1048 16.263 12.860 54.034 1.00 27.06 C ATOM 689 O ILE A1048 15.316 13.633 54.204 1.00 25.43 O ATOM 690 CB ILE A1048 16.203 11.127 55.847 1.00 29.73 C ATOM 691 CG1 ILE A1048 14.870 11.656 56.362 1.00 31.04 C ATOM 692 CG2 ILE A1048 17.008 10.480 56.987 1.00 31.47 C ATOM 693 CD1 ILE A1048 13.856 10.566 56.643 1.00 32.40 C ATOM 694 N MET A1049 16.694 12.478 52.842 1.00 26.59 N ATOM 695 CA MET A1049 16.126 12.995 51.617 1.00 27.96 C ATOM 696 C MET A1049 15.826 11.925 50.583 1.00 27.54 C ATOM 697 O MET A1049 16.293 10.788 50.678 1.00 26.92 O ATOM 698 CB MET A1049 17.096 14.001 50.998 1.00 31.77 C ATOM 699 CG MET A1049 17.301 15.262 51.820 1.00 36.77 C ATOM 700 SD MET A1049 18.637 16.246 51.139 1.00 44.84 S ATOM 701 CE MET A1049 18.102 16.428 49.440 1.00 42.11 C ATOM 702 N GLU A1050 15.041 12.329 49.593 1.00 25.29 N ATOM 703 CA GLU A1050 14.658 11.485 48.484 1.00 25.13 C ATOM 704 C GLU A1050 15.937 10.898 47.889 1.00 24.01 C ATOM 705 O GLU A1050 16.916 11.613 47.683 1.00 22.50 O ATOM 706 CB GLU A1050 13.933 12.340 47.443 1.00 24.45 C ATOM 707 CG GLU A1050 13.500 11.605 46.200 1.00 25.49 C ATOM 708 CD GLU A1050 12.879 12.529 45.170 1.00 25.10 C ATOM 709 OE1 GLU A1050 12.590 12.054 44.060 1.00 24.97 O ATOM 710 OE2 GLU A1050 12.675 13.730 45.461 1.00 26.25 O ATOM 711 N LEU A1051 15.931 9.596 47.620 1.00 24.01 N ATOM 712 CA LEU A1051 17.104 8.941 47.047 1.00 23.23 C ATOM 713 C LEU A1051 17.134 9.155 45.535 1.00 22.80 C ATOM 714 O LEU A1051 16.146 8.928 44.851 1.00 22.75 O ATOM 715 CB LEU A1051 17.079 7.437 47.360 1.00 24.45 C ATOM 716 CG LEU A1051 18.263 6.594 46.863 1.00 22.72 C ATOM 717 CD1 LEU A1051 19.544 7.080 47.525 1.00 23.98 C ATOM 718 CD2 LEU A1051 18.031 5.113 47.194 1.00 23.76 C ATOM 719 N MET A1052 18.277 9.598 45.026 1.00 23.22 N ATOM 720 CA MET A1052 18.473 9.837 43.600 1.00 24.25 C ATOM 721 C MET A1052 19.578 8.854 43.216 1.00 24.98 C ATOM 722 O MET A1052 20.767 9.181 43.293 1.00 23.42 O ATOM 723 CB MET A1052 18.935 11.285 43.372 1.00 24.55 C ATOM 724 CG MET A1052 17.943 12.339 43.879 1.00 24.25 C ATOM 725 SD MET A1052 16.321 12.208 43.092 1.00 25.17 S ATOM 726 CE MET A1052 16.704 12.783 41.428 1.00 24.92 C ATOM 727 N THR A1053 19.181 7.649 42.805 1.00 26.09 N ATOM 728 CA THR A1053 20.153 6.600 42.493 1.00 27.23 C ATOM 729 C THR A1053 21.257 6.900 41.480 1.00 27.85 C ATOM 730 O THR A1053 22.354 6.363 41.606 1.00 27.93 O ATOM 731 CB THR A1053 19.444 5.268 42.098 1.00 27.09 C ATOM 732 OG1 THR A1053 18.581 5.478 40.974 1.00 27.57 O ATOM 733 CG2 THR A1053 18.614 4.744 43.276 1.00 27.54 C ATOM 734 N ARG A1054 20.998 7.747 40.489 1.00 27.94 N ATOM 735 CA ARG A1054 22.031 8.056 39.499 1.00 28.48 C ATOM 736 C ARG A1054 23.034 9.157 39.883 1.00 28.15 C ATOM 737 O ARG A1054 23.841 9.565 39.054 1.00 29.23 O ATOM 738 CB ARG A1054 21.399 8.413 38.150 1.00 30.54 C ATOM 739 CG ARG A1054 21.108 7.238 37.216 1.00 32.85 C ATOM 740 CD ARG A1054 19.916 6.431 37.657 1.00 34.31 C ATOM 741 NE ARG A1054 19.282 5.705 36.550 1.00 35.72 N ATOM 742 CZ ARG A1054 19.874 4.770 35.809 1.00 37.42 C ATOM 743 NH1 ARG A1054 21.139 4.426 36.026 1.00 37.69 N ATOM 744 NH2 ARG A1054 19.185 4.144 34.865 1.00 38.81 N ATOM 745 N GLY A1055 22.992 9.639 41.123 1.00 27.23 N ATOM 746 CA GLY A1055 23.937 10.660 41.550 1.00 25.42 C ATOM 747 C GLY A1055 23.758 12.038 40.922 1.00 25.23 C ATOM 748 O GLY A1055 22.729 12.323 40.309 1.00 23.81 O ATOM 749 N ASP A1056 24.769 12.892 41.062 1.00 25.11 N ATOM 750 CA ASP A1056 24.684 14.246 40.510 1.00 26.01 C ATOM 751 C ASP A1056 24.768 14.235 38.984 1.00 25.79 C ATOM 752 O ASP A1056 25.349 13.323 38.378 1.00 25.35 O ATOM 753 CB ASP A1056 25.781 15.142 41.095 1.00 26.20 C ATOM 754 CG ASP A1056 27.164 14.777 40.596 1.00 28.11 C ATOM 755 OD1 ASP A1056 27.739 13.780 41.076 1.00 28.78 O ATOM 756 OD2 ASP A1056 27.675 15.491 39.712 1.00 27.37 O ATOM 757 N LEU A1057 24.180 15.255 38.371 1.00 24.59 N ATOM 758 CA LEU A1057 24.146 15.368 36.921 1.00 24.01 C ATOM 759 C LEU A1057 25.509 15.508 36.253 1.00 23.82 C ATOM 760 O LEU A1057 25.694 15.035 35.132 1.00 21.71 O ATOM 761 CB LEU A1057 23.259 16.544 36.500 1.00 23.32 C ATOM 762 CG LEU A1057 23.153 16.728 34.981 1.00 22.90 C ATOM 763 CD1 LEU A1057 22.520 15.482 34.365 1.00 23.07 C ATOM 764 CD2 LEU A1057 22.320 17.969 34.659 1.00 22.41 C ATOM 765 N LYS A1058 26.459 16.154 36.920 1.00 24.23 N ATOM 766 CA LYS A1058 27.774 16.313 36.309 1.00 27.06 C ATOM 767 C LYS A1058 28.446 14.952 36.114 1.00 27.59 C ATOM 768 O LYS A1058 28.933 14.640 35.027 1.00 27.20 O ATOM 769 CB LYS A1058 28.684 17.207 37.157 1.00 27.89 C ATOM 770 CG LYS A1058 30.057 17.358 36.504 1.00 29.99 C ATOM 771 CD LYS A1058 31.050 18.151 37.324 1.00 31.64 C ATOM 772 CE LYS A1058 32.395 18.185 36.591 1.00 33.30 C ATOM 773 NZ LYS A1058 33.455 18.894 37.355 1.00 33.01 N ATOM 774 N SER A1059 28.469 14.149 37.174 1.00 28.77 N ATOM 775 CA SER A1059 29.076 12.822 37.115 1.00 29.75 C ATOM 776 C SER A1059 28.340 11.948 36.111 1.00 30.79 C ATOM 777 O SER A1059 28.956 11.160 35.400 1.00 31.10 O ATOM 778 CB SER A1059 29.033 12.158 38.490 1.00 30.57 C ATOM 779 OG SER A1059 29.684 12.954 39.466 1.00 31.67 O ATOM 780 N TYR A1060 27.016 12.085 36.053 1.00 31.22 N ATOM 781 CA TYR A1060 26.219 11.291 35.126 1.00 31.33 C ATOM 782 C TYR A1060 26.567 11.632 33.678 1.00 32.61 C ATOM 783 O TYR A1060 26.666 10.742 32.824 1.00 32.54 O ATOM 784 CB TYR A1060 24.724 11.522 35.364 1.00 30.63 C ATOM 785 CG TYR A1060 23.856 10.868 34.318 1.00 30.43 C ATOM 786 CD1 TYR A1060 23.793 9.479 34.205 1.00 31.37 C ATOM 787 CD2 TYR A1060 23.151 11.636 33.396 1.00 30.77 C ATOM 788 CE1 TYR A1060 23.055 8.873 33.189 1.00 31.19 C ATOM 789 CE2 TYR A1060 22.410 11.043 32.381 1.00 31.19 C ATOM 790 CZ TYR A1060 22.368 9.663 32.281 1.00 31.79 C ATOM 791 OH TYR A1060 21.652 9.082 31.263 1.00 32.50 O ATOM 792 N LEU A1061 26.748 12.921 33.403 1.00 32.33 N ATOM 793 CA LEU A1061 27.100 13.368 32.061 1.00 32.62 C ATOM 794 C LEU A1061 28.505 12.885 31.702 1.00 33.87 C ATOM 795 O LEU A1061 28.739 12.407 30.592 1.00 33.84 O ATOM 796 CB LEU A1061 27.027 14.896 31.974 1.00 30.76 C ATOM 797 CG LEU A1061 25.627 15.518 32.075 1.00 30.20 C ATOM 798 CD1 LEU A1061 25.727 17.030 32.210 1.00 31.22 C ATOM 799 CD2 LEU A1061 24.820 15.156 30.843 1.00 29.72 C ATOM 800 N ARG A1062 29.438 13.007 32.642 1.00 35.64 N ATOM 801 CA ARG A1062 30.810 12.568 32.401 1.00 38.37 C ATOM 802 C ARG A1062 30.836 11.074 32.079 1.00 39.00 C ATOM 803 O ARG A1062 31.561 10.638 31.185 1.00 38.94 O ATOM 804 CB ARG A1062 31.695 12.828 33.630 1.00 38.58 C ATOM 805 CG ARG A1062 31.898 14.295 33.991 1.00 41.31 C ATOM 806 CD ARG A1062 32.698 15.048 32.937 1.00 42.21 C ATOM 807 NE ARG A1062 34.030 14.483 32.727 1.00 44.06 N ATOM 808 CZ ARG A1062 34.970 15.045 31.968 1.00 44.58 C ATOM 809 NH1 ARG A1062 34.727 16.192 31.343 1.00 44.28 N ATOM 810 NH2 ARG A1062 36.156 14.464 31.835 1.00 44.18 N ATOM 811 N SER A1063 30.037 10.299 32.809 1.00 40.20 N ATOM 812 CA SER A1063 29.988 8.853 32.612 1.00 41.70 C ATOM 813 C SER A1063 29.549 8.474 31.202 1.00 42.85 C ATOM 814 O SER A1063 29.748 7.338 30.773 1.00 43.24 O ATOM 815 CB SER A1063 29.040 8.202 33.627 1.00 41.52 C ATOM 816 OG SER A1063 27.685 8.291 33.208 1.00 41.02 O ATOM 817 N LEU A1064 28.952 9.416 30.482 1.00 43.80 N ATOM 818 CA LEU A1064 28.492 9.137 29.126 1.00 45.47 C ATOM 819 C LEU A1064 29.544 9.467 28.074 1.00 47.26 C ATOM 820 O LEU A1064 29.302 9.313 26.878 1.00 47.07 O ATOM 821 CB LEU A1064 27.212 9.916 28.820 1.00 44.46 C ATOM 822 CG LEU A1064 26.023 9.692 29.756 1.00 43.90 C ATOM 823 CD1 LEU A1064 24.834 10.480 29.235 1.00 43.45 C ATOM 824 CD2 LEU A1064 25.686 8.205 29.842 1.00 43.77 C ATOM 825 N ARG A1065 30.709 9.922 28.521 1.00 49.35 N ATOM 826 CA ARG A1065 31.783 10.263 27.601 1.00 52.09 C ATOM 827 C ARG A1065 32.370 9.016 26.949 1.00 54.17 C ATOM 828 O ARG A1065 32.645 8.025 27.624 1.00 53.99 O ATOM 829 CB ARG A1065 32.886 11.020 28.337 1.00 52.42 C ATOM 830 CG ARG A1065 32.592 12.489 28.550 1.00 52.70 C ATOM 831 CD ARG A1065 33.639 13.120 29.442 1.00 52.80 C ATOM 832 NE ARG A1065 33.543 14.575 29.433 1.00 53.49 N ATOM 833 CZ ARG A1065 33.843 15.332 28.385 1.00 53.15 C ATOM 834 NH1 ARG A1065 34.263 14.771 27.261 1.00 53.36 N ATOM 835 NH2 ARG A1065 33.720 16.649 28.459 1.00 53.44 N ATOM 836 N PRO A1066 32.564 9.052 25.620 1.00 56.25 N ATOM 837 CA PRO A1066 33.124 7.925 24.867 1.00 57.98 C ATOM 838 C PRO A1066 34.489 7.516 25.414 1.00 59.42 C ATOM 839 O PRO A1066 34.835 6.333 25.436 1.00 59.72 O ATOM 840 CB PRO A1066 33.214 8.474 23.446 1.00 57.80 C ATOM 841 CG PRO A1066 32.049 9.415 23.385 1.00 57.81 C ATOM 842 CD PRO A1066 32.167 10.140 24.708 1.00 56.81 C ATOM 843 N GLU A1067 35.260 8.505 25.854 1.00 60.85 N ATOM 844 CA GLU A1067 36.585 8.253 26.408 1.00 62.41 C ATOM 845 C GLU A1067 36.479 7.378 27.653 1.00 63.46 C ATOM 846 O GLU A1067 37.005 6.263 27.687 1.00 63.97 O ATOM 847 N MET A1068 35.794 7.890 28.671 1.00 64.16 N ATOM 848 CA MET A1068 35.610 7.160 29.922 1.00 64.75 C ATOM 849 C MET A1068 34.508 6.111 29.793 1.00 65.31 C ATOM 850 O MET A1068 33.320 6.423 29.900 1.00 65.66 O ATOM 851 N PRO A1077 23.717 11.407 24.803 1.00 50.21 N ATOM 852 CA PRO A1077 22.259 11.525 24.908 1.00 49.31 C ATOM 853 C PRO A1077 21.624 12.203 23.693 1.00 48.53 C ATOM 854 O PRO A1077 22.190 13.136 23.121 1.00 48.48 O ATOM 855 CB PRO A1077 22.073 12.326 26.196 1.00 49.44 C ATOM 856 CG PRO A1077 23.272 13.215 26.204 1.00 50.26 C ATOM 857 CD PRO A1077 24.386 12.271 25.793 1.00 50.38 C ATOM 858 N SER A1078 20.445 11.724 23.307 1.00 47.25 N ATOM 859 CA SER A1078 19.729 12.262 22.156 1.00 45.97 C ATOM 860 C SER A1078 19.218 13.677 22.394 1.00 45.53 C ATOM 861 O SER A1078 19.163 14.151 23.526 1.00 45.17 O ATOM 862 CB SER A1078 18.541 11.362 21.807 1.00 45.85 C ATOM 863 OG SER A1078 17.542 11.432 22.810 1.00 44.10 O ATOM 864 N LEU A1079 18.840 14.344 21.309 1.00 44.74 N ATOM 865 CA LEU A1079 18.319 15.696 21.387 1.00 44.11 C ATOM 866 C LEU A1079 17.122 15.732 22.325 1.00 43.56 C ATOM 867 O LEU A1079 17.003 16.639 23.143 1.00 43.97 O ATOM 868 CB LEU A1079 17.899 16.184 20.001 1.00 44.85 C ATOM 869 N SER A1080 16.237 14.746 22.202 1.00 42.66 N ATOM 870 CA SER A1080 15.049 14.672 23.048 1.00 42.08 C ATOM 871 C SER A1080 15.380 14.468 24.520 1.00 40.47 C ATOM 872 O SER A1080 14.743 15.063 25.391 1.00 39.95 O ATOM 873 CB SER A1080 14.126 13.549 22.582 1.00 42.75 C ATOM 874 OG SER A1080 13.350 13.976 21.480 1.00 46.12 O ATOM 875 N LYS A1081 16.369 13.626 24.798 1.00 38.72 N ATOM 876 CA LYS A1081 16.770 13.377 26.173 1.00 37.03 C ATOM 877 C LYS A1081 17.356 14.661 26.764 1.00 35.75 C ATOM 878 O LYS A1081 17.112 14.988 27.921 1.00 35.30 O ATOM 879 CB LYS A1081 17.803 12.248 26.233 1.00 37.18 C ATOM 880 N MET A1082 18.127 15.389 25.963 1.00 34.22 N ATOM 881 CA MET A1082 18.725 16.631 26.432 1.00 33.27 C ATOM 882 C MET A1082 17.668 17.688 26.718 1.00 31.88 C ATOM 883 O MET A1082 17.744 18.399 27.718 1.00 31.22 O ATOM 884 CB MET A1082 19.719 17.170 25.407 1.00 32.69 C ATOM 885 CG MET A1082 21.034 16.423 25.369 1.00 34.08 C ATOM 886 SD MET A1082 22.228 17.260 24.309 1.00 35.04 S ATOM 887 CE MET A1082 21.798 16.572 22.721 1.00 36.67 C ATOM 888 N ILE A1083 16.683 17.789 25.837 1.00 31.11 N ATOM 889 CA ILE A1083 15.613 18.762 26.008 1.00 31.70 C ATOM 890 C ILE A1083 14.739 18.386 27.199 1.00 30.87 C ATOM 891 O ILE A1083 14.202 19.258 27.881 1.00 29.96 O ATOM 892 CB ILE A1083 14.729 18.849 24.750 1.00 32.09 C ATOM 893 CG1 ILE A1083 15.590 19.225 23.542 1.00 34.08 C ATOM 894 CG2 ILE A1083 13.622 19.876 24.957 1.00 32.34 C ATOM 895 CD1 ILE A1083 16.247 20.580 23.653 1.00 36.60 C ATOM 896 N GLN A1084 14.596 17.089 27.446 1.00 30.30 N ATOM 897 CA GLN A1084 13.790 16.630 28.571 1.00 30.80 C ATOM 898 C GLN A1084 14.474 17.074 29.866 1.00 29.31 C ATOM 899 O GLN A1084 13.818 17.518 30.802 1.00 28.83 O ATOM 900 CB GLN A1084 13.649 15.099 28.539 1.00 30.73 C ATOM 901 CG GLN A1084 12.833 14.494 29.683 1.00 32.39 C ATOM 902 CD GLN A1084 11.361 14.892 29.653 1.00 34.29 C ATOM 903 OE1 GLN A1084 10.754 15.003 28.586 1.00 35.55 O ATOM 904 NE2 GLN A1084 10.777 15.090 30.831 1.00 34.50 N ATOM 905 N MET A1085 15.796 16.950 29.913 1.00 28.54 N ATOM 906 CA MET A1085 16.548 17.351 31.098 1.00 28.16 C ATOM 907 C MET A1085 16.433 18.851 31.319 1.00 26.68 C ATOM 908 O MET A1085 16.256 19.314 32.447 1.00 25.69 O ATOM 909 CB MET A1085 18.020 16.971 30.957 1.00 29.48 C ATOM 910 CG MET A1085 18.262 15.476 30.997 1.00 31.03 C ATOM 911 SD MET A1085 19.989 15.097 31.283 1.00 35.66 S ATOM 912 CE MET A1085 20.646 15.318 29.654 1.00 34.45 C ATOM 913 N ALA A1086 16.531 19.605 30.231 1.00 25.68 N ATOM 914 CA ALA A1086 16.436 21.053 30.300 1.00 25.06 C ATOM 915 C ALA A1086 15.079 21.459 30.859 1.00 24.78 C ATOM 916 O ALA A1086 14.977 22.373 31.676 1.00 24.75 O ATOM 917 CB ALA A1086 16.622 21.649 28.914 1.00 24.11 C ATOM 918 N GLY A1087 14.034 20.773 30.411 1.00 24.46 N ATOM 919 CA GLY A1087 12.695 21.098 30.865 1.00 23.43 C ATOM 920 C GLY A1087 12.463 20.798 32.329 1.00 22.99 C ATOM 921 O GLY A1087 11.788 21.559 33.024 1.00 23.28 O ATOM 922 N GLU A1088 13.013 19.683 32.799 1.00 22.82 N ATOM 923 CA GLU A1088 12.854 19.283 34.192 1.00 22.14 C ATOM 924 C GLU A1088 13.580 20.263 35.117 1.00 22.13 C ATOM 925 O GLU A1088 13.031 20.686 36.136 1.00 20.88 O ATOM 926 CB GLU A1088 13.375 17.855 34.375 1.00 22.81 C ATOM 927 CG GLU A1088 12.690 16.850 33.435 1.00 25.10 C ATOM 928 CD GLU A1088 13.232 15.434 33.559 1.00 26.12 C ATOM 929 OE1 GLU A1088 14.452 15.277 33.769 1.00 25.99 O ATOM 930 OE2 GLU A1088 12.438 14.476 33.424 1.00 25.70 O ATOM 931 N ILE A1089 14.806 20.627 34.753 1.00 20.22 N ATOM 932 CA ILE A1089 15.599 21.563 35.546 1.00 20.98 C ATOM 933 C ILE A1089 14.917 22.927 35.600 1.00 21.22 C ATOM 934 O ILE A1089 14.838 23.554 36.663 1.00 22.10 O ATOM 935 CB ILE A1089 17.016 21.754 34.940 1.00 20.69 C ATOM 936 CG1 ILE A1089 17.795 20.433 35.011 1.00 20.64 C ATOM 937 CG2 ILE A1089 17.749 22.866 35.681 1.00 18.72 C ATOM 938 CD1 ILE A1089 19.100 20.431 34.215 1.00 19.57 C ATOM 939 N ALA A1090 14.429 23.377 34.447 1.00 19.87 N ATOM 940 CA ALA A1090 13.747 24.663 34.344 1.00 20.24 C ATOM 941 C ALA A1090 12.449 24.646 35.152 1.00 19.68 C ATOM 942 O ALA A1090 12.062 25.660 35.728 1.00 20.08 O ATOM 943 CB ALA A1090 13.452 24.989 32.875 1.00 19.78 C ATOM 944 N ASP A1091 11.781 23.497 35.200 1.00 20.03 N ATOM 945 CA ASP A1091 10.535 23.396 35.961 1.00 20.16 C ATOM 946 C ASP A1091 10.836 23.518 37.457 1.00 19.57 C ATOM 947 O ASP A1091 10.134 24.215 38.186 1.00 19.64 O ATOM 948 CB ASP A1091 9.822 22.066 35.680 1.00 18.81 C ATOM 949 CG ASP A1091 8.399 22.041 36.231 1.00 21.37 C ATOM 950 OD1 ASP A1091 7.581 22.884 35.807 1.00 21.94 O ATOM 951 OD2 ASP A1091 8.094 21.189 37.091 1.00 22.30 O ATOM 952 N GLY A1092 11.884 22.838 37.913 1.00 18.41 N ATOM 953 CA GLY A1092 12.243 22.920 39.317 1.00 17.43 C ATOM 954 C GLY A1092 12.625 24.346 39.673 1.00 17.88 C ATOM 955 O GLY A1092 12.257 24.853 40.740 1.00 17.91 O ATOM 956 N MET A1093 13.360 25.002 38.778 1.00 17.50 N ATOM 957 CA MET A1093 13.785 26.379 39.008 1.00 18.03 C ATOM 958 C MET A1093 12.584 27.318 38.968 1.00 19.25 C ATOM 959 O MET A1093 12.497 28.251 39.762 1.00 20.32 O ATOM 960 CB MET A1093 14.820 26.800 37.967 1.00 17.76 C ATOM 961 CG MET A1093 16.170 26.087 38.113 1.00 19.10 C ATOM 962 SD MET A1093 16.909 26.353 39.738 1.00 20.39 S ATOM 963 CE MET A1093 17.132 28.154 39.709 1.00 21.07 C ATOM 964 N ALA A1094 11.654 27.074 38.048 1.00 19.76 N ATOM 965 CA ALA A1094 10.456 27.909 37.969 1.00 20.51 C ATOM 966 C ALA A1094 9.725 27.831 39.311 1.00 21.07 C ATOM 967 O ALA A1094 9.256 28.844 39.834 1.00 21.81 O ATOM 968 CB ALA A1094 9.548 27.424 36.840 1.00 19.84 C ATOM 969 N TYR A1095 9.639 26.622 39.865 1.00 21.19 N ATOM 970 CA TYR A1095 8.986 26.402 41.154 1.00 21.83 C ATOM 971 C TYR A1095 9.698 27.224 42.229 1.00 23.46 C ATOM 972 O TYR A1095 9.068 27.957 43.002 1.00 22.56 O ATOM 973 CB TYR A1095 9.035 24.913 41.534 1.00 21.54 C ATOM 974 CG TYR A1095 8.518 24.628 42.934 1.00 22.93 C ATOM 975 CD1 TYR A1095 7.149 24.607 43.207 1.00 23.33 C ATOM 976 CD2 TYR A1095 9.400 24.436 43.996 1.00 23.82 C ATOM 977 CE1 TYR A1095 6.672 24.405 44.505 1.00 23.48 C ATOM 978 CE2 TYR A1095 8.934 24.232 45.301 1.00 24.47 C ATOM 979 CZ TYR A1095 7.568 24.219 45.544 1.00 24.72 C ATOM 980 OH TYR A1095 7.107 24.015 46.827 1.00 25.67 O ATOM 981 N LEU A1096 11.019 27.093 42.272 1.00 23.30 N ATOM 982 CA LEU A1096 11.829 27.823 43.236 1.00 24.83 C ATOM 983 C LEU A1096 11.595 29.332 43.129 1.00 24.52 C ATOM 984 O LEU A1096 11.273 29.988 44.120 1.00 24.89 O ATOM 985 CB LEU A1096 13.311 27.507 43.011 1.00 24.65 C ATOM 986 CG LEU A1096 14.014 26.598 44.021 1.00 27.42 C ATOM 987 CD1 LEU A1096 13.142 25.417 44.390 1.00 27.26 C ATOM 988 CD2 LEU A1096 15.342 26.142 43.434 1.00 27.69 C ATOM 989 N ASN A1097 11.754 29.877 41.926 1.00 25.01 N ATOM 990 CA ASN A1097 11.564 31.310 41.700 1.00 25.09 C ATOM 991 C ASN A1097 10.128 31.760 42.022 1.00 26.02 C ATOM 992 O ASN A1097 9.914 32.864 42.532 1.00 25.13 O ATOM 993 CB ASN A1097 11.913 31.675 40.243 1.00 24.95 C ATOM 994 CG ASN A1097 13.427 31.694 39.970 1.00 26.01 C ATOM 995 OD1 ASN A1097 13.856 31.926 38.839 1.00 24.41 O ATOM 996 ND2 ASN A1097 14.232 31.458 41.004 1.00 23.19 N ATOM 997 N ALA A1098 9.152 30.904 41.727 1.00 26.74 N ATOM 998 CA ALA A1098 7.750 31.223 41.991 1.00 27.75 C ATOM 999 C ALA A1098 7.509 31.376 43.492 1.00 29.50 C ATOM 1000 O ALA A1098 6.645 32.142 43.919 1.00 29.69 O ATOM 1001 CB ALA A1098 6.851 30.144 41.427 1.00 26.95 C ATOM 1002 N ASN A1099 8.271 30.644 44.294 1.00 30.13 N ATOM 1003 CA ASN A1099 8.129 30.748 45.736 1.00 30.23 C ATOM 1004 C ASN A1099 9.059 31.808 46.312 1.00 29.27 C ATOM 1005 O ASN A1099 9.296 31.857 47.518 1.00 28.65 O ATOM 1006 CB ASN A1099 8.377 29.397 46.397 1.00 32.56 C ATOM 1007 CG ASN A1099 7.246 28.418 46.144 1.00 34.58 C ATOM 1008 OD1 ASN A1099 7.170 27.783 45.086 1.00 34.70 O ATOM 1009 ND2 ASN A1099 6.343 28.310 47.109 1.00 35.43 N ATOM 1010 N LYS A1100 9.584 32.657 45.437 1.00 29.47 N ATOM 1011 CA LYS A1100 10.465 33.743 45.849 1.00 29.75 C ATOM 1012 C LYS A1100 11.808 33.318 46.435 1.00 29.10 C ATOM 1013 O LYS A1100 12.260 33.857 47.450 1.00 28.76 O ATOM 1014 CB LYS A1100 9.728 34.660 46.836 1.00 32.12 C ATOM 1015 CG LYS A1100 8.564 35.413 46.203 1.00 34.99 C ATOM 1016 CD LYS A1100 9.064 36.316 45.079 1.00 36.91 C ATOM 1017 CE LYS A1100 7.919 37.041 44.378 1.00 40.08 C ATOM 1018 NZ LYS A1100 8.427 37.966 43.318 1.00 41.72 N ATOM 1019 N PHE A1101 12.443 32.346 45.792 1.00 27.72 N ATOM 1020 CA PHE A1101 13.756 31.888 46.220 1.00 26.30 C ATOM 1021 C PHE A1101 14.692 31.990 45.028 1.00 25.67 C ATOM 1022 O PHE A1101 14.314 31.655 43.903 1.00 25.05 O ATOM 1023 CB PHE A1101 13.711 30.426 46.686 1.00 27.38 C ATOM 1024 CG PHE A1101 13.132 30.237 48.060 1.00 28.93 C ATOM 1025 CD1 PHE A1101 13.920 30.418 49.191 1.00 28.95 C ATOM 1026 CD2 PHE A1101 11.795 29.883 48.223 1.00 29.91 C ATOM 1027 CE1 PHE A1101 13.388 30.248 50.472 1.00 29.44 C ATOM 1028 CE2 PHE A1101 11.250 29.712 49.501 1.00 31.10 C ATOM 1029 CZ PHE A1101 12.055 29.896 50.627 1.00 29.58 C ATOM 1030 N VAL A1102 15.906 32.464 45.267 1.00 23.89 N ATOM 1031 CA VAL A1102 16.892 32.526 44.205 1.00 22.46 C ATOM 1032 C VAL A1102 17.889 31.440 44.601 1.00 22.33 C ATOM 1033 O VAL A1102 18.403 31.437 45.725 1.00 20.73 O ATOM 1034 CB VAL A1102 17.568 33.918 44.118 1.00 22.76 C ATOM 1035 CG1 VAL A1102 18.166 34.316 45.463 1.00 22.31 C ATOM 1036 CG2 VAL A1102 18.621 33.904 43.031 1.00 23.77 C ATOM 1037 N HIS A1103 18.151 30.512 43.685 1.00 20.22 N ATOM 1038 CA HIS A1103 19.051 29.404 43.976 1.00 20.83 C ATOM 1039 C HIS A1103 20.514 29.825 44.153 1.00 20.79 C ATOM 1040 O HIS A1103 21.160 29.427 45.121 1.00 21.47 O ATOM 1041 CB HIS A1103 18.908 28.340 42.889 1.00 20.83 C ATOM 1042 CG HIS A1103 19.588 27.049 43.222 1.00 21.83 C ATOM 1043 ND1 HIS A1103 20.956 26.895 43.175 1.00 22.48 N ATOM 1044 CD2 HIS A1103 19.086 25.856 43.618 1.00 22.08 C ATOM 1045 CE1 HIS A1103 21.270 25.658 43.525 1.00 21.60 C ATOM 1046 NE2 HIS A1103 20.153 25.008 43.800 1.00 21.83 N ATOM 1047 N ARG A1104 21.024 30.627 43.220 1.00 21.21 N ATOM 1048 CA ARG A1104 22.392 31.154 43.262 1.00 21.05 C ATOM 1049 C ARG A1104 23.539 30.191 42.966 1.00 20.65 C ATOM 1050 O ARG A1104 24.678 30.627 42.802 1.00 20.84 O ATOM 1051 CB ARG A1104 22.659 31.825 44.621 1.00 21.75 C ATOM 1052 CG ARG A1104 21.754 33.017 44.925 1.00 24.07 C ATOM 1053 CD ARG A1104 22.111 33.642 46.266 1.00 24.62 C ATOM 1054 NE ARG A1104 23.485 34.123 46.265 1.00 24.77 N ATOM 1055 CZ ARG A1104 24.370 33.886 47.229 1.00 25.33 C ATOM 1056 NH1 ARG A1104 24.034 33.167 48.294 1.00 26.22 N ATOM 1057 NH2 ARG A1104 25.599 34.363 47.118 1.00 24.33 N ATOM 1058 N ASP A1105 23.267 28.893 42.895 1.00 19.35 N ATOM 1059 CA ASP A1105 24.346 27.951 42.632 1.00 19.45 C ATOM 1060 C ASP A1105 23.889 26.840 41.697 1.00 20.19 C ATOM 1061 O ASP A1105 24.210 25.667 41.893 1.00 19.31 O ATOM 1062 CB ASP A1105 24.869 27.382 43.964 1.00 20.07 C ATOM 1063 CG ASP A1105 26.205 26.643 43.817 1.00 20.66 C ATOM 1064 OD1 ASP A1105 26.875 26.796 42.775 1.00 20.03 O ATOM 1065 OD2 ASP A1105 26.594 25.919 44.757 1.00 20.30 O ATOM 1066 N LEU A1106 23.135 27.222 40.668 1.00 19.82 N ATOM 1067 CA LEU A1106 22.657 26.254 39.692 1.00 19.39 C ATOM 1068 C LEU A1106 23.838 25.815 38.830 1.00 18.29 C ATOM 1069 O LEU A1106 24.543 26.639 38.250 1.00 17.57 O ATOM 1070 CB LEU A1106 21.555 26.860 38.819 1.00 18.64 C ATOM 1071 CG LEU A1106 21.020 25.979 37.684 1.00 20.68 C ATOM 1072 CD1 LEU A1106 20.622 24.607 38.216 1.00 21.87 C ATOM 1073 CD2 LEU A1106 19.828 26.670 37.032 1.00 20.55 C ATOM 1074 N ALA A1107 24.037 24.506 38.761 1.00 17.03 N ATOM 1075 CA ALA A1107 25.139 23.908 38.011 1.00 18.44 C ATOM 1076 C ALA A1107 24.837 22.426 37.939 1.00 19.60 C ATOM 1077 O ALA A1107 24.084 21.911 38.763 1.00 20.20 O ATOM 1078 CB ALA A1107 26.462 24.125 38.753 1.00 16.52 C ATOM 1079 N ALA A1108 25.418 21.736 36.964 1.00 20.79 N ATOM 1080 CA ALA A1108 25.172 20.309 36.833 1.00 20.95 C ATOM 1081 C ALA A1108 25.508 19.567 38.130 1.00 21.25 C ATOM 1082 O ALA A1108 24.810 18.626 38.509 1.00 22.28 O ATOM 1083 CB ALA A1108 25.975 19.741 35.672 1.00 20.34 C ATOM 1084 N ARG A1109 26.566 19.988 38.816 1.00 21.09 N ATOM 1085 CA ARG A1109 26.962 19.324 40.055 1.00 21.19 C ATOM 1086 C ARG A1109 25.883 19.413 41.135 1.00 21.92 C ATOM 1087 O ARG A1109 25.891 18.629 42.086 1.00 21.98 O ATOM 1088 CB ARG A1109 28.263 19.929 40.599 1.00 22.23 C ATOM 1089 CG ARG A1109 28.138 21.407 40.964 1.00 20.07 C ATOM 1090 CD ARG A1109 29.361 21.943 41.695 1.00 18.83 C ATOM 1091 NE ARG A1109 29.197 23.382 41.899 1.00 19.11 N ATOM 1092 CZ ARG A1109 29.396 24.290 40.951 1.00 19.03 C ATOM 1093 NH1 ARG A1109 29.788 23.904 39.741 1.00 16.64 N ATOM 1094 NH2 ARG A1109 29.159 25.576 41.198 1.00 17.41 N ATOM 1095 N ASN A1110 24.954 20.356 40.995 1.00 21.57 N ATOM 1096 CA ASN A1110 23.917 20.519 42.005 1.00 21.89 C ATOM 1097 C ASN A1110 22.544 19.968 41.644 1.00 22.65 C ATOM 1098 O ASN A1110 21.580 20.138 42.396 1.00 22.59 O ATOM 1099 CB ASN A1110 23.836 21.994 42.433 1.00 21.22 C ATOM 1100 CG ASN A1110 25.051 22.416 43.249 1.00 21.91 C ATOM 1101 OD1 ASN A1110 25.549 21.640 44.054 1.00 20.62 O ATOM 1102 ND2 ASN A1110 25.528 23.644 43.049 1.00 21.03 N ATOM 1103 N CYS A1111 22.468 19.306 40.492 1.00 22.41 N ATOM 1104 CA CYS A1111 21.242 18.664 40.035 1.00 22.34 C ATOM 1105 C CYS A1111 21.507 17.180 40.255 1.00 22.82 C ATOM 1106 O CYS A1111 22.661 16.761 40.207 1.00 21.48 O ATOM 1107 CB CYS A1111 21.005 18.927 38.546 1.00 22.08 C ATOM 1108 SG CYS A1111 20.684 20.664 38.138 1.00 22.48 S ATOM 1109 N MET A1112 20.454 16.399 40.498 1.00 23.07 N ATOM 1110 CA MET A1112 20.586 14.957 40.731 1.00 23.64 C ATOM 1111 C MET A1112 19.743 14.184 39.720 1.00 23.87 C ATOM 1112 O MET A1112 18.804 14.729 39.139 1.00 22.59 O ATOM 1113 CB MET A1112 20.123 14.591 42.144 1.00 24.75 C ATOM 1114 CG MET A1112 20.901 15.234 43.287 1.00 28.40 C ATOM 1115 SD MET A1112 22.628 14.708 43.397 1.00 33.90 S ATOM 1116 CE MET A1112 22.449 13.151 44.242 1.00 32.77 C ATOM 1117 N VAL A1113 20.077 12.912 39.519 1.00 23.78 N ATOM 1118 CA VAL A1113 19.355 12.072 38.567 1.00 24.23 C ATOM 1119 C VAL A1113 18.743 10.855 39.263 1.00 24.40 C ATOM 1120 O VAL A1113 19.441 10.088 39.929 1.00 23.04 O ATOM 1121 CB VAL A1113 20.299 11.607 37.433 1.00 25.15 C ATOM 1122 CG1 VAL A1113 19.536 10.785 36.407 1.00 25.83 C ATOM 1123 CG2 VAL A1113 20.935 12.826 36.770 1.00 25.48 C ATOM 1124 N ALA A1114 17.434 10.692 39.100 1.00 24.74 N ATOM 1125 CA ALA A1114 16.706 9.591 39.712 1.00 25.51 C ATOM 1126 C ALA A1114 16.862 8.308 38.904 1.00 26.94 C ATOM 1127 O ALA A1114 17.408 8.319 37.794 1.00 27.03 O ATOM 1128 CB ALA A1114 15.222 9.955 39.837 1.00 24.11 C ATOM 1129 N GLU A1115 16.380 7.200 39.463 1.00 28.23 N ATOM 1130 CA GLU A1115 16.470 5.913 38.780 1.00 29.39 C ATOM 1131 C GLU A1115 15.940 6.005 37.351 1.00 29.85 C ATOM 1132 O GLU A1115 16.603 5.570 36.410 1.00 31.27 O ATOM 1133 CB GLU A1115 15.689 4.835 39.543 1.00 29.73 C ATOM 1134 CG GLU A1115 15.680 3.486 38.832 1.00 31.53 C ATOM 1135 CD GLU A1115 17.054 2.834 38.781 1.00 32.47 C ATOM 1136 OE1 GLU A1115 17.287 2.009 37.867 1.00 33.75 O ATOM 1137 OE2 GLU A1115 17.895 3.131 39.659 1.00 32.29 O ATOM 1138 N ASP A1116 14.750 6.574 37.188 1.00 30.26 N ATOM 1139 CA ASP A1116 14.154 6.696 35.864 1.00 31.33 C ATOM 1140 C ASP A1116 14.726 7.838 35.024 1.00 31.31 C ATOM 1141 O ASP A1116 14.110 8.253 34.044 1.00 31.61 O ATOM 1142 CB ASP A1116 12.630 6.847 35.975 1.00 32.10 C ATOM 1143 CG ASP A1116 12.207 8.149 36.636 1.00 33.78 C ATOM 1144 OD1 ASP A1116 13.086 8.976 36.964 1.00 34.04 O ATOM 1145 OD2 ASP A1116 10.985 8.344 36.827 1.00 33.69 O ATOM 1146 N PHE A1117 15.898 8.338 35.415 1.00 31.74 N ATOM 1147 CA PHE A1117 16.586 9.423 34.703 1.00 30.88 C ATOM 1148 C PHE A1117 16.012 10.830 34.848 1.00 29.97 C ATOM 1149 O PHE A1117 16.469 11.765 34.183 1.00 30.59 O ATOM 1150 CB PHE A1117 16.713 9.073 33.218 1.00 31.73 C ATOM 1151 CG PHE A1117 17.608 7.900 32.961 1.00 32.33 C ATOM 1152 CD1 PHE A1117 18.981 8.009 33.143 1.00 32.68 C ATOM 1153 CD2 PHE A1117 17.076 6.676 32.577 1.00 33.60 C ATOM 1154 CE1 PHE A1117 19.816 6.915 32.949 1.00 33.11 C ATOM 1155 CE2 PHE A1117 17.901 5.571 32.380 1.00 33.23 C ATOM 1156 CZ PHE A1117 19.276 5.694 32.566 1.00 33.90 C ATOM 1157 N THR A1118 15.016 10.990 35.707 1.00 28.01 N ATOM 1158 CA THR A1118 14.442 12.313 35.929 1.00 26.47 C ATOM 1159 C THR A1118 15.514 13.188 36.602 1.00 25.65 C ATOM 1160 O THR A1118 16.201 12.741 37.520 1.00 24.72 O ATOM 1161 CB THR A1118 13.218 12.243 36.860 1.00 26.29 C ATOM 1162 OG1 THR A1118 12.186 11.460 36.242 1.00 26.39 O ATOM 1163 CG2 THR A1118 12.690 13.643 37.150 1.00 24.34 C ATOM 1164 N VAL A1119 15.657 14.429 36.148 1.00 24.72 N ATOM 1165 CA VAL A1119 16.645 15.337 36.734 1.00 24.06 C ATOM 1166 C VAL A1119 15.931 16.268 37.717 1.00 23.41 C ATOM 1167 O VAL A1119 14.821 16.723 37.447 1.00 23.73 O ATOM 1168 CB VAL A1119 17.352 16.190 35.644 1.00 24.07 C ATOM 1169 CG1 VAL A1119 18.417 17.080 36.287 1.00 24.18 C ATOM 1170 CG2 VAL A1119 17.998 15.273 34.597 1.00 24.82 C ATOM 1171 N LYS A1120 16.563 16.544 38.854 1.00 23.15 N ATOM 1172 CA LYS A1120 15.971 17.419 39.867 1.00 23.75 C ATOM 1173 C LYS A1120 17.011 18.320 40.526 1.00 24.39 C ATOM 1174 O LYS A1120 18.186 17.944 40.643 1.00 24.12 O ATOM 1175 CB LYS A1120 15.286 16.588 40.962 1.00 23.59 C ATOM 1176 CG LYS A1120 14.268 15.572 40.450 1.00 23.89 C ATOM 1177 CD LYS A1120 13.539 14.890 41.598 1.00 24.50 C ATOM 1178 CE LYS A1120 12.626 13.796 41.063 1.00 25.14 C ATOM 1179 NZ LYS A1120 11.696 13.274 42.092 1.00 24.84 N ATOM 1180 N ILE A1121 16.571 19.505 40.954 1.00 23.48 N ATOM 1181 CA ILE A1121 17.439 20.462 41.641 1.00 25.09 C ATOM 1182 C ILE A1121 17.710 19.841 43.013 1.00 25.54 C ATOM 1183 O ILE A1121 16.764 19.509 43.730 1.00 24.51 O ATOM 1184 CB ILE A1121 16.721 21.813 41.834 1.00 24.80 C ATOM 1185 CG1 ILE A1121 16.148 22.289 40.495 1.00 24.18 C ATOM 1186 CG2 ILE A1121 17.680 22.829 42.438 1.00 26.21 C ATOM 1187 CD1 ILE A1121 17.146 22.305 39.342 1.00 24.02 C ATOM 1188 N GLY A1122 18.977 19.690 43.391 1.00 26.26 N ATOM 1189 CA GLY A1122 19.251 19.027 44.658 1.00 29.63 C ATOM 1190 C GLY A1122 20.141 19.584 45.758 1.00 32.10 C ATOM 1191 O GLY A1122 20.239 18.955 46.823 1.00 35.77 O ATOM 1192 N ASP A1123 20.803 20.715 45.535 1.00 30.67 N ATOM 1193 CA ASP A1123 21.655 21.300 46.571 1.00 30.46 C ATOM 1194 C ASP A1123 21.189 22.744 46.729 1.00 29.67 C ATOM 1195 O ASP A1123 21.030 23.444 45.737 1.00 31.35 O ATOM 1196 CB ASP A1123 23.132 21.273 46.150 1.00 31.20 C ATOM 1197 CG ASP A1123 24.077 21.614 47.302 1.00 33.97 C ATOM 1198 OD1 ASP A1123 24.497 20.680 48.027 1.00 36.06 O ATOM 1199 OD2 ASP A1123 24.391 22.811 47.498 1.00 32.13 O ATOM 1200 N PHE A1124 20.969 23.188 47.962 1.00 28.63 N ATOM 1201 CA PHE A1124 20.489 24.549 48.198 1.00 28.36 C ATOM 1202 C PHE A1124 21.369 25.328 49.161 1.00 27.22 C ATOM 1203 O PHE A1124 20.891 26.202 49.880 1.00 26.52 O ATOM 1204 CB PHE A1124 19.056 24.486 48.728 1.00 29.29 C ATOM 1205 CG PHE A1124 18.145 23.676 47.857 1.00 30.50 C ATOM 1206 CD1 PHE A1124 17.588 24.229 46.707 1.00 31.13 C ATOM 1207 CD2 PHE A1124 17.914 22.334 48.135 1.00 30.08 C ATOM 1208 CE1 PHE A1124 16.815 23.449 45.843 1.00 30.62 C ATOM 1209 CE2 PHE A1124 17.148 21.550 47.279 1.00 30.60 C ATOM 1210 CZ PHE A1124 16.599 22.107 46.133 1.00 29.59 C ATOM 1211 N GLY A1125 22.658 25.010 49.158 1.00 26.48 N ATOM 1212 CA GLY A1125 23.588 25.671 50.053 1.00 27.04 C ATOM 1213 C GLY A1125 23.627 27.184 49.958 1.00 27.00 C ATOM 1214 O GLY A1125 23.889 27.844 50.956 1.00 28.24 O ATOM 1215 N MET A1126 23.360 27.742 48.779 1.00 26.36 N ATOM 1216 CA MET A1126 23.404 29.194 48.605 1.00 26.38 C ATOM 1217 C MET A1126 22.044 29.839 48.351 1.00 26.17 C ATOM 1218 O MET A1126 21.961 31.047 48.120 1.00 25.93 O ATOM 1219 CB MET A1126 24.362 29.544 47.457 1.00 26.71 C ATOM 1220 CG MET A1126 25.823 29.224 47.750 1.00 26.48 C ATOM 1221 SD MET A1126 26.935 29.516 46.352 1.00 25.11 S ATOM 1222 CE MET A1126 26.534 31.258 45.914 1.00 27.70 C ATOM 1223 N THR A1127 20.987 29.035 48.395 1.00 25.44 N ATOM 1224 CA THR A1127 19.628 29.519 48.155 1.00 25.77 C ATOM 1225 C THR A1127 19.203 30.585 49.160 1.00 26.86 C ATOM 1226 O THR A1127 19.430 30.448 50.365 1.00 26.41 O ATOM 1227 CB THR A1127 18.616 28.350 48.196 1.00 24.49 C ATOM 1228 OG1 THR A1127 18.958 27.390 47.187 1.00 23.51 O ATOM 1229 CG2 THR A1127 17.197 28.851 47.949 1.00 24.91 C ATOM 1230 N ARG A1128 18.578 31.647 48.656 1.00 27.56 N ATOM 1231 CA ARG A1128 18.131 32.748 49.497 1.00 29.70 C ATOM 1232 C ARG A1128 16.701 33.194 49.211 1.00 30.71 C ATOM 1233 O ARG A1128 16.251 33.224 48.067 1.00 28.23 O ATOM 1234 CB ARG A1128 19.056 33.956 49.317 1.00 30.44 C ATOM 1235 CG ARG A1128 20.480 33.733 49.775 1.00 31.81 C ATOM 1236 CD ARG A1128 20.565 33.720 51.297 1.00 34.73 C ATOM 1237 NE ARG A1128 21.938 33.543 51.759 1.00 35.75 N ATOM 1238 CZ ARG A1128 22.593 32.389 51.733 1.00 37.51 C ATOM 1239 NH1 ARG A1128 21.999 31.297 51.273 1.00 37.95 N ATOM 1240 NH2 ARG A1128 23.849 32.329 52.156 1.00 38.13 N ATOM 1241 N ASP A1129 15.993 33.549 50.272 1.00 32.00 N ATOM 1242 CA ASP A1129 14.629 34.028 50.142 1.00 34.71 C ATOM 1243 C ASP A1129 14.685 35.470 49.626 1.00 34.74 C ATOM 1244 O ASP A1129 15.422 36.291 50.162 1.00 34.82 O ATOM 1245 CB ASP A1129 13.942 33.950 51.508 1.00 36.26 C ATOM 1246 CG ASP A1129 12.658 34.733 51.559 1.00 38.18 C ATOM 1247 OD1 ASP A1129 11.850 34.629 50.613 1.00 38.45 O ATOM 1248 OD2 ASP A1129 12.458 35.449 52.560 1.00 40.73 O ATOM 1249 N ILE A1130 13.921 35.772 48.579 1.00 35.41 N ATOM 1250 CA ILE A1130 13.897 37.122 48.006 1.00 36.11 C ATOM 1251 C ILE A1130 12.477 37.691 47.982 1.00 37.60 C ATOM 1252 O ILE A1130 12.165 38.588 47.196 1.00 37.46 O ATOM 1253 CB ILE A1130 14.440 37.139 46.555 1.00 35.24 C ATOM 1254 CG1 ILE A1130 13.631 36.170 45.687 1.00 34.42 C ATOM 1255 CG2 ILE A1130 15.921 36.788 46.546 1.00 34.41 C ATOM 1256 CD1 ILE A1130 13.893 36.295 44.191 1.00 33.92 C HETATM 1257 N PTR A1131 11.623 37.159 48.845 1.00 39.53 N HETATM 1258 CA PTR A1131 10.237 37.596 48.927 1.00 42.03 C HETATM 1259 C PTR A1131 10.094 39.112 49.040 1.00 42.46 C HETATM 1260 O PTR A1131 9.355 39.738 48.278 1.00 41.84 O HETATM 1261 CB PTR A1131 9.567 36.929 50.130 1.00 45.24 C HETATM 1262 CG PTR A1131 8.171 37.424 50.425 1.00 49.18 C HETATM 1263 CD1 PTR A1131 7.139 37.257 49.503 1.00 51.15 C HETATM 1264 CD2 PTR A1131 7.879 38.051 51.637 1.00 50.90 C HETATM 1265 CE1 PTR A1131 5.846 37.702 49.781 1.00 53.14 C HETATM 1266 CE2 PTR A1131 6.593 38.497 51.925 1.00 53.22 C HETATM 1267 CZ PTR A1131 5.581 38.320 50.996 1.00 54.72 C HETATM 1268 OH PTR A1131 4.311 38.762 51.305 1.00 58.56 O HETATM 1269 P PTR A1131 2.960 38.800 50.371 1.00 61.12 P HETATM 1270 O1P PTR A1131 3.314 39.751 49.278 1.00 60.54 O HETATM 1271 O2P PTR A1131 1.955 39.295 51.345 1.00 60.74 O HETATM 1272 O3P PTR A1131 2.773 37.387 49.932 1.00 60.89 O ATOM 1273 N GLU A1132 10.808 39.697 49.992 1.00 42.33 N ATOM 1274 CA GLU A1132 10.731 41.131 50.225 1.00 43.58 C ATOM 1275 C GLU A1132 11.323 42.044 49.150 1.00 43.59 C ATOM 1276 O GLU A1132 10.659 42.977 48.701 1.00 44.46 O ATOM 1277 CB GLU A1132 11.374 41.468 51.576 1.00 43.91 C ATOM 1278 N THR A1133 12.558 41.780 48.731 1.00 42.98 N ATOM 1279 CA THR A1133 13.220 42.647 47.760 1.00 42.14 C ATOM 1280 C THR A1133 13.437 42.143 46.334 1.00 41.86 C ATOM 1281 O THR A1133 13.878 42.907 45.480 1.00 41.49 O ATOM 1282 CB THR A1133 14.594 43.084 48.291 1.00 42.52 C ATOM 1283 OG1 THR A1133 15.448 41.938 48.389 1.00 42.13 O ATOM 1284 CG2 THR A1133 14.457 43.718 49.668 1.00 42.30 C ATOM 1285 N ASP A1134 13.143 40.874 46.070 1.00 41.46 N ATOM 1286 CA ASP A1134 13.336 40.322 44.730 1.00 41.09 C ATOM 1287 C ASP A1134 14.797 40.169 44.323 1.00 40.14 C ATOM 1288 O ASP A1134 15.094 39.918 43.153 1.00 38.86 O ATOM 1289 CB ASP A1134 12.627 41.181 43.681 1.00 42.10 C ATOM 1290 CG ASP A1134 11.215 40.717 43.405 1.00 42.65 C ATOM 1291 OD1 ASP A1134 10.504 41.418 42.657 1.00 43.77 O ATOM 1292 OD2 ASP A1134 10.820 39.651 43.927 1.00 44.33 O HETATM 1293 N PTR A1135 15.711 40.325 45.272 1.00 39.19 N HETATM 1294 CA PTR A1135 17.123 40.169 44.959 1.00 39.21 C HETATM 1295 C PTR A1135 17.918 39.888 46.214 1.00 39.09 C HETATM 1296 O PTR A1135 17.431 40.089 47.327 1.00 37.71 O HETATM 1297 CB PTR A1135 17.671 41.423 44.256 1.00 40.73 C HETATM 1298 CG PTR A1135 17.998 42.595 45.169 1.00 42.86 C HETATM 1299 CD1 PTR A1135 19.220 42.665 45.839 1.00 43.96 C HETATM 1300 CD2 PTR A1135 17.085 43.631 45.361 1.00 44.31 C HETATM 1301 CE1 PTR A1135 19.527 43.742 46.680 1.00 45.50 C HETATM 1302 CE2 PTR A1135 17.379 44.711 46.199 1.00 45.17 C HETATM 1303 CZ PTR A1135 18.600 44.760 46.855 1.00 45.89 C HETATM 1304 OH PTR A1135 18.887 45.826 47.690 1.00 47.29 O HETATM 1305 P PTR A1135 20.096 46.933 47.510 1.00 47.95 P HETATM 1306 O1P PTR A1135 21.238 46.297 48.213 1.00 46.60 O HETATM 1307 O2P PTR A1135 19.528 48.125 48.200 1.00 48.05 O HETATM 1308 O3P PTR A1135 20.249 47.089 46.043 1.00 46.43 O HETATM 1309 N PTR A1136 19.143 39.411 46.022 1.00 38.73 N HETATM 1310 CA PTR A1136 20.042 39.127 47.128 1.00 39.15 C HETATM 1311 C PTR A1136 21.402 39.693 46.762 1.00 39.90 C HETATM 1312 O PTR A1136 21.923 39.423 45.680 1.00 39.58 O HETATM 1313 CB PTR A1136 20.173 37.621 47.377 1.00 38.50 C HETATM 1314 CG PTR A1136 21.263 37.299 48.381 1.00 38.40 C HETATM 1315 CD1 PTR A1136 21.028 37.389 49.755 1.00 38.33 C HETATM 1316 CD2 PTR A1136 22.549 36.965 47.955 1.00 37.94 C HETATM 1317 CE1 PTR A1136 22.053 37.157 50.677 1.00 39.61 C HETATM 1318 CE2 PTR A1136 23.572 36.734 48.862 1.00 39.51 C HETATM 1319 CZ PTR A1136 23.323 36.831 50.221 1.00 40.38 C HETATM 1320 OH PTR A1136 24.364 36.618 51.100 1.00 42.88 O HETATM 1321 P PTR A1136 24.436 36.484 52.729 1.00 45.09 P HETATM 1322 O1P PTR A1136 23.834 37.747 53.238 1.00 43.98 O HETATM 1323 O2P PTR A1136 25.906 36.362 52.888 1.00 44.77 O HETATM 1324 O3P PTR A1136 23.663 35.270 53.070 1.00 44.10 O ATOM 1325 N ARG A1137 21.974 40.484 47.662 1.00 40.96 N ATOM 1326 CA ARG A1137 23.284 41.074 47.421 1.00 42.17 C ATOM 1327 C ARG A1137 24.293 40.457 48.381 1.00 42.46 C ATOM 1328 O ARG A1137 24.097 40.462 49.598 1.00 42.30 O ATOM 1329 CB ARG A1137 23.245 42.593 47.623 1.00 42.73 C ATOM 1330 CG ARG A1137 24.573 43.290 47.324 1.00 44.62 C ATOM 1331 CD ARG A1137 24.535 44.765 47.715 1.00 45.62 C ATOM 1332 NE ARG A1137 23.571 45.523 46.923 1.00 45.60 N ATOM 1333 CZ ARG A1137 23.775 45.912 45.670 1.00 46.03 C ATOM 1334 NH1 ARG A1137 24.915 45.622 45.060 1.00 46.49 N ATOM 1335 NH2 ARG A1137 22.836 46.589 45.023 1.00 46.81 N ATOM 1336 N LYS A1138 25.371 39.917 47.827 1.00 42.70 N ATOM 1337 CA LYS A1138 26.409 39.302 48.641 1.00 42.66 C ATOM 1338 C LYS A1138 27.364 40.376 49.144 1.00 42.78 C ATOM 1339 O LYS A1138 27.872 41.181 48.364 1.00 41.86 O ATOM 1340 CB LYS A1138 27.181 38.268 47.818 1.00 42.89 C ATOM 1341 CG LYS A1138 28.347 37.632 48.556 1.00 43.04 C ATOM 1342 CD LYS A1138 27.878 36.875 49.786 1.00 44.05 C ATOM 1343 CE LYS A1138 29.066 36.382 50.601 1.00 45.08 C ATOM 1344 NZ LYS A1138 28.634 35.641 51.812 1.00 45.65 N ATOM 1345 N GLY A1139 27.603 40.388 50.450 1.00 43.27 N ATOM 1346 CA GLY A1139 28.506 41.370 51.021 1.00 44.63 C ATOM 1347 C GLY A1139 29.804 40.756 51.517 1.00 45.15 C ATOM 1348 O GLY A1139 29.813 39.642 52.047 1.00 45.65 O ATOM 1349 N GLY A1140 30.907 41.477 51.335 1.00 45.78 N ATOM 1350 CA GLY A1140 32.196 40.986 51.793 1.00 45.89 C ATOM 1351 C GLY A1140 32.851 39.950 50.898 1.00 46.07 C ATOM 1352 O GLY A1140 32.688 39.967 49.675 1.00 46.07 O ATOM 1353 N LYS A1141 33.599 39.043 51.518 1.00 45.30 N ATOM 1354 CA LYS A1141 34.296 37.987 50.792 1.00 44.44 C ATOM 1355 C LYS A1141 33.475 36.704 50.795 1.00 42.66 C ATOM 1356 O LYS A1141 32.599 36.520 51.642 1.00 42.95 O ATOM 1357 CB LYS A1141 35.651 37.700 51.443 1.00 45.50 C ATOM 1358 CG LYS A1141 36.554 38.909 51.590 1.00 47.72 C ATOM 1359 CD LYS A1141 37.865 38.522 52.258 1.00 49.40 C ATOM 1360 CE LYS A1141 38.715 39.744 52.565 1.00 50.57 C ATOM 1361 NZ LYS A1141 39.983 39.370 53.254 1.00 52.71 N ATOM 1362 N GLY A1142 33.767 35.821 49.846 1.00 40.74 N ATOM 1363 CA GLY A1142 33.058 34.558 49.769 1.00 38.78 C ATOM 1364 C GLY A1142 33.561 33.670 48.647 1.00 37.54 C ATOM 1365 O GLY A1142 34.132 34.150 47.666 1.00 37.38 O ATOM 1366 N LEU A1143 33.373 32.365 48.800 1.00 35.89 N ATOM 1367 CA LEU A1143 33.784 31.416 47.772 1.00 34.26 C ATOM 1368 C LEU A1143 32.541 31.229 46.906 1.00 33.66 C ATOM 1369 O LEU A1143 31.576 30.579 47.318 1.00 32.21 O ATOM 1370 CB LEU A1143 34.209 30.089 48.405 1.00 33.34 C ATOM 1371 CG LEU A1143 35.381 30.151 49.394 1.00 33.48 C ATOM 1372 CD1 LEU A1143 35.719 28.738 49.864 1.00 33.87 C ATOM 1373 CD2 LEU A1143 36.593 30.782 48.730 1.00 32.08 C ATOM 1374 N LEU A1144 32.568 31.810 45.711 1.00 32.55 N ATOM 1375 CA LEU A1144 31.427 31.744 44.807 1.00 31.61 C ATOM 1376 C LEU A1144 31.738 31.041 43.500 1.00 29.52 C ATOM 1377 O LEU A1144 32.880 31.043 43.041 1.00 28.87 O ATOM 1378 CB LEU A1144 30.916 33.160 44.524 1.00 32.42 C ATOM 1379 CG LEU A1144 30.440 33.915 45.766 1.00 33.65 C ATOM 1380 CD1 LEU A1144 30.035 35.338 45.399 1.00 34.15 C ATOM 1381 CD2 LEU A1144 29.275 33.172 46.383 1.00 34.78 C ATOM 1382 N PRO A1145 30.711 30.430 42.883 1.00 28.32 N ATOM 1383 CA PRO A1145 30.807 29.697 41.617 1.00 27.00 C ATOM 1384 C PRO A1145 30.961 30.638 40.428 1.00 27.28 C ATOM 1385 O PRO A1145 30.061 30.759 39.592 1.00 26.30 O ATOM 1386 CB PRO A1145 29.501 28.913 41.583 1.00 26.78 C ATOM 1387 CG PRO A1145 28.539 29.875 42.228 1.00 27.57 C ATOM 1388 CD PRO A1145 29.332 30.378 43.412 1.00 27.18 C ATOM 1389 N VAL A1146 32.119 31.294 40.366 1.00 25.54 N ATOM 1390 CA VAL A1146 32.440 32.252 39.314 1.00 26.17 C ATOM 1391 C VAL A1146 32.111 31.863 37.873 1.00 25.07 C ATOM 1392 O VAL A1146 31.586 32.685 37.122 1.00 26.03 O ATOM 1393 CB VAL A1146 33.941 32.646 39.376 1.00 26.12 C ATOM 1394 CG1 VAL A1146 34.366 33.302 38.077 1.00 25.69 C ATOM 1395 CG2 VAL A1146 34.174 33.597 40.541 1.00 26.52 C ATOM 1396 N ARG A1147 32.417 30.628 37.482 1.00 24.22 N ATOM 1397 CA ARG A1147 32.165 30.185 36.110 1.00 23.21 C ATOM 1398 C ARG A1147 30.701 29.933 35.766 1.00 22.32 C ATOM 1399 O ARG A1147 30.383 29.599 34.632 1.00 21.76 O ATOM 1400 CB ARG A1147 32.993 28.933 35.798 1.00 24.37 C ATOM 1401 CG ARG A1147 34.501 29.196 35.798 1.00 24.78 C ATOM 1402 CD ARG A1147 35.329 27.916 35.716 1.00 26.53 C ATOM 1403 NE ARG A1147 36.729 28.177 36.064 1.00 28.56 N ATOM 1404 CZ ARG A1147 37.713 28.353 35.187 1.00 28.84 C ATOM 1405 NH1 ARG A1147 37.471 28.288 33.888 1.00 29.87 N ATOM 1406 NH2 ARG A1147 38.942 28.618 35.612 1.00 30.97 N ATOM 1407 N TRP A1148 29.816 30.101 36.742 1.00 22.02 N ATOM 1408 CA TRP A1148 28.379 29.892 36.535 1.00 22.03 C ATOM 1409 C TRP A1148 27.602 31.191 36.805 1.00 22.08 C ATOM 1410 O TRP A1148 26.384 31.242 36.636 1.00 22.40 O ATOM 1411 CB TRP A1148 27.870 28.781 37.475 1.00 21.28 C ATOM 1412 CG TRP A1148 28.182 27.364 37.015 1.00 21.41 C ATOM 1413 CD1 TRP A1148 27.359 26.536 36.303 1.00 19.85 C ATOM 1414 CD2 TRP A1148 29.423 26.654 37.170 1.00 21.72 C ATOM 1415 NE1 TRP A1148 28.007 25.364 35.999 1.00 22.04 N ATOM 1416 CE2 TRP A1148 29.275 25.409 36.516 1.00 21.25 C ATOM 1417 CE3 TRP A1148 30.645 26.952 37.789 1.00 21.59 C ATOM 1418 CZ2 TRP A1148 30.306 24.460 36.465 1.00 21.60 C ATOM 1419 CZ3 TRP A1148 31.671 26.003 37.735 1.00 21.09 C ATOM 1420 CH2 TRP A1148 31.492 24.775 37.078 1.00 21.30 C ATOM 1421 N MET A1149 28.313 32.236 37.220 1.00 21.95 N ATOM 1422 CA MET A1149 27.696 33.518 37.559 1.00 21.21 C ATOM 1423 C MET A1149 27.503 34.517 36.423 1.00 20.65 C ATOM 1424 O MET A1149 28.342 34.649 35.542 1.00 19.63 O ATOM 1425 CB MET A1149 28.492 34.177 38.685 1.00 21.34 C ATOM 1426 CG MET A1149 28.245 33.556 40.057 1.00 23.81 C ATOM 1427 SD MET A1149 29.563 33.946 41.227 1.00 24.28 S ATOM 1428 CE MET A1149 29.232 35.680 41.536 1.00 22.44 C ATOM 1429 N SER A1150 26.383 35.229 36.459 1.00 20.62 N ATOM 1430 CA SER A1150 26.077 36.221 35.433 1.00 21.91 C ATOM 1431 C SER A1150 27.050 37.398 35.535 1.00 23.22 C ATOM 1432 O SER A1150 27.753 37.558 36.536 1.00 23.28 O ATOM 1433 CB SER A1150 24.648 36.746 35.614 1.00 21.94 C ATOM 1434 OG SER A1150 24.567 37.582 36.757 1.00 20.51 O ATOM 1435 N PRO A1151 27.108 38.231 34.489 1.00 23.80 N ATOM 1436 CA PRO A1151 27.998 39.393 34.488 1.00 24.00 C ATOM 1437 C PRO A1151 27.698 40.346 35.646 1.00 24.99 C ATOM 1438 O PRO A1151 28.615 40.821 36.322 1.00 24.78 O ATOM 1439 CB PRO A1151 27.724 40.026 33.129 1.00 24.25 C ATOM 1440 CG PRO A1151 27.457 38.830 32.270 1.00 23.52 C ATOM 1441 CD PRO A1151 26.538 38.011 33.146 1.00 23.44 C ATOM 1442 N GLU A1152 26.418 40.621 35.882 1.00 26.35 N ATOM 1443 CA GLU A1152 26.044 41.534 36.962 1.00 27.19 C ATOM 1444 C GLU A1152 26.393 40.978 38.342 1.00 27.86 C ATOM 1445 O GLU A1152 26.744 41.738 39.251 1.00 27.76 O ATOM 1446 CB GLU A1152 24.546 41.861 36.907 1.00 27.85 C ATOM 1447 CG GLU A1152 23.627 40.684 37.224 1.00 27.45 C ATOM 1448 CD GLU A1152 23.235 39.891 35.998 1.00 27.50 C ATOM 1449 OE1 GLU A1152 23.916 40.020 34.957 1.00 28.04 O ATOM 1450 OE2 GLU A1152 22.249 39.129 36.078 1.00 26.69 O ATOM 1451 N SER A1153 26.290 39.657 38.502 1.00 27.90 N ATOM 1452 CA SER A1153 26.611 39.014 39.776 1.00 28.81 C ATOM 1453 C SER A1153 28.112 39.096 40.015 1.00 29.24 C ATOM 1454 O SER A1153 28.560 39.363 41.124 1.00 29.44 O ATOM 1455 CB SER A1153 26.187 37.537 39.773 1.00 28.63 C ATOM 1456 OG SER A1153 24.779 37.400 39.738 1.00 27.87 O ATOM 1457 N LEU A1154 28.887 38.857 38.965 1.00 31.33 N ATOM 1458 CA LEU A1154 30.333 38.918 39.082 1.00 32.30 C ATOM 1459 C LEU A1154 30.764 40.343 39.415 1.00 34.21 C ATOM 1460 O LEU A1154 31.722 40.553 40.158 1.00 34.22 O ATOM 1461 CB LEU A1154 30.994 38.483 37.773 1.00 31.82 C ATOM 1462 CG LEU A1154 30.936 37.012 37.353 1.00 31.01 C ATOM 1463 CD1 LEU A1154 31.453 36.882 35.937 1.00 30.51 C ATOM 1464 CD2 LEU A1154 31.760 36.155 38.309 1.00 31.14 C ATOM 1465 N LYS A1155 30.046 41.321 38.871 1.00 35.41 N ATOM 1466 CA LYS A1155 30.396 42.718 39.092 1.00 37.26 C ATOM 1467 C LYS A1155 30.067 43.282 40.474 1.00 37.90 C ATOM 1468 O LYS A1155 30.910 43.930 41.088 1.00 39.01 O ATOM 1469 CB LYS A1155 29.759 43.599 38.012 1.00 38.43 C ATOM 1470 CG LYS A1155 30.502 44.917 37.819 1.00 42.06 C ATOM 1471 CD LYS A1155 29.870 45.811 36.758 1.00 43.61 C ATOM 1472 CE LYS A1155 28.624 46.501 37.285 1.00 46.15 C ATOM 1473 NZ LYS A1155 28.123 47.538 36.335 1.00 46.94 N ATOM 1474 N ASP A1156 28.858 43.050 40.974 1.00 38.49 N ATOM 1475 CA ASP A1156 28.502 43.581 42.287 1.00 39.27 C ATOM 1476 C ASP A1156 27.768 42.629 43.227 1.00 38.06 C ATOM 1477 O ASP A1156 27.036 43.064 44.120 1.00 37.93 O ATOM 1478 CB ASP A1156 27.703 44.879 42.126 1.00 41.62 C ATOM 1479 CG ASP A1156 26.924 44.922 40.835 1.00 44.42 C ATOM 1480 OD1 ASP A1156 26.005 44.091 40.666 1.00 47.33 O ATOM 1481 OD2 ASP A1156 27.240 45.783 39.984 1.00 45.06 O ATOM 1482 N GLY A1157 27.968 41.331 43.020 1.00 36.85 N ATOM 1483 CA GLY A1157 27.353 40.331 43.878 1.00 35.19 C ATOM 1484 C GLY A1157 25.843 40.336 44.027 1.00 33.92 C ATOM 1485 O GLY A1157 25.327 39.908 45.059 1.00 33.36 O ATOM 1486 N VAL A1158 25.127 40.804 43.008 1.00 32.96 N ATOM 1487 CA VAL A1158 23.668 40.825 43.066 1.00 32.37 C ATOM 1488 C VAL A1158 23.104 39.576 42.378 1.00 30.55 C ATOM 1489 O VAL A1158 23.466 39.256 41.243 1.00 30.52 O ATOM 1490 CB VAL A1158 23.099 42.104 42.394 1.00 33.85 C ATOM 1491 CG1 VAL A1158 23.366 42.081 40.902 1.00 34.94 C ATOM 1492 CG2 VAL A1158 21.617 42.225 42.674 1.00 35.56 C ATOM 1493 N PHE A1159 22.222 38.867 43.076 1.00 29.06 N ATOM 1494 CA PHE A1159 21.616 37.654 42.539 1.00 27.66 C ATOM 1495 C PHE A1159 20.103 37.799 42.414 1.00 26.79 C ATOM 1496 O PHE A1159 19.435 38.200 43.359 1.00 25.96 O ATOM 1497 CB PHE A1159 21.942 36.451 43.435 1.00 25.78 C ATOM 1498 CG PHE A1159 23.409 36.099 43.480 1.00 26.78 C ATOM 1499 CD1 PHE A1159 24.306 36.869 44.213 1.00 26.61 C ATOM 1500 CD2 PHE A1159 23.892 34.993 42.789 1.00 25.51 C ATOM 1501 CE1 PHE A1159 25.663 36.542 44.256 1.00 25.91 C ATOM 1502 CE2 PHE A1159 25.244 34.658 42.825 1.00 26.91 C ATOM 1503 CZ PHE A1159 26.135 35.435 43.562 1.00 25.20 C ATOM 1504 N THR A1160 19.577 37.459 41.241 1.00 25.52 N ATOM 1505 CA THR A1160 18.146 37.555 40.964 1.00 25.74 C ATOM 1506 C THR A1160 17.698 36.305 40.221 1.00 24.38 C ATOM 1507 O THR A1160 18.516 35.461 39.881 1.00 24.42 O ATOM 1508 CB THR A1160 17.846 38.728 40.028 1.00 25.44 C ATOM 1509 OG1 THR A1160 18.443 38.458 38.758 1.00 26.76 O ATOM 1510 CG2 THR A1160 18.422 40.034 40.573 1.00 25.40 C ATOM 1511 N THR A1161 16.397 36.190 39.964 1.00 24.58 N ATOM 1512 CA THR A1161 15.901 35.054 39.204 1.00 24.19 C ATOM 1513 C THR A1161 16.585 35.134 37.836 1.00 23.61 C ATOM 1514 O THR A1161 16.790 34.113 37.180 1.00 22.54 O ATOM 1515 CB THR A1161 14.367 35.105 39.003 1.00 25.24 C ATOM 1516 OG1 THR A1161 14.015 36.276 38.255 1.00 26.83 O ATOM 1517 CG2 THR A1161 13.655 35.139 40.345 1.00 25.51 C ATOM 1518 N TYR A1162 16.944 36.352 37.420 1.00 22.79 N ATOM 1519 CA TYR A1162 17.611 36.558 36.132 1.00 23.33 C ATOM 1520 C TYR A1162 18.991 35.914 36.121 1.00 21.37 C ATOM 1521 O TYR A1162 19.388 35.324 35.125 1.00 19.55 O ATOM 1522 CB TYR A1162 17.799 38.048 35.811 1.00 26.24 C ATOM 1523 CG TYR A1162 16.588 38.920 36.012 1.00 31.15 C ATOM 1524 CD1 TYR A1162 15.338 38.546 35.517 1.00 32.33 C ATOM 1525 CD2 TYR A1162 16.700 40.140 36.683 1.00 32.29 C ATOM 1526 CE1 TYR A1162 14.220 39.372 35.686 1.00 35.37 C ATOM 1527 CE2 TYR A1162 15.595 40.972 36.856 1.00 35.36 C ATOM 1528 CZ TYR A1162 14.359 40.584 36.356 1.00 36.14 C ATOM 1529 OH TYR A1162 13.274 41.415 36.524 1.00 38.51 O ATOM 1530 N SER A1163 19.729 36.032 37.221 1.00 20.36 N ATOM 1531 CA SER A1163 21.053 35.425 37.252 1.00 20.66 C ATOM 1532 C SER A1163 20.925 33.910 37.364 1.00 19.20 C ATOM 1533 O SER A1163 21.821 33.193 36.963 1.00 20.57 O ATOM 1534 CB SER A1163 21.913 36.009 38.388 1.00 20.41 C ATOM 1535 OG SER A1163 21.261 35.950 39.638 1.00 20.56 O ATOM 1536 N ASP A1164 19.809 33.421 37.904 1.00 19.83 N ATOM 1537 CA ASP A1164 19.584 31.975 37.994 1.00 18.38 C ATOM 1538 C ASP A1164 19.384 31.483 36.553 1.00 18.45 C ATOM 1539 O ASP A1164 19.806 30.386 36.183 1.00 17.16 O ATOM 1540 CB ASP A1164 18.316 31.653 38.797 1.00 18.06 C ATOM 1541 CG ASP A1164 18.572 31.457 40.287 1.00 18.68 C ATOM 1542 OD1 ASP A1164 19.745 31.451 40.725 1.00 18.00 O ATOM 1543 OD2 ASP A1164 17.572 31.297 41.025 1.00 17.03 O ATOM 1544 N VAL A1165 18.735 32.303 35.735 1.00 18.36 N ATOM 1545 CA VAL A1165 18.497 31.926 34.347 1.00 17.43 C ATOM 1546 C VAL A1165 19.826 31.879 33.592 1.00 18.58 C ATOM 1547 O VAL A1165 20.013 31.043 32.706 1.00 18.39 O ATOM 1548 CB VAL A1165 17.504 32.902 33.670 1.00 17.29 C ATOM 1549 CG1 VAL A1165 17.495 32.693 32.160 1.00 16.72 C ATOM 1550 CG2 VAL A1165 16.095 32.657 34.223 1.00 14.96 C ATOM 1551 N TRP A1166 20.748 32.773 33.946 1.00 17.75 N ATOM 1552 CA TRP A1166 22.067 32.776 33.316 1.00 18.72 C ATOM 1553 C TRP A1166 22.749 31.436 33.592 1.00 18.21 C ATOM 1554 O TRP A1166 23.264 30.791 32.677 1.00 18.45 O ATOM 1555 CB TRP A1166 22.939 33.906 33.874 1.00 18.75 C ATOM 1556 CG TRP A1166 24.350 33.875 33.352 1.00 20.20 C ATOM 1557 CD1 TRP A1166 25.360 33.041 33.754 1.00 20.58 C ATOM 1558 CD2 TRP A1166 24.884 34.663 32.283 1.00 20.50 C ATOM 1559 NE1 TRP A1166 26.484 33.262 32.996 1.00 20.05 N ATOM 1560 CE2 TRP A1166 26.220 34.253 32.087 1.00 21.51 C ATOM 1561 CE3 TRP A1166 24.361 35.680 31.469 1.00 20.80 C ATOM 1562 CZ2 TRP A1166 27.047 34.822 31.107 1.00 21.96 C ATOM 1563 CZ3 TRP A1166 25.179 36.246 30.496 1.00 22.00 C ATOM 1564 CH2 TRP A1166 26.509 35.813 30.324 1.00 22.50 C ATOM 1565 N SER A1167 22.753 31.030 34.860 1.00 17.58 N ATOM 1566 CA SER A1167 23.370 29.764 35.266 1.00 17.66 C ATOM 1567 C SER A1167 22.712 28.584 34.570 1.00 17.54 C ATOM 1568 O SER A1167 23.379 27.614 34.226 1.00 17.89 O ATOM 1569 CB SER A1167 23.273 29.585 36.780 1.00 17.37 C ATOM 1570 OG SER A1167 23.954 30.631 37.444 1.00 20.33 O ATOM 1571 N PHE A1168 21.399 28.659 34.369 1.00 17.45 N ATOM 1572 CA PHE A1168 20.687 27.587 33.674 1.00 18.21 C ATOM 1573 C PHE A1168 21.314 27.457 32.280 1.00 18.08 C ATOM 1574 O PHE A1168 21.484 26.354 31.757 1.00 17.75 O ATOM 1575 CB PHE A1168 19.198 27.934 33.561 1.00 19.12 C ATOM 1576 CG PHE A1168 18.402 26.965 32.723 1.00 20.24 C ATOM 1577 CD1 PHE A1168 18.062 25.711 33.213 1.00 20.78 C ATOM 1578 CD2 PHE A1168 17.976 27.321 31.445 1.00 20.98 C ATOM 1579 CE1 PHE A1168 17.301 24.823 32.442 1.00 19.86 C ATOM 1580 CE2 PHE A1168 17.215 26.436 30.666 1.00 20.47 C ATOM 1581 CZ PHE A1168 16.880 25.194 31.169 1.00 21.49 C ATOM 1582 N GLY A1169 21.664 28.592 31.680 1.00 18.86 N ATOM 1583 CA GLY A1169 22.287 28.559 30.368 1.00 17.80 C ATOM 1584 C GLY A1169 23.582 27.772 30.434 1.00 19.15 C ATOM 1585 O GLY A1169 23.900 26.983 29.538 1.00 19.60 O ATOM 1586 N VAL A1170 24.342 27.972 31.505 1.00 18.68 N ATOM 1587 CA VAL A1170 25.598 27.246 31.639 1.00 20.58 C ATOM 1588 C VAL A1170 25.339 25.751 31.808 1.00 20.77 C ATOM 1589 O VAL A1170 26.080 24.924 31.269 1.00 20.63 O ATOM 1590 CB VAL A1170 26.426 27.768 32.817 1.00 20.58 C ATOM 1591 CG1 VAL A1170 27.751 26.993 32.898 1.00 21.16 C ATOM 1592 CG2 VAL A1170 26.707 29.265 32.615 1.00 19.95 C ATOM 1593 N VAL A1171 24.288 25.406 32.548 1.00 20.40 N ATOM 1594 CA VAL A1171 23.944 24.000 32.756 1.00 19.79 C ATOM 1595 C VAL A1171 23.602 23.363 31.405 1.00 20.48 C ATOM 1596 O VAL A1171 23.968 22.219 31.147 1.00 21.21 O ATOM 1597 CB VAL A1171 22.761 23.851 33.741 1.00 19.08 C ATOM 1598 CG1 VAL A1171 22.314 22.394 33.827 1.00 19.15 C ATOM 1599 CG2 VAL A1171 23.178 24.338 35.117 1.00 17.80 C ATOM 1600 N LEU A1172 22.905 24.100 30.542 1.00 21.04 N ATOM 1601 CA LEU A1172 22.575 23.583 29.216 1.00 21.60 C ATOM 1602 C LEU A1172 23.879 23.289 28.475 1.00 21.76 C ATOM 1603 O LEU A1172 24.012 22.258 27.818 1.00 21.18 O ATOM 1604 CB LEU A1172 21.752 24.597 28.415 1.00 22.42 C ATOM 1605 CG LEU A1172 20.328 24.868 28.907 1.00 20.90 C ATOM 1606 CD1 LEU A1172 19.589 25.707 27.873 1.00 21.75 C ATOM 1607 CD2 LEU A1172 19.602 23.543 29.125 1.00 23.30 C ATOM 1608 N TRP A1173 24.839 24.201 28.585 1.00 22.28 N ATOM 1609 CA TRP A1173 26.139 24.015 27.938 1.00 23.36 C ATOM 1610 C TRP A1173 26.803 22.747 28.498 1.00 22.64 C ATOM 1611 O TRP A1173 27.355 21.940 27.755 1.00 24.20 O ATOM 1612 CB TRP A1173 27.038 25.222 28.208 1.00 22.87 C ATOM 1613 CG TRP A1173 28.352 25.200 27.464 1.00 24.86 C ATOM 1614 CD1 TRP A1173 28.586 25.652 26.193 1.00 25.62 C ATOM 1615 CD2 TRP A1173 29.610 24.718 27.954 1.00 25.24 C ATOM 1616 NE1 TRP A1173 29.911 25.488 25.866 1.00 24.24 N ATOM 1617 CE2 TRP A1173 30.562 24.918 26.927 1.00 26.69 C ATOM 1618 CE3 TRP A1173 30.026 24.142 29.161 1.00 26.90 C ATOM 1619 CZ2 TRP A1173 31.911 24.556 27.072 1.00 26.56 C ATOM 1620 CZ3 TRP A1173 31.365 23.785 29.305 1.00 26.67 C ATOM 1621 CH2 TRP A1173 32.291 23.995 28.265 1.00 26.69 C ATOM 1622 N GLU A1174 26.745 22.572 29.813 1.00 22.84 N ATOM 1623 CA GLU A1174 27.343 21.400 30.438 1.00 22.69 C ATOM 1624 C GLU A1174 26.702 20.125 29.899 1.00 23.15 C ATOM 1625 O GLU A1174 27.375 19.121 29.666 1.00 21.87 O ATOM 1626 CB GLU A1174 27.163 21.453 31.952 1.00 23.39 C ATOM 1627 CG GLU A1174 28.076 22.433 32.671 1.00 23.69 C ATOM 1628 CD GLU A1174 27.889 22.369 34.175 1.00 24.63 C ATOM 1629 OE1 GLU A1174 26.871 22.901 34.670 1.00 23.59 O ATOM 1630 OE2 GLU A1174 28.753 21.774 34.861 1.00 24.00 O ATOM 1631 N ILE A1175 25.393 20.164 29.702 1.00 22.76 N ATOM 1632 CA ILE A1175 24.698 18.997 29.182 1.00 24.36 C ATOM 1633 C ILE A1175 25.169 18.670 27.761 1.00 24.95 C ATOM 1634 O ILE A1175 25.516 17.530 27.469 1.00 25.29 O ATOM 1635 CB ILE A1175 23.179 19.227 29.190 1.00 23.89 C ATOM 1636 CG1 ILE A1175 22.688 19.292 30.640 1.00 23.04 C ATOM 1637 CG2 ILE A1175 22.474 18.136 28.387 1.00 24.11 C ATOM 1638 CD1 ILE A1175 21.185 19.531 30.788 1.00 23.37 C ATOM 1639 N ALA A1176 25.186 19.675 26.889 1.00 25.64 N ATOM 1640 CA ALA A1176 25.600 19.482 25.498 1.00 26.86 C ATOM 1641 C ALA A1176 27.072 19.112 25.299 1.00 27.84 C ATOM 1642 O ALA A1176 27.424 18.578 24.253 1.00 28.96 O ATOM 1643 CB ALA A1176 25.275 20.727 24.675 1.00 25.07 C ATOM 1644 N THR A1177 27.926 19.397 26.283 1.00 27.35 N ATOM 1645 CA THR A1177 29.351 19.071 26.173 1.00 29.06 C ATOM 1646 C THR A1177 29.733 17.883 27.055 1.00 29.00 C ATOM 1647 O THR A1177 30.912 17.544 27.165 1.00 28.67 O ATOM 1648 CB THR A1177 30.253 20.254 26.611 1.00 28.15 C ATOM 1649 OG1 THR A1177 29.969 20.582 27.977 1.00 29.36 O ATOM 1650 CG2 THR A1177 30.017 21.477 25.739 1.00 28.44 C ATOM 1651 N LEU A1178 28.741 17.256 27.681 1.00 30.07 N ATOM 1652 CA LEU A1178 28.992 16.133 28.580 1.00 30.49 C ATOM 1653 C LEU A1178 29.897 16.558 29.729 1.00 30.81 C ATOM 1654 O LEU A1178 30.914 15.919 30.017 1.00 31.06 O ATOM 1655 CB LEU A1178 29.615 14.948 27.832 1.00 30.85 C ATOM 1656 CG LEU A1178 28.714 14.291 26.781 1.00 32.12 C ATOM 1657 CD1 LEU A1178 29.386 13.028 26.256 1.00 31.80 C ATOM 1658 CD2 LEU A1178 27.355 13.946 27.397 1.00 31.79 C ATOM 1659 N ALA A1179 29.506 17.652 30.375 1.00 30.26 N ATOM 1660 CA ALA A1179 30.207 18.208 31.525 1.00 30.16 C ATOM 1661 C ALA A1179 31.652 18.639 31.321 1.00 31.33 C ATOM 1662 O ALA A1179 32.527 18.283 32.107 1.00 30.33 O ATOM 1663 CB ALA A1179 30.125 17.240 32.706 1.00 30.30 C ATOM 1664 N GLU A1180 31.908 19.407 30.271 1.00 32.25 N ATOM 1665 CA GLU A1180 33.255 19.910 30.052 1.00 34.21 C ATOM 1666 C GLU A1180 33.341 21.026 31.088 1.00 33.67 C ATOM 1667 O GLU A1180 32.311 21.503 31.556 1.00 33.21 O ATOM 1668 CB GLU A1180 33.393 20.495 28.642 1.00 36.10 C ATOM 1669 CG GLU A1180 34.828 20.573 28.148 1.00 40.32 C ATOM 1670 CD GLU A1180 35.426 19.194 27.924 1.00 41.89 C ATOM 1671 OE1 GLU A1180 34.966 18.495 26.995 1.00 43.51 O ATOM 1672 OE2 GLU A1180 36.343 18.803 28.680 1.00 43.58 O ATOM 1673 N GLN A1181 34.545 21.440 31.460 1.00 33.14 N ATOM 1674 CA GLN A1181 34.682 22.519 32.432 1.00 34.15 C ATOM 1675 C GLN A1181 34.403 23.839 31.717 1.00 33.39 C ATOM 1676 O GLN A1181 34.995 24.117 30.668 1.00 32.59 O ATOM 1677 CB GLN A1181 36.098 22.541 33.009 1.00 36.27 C ATOM 1678 CG GLN A1181 36.380 23.736 33.907 1.00 40.12 C ATOM 1679 CD GLN A1181 35.654 23.659 35.237 1.00 42.74 C ATOM 1680 OE1 GLN A1181 35.803 24.537 36.089 1.00 45.31 O ATOM 1681 NE2 GLN A1181 34.868 22.602 35.427 1.00 43.77 N ATOM 1682 N PRO A1182 33.490 24.665 32.260 1.00 32.32 N ATOM 1683 CA PRO A1182 33.181 25.947 31.616 1.00 31.77 C ATOM 1684 C PRO A1182 34.419 26.837 31.529 1.00 31.38 C ATOM 1685 O PRO A1182 35.154 26.976 32.502 1.00 31.14 O ATOM 1686 CB PRO A1182 32.115 26.548 32.530 1.00 31.59 C ATOM 1687 CG PRO A1182 31.445 25.341 33.117 1.00 32.69 C ATOM 1688 CD PRO A1182 32.617 24.443 33.426 1.00 32.06 C ATOM 1689 N TYR A1183 34.640 27.434 30.361 1.00 31.71 N ATOM 1690 CA TYR A1183 35.784 28.319 30.145 1.00 32.02 C ATOM 1691 C TYR A1183 37.086 27.585 30.455 1.00 33.65 C ATOM 1692 O TYR A1183 37.983 28.130 31.105 1.00 33.43 O ATOM 1693 CB TYR A1183 35.674 29.558 31.038 1.00 30.45 C ATOM 1694 CG TYR A1183 34.327 30.249 30.981 1.00 28.66 C ATOM 1695 CD1 TYR A1183 33.974 31.070 29.904 1.00 27.81 C ATOM 1696 CD2 TYR A1183 33.396 30.066 32.004 1.00 27.87 C ATOM 1697 CE1 TYR A1183 32.714 31.694 29.852 1.00 27.64 C ATOM 1698 CE2 TYR A1183 32.145 30.680 31.964 1.00 27.39 C ATOM 1699 CZ TYR A1183 31.809 31.488 30.890 1.00 27.82 C ATOM 1700 OH TYR A1183 30.563 32.066 30.866 1.00 28.42 O ATOM 1701 N GLN A1184 37.182 26.347 29.987 1.00 35.15 N ATOM 1702 CA GLN A1184 38.369 25.535 30.210 1.00 38.12 C ATOM 1703 C GLN A1184 39.600 26.176 29.584 1.00 38.26 C ATOM 1704 O GLN A1184 39.595 26.542 28.410 1.00 37.98 O ATOM 1705 CB GLN A1184 38.160 24.140 29.626 1.00 40.97 C ATOM 1706 CG GLN A1184 39.376 23.239 29.725 1.00 45.31 C ATOM 1707 CD GLN A1184 39.004 21.771 29.655 1.00 48.16 C ATOM 1708 OE1 GLN A1184 38.232 21.273 30.482 1.00 50.21 O ATOM 1709 NE2 GLN A1184 39.547 21.067 28.666 1.00 49.52 N ATOM 1710 N GLY A1185 40.659 26.309 30.372 1.00 38.45 N ATOM 1711 CA GLY A1185 41.872 26.913 29.854 1.00 38.60 C ATOM 1712 C GLY A1185 42.040 28.331 30.361 1.00 38.43 C ATOM 1713 O GLY A1185 43.140 28.883 30.324 1.00 39.31 O ATOM 1714 N LEU A1186 40.948 28.929 30.829 1.00 37.69 N ATOM 1715 CA LEU A1186 40.998 30.284 31.360 1.00 36.66 C ATOM 1716 C LEU A1186 41.107 30.239 32.878 1.00 36.55 C ATOM 1717 O LEU A1186 40.409 29.466 33.535 1.00 36.44 O ATOM 1718 CB LEU A1186 39.741 31.071 30.971 1.00 36.43 C ATOM 1719 CG LEU A1186 39.601 31.533 29.520 1.00 36.99 C ATOM 1720 CD1 LEU A1186 38.334 32.360 29.342 1.00 36.82 C ATOM 1721 CD2 LEU A1186 40.807 32.366 29.158 1.00 38.03 C ATOM 1722 N SER A1187 41.986 31.062 33.436 1.00 35.34 N ATOM 1723 CA SER A1187 42.136 31.114 34.880 1.00 35.18 C ATOM 1724 C SER A1187 40.884 31.819 35.390 1.00 35.63 C ATOM 1725 O SER A1187 40.159 32.439 34.608 1.00 35.88 O ATOM 1726 CB SER A1187 43.366 31.933 35.261 1.00 34.55 C ATOM 1727 OG SER A1187 43.177 33.283 34.890 1.00 32.41 O ATOM 1728 N ASN A1188 40.630 31.730 36.689 1.00 34.98 N ATOM 1729 CA ASN A1188 39.455 32.370 37.262 1.00 35.62 C ATOM 1730 C ASN A1188 39.439 33.855 36.910 1.00 35.61 C ATOM 1731 O ASN A1188 38.384 34.431 36.641 1.00 34.31 O ATOM 1732 CB ASN A1188 39.437 32.181 38.781 1.00 34.56 C ATOM 1733 CG ASN A1188 39.387 30.718 39.178 1.00 35.92 C ATOM 1734 OD1 ASN A1188 38.721 29.917 38.524 1.00 35.19 O ATOM 1735 ND2 ASN A1188 40.080 30.364 40.259 1.00 35.78 N ATOM 1736 N GLU A1189 40.624 34.458 36.912 1.00 36.09 N ATOM 1737 CA GLU A1189 40.788 35.871 36.592 1.00 36.71 C ATOM 1738 C GLU A1189 40.323 36.206 35.185 1.00 35.48 C ATOM 1739 O GLU A1189 39.588 37.171 34.976 1.00 35.09 O ATOM 1740 CB GLU A1189 42.257 36.273 36.732 1.00 39.67 C ATOM 1741 CG GLU A1189 42.610 36.813 38.095 1.00 42.50 C ATOM 1742 CD GLU A1189 41.675 37.927 38.505 1.00 44.59 C ATOM 1743 OE1 GLU A1189 41.312 38.743 37.626 1.00 44.64 O ATOM 1744 OE2 GLU A1189 41.309 37.987 39.699 1.00 45.54 O ATOM 1745 N GLN A1190 40.765 35.405 34.223 1.00 33.88 N ATOM 1746 CA GLN A1190 40.400 35.610 32.833 1.00 34.12 C ATOM 1747 C GLN A1190 38.904 35.387 32.635 1.00 34.04 C ATOM 1748 O GLN A1190 38.282 36.026 31.783 1.00 32.68 O ATOM 1749 CB GLN A1190 41.200 34.662 31.934 1.00 34.86 C ATOM 1750 CG GLN A1190 42.700 34.950 31.914 1.00 35.71 C ATOM 1751 CD GLN A1190 43.482 33.904 31.150 1.00 36.69 C ATOM 1752 OE1 GLN A1190 43.489 32.727 31.518 1.00 37.31 O ATOM 1753 NE2 GLN A1190 44.147 34.325 30.078 1.00 35.94 N ATOM 1754 N VAL A1191 38.327 34.478 33.420 1.00 33.55 N ATOM 1755 CA VAL A1191 36.898 34.204 33.318 1.00 32.93 C ATOM 1756 C VAL A1191 36.131 35.445 33.725 1.00 33.19 C ATOM 1757 O VAL A1191 35.226 35.885 33.019 1.00 33.68 O ATOM 1758 CB VAL A1191 36.475 33.031 34.226 1.00 32.45 C ATOM 1759 CG1 VAL A1191 34.952 32.994 34.353 1.00 32.10 C ATOM 1760 CG2 VAL A1191 36.981 31.723 33.637 1.00 30.99 C ATOM 1761 N LEU A1192 36.504 36.006 34.869 1.00 34.12 N ATOM 1762 CA LEU A1192 35.866 37.206 35.388 1.00 35.32 C ATOM 1763 C LEU A1192 35.866 38.311 34.332 1.00 35.55 C ATOM 1764 O LEU A1192 34.844 38.960 34.096 1.00 35.01 O ATOM 1765 CB LEU A1192 36.611 37.689 36.635 1.00 37.17 C ATOM 1766 CG LEU A1192 35.805 37.887 37.923 1.00 39.16 C ATOM 1767 CD1 LEU A1192 34.719 38.927 37.692 1.00 40.74 C ATOM 1768 CD2 LEU A1192 35.197 36.560 38.360 1.00 39.96 C ATOM 1769 N ARG A1193 37.015 38.515 33.695 1.00 35.01 N ATOM 1770 CA ARG A1193 37.152 39.549 32.673 1.00 35.31 C ATOM 1771 C ARG A1193 36.423 39.194 31.383 1.00 33.90 C ATOM 1772 O ARG A1193 35.741 40.029 30.797 1.00 33.16 O ATOM 1773 CB ARG A1193 38.631 39.789 32.355 1.00 36.67 C ATOM 1774 CG ARG A1193 39.470 40.165 33.560 1.00 39.06 C ATOM 1775 CD ARG A1193 40.921 40.385 33.162 1.00 41.64 C ATOM 1776 NE ARG A1193 41.783 40.580 34.323 1.00 43.71 N ATOM 1777 CZ ARG A1193 43.059 40.946 34.250 1.00 45.34 C ATOM 1778 NH1 ARG A1193 43.625 41.161 33.067 1.00 45.29 N ATOM 1779 NH2 ARG A1193 43.770 41.093 35.360 1.00 46.07 N ATOM 1780 N PHE A1194 36.580 37.951 30.944 1.00 32.63 N ATOM 1781 CA PHE A1194 35.950 37.481 29.718 1.00 32.35 C ATOM 1782 C PHE A1194 34.435 37.665 29.747 1.00 32.22 C ATOM 1783 O PHE A1194 33.846 38.211 28.809 1.00 31.58 O ATOM 1784 CB PHE A1194 36.273 35.999 29.500 1.00 31.66 C ATOM 1785 CG PHE A1194 35.744 35.445 28.207 1.00 32.46 C ATOM 1786 CD1 PHE A1194 36.161 35.971 26.984 1.00 31.29 C ATOM 1787 CD2 PHE A1194 34.834 34.392 28.209 1.00 31.60 C ATOM 1788 CE1 PHE A1194 35.682 35.457 25.786 1.00 31.74 C ATOM 1789 CE2 PHE A1194 34.346 33.869 27.015 1.00 31.40 C ATOM 1790 CZ PHE A1194 34.771 34.401 25.799 1.00 32.67 C ATOM 1791 N VAL A1195 33.811 37.208 30.827 1.00 31.38 N ATOM 1792 CA VAL A1195 32.360 37.295 30.967 1.00 31.01 C ATOM 1793 C VAL A1195 31.830 38.713 31.175 1.00 31.46 C ATOM 1794 O VAL A1195 30.838 39.105 30.560 1.00 30.89 O ATOM 1795 CB VAL A1195 31.864 36.407 32.132 1.00 29.97 C ATOM 1796 CG1 VAL A1195 30.363 36.585 32.322 1.00 29.10 C ATOM 1797 CG2 VAL A1195 32.178 34.949 31.837 1.00 28.84 C ATOM 1798 N MET A1196 32.485 39.480 32.037 1.00 32.36 N ATOM 1799 CA MET A1196 32.037 40.837 32.302 1.00 34.20 C ATOM 1800 C MET A1196 32.186 41.746 31.092 1.00 34.32 C ATOM 1801 O MET A1196 31.535 42.783 31.008 1.00 34.68 O ATOM 1802 CB MET A1196 32.778 41.422 33.507 1.00 35.34 C ATOM 1803 CG MET A1196 32.141 41.045 34.836 1.00 36.88 C ATOM 1804 SD MET A1196 33.015 41.665 36.284 1.00 40.41 S ATOM 1805 CE MET A1196 32.869 43.439 36.046 1.00 41.79 C ATOM 1806 N GLU A1197 33.037 41.355 30.152 1.00 34.94 N ATOM 1807 CA GLU A1197 33.235 42.149 28.950 1.00 36.46 C ATOM 1808 C GLU A1197 32.321 41.723 27.805 1.00 35.47 C ATOM 1809 O GLU A1197 32.364 42.305 26.727 1.00 35.30 O ATOM 1810 CB GLU A1197 34.697 42.088 28.508 1.00 38.52 C ATOM 1811 CG GLU A1197 35.612 42.975 29.339 1.00 42.80 C ATOM 1812 CD GLU A1197 37.069 42.857 28.933 1.00 45.45 C ATOM 1813 OE1 GLU A1197 37.362 42.972 27.723 1.00 48.18 O ATOM 1814 OE2 GLU A1197 37.922 42.655 29.823 1.00 47.47 O ATOM 1815 N GLY A1198 31.490 40.710 28.038 1.00 34.57 N ATOM 1816 CA GLY A1198 30.573 40.267 26.999 1.00 32.04 C ATOM 1817 C GLY A1198 30.889 38.938 26.339 1.00 31.11 C ATOM 1818 O GLY A1198 30.192 38.530 25.410 1.00 31.81 O ATOM 1819 N GLY A1199 31.930 38.258 26.809 1.00 29.92 N ATOM 1820 CA GLY A1199 32.290 36.972 26.232 1.00 29.02 C ATOM 1821 C GLY A1199 31.331 35.869 26.644 1.00 28.59 C ATOM 1822 O GLY A1199 30.657 35.982 27.669 1.00 26.96 O ATOM 1823 N LEU A1200 31.276 34.804 25.845 1.00 29.10 N ATOM 1824 CA LEU A1200 30.391 33.667 26.107 1.00 29.42 C ATOM 1825 C LEU A1200 31.074 32.332 25.829 1.00 30.27 C ATOM 1826 O LEU A1200 32.061 32.263 25.094 1.00 29.94 O ATOM 1827 CB LEU A1200 29.147 33.745 25.213 1.00 29.18 C ATOM 1828 CG LEU A1200 28.255 34.985 25.288 1.00 29.96 C ATOM 1829 CD1 LEU A1200 27.207 34.918 24.190 1.00 29.66 C ATOM 1830 CD2 LEU A1200 27.611 35.072 26.663 1.00 28.31 C ATOM 1831 N LEU A1201 30.536 31.272 26.420 1.00 30.53 N ATOM 1832 CA LEU A1201 31.054 29.926 26.195 1.00 31.33 C ATOM 1833 C LEU A1201 30.753 29.609 24.731 1.00 33.51 C ATOM 1834 O LEU A1201 29.834 30.189 24.153 1.00 32.70 O ATOM 1835 CB LEU A1201 30.338 28.931 27.111 1.00 29.71 C ATOM 1836 CG LEU A1201 30.666 29.073 28.598 1.00 27.86 C ATOM 1837 CD1 LEU A1201 29.534 28.518 29.447 1.00 27.69 C ATOM 1838 CD2 LEU A1201 31.990 28.353 28.890 1.00 28.03 C ATOM 1839 N ASP A1202 31.516 28.699 24.128 1.00 36.00 N ATOM 1840 CA ASP A1202 31.299 28.360 22.725 1.00 37.82 C ATOM 1841 C ASP A1202 30.035 27.544 22.476 1.00 38.71 C ATOM 1842 O ASP A1202 29.352 27.120 23.408 1.00 38.16 O ATOM 1843 CB ASP A1202 32.502 27.597 22.151 1.00 39.73 C ATOM 1844 CG ASP A1202 32.713 26.238 22.812 1.00 42.66 C ATOM 1845 OD1 ASP A1202 31.734 25.650 23.324 1.00 43.54 O ATOM 1846 OD2 ASP A1202 33.863 25.745 22.802 1.00 43.89 O ATOM 1847 N LYS A1203 29.735 27.334 21.200 1.00 39.24 N ATOM 1848 CA LYS A1203 28.577 26.556 20.798 1.00 40.74 C ATOM 1849 C LYS A1203 29.048 25.111 20.680 1.00 41.02 C ATOM 1850 O LYS A1203 29.826 24.775 19.785 1.00 40.89 O ATOM 1851 CB LYS A1203 28.052 27.059 19.451 1.00 42.04 C ATOM 1852 CG LYS A1203 27.666 28.535 19.458 1.00 43.47 C ATOM 1853 CD LYS A1203 27.251 29.015 18.068 1.00 45.47 C ATOM 1854 CE LYS A1203 26.832 30.483 18.099 1.00 46.18 C ATOM 1855 NZ LYS A1203 26.525 31.024 16.738 1.00 47.55 N ATOM 1856 N PRO A1204 28.590 24.238 21.593 1.00 40.85 N ATOM 1857 CA PRO A1204 28.983 22.827 21.576 1.00 41.16 C ATOM 1858 C PRO A1204 28.721 22.185 20.220 1.00 42.18 C ATOM 1859 O PRO A1204 27.693 22.440 19.591 1.00 41.48 O ATOM 1860 CB PRO A1204 28.114 22.216 22.674 1.00 41.00 C ATOM 1861 CG PRO A1204 27.901 23.360 23.620 1.00 40.26 C ATOM 1862 CD PRO A1204 27.618 24.493 22.669 1.00 39.94 C ATOM 1863 N ASP A1205 29.651 21.352 19.773 1.00 43.81 N ATOM 1864 CA ASP A1205 29.497 20.672 18.496 1.00 46.22 C ATOM 1865 C ASP A1205 28.286 19.750 18.526 1.00 46.55 C ATOM 1866 O ASP A1205 28.021 19.091 19.532 1.00 47.44 O ATOM 1867 CB ASP A1205 30.755 19.863 18.171 1.00 48.03 C ATOM 1868 CG ASP A1205 31.937 20.742 17.806 1.00 49.94 C ATOM 1869 OD1 ASP A1205 31.861 21.438 16.769 1.00 51.31 O ATOM 1870 OD2 ASP A1205 32.939 20.742 18.553 1.00 51.46 O ATOM 1871 N ASN A1206 27.551 19.713 17.422 1.00 46.56 N ATOM 1872 CA ASN A1206 26.375 18.859 17.307 1.00 47.20 C ATOM 1873 C ASN A1206 25.323 19.103 18.387 1.00 46.57 C ATOM 1874 O ASN A1206 24.619 18.179 18.791 1.00 47.30 O ATOM 1875 CB ASN A1206 26.801 17.389 17.343 1.00 48.65 C ATOM 1876 CG ASN A1206 27.840 17.058 16.288 1.00 50.01 C ATOM 1877 OD1 ASN A1206 28.431 15.977 16.302 1.00 51.30 O ATOM 1878 ND2 ASN A1206 28.066 17.987 15.364 1.00 50.10 N ATOM 1879 N CYS A1207 25.214 20.340 18.857 1.00 45.44 N ATOM 1880 CA CYS A1207 24.226 20.665 19.879 1.00 43.21 C ATOM 1881 C CYS A1207 22.892 20.998 19.212 1.00 42.07 C ATOM 1882 O CYS A1207 22.852 21.667 18.182 1.00 41.48 O ATOM 1883 CB CYS A1207 24.695 21.864 20.711 1.00 42.90 C ATOM 1884 SG CYS A1207 23.540 22.385 22.012 1.00 40.80 S ATOM 1885 N PRO A1208 21.782 20.515 19.785 1.00 41.16 N ATOM 1886 CA PRO A1208 20.445 20.772 19.240 1.00 40.17 C ATOM 1887 C PRO A1208 20.184 22.275 19.118 1.00 39.10 C ATOM 1888 O PRO A1208 20.482 23.033 20.041 1.00 38.01 O ATOM 1889 CB PRO A1208 19.530 20.115 20.267 1.00 41.04 C ATOM 1890 CG PRO A1208 20.353 18.945 20.732 1.00 41.37 C ATOM 1891 CD PRO A1208 21.718 19.569 20.913 1.00 41.67 C ATOM 1892 N ASP A1209 19.631 22.701 17.984 1.00 38.15 N ATOM 1893 CA ASP A1209 19.348 24.118 17.764 1.00 37.21 C ATOM 1894 C ASP A1209 18.560 24.777 18.889 1.00 35.77 C ATOM 1895 O ASP A1209 18.852 25.911 19.260 1.00 35.30 O ATOM 1896 CB ASP A1209 18.603 24.330 16.440 1.00 37.83 C ATOM 1897 CG ASP A1209 19.509 24.181 15.233 1.00 39.14 C ATOM 1898 OD1 ASP A1209 20.738 24.316 15.397 1.00 41.17 O ATOM 1899 OD2 ASP A1209 18.997 23.946 14.120 1.00 40.41 O ATOM 1900 N MET A1210 17.564 24.081 19.432 1.00 34.61 N ATOM 1901 CA MET A1210 16.761 24.656 20.511 1.00 34.65 C ATOM 1902 C MET A1210 17.595 24.988 21.744 1.00 33.41 C ATOM 1903 O MET A1210 17.330 25.973 22.435 1.00 32.22 O ATOM 1904 CB MET A1210 15.622 23.715 20.912 1.00 36.25 C ATOM 1905 CG MET A1210 14.504 23.622 19.892 1.00 39.39 C ATOM 1906 SD MET A1210 13.065 22.747 20.541 1.00 43.20 S ATOM 1907 CE MET A1210 11.969 24.119 20.947 1.00 42.21 C ATOM 1908 N LEU A1211 18.601 24.169 22.023 1.00 32.23 N ATOM 1909 CA LEU A1211 19.454 24.420 23.177 1.00 32.42 C ATOM 1910 C LEU A1211 20.426 25.565 22.897 1.00 31.06 C ATOM 1911 O LEU A1211 20.749 26.340 23.793 1.00 30.39 O ATOM 1912 CB LEU A1211 20.208 23.145 23.568 1.00 33.87 C ATOM 1913 CG LEU A1211 19.297 22.014 24.059 1.00 35.27 C ATOM 1914 CD1 LEU A1211 20.142 20.834 24.497 1.00 36.95 C ATOM 1915 CD2 LEU A1211 18.440 22.499 25.214 1.00 34.89 C ATOM 1916 N LEU A1212 20.891 25.681 21.657 1.00 30.08 N ATOM 1917 CA LEU A1212 21.794 26.776 21.311 1.00 29.34 C ATOM 1918 C LEU A1212 21.034 28.089 21.465 1.00 28.41 C ATOM 1919 O LEU A1212 21.568 29.073 21.978 1.00 27.96 O ATOM 1920 CB LEU A1212 22.290 26.640 19.866 1.00 30.52 C ATOM 1921 CG LEU A1212 23.305 25.528 19.578 1.00 32.56 C ATOM 1922 CD1 LEU A1212 23.548 25.417 18.080 1.00 31.88 C ATOM 1923 CD2 LEU A1212 24.609 25.825 20.313 1.00 31.93 C ATOM 1924 N GLU A1213 19.779 28.094 21.019 1.00 27.36 N ATOM 1925 CA GLU A1213 18.944 29.288 21.099 1.00 26.61 C ATOM 1926 C GLU A1213 18.624 29.621 22.554 1.00 25.99 C ATOM 1927 O GLU A1213 18.670 30.782 22.947 1.00 26.32 O ATOM 1928 CB GLU A1213 17.659 29.081 20.286 1.00 25.91 C ATOM 1929 CG GLU A1213 16.638 30.210 20.361 1.00 25.41 C ATOM 1930 CD GLU A1213 17.186 31.577 19.965 1.00 26.64 C ATOM 1931 OE1 GLU A1213 18.334 31.674 19.475 1.00 25.47 O ATOM 1932 OE2 GLU A1213 16.449 32.568 20.144 1.00 25.53 O ATOM 1933 N LEU A1214 18.301 28.607 23.352 1.00 25.84 N ATOM 1934 CA LEU A1214 18.008 28.832 24.768 1.00 24.94 C ATOM 1935 C LEU A1214 19.241 29.441 25.431 1.00 24.53 C ATOM 1936 O LEU A1214 19.137 30.376 26.232 1.00 23.74 O ATOM 1937 CB LEU A1214 17.632 27.516 25.467 1.00 24.02 C ATOM 1938 CG LEU A1214 16.222 26.992 25.184 1.00 26.60 C ATOM 1939 CD1 LEU A1214 15.978 25.709 25.965 1.00 26.30 C ATOM 1940 CD2 LEU A1214 15.192 28.050 25.575 1.00 25.76 C ATOM 1941 N MET A1215 20.412 28.910 25.093 1.00 24.05 N ATOM 1942 CA MET A1215 21.649 29.437 25.651 1.00 25.08 C ATOM 1943 C MET A1215 21.785 30.904 25.277 1.00 24.95 C ATOM 1944 O MET A1215 22.050 31.744 26.134 1.00 24.69 O ATOM 1945 CB MET A1215 22.861 28.650 25.137 1.00 26.28 C ATOM 1946 CG MET A1215 23.079 27.318 25.845 1.00 26.95 C ATOM 1947 SD MET A1215 24.641 26.512 25.393 1.00 28.82 S ATOM 1948 CE MET A1215 24.066 25.184 24.368 1.00 25.56 C ATOM 1949 N ARG A1216 21.599 31.211 23.993 1.00 25.68 N ATOM 1950 CA ARG A1216 21.696 32.587 23.520 1.00 25.60 C ATOM 1951 C ARG A1216 20.780 33.496 24.336 1.00 25.17 C ATOM 1952 O ARG A1216 21.164 34.603 24.714 1.00 24.03 O ATOM 1953 CB ARG A1216 21.304 32.685 22.038 1.00 26.08 C ATOM 1954 CG ARG A1216 21.494 34.092 21.456 1.00 28.88 C ATOM 1955 CD ARG A1216 20.999 34.207 20.012 1.00 27.63 C ATOM 1956 NE ARG A1216 19.544 34.192 19.938 1.00 29.46 N ATOM 1957 CZ ARG A1216 18.765 35.208 20.286 1.00 30.06 C ATOM 1958 NH1 ARG A1216 19.296 36.340 20.728 1.00 32.37 N ATOM 1959 NH2 ARG A1216 17.448 35.090 20.204 1.00 31.76 N ATOM 1960 N MET A1217 19.566 33.017 24.596 1.00 24.62 N ATOM 1961 CA MET A1217 18.575 33.772 25.356 1.00 24.56 C ATOM 1962 C MET A1217 18.991 33.937 26.820 1.00 23.69 C ATOM 1963 O MET A1217 18.897 35.033 27.375 1.00 23.64 O ATOM 1964 CB MET A1217 17.206 33.069 25.291 1.00 26.04 C ATOM 1965 CG MET A1217 16.579 32.968 23.890 1.00 28.51 C ATOM 1966 SD MET A1217 15.232 31.725 23.766 1.00 33.04 S ATOM 1967 CE MET A1217 13.860 32.567 24.621 1.00 32.84 C ATOM 1968 N CYS A1218 19.446 32.850 27.442 1.00 23.38 N ATOM 1969 CA CYS A1218 19.858 32.891 28.849 1.00 23.43 C ATOM 1970 C CYS A1218 21.089 33.743 29.071 1.00 23.69 C ATOM 1971 O CYS A1218 21.308 34.250 30.176 1.00 22.98 O ATOM 1972 CB CYS A1218 20.137 31.480 29.382 1.00 23.54 C ATOM 1973 SG CYS A1218 18.684 30.420 29.454 1.00 25.79 S ATOM 1974 N TRP A1219 21.894 33.902 28.023 1.00 23.19 N ATOM 1975 CA TRP A1219 23.114 34.684 28.143 1.00 23.68 C ATOM 1976 C TRP A1219 23.045 36.110 27.598 1.00 24.33 C ATOM 1977 O TRP A1219 24.054 36.659 27.152 1.00 23.35 O ATOM 1978 CB TRP A1219 24.288 33.947 27.499 1.00 22.27 C ATOM 1979 CG TRP A1219 24.613 32.640 28.160 1.00 22.76 C ATOM 1980 CD1 TRP A1219 24.380 32.297 29.463 1.00 22.68 C ATOM 1981 CD2 TRP A1219 25.258 31.514 27.556 1.00 23.13 C ATOM 1982 NE1 TRP A1219 24.838 31.021 29.706 1.00 23.55 N ATOM 1983 CE2 TRP A1219 25.383 30.519 28.553 1.00 24.41 C ATOM 1984 CE3 TRP A1219 25.746 31.248 26.268 1.00 23.54 C ATOM 1985 CZ2 TRP A1219 25.975 29.274 28.300 1.00 24.69 C ATOM 1986 CZ3 TRP A1219 26.336 30.007 26.017 1.00 25.12 C ATOM 1987 CH2 TRP A1219 26.443 29.037 27.033 1.00 23.61 C ATOM 1988 N GLN A1220 21.859 36.705 27.631 1.00 25.40 N ATOM 1989 CA GLN A1220 21.711 38.095 27.199 1.00 25.57 C ATOM 1990 C GLN A1220 22.449 38.898 28.266 1.00 26.10 C ATOM 1991 O GLN A1220 22.258 38.658 29.458 1.00 26.80 O ATOM 1992 CB GLN A1220 20.231 38.483 27.168 1.00 24.03 C ATOM 1993 CG GLN A1220 19.490 37.916 25.974 1.00 23.69 C ATOM 1994 CD GLN A1220 20.011 38.486 24.672 1.00 26.12 C ATOM 1995 OE1 GLN A1220 19.894 39.689 24.421 1.00 25.83 O ATOM 1996 NE2 GLN A1220 20.612 37.632 23.842 1.00 25.90 N ATOM 1997 N TYR A1221 23.293 39.841 27.860 1.00 26.78 N ATOM 1998 CA TYR A1221 24.043 40.623 28.841 1.00 27.48 C ATOM 1999 C TYR A1221 23.094 41.393 29.760 1.00 27.89 C ATOM 2000 O TYR A1221 23.331 41.534 30.960 1.00 27.30 O ATOM 2001 CB TYR A1221 24.981 41.604 28.137 1.00 27.98 C ATOM 2002 CG TYR A1221 26.073 42.125 29.037 1.00 28.11 C ATOM 2003 CD1 TYR A1221 27.231 41.381 29.259 1.00 28.75 C ATOM 2004 CD2 TYR A1221 25.941 43.350 29.689 1.00 29.08 C ATOM 2005 CE1 TYR A1221 28.233 41.842 30.109 1.00 29.67 C ATOM 2006 CE2 TYR A1221 26.936 43.821 30.542 1.00 30.30 C ATOM 2007 CZ TYR A1221 28.080 43.062 30.747 1.00 30.27 C ATOM 2008 OH TYR A1221 29.065 43.519 31.590 1.00 31.23 O ATOM 2009 N ASN A1222 22.014 41.893 29.176 1.00 28.43 N ATOM 2010 CA ASN A1222 21.017 42.652 29.916 1.00 28.57 C ATOM 2011 C ASN A1222 20.092 41.634 30.576 1.00 28.81 C ATOM 2012 O ASN A1222 19.325 40.958 29.897 1.00 28.32 O ATOM 2013 CB ASN A1222 20.247 43.540 28.936 1.00 29.64 C ATOM 2014 CG ASN A1222 19.158 44.346 29.600 1.00 30.31 C ATOM 2015 OD1 ASN A1222 18.490 45.156 28.947 1.00 33.54 O ATOM 2016 ND2 ASN A1222 18.964 44.137 30.893 1.00 28.43 N ATOM 2017 N PRO A1223 20.149 41.517 31.913 1.00 29.24 N ATOM 2018 CA PRO A1223 19.291 40.547 32.596 1.00 29.21 C ATOM 2019 C PRO A1223 17.822 40.617 32.226 1.00 29.78 C ATOM 2020 O PRO A1223 17.145 39.588 32.170 1.00 27.87 O ATOM 2021 CB PRO A1223 19.546 40.835 34.077 1.00 29.91 C ATOM 2022 CG PRO A1223 19.979 42.264 34.087 1.00 30.06 C ATOM 2023 CD PRO A1223 20.875 42.346 32.887 1.00 29.18 C ATOM 2024 N LYS A1224 17.336 41.830 31.969 1.00 29.51 N ATOM 2025 CA LYS A1224 15.940 42.032 31.620 1.00 30.12 C ATOM 2026 C LYS A1224 15.603 41.442 30.253 1.00 30.43 C ATOM 2027 O LYS A1224 14.431 41.276 29.920 1.00 31.09 O ATOM 2028 CB LYS A1224 15.604 43.530 31.640 1.00 30.51 C ATOM 2029 N MET A1225 16.629 41.127 29.464 1.00 29.86 N ATOM 2030 CA MET A1225 16.418 40.550 28.139 1.00 29.89 C ATOM 2031 C MET A1225 16.343 39.027 28.192 1.00 29.07 C ATOM 2032 O MET A1225 15.973 38.378 27.217 1.00 28.07 O ATOM 2033 CB MET A1225 17.542 40.972 27.189 1.00 31.78 C ATOM 2034 CG MET A1225 17.511 42.441 26.790 1.00 34.00 C ATOM 2035 SD MET A1225 16.076 42.830 25.774 1.00 39.69 S ATOM 2036 CE MET A1225 15.115 43.856 26.901 1.00 38.38 C ATOM 2037 N ARG A1226 16.698 38.453 29.332 1.00 27.36 N ATOM 2038 CA ARG A1226 16.657 37.005 29.469 1.00 25.66 C ATOM 2039 C ARG A1226 15.236 36.527 29.695 1.00 25.25 C ATOM 2040 O ARG A1226 14.404 37.254 30.228 1.00 25.75 O ATOM 2041 CB ARG A1226 17.533 36.557 30.638 1.00 24.15 C ATOM 2042 CG ARG A1226 18.999 36.898 30.461 1.00 21.97 C ATOM 2043 CD ARG A1226 19.819 36.607 31.714 1.00 21.87 C ATOM 2044 NE ARG A1226 21.045 37.396 31.690 1.00 21.18 N ATOM 2045 CZ ARG A1226 21.680 37.841 32.771 1.00 21.83 C ATOM 2046 NH1 ARG A1226 21.218 37.567 33.989 1.00 20.36 N ATOM 2047 NH2 ARG A1226 22.748 38.615 32.627 1.00 22.05 N ATOM 2048 N PRO A1227 14.932 35.293 29.275 1.00 25.03 N ATOM 2049 CA PRO A1227 13.586 34.752 29.466 1.00 24.47 C ATOM 2050 C PRO A1227 13.457 34.295 30.916 1.00 25.04 C ATOM 2051 O PRO A1227 14.459 34.168 31.621 1.00 24.30 O ATOM 2052 CB PRO A1227 13.557 33.574 28.502 1.00 24.69 C ATOM 2053 CG PRO A1227 14.977 33.053 28.603 1.00 23.19 C ATOM 2054 CD PRO A1227 15.775 34.351 28.517 1.00 23.48 C ATOM 2055 N SER A1228 12.225 34.056 31.355 1.00 24.28 N ATOM 2056 CA SER A1228 11.971 33.569 32.709 1.00 23.53 C ATOM 2057 C SER A1228 11.936 32.060 32.553 1.00 22.77 C ATOM 2058 O SER A1228 11.834 31.559 31.432 1.00 23.50 O ATOM 2059 CB SER A1228 10.603 34.044 33.198 1.00 23.34 C ATOM 2060 OG SER A1228 9.590 33.413 32.437 1.00 24.24 O ATOM 2061 N PHE A1229 12.015 31.321 33.654 1.00 22.08 N ATOM 2062 CA PHE A1229 11.975 29.872 33.539 1.00 21.69 C ATOM 2063 C PHE A1229 10.647 29.409 32.942 1.00 22.19 C ATOM 2064 O PHE A1229 10.597 28.414 32.206 1.00 20.79 O ATOM 2065 CB PHE A1229 12.249 29.225 34.900 1.00 20.85 C ATOM 2066 CG PHE A1229 13.712 29.219 35.269 1.00 19.61 C ATOM 2067 CD1 PHE A1229 14.620 28.477 34.523 1.00 18.45 C ATOM 2068 CD2 PHE A1229 14.184 29.970 36.341 1.00 20.35 C ATOM 2069 CE1 PHE A1229 15.972 28.482 34.834 1.00 18.37 C ATOM 2070 CE2 PHE A1229 15.540 29.980 36.662 1.00 19.26 C ATOM 2071 CZ PHE A1229 16.437 29.235 35.907 1.00 17.48 C ATOM 2072 N LEU A1230 9.572 30.131 33.247 1.00 23.62 N ATOM 2073 CA LEU A1230 8.269 29.785 32.686 1.00 24.61 C ATOM 2074 C LEU A1230 8.312 29.981 31.172 1.00 24.68 C ATOM 2075 O LEU A1230 7.830 29.138 30.421 1.00 25.74 O ATOM 2076 CB LEU A1230 7.165 30.653 33.297 1.00 24.86 C ATOM 2077 CG LEU A1230 6.873 30.359 34.769 1.00 24.52 C ATOM 2078 CD1 LEU A1230 5.808 31.330 35.291 1.00 26.64 C ATOM 2079 CD2 LEU A1230 6.411 28.909 34.911 1.00 25.36 C ATOM 2080 N GLU A1231 8.889 31.089 30.721 1.00 25.85 N ATOM 2081 CA GLU A1231 8.992 31.342 29.283 1.00 26.93 C ATOM 2082 C GLU A1231 9.856 30.265 28.624 1.00 26.75 C ATOM 2083 O GLU A1231 9.584 29.836 27.499 1.00 27.76 O ATOM 2084 CB GLU A1231 9.579 32.734 29.020 1.00 28.66 C ATOM 2085 CG GLU A1231 8.700 33.861 29.559 1.00 32.64 C ATOM 2086 CD GLU A1231 9.271 35.248 29.309 1.00 33.20 C ATOM 2087 OE1 GLU A1231 10.496 35.436 29.461 1.00 33.48 O ATOM 2088 OE2 GLU A1231 8.486 36.161 28.976 1.00 36.08 O ATOM 2089 N ILE A1232 10.894 29.820 29.327 1.00 25.89 N ATOM 2090 CA ILE A1232 11.771 28.780 28.796 1.00 23.97 C ATOM 2091 C ILE A1232 10.991 27.480 28.605 1.00 24.30 C ATOM 2092 O ILE A1232 11.063 26.843 27.554 1.00 22.92 O ATOM 2093 CB ILE A1232 12.967 28.526 29.746 1.00 23.67 C ATOM 2094 CG1 ILE A1232 13.957 29.697 29.647 1.00 23.41 C ATOM 2095 CG2 ILE A1232 13.626 27.197 29.403 1.00 21.51 C ATOM 2096 CD1 ILE A1232 15.007 29.734 30.739 1.00 23.55 C ATOM 2097 N ILE A1233 10.245 27.091 29.630 1.00 25.00 N ATOM 2098 CA ILE A1233 9.450 25.871 29.578 1.00 26.21 C ATOM 2099 C ILE A1233 8.410 25.974 28.466 1.00 27.62 C ATOM 2100 O ILE A1233 8.208 25.039 27.689 1.00 27.64 O ATOM 2101 CB ILE A1233 8.735 25.626 30.928 1.00 26.36 C ATOM 2102 CG1 ILE A1233 9.777 25.322 32.009 1.00 25.34 C ATOM 2103 CG2 ILE A1233 7.738 24.467 30.799 1.00 25.70 C ATOM 2104 CD1 ILE A1233 9.232 25.372 33.414 1.00 24.91 C ATOM 2105 N SER A1234 7.755 27.125 28.399 1.00 28.85 N ATOM 2106 CA SER A1234 6.734 27.363 27.391 1.00 30.83 C ATOM 2107 C SER A1234 7.270 27.103 25.983 1.00 31.46 C ATOM 2108 O SER A1234 6.614 26.453 25.170 1.00 30.79 O ATOM 2109 CB SER A1234 6.243 28.803 27.498 1.00 30.85 C ATOM 2110 OG SER A1234 5.253 29.070 26.533 1.00 36.36 O ATOM 2111 N SER A1235 8.470 27.603 25.703 1.00 30.79 N ATOM 2112 CA SER A1235 9.066 27.446 24.381 1.00 31.12 C ATOM 2113 C SER A1235 9.444 26.023 23.976 1.00 30.72 C ATOM 2114 O SER A1235 9.570 25.740 22.786 1.00 31.73 O ATOM 2115 CB SER A1235 10.301 28.344 24.252 1.00 30.68 C ATOM 2116 OG SER A1235 11.358 27.861 25.060 1.00 32.75 O ATOM 2117 N ILE A1236 9.626 25.125 24.941 1.00 29.62 N ATOM 2118 CA ILE A1236 10.006 23.748 24.618 1.00 29.15 C ATOM 2119 C ILE A1236 9.008 22.695 25.088 1.00 30.05 C ATOM 2120 O ILE A1236 9.264 21.502 24.961 1.00 29.14 O ATOM 2121 CB ILE A1236 11.374 23.380 25.248 1.00 29.37 C ATOM 2122 CG1 ILE A1236 11.281 23.487 26.777 1.00 29.40 C ATOM 2123 CG2 ILE A1236 12.466 24.290 24.701 1.00 28.70 C ATOM 2124 CD1 ILE A1236 12.555 23.093 27.519 1.00 29.57 C ATOM 2125 N LYS A1237 7.879 23.131 25.628 1.00 31.86 N ATOM 2126 CA LYS A1237 6.881 22.207 26.157 1.00 34.62 C ATOM 2127 C LYS A1237 6.377 21.118 25.220 1.00 35.38 C ATOM 2128 O LYS A1237 6.024 20.027 25.677 1.00 36.10 O ATOM 2129 CB LYS A1237 5.690 22.987 26.713 1.00 35.75 C ATOM 2130 CG LYS A1237 4.982 23.865 25.706 1.00 37.84 C ATOM 2131 CD LYS A1237 3.859 24.619 26.386 1.00 39.51 C ATOM 2132 CE LYS A1237 3.277 25.688 25.483 1.00 41.71 C ATOM 2133 NZ LYS A1237 2.257 26.479 26.224 1.00 44.31 N ATOM 2134 N GLU A1238 6.339 21.392 23.919 1.00 35.40 N ATOM 2135 CA GLU A1238 5.861 20.388 22.977 1.00 35.84 C ATOM 2136 C GLU A1238 6.873 19.256 22.814 1.00 36.19 C ATOM 2137 O GLU A1238 6.537 18.179 22.319 1.00 37.25 O ATOM 2138 CB GLU A1238 5.562 21.029 21.617 1.00 35.09 C ATOM 2139 N GLU A1239 8.110 19.498 23.241 1.00 36.08 N ATOM 2140 CA GLU A1239 9.173 18.501 23.129 1.00 35.81 C ATOM 2141 C GLU A1239 9.297 17.632 24.376 1.00 35.66 C ATOM 2142 O GLU A1239 10.051 16.657 24.388 1.00 35.29 O ATOM 2143 CB GLU A1239 10.510 19.197 22.870 1.00 37.07 C ATOM 2144 CG GLU A1239 10.425 20.305 21.841 1.00 38.99 C ATOM 2145 CD GLU A1239 10.020 19.803 20.469 1.00 40.84 C ATOM 2146 OE1 GLU A1239 9.413 20.590 19.710 1.00 42.64 O ATOM 2147 OE2 GLU A1239 10.314 18.630 20.145 1.00 40.55 O ATOM 2148 N MET A1240 8.559 17.985 25.424 1.00 35.58 N ATOM 2149 CA MET A1240 8.601 17.228 26.675 1.00 35.95 C ATOM 2150 C MET A1240 7.781 15.938 26.588 1.00 37.40 C ATOM 2151 O MET A1240 6.808 15.866 25.836 1.00 38.23 O ATOM 2152 CB MET A1240 8.066 18.091 27.822 1.00 33.51 C ATOM 2153 CG MET A1240 8.839 19.385 28.056 1.00 31.62 C ATOM 2154 SD MET A1240 10.583 19.085 28.446 1.00 29.26 S ATOM 2155 CE MET A1240 10.442 18.390 30.070 1.00 29.87 C ATOM 2156 N GLU A1241 8.171 14.923 27.356 1.00 38.68 N ATOM 2157 CA GLU A1241 7.440 13.658 27.362 1.00 40.33 C ATOM 2158 C GLU A1241 6.023 13.902 27.878 1.00 40.09 C ATOM 2159 O GLU A1241 5.765 14.891 28.560 1.00 39.84 O ATOM 2160 CB GLU A1241 8.147 12.625 28.241 1.00 41.70 C ATOM 2161 CG GLU A1241 9.587 12.376 27.839 1.00 44.98 C ATOM 2162 CD GLU A1241 10.222 11.239 28.613 1.00 47.13 C ATOM 2163 OE1 GLU A1241 9.838 11.025 29.782 1.00 48.69 O ATOM 2164 OE2 GLU A1241 11.119 10.569 28.056 1.00 49.28 O ATOM 2165 N PRO A1242 5.086 12.994 27.557 1.00 40.03 N ATOM 2166 CA PRO A1242 3.682 13.094 27.968 1.00 39.72 C ATOM 2167 C PRO A1242 3.440 13.361 29.454 1.00 38.89 C ATOM 2168 O PRO A1242 2.685 14.266 29.817 1.00 38.63 O ATOM 2169 CB PRO A1242 3.099 11.749 27.528 1.00 39.66 C ATOM 2170 CG PRO A1242 3.936 11.396 26.333 1.00 40.44 C ATOM 2171 CD PRO A1242 5.319 11.742 26.813 1.00 40.20 C ATOM 2172 N GLY A1243 4.085 12.568 30.304 1.00 38.08 N ATOM 2173 CA GLY A1243 3.909 12.707 31.738 1.00 37.23 C ATOM 2174 C GLY A1243 4.357 14.008 32.380 1.00 36.38 C ATOM 2175 O GLY A1243 4.154 14.195 33.582 1.00 36.22 O ATOM 2176 N PHE A1244 4.960 14.903 31.601 1.00 35.38 N ATOM 2177 CA PHE A1244 5.426 16.181 32.134 1.00 34.51 C ATOM 2178 C PHE A1244 4.234 17.016 32.596 1.00 35.25 C ATOM 2179 O PHE A1244 4.302 17.720 33.605 1.00 33.57 O ATOM 2180 CB PHE A1244 6.206 16.953 31.062 1.00 33.30 C ATOM 2181 CG PHE A1244 6.821 18.235 31.559 1.00 30.43 C ATOM 2182 CD1 PHE A1244 7.876 18.212 32.467 1.00 29.71 C ATOM 2183 CD2 PHE A1244 6.337 19.468 31.129 1.00 30.80 C ATOM 2184 CE1 PHE A1244 8.445 19.401 32.944 1.00 27.55 C ATOM 2185 CE2 PHE A1244 6.900 20.664 31.599 1.00 30.08 C ATOM 2186 CZ PHE A1244 7.960 20.622 32.512 1.00 27.60 C ATOM 2187 N ARG A1245 3.142 16.927 31.849 1.00 36.28 N ATOM 2188 CA ARG A1245 1.930 17.673 32.159 1.00 38.25 C ATOM 2189 C ARG A1245 1.310 17.222 33.483 1.00 38.04 C ATOM 2190 O ARG A1245 0.634 17.994 34.156 1.00 38.57 O ATOM 2191 CB ARG A1245 0.921 17.495 31.018 1.00 41.21 C ATOM 2192 CG ARG A1245 1.568 17.569 29.630 1.00 44.94 C ATOM 2193 CD ARG A1245 0.582 17.345 28.477 1.00 47.83 C ATOM 2194 NE ARG A1245 -0.155 18.558 28.123 1.00 50.26 N ATOM 2195 CZ ARG A1245 -1.163 19.061 28.830 1.00 51.42 C ATOM 2196 NH1 ARG A1245 -1.572 18.454 29.937 1.00 51.49 N ATOM 2197 NH2 ARG A1245 -1.754 20.183 28.435 1.00 51.61 N ATOM 2198 N GLU A1246 1.554 15.971 33.854 1.00 38.27 N ATOM 2199 CA GLU A1246 0.999 15.407 35.080 1.00 38.26 C ATOM 2200 C GLU A1246 1.800 15.687 36.351 1.00 36.86 C ATOM 2201 O GLU A1246 1.226 15.821 37.431 1.00 37.18 O ATOM 2202 CB GLU A1246 0.849 13.891 34.926 1.00 40.55 C ATOM 2203 CG GLU A1246 -0.034 13.457 33.756 1.00 44.85 C ATOM 2204 CD GLU A1246 -0.045 11.947 33.554 1.00 46.95 C ATOM 2205 OE1 GLU A1246 0.971 11.397 33.069 1.00 47.55 O ATOM 2206 OE2 GLU A1246 -1.072 11.309 33.886 1.00 48.83 O ATOM 2207 N VAL A1247 3.120 15.776 36.229 1.00 34.12 N ATOM 2208 CA VAL A1247 3.966 15.989 37.399 1.00 32.43 C ATOM 2209 C VAL A1247 4.665 17.341 37.518 1.00 31.40 C ATOM 2210 O VAL A1247 5.228 17.656 38.567 1.00 32.16 O ATOM 2211 CB VAL A1247 5.063 14.921 37.463 1.00 32.30 C ATOM 2212 CG1 VAL A1247 4.442 13.526 37.472 1.00 31.52 C ATOM 2213 CG2 VAL A1247 6.001 15.089 36.275 1.00 32.05 C ATOM 2214 N SER A1248 4.631 18.140 36.461 1.00 29.37 N ATOM 2215 CA SER A1248 5.322 19.418 36.470 1.00 28.45 C ATOM 2216 C SER A1248 4.661 20.559 37.225 1.00 28.46 C ATOM 2217 O SER A1248 3.435 20.618 37.358 1.00 27.77 O ATOM 2218 CB SER A1248 5.576 19.878 35.034 1.00 28.85 C ATOM 2219 OG SER A1248 4.361 20.229 34.397 1.00 29.35 O ATOM 2220 N PHE A1249 5.491 21.470 37.726 1.00 26.51 N ATOM 2221 CA PHE A1249 4.978 22.651 38.410 1.00 26.75 C ATOM 2222 C PHE A1249 4.331 23.533 37.336 1.00 26.82 C ATOM 2223 O PHE A1249 3.327 24.214 37.582 1.00 27.57 O ATOM 2224 CB PHE A1249 6.117 23.428 39.070 1.00 24.98 C ATOM 2225 CG PHE A1249 5.774 24.859 39.379 1.00 26.52 C ATOM 2226 CD1 PHE A1249 4.952 25.175 40.452 1.00 25.76 C ATOM 2227 CD2 PHE A1249 6.270 25.892 38.589 1.00 25.81 C ATOM 2228 CE1 PHE A1249 4.629 26.507 40.743 1.00 26.71 C ATOM 2229 CE2 PHE A1249 5.953 27.220 38.871 1.00 26.73 C ATOM 2230 CZ PHE A1249 5.131 27.525 39.951 1.00 25.90 C ATOM 2231 N TYR A1250 4.920 23.509 36.143 1.00 25.68 N ATOM 2232 CA TYR A1250 4.432 24.305 35.022 1.00 26.44 C ATOM 2233 C TYR A1250 2.942 24.097 34.745 1.00 26.31 C ATOM 2234 O TYR A1250 2.197 25.060 34.624 1.00 25.05 O ATOM 2235 CB TYR A1250 5.222 23.977 33.750 1.00 26.67 C ATOM 2236 CG TYR A1250 4.863 24.856 32.573 1.00 28.60 C ATOM 2237 CD1 TYR A1250 5.351 26.159 32.473 1.00 27.57 C ATOM 2238 CD2 TYR A1250 3.996 24.396 31.577 1.00 28.82 C ATOM 2239 CE1 TYR A1250 4.982 26.986 31.405 1.00 29.72 C ATOM 2240 CE2 TYR A1250 3.619 25.214 30.511 1.00 29.09 C ATOM 2241 CZ TYR A1250 4.112 26.503 30.431 1.00 29.89 C ATOM 2242 OH TYR A1250 3.728 27.308 29.385 1.00 32.31 O ATOM 2243 N TYR A1251 2.513 22.844 34.642 1.00 27.48 N ATOM 2244 CA TYR A1251 1.107 22.552 34.359 1.00 29.90 C ATOM 2245 C TYR A1251 0.205 22.421 35.590 1.00 30.89 C ATOM 2246 O TYR A1251 -0.973 22.080 35.459 1.00 31.00 O ATOM 2247 CB TYR A1251 0.988 21.273 33.525 1.00 30.84 C ATOM 2248 CG TYR A1251 1.347 21.441 32.066 1.00 32.97 C ATOM 2249 CD1 TYR A1251 2.590 21.036 31.575 1.00 33.92 C ATOM 2250 CD2 TYR A1251 0.431 21.990 31.169 1.00 33.69 C ATOM 2251 CE1 TYR A1251 2.910 21.168 30.213 1.00 34.66 C ATOM 2252 CE2 TYR A1251 0.739 22.133 29.816 1.00 35.57 C ATOM 2253 CZ TYR A1251 1.975 21.718 29.344 1.00 35.59 C ATOM 2254 OH TYR A1251 2.258 21.849 28.003 1.00 36.47 O ATOM 2255 N SER A1252 0.749 22.688 36.776 1.00 30.78 N ATOM 2256 CA SER A1252 -0.028 22.581 38.006 1.00 31.50 C ATOM 2257 C SER A1252 -0.923 23.797 38.211 1.00 33.77 C ATOM 2258 O SER A1252 -0.703 24.856 37.622 1.00 32.63 O ATOM 2259 CB SER A1252 0.898 22.446 39.214 1.00 28.47 C ATOM 2260 OG SER A1252 1.443 23.708 39.556 1.00 25.98 O ATOM 2261 N GLU A1253 -1.936 23.648 39.057 1.00 38.13 N ATOM 2262 CA GLU A1253 -2.832 24.762 39.326 1.00 41.85 C ATOM 2263 C GLU A1253 -2.134 25.859 40.129 1.00 43.22 C ATOM 2264 O GLU A1253 -2.536 27.019 40.078 1.00 44.08 O ATOM 2265 CB GLU A1253 -4.084 24.273 40.058 1.00 44.10 C ATOM 2266 CG GLU A1253 -5.021 23.471 39.169 1.00 47.20 C ATOM 2267 CD GLU A1253 -6.372 23.223 39.806 1.00 49.62 C ATOM 2268 OE1 GLU A1253 -6.419 22.586 40.882 1.00 51.56 O ATOM 2269 OE2 GLU A1253 -7.389 23.666 39.230 1.00 51.17 O ATOM 2270 N GLU A1254 -1.085 25.502 40.865 1.00 45.08 N ATOM 2271 CA GLU A1254 -0.363 26.500 41.650 1.00 47.25 C ATOM 2272 C GLU A1254 0.278 27.562 40.763 1.00 48.14 C ATOM 2273 O GLU A1254 0.554 28.673 41.219 1.00 48.85 O ATOM 2274 CB GLU A1254 0.716 25.848 42.522 1.00 48.10 C ATOM 2275 CG GLU A1254 0.174 25.151 43.756 1.00 49.67 C ATOM 2276 CD GLU A1254 0.017 23.658 43.565 1.00 51.38 C ATOM 2277 OE1 GLU A1254 -0.521 23.235 42.515 1.00 51.36 O ATOM 2278 OE2 GLU A1254 0.430 22.907 44.476 1.00 52.89 O ATOM 2279 N ASN A1255 0.514 27.221 39.499 1.00 48.72 N ATOM 2280 CA ASN A1255 1.115 28.161 38.560 1.00 49.06 C ATOM 2281 C ASN A1255 0.071 28.805 37.650 1.00 49.93 C ATOM 2282 O ASN A1255 -0.331 28.225 36.639 1.00 50.04 O ATOM 2283 CB ASN A1255 2.170 27.465 37.700 1.00 47.46 C ATOM 2284 CG ASN A1255 2.689 28.359 36.598 1.00 46.80 C ATOM 2285 OD1 ASN A1255 3.088 29.495 36.848 1.00 45.76 O ATOM 2286 ND2 ASN A1255 2.685 27.856 35.370 1.00 45.96 N ATOM 2287 N LYS A1256 -0.361 30.007 38.018 1.00 51.06 N ATOM 2288 CA LYS A1256 -1.358 30.739 37.241 1.00 51.71 C ATOM 2289 C LYS A1256 -1.141 32.241 37.380 1.00 51.87 C ATOM 2290 O LYS A1256 -0.266 32.607 38.194 1.00 52.38 O ATOM 2291 CB LYS A1256 -2.769 30.374 37.713 1.00 51.43 C TER 2292 LYS A1256 ATOM 2293 N GLY B 6 39.036 24.284 41.107 1.00 40.82 N ATOM 2294 CA GLY B 6 37.941 24.473 42.100 1.00 40.78 C ATOM 2295 C GLY B 6 36.802 25.287 41.518 1.00 40.77 C ATOM 2296 O GLY B 6 37.032 26.231 40.762 1.00 41.04 O ATOM 2297 N GLU B 7 35.571 24.936 41.877 1.00 40.15 N ATOM 2298 CA GLU B 7 34.406 25.645 41.363 1.00 39.17 C ATOM 2299 C GLU B 7 34.047 26.896 42.152 1.00 37.83 C ATOM 2300 O GLU B 7 33.410 27.801 41.621 1.00 37.19 O ATOM 2301 CB GLU B 7 33.190 24.719 41.322 1.00 41.31 C ATOM 2302 CG GLU B 7 33.283 23.603 40.304 1.00 44.38 C ATOM 2303 CD GLU B 7 34.086 22.428 40.808 1.00 45.85 C ATOM 2304 OE1 GLU B 7 33.692 21.853 41.845 1.00 48.19 O ATOM 2305 OE2 GLU B 7 35.103 22.079 40.169 1.00 46.91 O ATOM 2306 N TYR B 8 34.444 26.948 43.418 1.00 35.85 N ATOM 2307 CA TYR B 8 34.138 28.111 44.236 1.00 35.08 C ATOM 2308 C TYR B 8 35.409 28.911 44.475 1.00 35.80 C ATOM 2309 O TYR B 8 36.367 28.421 45.071 1.00 36.07 O ATOM 2310 CB TYR B 8 33.491 27.679 45.551 1.00 32.23 C ATOM 2311 CG TYR B 8 32.208 26.906 45.331 1.00 30.79 C ATOM 2312 CD1 TYR B 8 32.233 25.536 45.069 1.00 29.80 C ATOM 2313 CD2 TYR B 8 30.972 27.556 45.325 1.00 29.27 C ATOM 2314 CE1 TYR B 8 31.057 24.827 44.804 1.00 28.38 C ATOM 2315 CE2 TYR B 8 29.791 26.858 45.059 1.00 28.51 C ATOM 2316 CZ TYR B 8 29.842 25.495 44.800 1.00 27.67 C ATOM 2317 OH TYR B 8 28.680 24.803 44.532 1.00 25.85 O ATOM 2318 N VAL B 9 35.396 30.148 43.994 1.00 35.98 N ATOM 2319 CA VAL B 9 36.537 31.048 44.079 1.00 36.82 C ATOM 2320 C VAL B 9 36.235 32.253 44.946 1.00 37.49 C ATOM 2321 O VAL B 9 35.115 32.757 44.956 1.00 36.73 O ATOM 2322 CB VAL B 9 36.920 31.565 42.674 1.00 37.23 C ATOM 2323 CG1 VAL B 9 38.233 32.339 42.741 1.00 37.93 C ATOM 2324 CG2 VAL B 9 37.015 30.404 41.701 1.00 35.96 C ATOM 2325 N ASN B 10 37.241 32.726 45.672 1.00 39.29 N ATOM 2326 CA ASN B 10 37.043 33.884 46.524 1.00 41.20 C ATOM 2327 C ASN B 10 36.815 35.125 45.668 1.00 41.65 C ATOM 2328 O ASN B 10 37.458 35.318 44.638 1.00 41.69 O ATOM 2329 CB ASN B 10 38.251 34.096 47.434 1.00 42.91 C ATOM 2330 CG ASN B 10 37.977 35.105 48.528 1.00 45.62 C ATOM 2331 OD1 ASN B 10 37.842 36.305 48.268 1.00 47.21 O ATOM 2332 ND2 ASN B 10 37.881 34.623 49.763 1.00 47.32 N ATOM 2333 N ILE B 11 35.883 35.960 46.106 1.00 42.19 N ATOM 2334 CA ILE B 11 35.550 37.189 45.408 1.00 43.33 C ATOM 2335 C ILE B 11 34.988 38.107 46.483 1.00 43.91 C ATOM 2336 O ILE B 11 34.255 37.661 47.366 1.00 44.07 O ATOM 2337 CB ILE B 11 34.498 36.927 44.289 1.00 43.84 C ATOM 2338 CG1 ILE B 11 34.243 38.206 43.492 1.00 43.89 C ATOM 2339 CG2 ILE B 11 33.202 36.414 44.897 1.00 43.79 C ATOM 2340 CD1 ILE B 11 33.405 37.987 42.244 1.00 43.43 C ATOM 2341 N GLU B 12 35.331 39.385 46.419 1.00 44.77 N ATOM 2342 CA GLU B 12 34.872 40.324 47.431 1.00 45.90 C ATOM 2343 C GLU B 12 34.130 41.518 46.847 1.00 45.85 C ATOM 2344 O GLU B 12 34.518 42.055 45.813 1.00 46.02 O ATOM 2345 CB GLU B 12 36.073 40.815 48.238 1.00 46.73 C ATOM 2346 CG GLU B 12 35.720 41.604 49.482 1.00 48.46 C ATOM 2347 CD GLU B 12 36.952 42.170 50.153 1.00 49.29 C ATOM 2348 OE1 GLU B 12 37.972 41.450 50.208 1.00 49.56 O ATOM 2349 OE2 GLU B 12 36.901 43.325 50.626 1.00 50.18 O ATOM 2350 N PHE B 13 33.063 41.931 47.521 1.00 46.52 N ATOM 2351 CA PHE B 13 32.274 43.069 47.071 1.00 47.14 C ATOM 2352 C PHE B 13 32.220 44.169 48.132 1.00 47.84 C ATOM 2353 O PHE B 13 31.914 43.830 49.298 1.00 48.52 O ATOM 2354 CB PHE B 13 30.856 42.618 46.715 1.00 46.83 C ATOM 2355 CG PHE B 13 30.811 41.516 45.692 1.00 46.45 C ATOM 2356 CD1 PHE B 13 30.698 40.187 46.084 1.00 46.19 C ATOM 2357 CD2 PHE B 13 30.910 41.808 44.336 1.00 46.29 C ATOM 2358 CE1 PHE B 13 30.684 39.163 45.139 1.00 45.84 C ATOM 2359 CE2 PHE B 13 30.898 40.791 43.385 1.00 45.77 C ATOM 2360 CZ PHE B 13 30.784 39.468 43.787 1.00 45.64 C TER 2361 PHE B 13 HETATM 2362 PG ACP A 300 28.187 20.375 47.993 1.00 90.63 P HETATM 2363 O1G ACP A 300 27.263 21.059 48.936 1.00 90.58 O HETATM 2364 O2G ACP A 300 29.614 20.704 48.227 1.00 90.46 O HETATM 2365 O3G ACP A 300 27.759 20.368 46.575 1.00 90.51 O HETATM 2366 PB ACP A 300 28.989 17.539 47.592 1.00 88.83 P HETATM 2367 O1B ACP A 300 29.314 17.993 46.216 1.00 88.99 O HETATM 2368 O2B ACP A 300 30.106 17.095 48.465 1.00 89.01 O HETATM 2369 C3B ACP A 300 28.121 18.761 48.386 1.00 89.61 C HETATM 2370 PA ACP A 300 26.836 16.029 48.383 1.00 84.52 P HETATM 2371 O1A ACP A 300 27.121 16.421 49.782 1.00 84.49 O HETATM 2372 O2A ACP A 300 25.591 16.500 47.731 1.00 84.46 O HETATM 2373 O3A ACP A 300 28.029 16.357 47.492 1.00 86.79 O HETATM 2374 O5' ACP A 300 26.834 14.426 48.328 1.00 82.72 O HETATM 2375 C5' ACP A 300 27.992 13.572 48.283 1.00 79.58 C HETATM 2376 C4' ACP A 300 27.603 12.316 47.539 1.00 77.81 C HETATM 2377 O4' ACP A 300 26.473 11.705 48.213 1.00 76.39 O HETATM 2378 C3' ACP A 300 27.130 12.537 46.110 1.00 77.47 C HETATM 2379 O3' ACP A 300 28.231 12.527 45.208 1.00 78.23 O HETATM 2380 C2' ACP A 300 26.209 11.347 45.874 1.00 76.55 C HETATM 2381 O2' ACP A 300 26.910 10.172 45.515 1.00 77.33 O HETATM 2382 C1' ACP A 300 25.572 11.174 47.255 1.00 75.12 C HETATM 2383 N9 ACP A 300 24.276 11.839 47.415 1.00 72.80 N HETATM 2384 C8 ACP A 300 24.015 13.074 47.962 1.00 72.08 C HETATM 2385 N7 ACP A 300 22.741 13.386 47.982 1.00 71.07 N HETATM 2386 C5 ACP A 300 22.118 12.287 47.406 1.00 70.69 C HETATM 2387 C6 ACP A 300 20.766 11.996 47.133 1.00 69.98 C HETATM 2388 N6 ACP A 300 19.753 12.819 47.426 1.00 68.35 N HETATM 2389 N1 ACP A 300 20.485 10.812 46.547 1.00 69.31 N HETATM 2390 C2 ACP A 300 21.497 9.986 46.254 1.00 70.12 C HETATM 2391 N3 ACP A 300 22.804 10.144 46.460 1.00 70.45 N HETATM 2392 C4 ACP A 300 23.052 11.329 47.045 1.00 71.44 C HETATM 2393 O HOH A 1 22.137 29.987 39.997 1.00 24.25 O HETATM 2394 O HOH A 2 28.502 21.379 37.559 1.00 17.51 O HETATM 2395 O HOH A 3 21.920 26.909 46.424 1.00 18.07 O HETATM 2396 O HOH A 4 25.752 30.702 40.361 1.00 25.78 O HETATM 2397 O HOH A 5 24.945 34.730 39.083 1.00 23.79 O HETATM 2398 O HOH A 6 29.279 31.851 33.168 1.00 21.31 O HETATM 2399 O HOH A 7 31.143 21.585 38.763 1.00 23.45 O HETATM 2400 O HOH A 8 26.341 38.277 27.657 1.00 25.42 O HETATM 2401 O HOH A 9 14.537 38.179 41.151 1.00 28.18 O HETATM 2402 O HOH A 10 9.520 12.415 36.226 1.00 25.47 O HETATM 2403 O HOH A 11 21.571 33.423 40.575 1.00 26.47 O HETATM 2404 O HOH A 12 9.808 31.932 36.081 1.00 24.12 O HETATM 2405 O HOH A 13 10.251 18.911 46.584 1.00 20.34 O HETATM 2406 O HOH A 14 29.036 37.929 28.766 1.00 23.81 O HETATM 2407 O HOH A 15 13.398 8.179 48.098 1.00 24.75 O HETATM 2408 O HOH A 16 10.832 15.265 44.323 1.00 21.60 O HETATM 2409 O HOH A 17 15.665 13.459 32.157 1.00 28.24 O HETATM 2410 O HOH A 18 26.572 27.947 40.217 1.00 21.83 O HETATM 2411 O HOH A 19 23.836 32.387 39.546 1.00 20.61 O HETATM 2412 O HOH A 20 30.537 33.584 34.558 1.00 27.88 O HETATM 2413 O HOH A 21 28.581 31.986 28.493 1.00 25.64 O HETATM 2414 O HOH A 22 9.993 14.732 34.653 1.00 22.34 O HETATM 2415 O HOH A 23 14.882 12.725 66.433 1.00 30.60 O HETATM 2416 O HOH A 24 14.789 38.625 32.433 1.00 34.28 O HETATM 2417 O HOH A 25 25.435 26.484 53.022 1.00 31.27 O HETATM 2418 O HOH A 26 30.141 16.575 40.620 1.00 33.77 O HETATM 2419 O HOH A 28 31.749 25.342 67.897 1.00 30.69 O HETATM 2420 O HOH A 29 14.812 35.957 33.696 1.00 30.39 O HETATM 2421 O HOH A 30 16.288 7.376 42.312 1.00 23.93 O HETATM 2422 O HOH A 31 1.206 19.282 36.921 1.00 26.84 O HETATM 2423 O HOH A 32 8.011 14.500 32.548 1.00 42.67 O HETATM 2424 O HOH A 33 26.860 11.491 42.483 1.00 36.55 O HETATM 2425 O HOH A 34 16.020 10.404 67.594 1.00 31.11 O HETATM 2426 O HOH A 35 21.459 41.899 26.285 1.00 29.09 O HETATM 2427 O HOH A 36 18.492 9.954 68.741 1.00 33.40 O HETATM 2428 O HOH A 37 6.597 16.223 56.219 1.00 52.42 O HETATM 2429 O HOH A 38 -2.101 20.541 39.799 1.00 31.64 O HETATM 2430 O HOH A 39 12.508 32.800 36.316 1.00 25.89 O HETATM 2431 O HOH A 40 8.498 30.990 38.113 1.00 25.67 O HETATM 2432 O HOH A 41 15.184 18.895 68.516 1.00 40.91 O HETATM 2433 O HOH A 43 7.785 5.814 54.761 1.00 35.37 O HETATM 2434 O HOH A 44 19.506 45.472 25.833 1.00 30.04 O HETATM 2435 O HOH A 45 17.722 8.373 29.609 1.00 39.92 O HETATM 2436 O HOH A 47 5.664 19.223 40.690 1.00 30.95 O HETATM 2437 O HOH A 48 43.007 33.486 38.592 1.00 36.20 O HETATM 2438 O HOH A 49 12.056 38.191 39.710 1.00 37.31 O HETATM 2439 O HOH A 50 12.933 6.960 39.622 1.00 34.19 O HETATM 2440 O HOH A 52 21.443 15.806 66.124 1.00 38.62 O HETATM 2441 O HOH A 53 13.432 24.781 60.537 1.00 41.23 O HETATM 2442 O HOH A 54 13.350 35.437 35.840 1.00 29.54 O HETATM 2443 O HOH A 55 4.164 19.389 27.476 1.00 41.74 O HETATM 2444 O HOH A 56 31.249 20.911 34.186 1.00 27.10 O HETATM 2445 O HOH A 57 19.746 28.049 17.447 1.00 39.48 O HETATM 2446 O HOH A 58 42.843 30.393 38.039 1.00 47.83 O HETATM 2447 O HOH A 59 31.592 27.673 64.845 1.00 43.83 O HETATM 2448 O HOH A 60 12.318 19.740 48.429 1.00 38.12 O HETATM 2449 O HOH A 61 12.451 8.944 41.374 1.00 40.43 O HETATM 2450 O HOH A 62 4.219 26.852 44.487 1.00 38.88 O HETATM 2451 O HOH A 63 26.219 10.703 38.752 1.00 28.12 O HETATM 2452 O HOH A 64 7.405 34.791 33.154 1.00 34.07 O HETATM 2453 O HOH A 65 11.515 26.327 56.838 1.00 31.08 O HETATM 2454 O HOH A 66 17.297 33.563 52.871 1.00 43.41 O HETATM 2455 O HOH A 67 24.267 8.457 44.546 1.00 38.80 O HETATM 2456 O HOH A 69 11.432 4.072 48.149 1.00 35.05 O HETATM 2457 O HOH A 70 10.772 11.020 40.667 1.00 37.02 O HETATM 2458 O HOH A 71 24.997 3.953 44.283 1.00 43.64 O HETATM 2459 O HOH A 72 23.451 6.060 35.463 1.00 45.73 O HETATM 2460 O HOH A 73 32.220 14.620 38.020 1.00 37.33 O HETATM 2461 O HOH A 74 13.693 1.406 44.713 1.00 48.16 O HETATM 2462 O HOH A 75 22.511 6.538 30.501 1.00 42.94 O HETATM 2463 O HOH A 76 24.836 42.218 33.193 1.00 32.38 O HETATM 2464 O HOH A 77 25.981 28.233 22.712 1.00 29.46 O HETATM 2465 O HOH A 78 32.320 22.917 23.374 1.00 48.86 O HETATM 2466 O HOH A 79 16.510 12.998 29.553 1.00 34.25 O HETATM 2467 O HOH A 80 45.514 30.182 32.390 1.00 44.39 O HETATM 2468 O HOH A 81 18.649 0.766 42.899 1.00 47.59 O HETATM 2469 O HOH A 82 26.554 14.855 54.851 1.00 30.76 O HETATM 2470 O HOH A 83 6.818 22.741 55.460 1.00 45.68 O HETATM 2471 O HOH A 84 24.057 29.805 21.544 1.00 35.34 O HETATM 2472 O HOH A 85 24.932 7.469 37.185 1.00 46.73 O HETATM 2473 O HOH A 86 27.606 30.708 22.713 1.00 35.85 O HETATM 2474 O HOH A 87 26.976 23.102 51.189 1.00 39.11 O HETATM 2475 O HOH A 88 9.637 10.018 38.354 1.00 35.11 O HETATM 2476 O HOH A 89 12.916 -4.328 51.504 1.00 45.03 O HETATM 2477 O HOH A 90 3.786 30.704 39.114 1.00 44.49 O HETATM 2478 O HOH A 91 18.854 11.664 32.681 1.00 40.60 O HETATM 2479 O HOH A 92 13.377 9.630 43.738 1.00 34.97 O HETATM 2480 O HOH A 93 26.928 29.602 60.404 1.00 49.22 O HETATM 2481 O HOH A 94 23.211 24.862 45.756 1.00 43.49 O HETATM 2482 O HOH A 95 24.506 23.885 52.760 1.00 42.23 O HETATM 2483 O HOH A 97 26.929 17.398 53.963 1.00 53.66 O HETATM 2484 O HOH A 98 26.377 18.429 51.202 1.00 49.22 O HETATM 2485 O HOH A 100 24.321 17.340 43.977 1.00 42.11 O HETATM 2486 O HOH A 101 24.964 20.989 50.603 1.00 63.81 O HETATM 2487 O HOH A 102 26.108 25.416 47.344 1.00 54.19 O HETATM 2488 O HOH A 103 23.111 26.758 54.643 1.00 39.22 O HETATM 2489 O HOH A 104 5.052 20.803 55.640 1.00 37.86 O HETATM 2490 O HOH A 105 11.313 19.059 50.627 1.00 33.05 O HETATM 2491 O HOH A 106 13.990 39.942 39.438 1.00 52.24 O HETATM 2492 O HOH A 107 27.194 32.974 49.723 1.00 31.57 O HETATM 2493 O HOH A 108 21.058 36.732 54.272 1.00 47.71 O HETATM 2494 O HOH A 109 18.121 1.998 49.995 1.00 29.42 O HETATM 2495 O HOH A 110 6.193 22.676 60.202 1.00 54.23 O HETATM 2496 O HOH A 111 16.261 21.710 17.961 1.00 55.38 O HETATM 2497 O HOH A 112 15.057 -4.883 50.272 1.00 39.14 O HETATM 2498 O HOH A 113 27.054 43.687 34.078 1.00 36.69 O HETATM 2499 O HOH A 114 12.294 11.767 33.039 1.00 35.68 O HETATM 2500 O HOH A 116 15.067 21.595 67.590 1.00 37.18 O HETATM 2501 O HOH A 117 32.656 21.284 36.411 1.00 45.07 O HETATM 2502 O HOH A 118 20.381 40.057 37.939 1.00 41.60 O HETATM 2503 O HOH A 119 29.326 1.277 52.677 1.00 45.29 O HETATM 2504 O HOH A 121 33.859 27.702 25.719 1.00 39.14 O HETATM 2505 O HOH A 122 16.017 3.348 34.593 1.00 39.15 O HETATM 2506 O HOH A 123 23.977 5.637 32.473 1.00 42.29 O HETATM 2507 O HOH A 124 23.155 30.578 18.925 1.00 43.77 O HETATM 2508 O HOH A 126 25.217 31.856 22.671 1.00 37.23 O HETATM 2509 O HOH A 127 2.659 22.591 41.848 1.00 43.18 O HETATM 2510 O HOH A 128 27.050 30.876 62.822 1.00 43.57 O HETATM 2511 O HOH A 129 34.139 39.714 54.500 1.00 42.22 O HETATM 2512 O HOH A 130 9.664 22.256 61.236 1.00 43.83 O HETATM 2513 O HOH A 131 12.664 13.436 71.519 1.00 43.94 O HETATM 2514 O HOH A 132 20.327 41.282 49.889 1.00 45.31 O HETATM 2515 O HOH A 133 31.509 37.374 48.793 1.00 46.23 O HETATM 2516 O HOH A 134 9.354 13.811 58.712 1.00 43.10 O HETATM 2517 O HOH A 135 8.605 7.368 47.689 1.00 46.66 O HETATM 2518 O HOH A 136 5.029 33.683 31.890 1.00 48.57 O HETATM 2519 O HOH A 137 35.485 27.292 21.198 1.00 46.51 O HETATM 2520 O HOH A 138 8.022 34.150 35.973 1.00 46.38 O HETATM 2521 O HOH A 139 18.323 44.117 35.949 1.00 43.47 O HETATM 2522 O HOH A 140 12.199 3.278 45.740 1.00 43.53 O HETATM 2523 O HOH A 141 11.674 38.458 29.581 1.00 48.58 O HETATM 2524 O HOH A 142 21.078 19.793 55.157 1.00 41.59 O HETATM 2525 O HOH A 143 25.520 45.197 36.030 1.00 42.70 O HETATM 2526 O HOH A 144 24.067 -2.119 57.839 1.00 47.84 O HETATM 2527 O HOH A 145 13.817 1.093 42.142 1.00 45.12 O HETATM 2528 O HOH A 146 22.117 7.414 63.254 1.00 36.34 O HETATM 2529 O HOH A 147 16.334 10.543 72.822 1.00 43.60 O HETATM 2530 O HOH A 148 38.999 24.750 33.957 1.00 59.12 O HETATM 2531 O HOH A 149 18.797 11.077 71.789 1.00 37.85 O HETATM 2532 O HOH A 150 8.548 12.865 55.304 1.00 35.43 O HETATM 2533 O HOH A 151 4.308 6.026 56.071 1.00 49.56 O HETATM 2534 O HOH A 152 5.097 23.151 50.408 1.00 56.67 O HETATM 2535 O HOH A 153 14.236 5.016 45.399 1.00 36.39 O HETATM 2536 O HOH A 154 13.623 7.565 45.484 1.00 45.30 O HETATM 2537 O HOH A 155 18.351 10.762 30.241 1.00 37.76 O HETATM 2538 O HOH A 156 14.282 39.792 49.638 1.00 44.76 O HETATM 2539 O HOH A 157 20.304 30.492 18.431 1.00 34.66 O HETATM 2540 O HOH A 158 28.549 22.226 45.041 1.00 43.12 O HETATM 2541 O HOH A 159 8.058 20.451 52.200 1.00 55.46 O HETATM 2542 O HOH A 160 41.352 32.088 42.084 1.00 52.59 O HETATM 2543 O HOH A 164 25.927 18.489 45.653 1.00 60.51 O HETATM 2544 O HOH B 27 36.625 28.028 38.866 1.00 28.39 O HETATM 2545 O HOH B 42 33.849 28.516 39.086 1.00 22.93 O HETATM 2546 O HOH B 51 36.441 34.000 51.717 1.00 74.17 O HETATM 2547 O HOH B 96 29.721 25.703 49.289 1.00 62.96 O HETATM 2548 O HOH B 99 31.721 19.360 40.533 1.00 37.77 O HETATM 2549 O HOH B 115 39.847 31.335 45.674 1.00 41.98 O HETATM 2550 O HOH B 125 35.930 24.489 44.770 1.00 44.28 O CONECT 1251 1257 CONECT 1257 1251 1258 CONECT 1258 1257 1259 1261 CONECT 1259 1258 1260 1273 CONECT 1260 1259 CONECT 1261 1258 1262 CONECT 1262 1261 1263 1264 CONECT 1263 1262 1265 CONECT 1264 1262 1266 CONECT 1265 1263 1267 CONECT 1266 1264 1267 CONECT 1267 1265 1266 1268 CONECT 1268 1267 1269 CONECT 1269 1268 1270 1271 1272 CONECT 1270 1269 CONECT 1271 1269 CONECT 1272 1269 CONECT 1273 1259 CONECT 1287 1293 CONECT 1293 1287 1294 CONECT 1294 1293 1295 1297 CONECT 1295 1294 1296 1309 CONECT 1296 1295 CONECT 1297 1294 1298 CONECT 1298 1297 1299 1300 CONECT 1299 1298 1301 CONECT 1300 1298 1302 CONECT 1301 1299 1303 CONECT 1302 1300 1303 CONECT 1303 1301 1302 1304 CONECT 1304 1303 1305 CONECT 1305 1304 1306 1307 1308 CONECT 1306 1305 CONECT 1307 1305 CONECT 1308 1305 CONECT 1309 1295 1310 CONECT 1310 1309 1311 1313 CONECT 1311 1310 1312 1325 CONECT 1312 1311 CONECT 1313 1310 1314 CONECT 1314 1313 1315 1316 CONECT 1315 1314 1317 CONECT 1316 1314 1318 CONECT 1317 1315 1319 CONECT 1318 1316 1319 CONECT 1319 1317 1318 1320 CONECT 1320 1319 1321 CONECT 1321 1320 1322 1323 1324 CONECT 1322 1321 CONECT 1323 1321 CONECT 1324 1321 CONECT 1325 1311 CONECT 2362 2363 2364 2365 2369 CONECT 2363 2362 CONECT 2364 2362 CONECT 2365 2362 CONECT 2366 2367 2368 2369 2373 CONECT 2367 2366 CONECT 2368 2366 CONECT 2369 2362 2366 CONECT 2370 2371 2372 2373 2374 CONECT 2371 2370 CONECT 2372 2370 CONECT 2373 2366 2370 CONECT 2374 2370 2375 CONECT 2375 2374 2376 CONECT 2376 2375 2377 2378 CONECT 2377 2376 2382 CONECT 2378 2376 2379 2380 CONECT 2379 2378 CONECT 2380 2378 2381 2382 CONECT 2381 2380 CONECT 2382 2377 2380 2383 CONECT 2383 2382 2384 2392 CONECT 2384 2383 2385 CONECT 2385 2384 2386 CONECT 2386 2385 2387 2392 CONECT 2387 2386 2388 2389 CONECT 2388 2387 CONECT 2389 2387 2390 CONECT 2390 2389 2391 CONECT 2391 2390 2392 CONECT 2392 2383 2386 2391 MASTER 312 0 4 15 13 0 5 6 2548 2 83 25 END