>>2VGZ:HELIX   16  16 SER A  296  THR A  342  1                                  47    
STFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 16 SER A 296 THR A 342 1 47 ATOM 2227 N SER A 296 35.798 33.450 55.253 1.00 30.04 N ATOM 2228 CA SER A 296 35.557 33.710 56.672 1.00 31.17 C ATOM 2229 C SER A 296 36.837 33.526 57.496 1.00 30.83 C ATOM 2230 O SER A 296 37.499 32.481 57.392 1.00 30.71 O ATOM 2231 CB SER A 296 34.509 32.726 57.167 1.00 31.62 C ATOM 2232 OG SER A 296 34.447 32.794 58.580 1.00 36.24 O ATOM 2233 N THR A 297 37.218 34.564 58.241 1.00 30.50 N ATOM 2234 CA THR A 297 38.430 34.533 59.048 1.00 29.51 C ATOM 2235 C THR A 297 38.246 33.556 60.194 1.00 29.60 C ATOM 2236 O THR A 297 39.143 32.760 60.499 1.00 29.98 O ATOM 2237 CB THR A 297 38.724 35.899 59.603 1.00 29.56 C ATOM 2238 OG1 THR A 297 38.559 36.868 58.548 1.00 29.36 O ATOM 2239 CG2 THR A 297 40.173 35.955 60.225 1.00 28.25 C ATOM 2240 N PHE A 298 37.078 33.632 60.804 1.00 29.13 N ATOM 2241 CA PHE A 298 36.612 32.729 61.847 1.00 30.19 C ATOM 2242 C PHE A 298 36.768 31.269 61.398 1.00 28.86 C ATOM 2243 O PHE A 298 37.449 30.501 62.042 1.00 29.12 O ATOM 2244 CB PHE A 298 35.121 33.074 62.217 1.00 30.41 C ATOM 2245 CG PHE A 298 34.627 32.410 63.509 1.00 34.07 C ATOM 2246 CD1 PHE A 298 34.557 33.131 64.719 1.00 38.03 C ATOM 2247 CD2 PHE A 298 34.238 31.097 63.525 1.00 35.35 C ATOM 2248 CE1 PHE A 298 34.106 32.517 65.910 1.00 40.12 C ATOM 2249 CE2 PHE A 298 33.816 30.465 64.714 1.00 38.31 C ATOM 2250 CZ PHE A 298 33.743 31.173 65.906 1.00 36.81 C ATOM 2251 N ASN A 299 36.165 30.902 60.270 1.00 28.65 N ATOM 2252 CA ASN A 299 36.236 29.524 59.780 1.00 27.68 C ATOM 2253 C ASN A 299 37.652 29.077 59.438 1.00 27.91 C ATOM 2254 O ASN A 299 38.033 27.927 59.712 1.00 27.23 O ATOM 2255 CB ASN A 299 35.325 29.340 58.592 1.00 27.48 C ATOM 2256 CG ASN A 299 33.854 29.590 58.935 1.00 30.60 C ATOM 2257 OD1 ASN A 299 33.510 29.848 60.098 1.00 31.24 O ATOM 2258 ND2 ASN A 299 32.980 29.488 57.925 1.00 30.33 N ATOM 2259 N GLN A 300 38.430 29.982 58.849 1.00 27.01 N ATOM 2260 CA GLN A 300 39.822 29.672 58.519 1.00 28.27 C ATOM 2261 C GLN A 300 40.663 29.432 59.769 1.00 28.29 C ATOM 2262 O GLN A 300 41.459 28.484 59.819 1.00 27.67 O ATOM 2263 CB GLN A 300 40.446 30.823 57.778 1.00 27.09 C ATOM 2264 CG GLN A 300 40.107 30.909 56.320 1.00 26.19 C ATOM 2265 CD GLN A 300 40.935 32.013 55.704 1.00 26.02 C ATOM 2266 OE1 GLN A 300 42.092 31.787 55.360 1.00 24.87 O ATOM 2267 NE2 GLN A 300 40.382 33.232 55.648 1.00 18.64 N ATOM 2268 N LEU A 301 40.488 30.297 60.767 1.00 29.04 N ATOM 2269 CA LEU A 301 41.152 30.096 62.053 1.00 30.48 C ATOM 2270 C LEU A 301 40.707 28.786 62.732 1.00 31.56 C ATOM 2271 O LEU A 301 41.562 28.091 63.276 1.00 32.95 O ATOM 2272 CB LEU A 301 40.970 31.292 62.972 1.00 30.76 C ATOM 2273 CG LEU A 301 41.784 32.575 62.717 1.00 30.56 C ATOM 2274 CD1 LEU A 301 41.244 33.694 63.599 1.00 29.43 C ATOM 2275 CD2 LEU A 301 43.259 32.366 63.055 1.00 27.45 C ATOM 2276 N MET A 302 39.427 28.400 62.677 1.00 31.27 N ATOM 2277 CA MET A 302 39.035 27.109 63.290 1.00 31.84 C ATOM 2278 C MET A 302 39.794 25.959 62.616 1.00 31.69 C ATOM 2279 O MET A 302 40.283 25.038 63.272 1.00 30.80 O ATOM 2280 CB MET A 302 37.546 26.782 63.134 1.00 31.26 C ATOM 2281 CG MET A 302 36.497 27.754 63.704 1.00 35.24 C ATOM 2282 SD MET A 302 34.777 27.299 63.110 1.00 34.28 S ATOM 2283 CE MET A 302 34.695 25.590 63.610 1.00 32.24 C ATOM 2284 N ILE A 303 39.814 25.974 61.291 1.00 31.63 N ATOM 2285 CA ILE A 303 40.497 24.930 60.510 1.00 31.93 C ATOM 2286 C ILE A 303 42.018 24.956 60.716 1.00 31.98 C ATOM 2287 O ILE A 303 42.655 23.904 60.871 1.00 30.98 O ATOM 2288 CB ILE A 303 40.136 25.041 59.003 1.00 31.88 C ATOM 2289 CG1 ILE A 303 38.706 24.567 58.808 1.00 33.79 C ATOM 2290 CG2 ILE A 303 41.089 24.202 58.121 1.00 32.56 C ATOM 2291 CD1 ILE A 303 38.187 24.744 57.402 1.00 37.70 C ATOM 2292 N SER A 304 42.595 26.156 60.731 1.00 31.49 N ATOM 2293 CA SER A 304 44.023 26.270 60.933 1.00 32.51 C ATOM 2294 C SER A 304 44.448 25.634 62.285 1.00 32.76 C ATOM 2295 O SER A 304 45.420 24.849 62.356 1.00 32.16 O ATOM 2296 CB SER A 304 44.441 27.745 60.846 1.00 32.56 C ATOM 2297 OG SER A 304 45.833 27.809 60.549 1.00 36.63 O ATOM 2298 N GLN A 305 43.721 25.961 63.355 1.00 33.22 N ATOM 2299 CA GLN A 305 44.042 25.434 64.700 1.00 34.07 C ATOM 2300 C GLN A 305 43.944 23.926 64.717 1.00 34.44 C ATOM 2301 O GLN A 305 44.828 23.238 65.274 1.00 34.05 O ATOM 2302 CB GLN A 305 43.144 26.049 65.776 1.00 33.92 C ATOM 2303 CG GLN A 305 43.725 27.347 66.315 1.00 38.73 C ATOM 2304 CD GLN A 305 43.112 27.801 67.624 1.00 48.62 C ATOM 2305 OE1 GLN A 305 43.139 27.087 68.671 1.00 50.97 O ATOM 2306 NE2 GLN A 305 42.548 29.009 67.593 1.00 52.53 N ATOM 2307 N LEU A 306 42.884 23.413 64.068 1.00 33.45 N ATOM 2308 CA LEU A 306 42.691 21.998 63.903 1.00 32.87 C ATOM 2309 C LEU A 306 43.879 21.371 63.199 1.00 32.87 C ATOM 2310 O LEU A 306 44.416 20.375 63.654 1.00 32.13 O ATOM 2311 CB LEU A 306 41.463 21.732 63.053 1.00 32.98 C ATOM 2312 CG LEU A 306 41.106 20.268 62.842 1.00 33.82 C ATOM 2313 CD1 LEU A 306 40.574 19.661 64.126 1.00 35.31 C ATOM 2314 CD2 LEU A 306 40.116 20.088 61.694 1.00 34.07 C ATOM 2315 N LEU A 307 44.276 21.937 62.062 1.00 33.00 N ATOM 2316 CA LEU A 307 45.288 21.269 61.261 1.00 32.96 C ATOM 2317 C LEU A 307 46.669 21.337 61.928 1.00 33.45 C ATOM 2318 O LEU A 307 47.432 20.383 61.806 1.00 32.86 O ATOM 2319 CB LEU A 307 45.318 21.776 59.812 1.00 32.82 C ATOM 2320 CG LEU A 307 44.013 21.621 58.998 1.00 33.77 C ATOM 2321 CD1 LEU A 307 44.167 22.305 57.676 1.00 31.96 C ATOM 2322 CD2 LEU A 307 43.592 20.179 58.783 1.00 32.97 C ATOM 2323 N HIS A 308 46.975 22.448 62.607 1.00 32.99 N ATOM 2324 CA HIS A 308 48.294 22.631 63.204 1.00 35.51 C ATOM 2325 C HIS A 308 48.447 21.725 64.407 1.00 36.13 C ATOM 2326 O HIS A 308 49.498 21.120 64.592 1.00 35.74 O ATOM 2327 CB HIS A 308 48.571 24.091 63.624 1.00 35.72 C ATOM 2328 CG HIS A 308 48.852 24.992 62.471 1.00 36.63 C ATOM 2329 ND1 HIS A 308 50.118 25.452 62.175 1.00 41.53 N ATOM 2330 CD2 HIS A 308 48.037 25.496 61.521 1.00 35.10 C ATOM 2331 CE1 HIS A 308 50.066 26.223 61.103 1.00 39.92 C ATOM 2332 NE2 HIS A 308 48.812 26.260 60.684 1.00 40.01 N ATOM 2333 N GLU A 309 47.387 21.624 65.193 1.00 36.59 N ATOM 2334 CA GLU A 309 47.340 20.651 66.260 1.00 38.13 C ATOM 2335 C GLU A 309 47.442 19.206 65.781 1.00 37.89 C ATOM 2336 O GLU A 309 48.128 18.407 66.413 1.00 36.51 O ATOM 2337 CB GLU A 309 46.117 20.867 67.160 1.00 38.28 C ATOM 2338 CG GLU A 309 46.139 20.080 68.472 1.00 44.90 C ATOM 2339 CD GLU A 309 47.543 19.973 69.117 1.00 53.93 C ATOM 2340 OE1 GLU A 309 48.266 21.015 69.156 1.00 57.62 O ATOM 2341 OE2 GLU A 309 47.909 18.850 69.593 1.00 55.62 O ATOM 2342 N TRP A 310 46.782 18.864 64.673 1.00 37.96 N ATOM 2343 CA TRP A 310 46.849 17.483 64.190 1.00 38.30 C ATOM 2344 C TRP A 310 48.202 17.161 63.601 1.00 39.19 C ATOM 2345 O TRP A 310 48.651 16.011 63.685 1.00 38.90 O ATOM 2346 CB TRP A 310 45.836 17.216 63.099 1.00 37.58 C ATOM 2347 CG TRP A 310 44.562 16.746 63.565 1.00 37.64 C ATOM 2348 CD1 TRP A 310 44.245 16.298 64.820 1.00 37.51 C ATOM 2349 CD2 TRP A 310 43.369 16.644 62.777 1.00 37.65 C ATOM 2350 NE1 TRP A 310 42.920 15.921 64.863 1.00 38.04 N ATOM 2351 CE2 TRP A 310 42.362 16.105 63.614 1.00 38.88 C ATOM 2352 CE3 TRP A 310 43.066 16.909 61.431 1.00 37.57 C ATOM 2353 CZ2 TRP A 310 41.048 15.858 63.153 1.00 37.46 C ATOM 2354 CZ3 TRP A 310 41.754 16.650 60.969 1.00 38.51 C ATOM 2355 CH2 TRP A 310 40.767 16.128 61.839 1.00 37.18 C ATOM 2356 N GLY A 311 48.817 18.166 62.963 1.00 40.29 N ATOM 2357 CA GLY A 311 49.996 17.974 62.121 1.00 41.93 C ATOM 2358 C GLY A 311 49.615 17.127 60.930 1.00 44.21 C ATOM 2359 O GLY A 311 48.486 16.649 60.846 1.00 44.17 O ATOM 2360 N GLU A 312 50.551 16.913 60.006 1.00 46.21 N ATOM 2361 CA GLU A 312 50.276 16.096 58.817 1.00 48.53 C ATOM 2362 C GLU A 312 49.802 14.662 59.178 1.00 47.76 C ATOM 2363 O GLU A 312 48.968 14.070 58.480 1.00 48.17 O ATOM 2364 CB GLU A 312 51.503 16.129 57.862 1.00 49.28 C ATOM 2365 CG GLU A 312 51.611 17.491 57.050 1.00 51.40 C ATOM 2366 CD GLU A 312 53.053 17.947 56.588 1.00 52.51 C ATOM 2367 OE1 GLU A 312 54.104 17.310 56.911 1.00 54.41 O ATOM 2368 OE2 GLU A 312 53.117 18.999 55.892 1.00 57.39 O ATOM 2369 N GLU A 313 50.311 14.116 60.282 1.00 47.44 N ATOM 2370 CA GLU A 313 49.981 12.750 60.688 1.00 46.55 C ATOM 2371 C GLU A 313 48.552 12.584 61.222 1.00 44.96 C ATOM 2372 O GLU A 313 47.853 11.637 60.828 1.00 45.01 O ATOM 2373 CB GLU A 313 50.999 12.212 61.702 1.00 47.36 C ATOM 2374 CG GLU A 313 52.437 11.906 61.107 1.00 53.74 C ATOM 2375 CD GLU A 313 52.503 10.693 60.114 1.00 59.76 C ATOM 2376 OE1 GLU A 313 52.007 10.832 58.956 1.00 61.11 O ATOM 2377 OE2 GLU A 313 53.069 9.613 60.493 1.00 60.49 O ATOM 2378 N GLY A 314 48.125 13.484 62.119 1.00 42.31 N ATOM 2379 CA GLY A 314 46.766 13.470 62.634 1.00 38.78 C ATOM 2380 C GLY A 314 45.767 13.724 61.505 1.00 37.50 C ATOM 2381 O GLY A 314 44.670 13.126 61.484 1.00 36.12 O ATOM 2382 N PHE A 315 46.162 14.577 60.551 1.00 36.25 N ATOM 2383 CA PHE A 315 45.343 14.824 59.369 1.00 36.94 C ATOM 2384 C PHE A 315 45.155 13.546 58.532 1.00 36.61 C ATOM 2385 O PHE A 315 44.021 13.133 58.247 1.00 36.53 O ATOM 2386 CB PHE A 315 45.875 15.996 58.510 1.00 36.46 C ATOM 2387 CG PHE A 315 45.037 16.270 57.252 1.00 38.03 C ATOM 2388 CD1 PHE A 315 43.785 16.870 57.336 1.00 37.14 C ATOM 2389 CD2 PHE A 315 45.509 15.920 55.995 1.00 39.84 C ATOM 2390 CE1 PHE A 315 43.020 17.133 56.195 1.00 40.07 C ATOM 2391 CE2 PHE A 315 44.751 16.169 54.829 1.00 39.63 C ATOM 2392 CZ PHE A 315 43.509 16.794 54.936 1.00 39.84 C ATOM 2393 N MET A 316 46.263 12.917 58.149 1.00 37.08 N ATOM 2394 CA MET A 316 46.180 11.650 57.427 1.00 37.28 C ATOM 2395 C MET A 316 45.486 10.541 58.245 1.00 36.40 C ATOM 2396 O MET A 316 44.752 9.760 57.690 1.00 36.53 O ATOM 2397 CB MET A 316 47.559 11.245 56.851 1.00 38.53 C ATOM 2398 CG MET A 316 48.047 12.230 55.696 1.00 42.52 C ATOM 2399 SD MET A 316 46.986 12.407 54.205 1.00 41.46 S ATOM 2400 CE MET A 316 46.673 14.082 54.258 1.00 43.12 C ATOM 2401 N ALA A 317 45.647 10.493 59.567 1.00 36.12 N ATOM 2402 CA ALA A 317 44.863 9.522 60.358 1.00 35.46 C ATOM 2403 C ALA A 317 43.365 9.864 60.266 1.00 35.58 C ATOM 2404 O ALA A 317 42.525 8.986 60.085 1.00 36.38 O ATOM 2405 CB ALA A 317 45.322 9.505 61.803 1.00 34.16 C ATOM 2406 N HIS A 318 43.010 11.141 60.363 1.00 35.39 N ATOM 2407 CA HIS A 318 41.584 11.477 60.200 1.00 35.69 C ATOM 2408 C HIS A 318 41.092 11.065 58.822 1.00 36.30 C ATOM 2409 O HIS A 318 40.008 10.490 58.686 1.00 37.56 O ATOM 2410 CB HIS A 318 41.335 12.944 60.445 1.00 34.66 C ATOM 2411 CG HIS A 318 40.012 13.417 59.948 1.00 35.43 C ATOM 2412 ND1 HIS A 318 38.829 13.104 60.578 1.00 33.57 N ATOM 2413 CD2 HIS A 318 39.681 14.185 58.884 1.00 35.58 C ATOM 2414 CE1 HIS A 318 37.824 13.656 59.932 1.00 32.66 C ATOM 2415 NE2 HIS A 318 38.313 14.325 58.903 1.00 35.67 N ATOM 2416 N VAL A 319 41.905 11.310 57.801 1.00 36.64 N ATOM 2417 CA VAL A 319 41.494 10.978 56.436 1.00 37.15 C ATOM 2418 C VAL A 319 41.274 9.491 56.299 1.00 37.85 C ATOM 2419 O VAL A 319 40.330 9.051 55.645 1.00 38.50 O ATOM 2420 CB VAL A 319 42.553 11.452 55.380 1.00 36.52 C ATOM 2421 CG1 VAL A 319 42.381 10.737 54.072 1.00 35.73 C ATOM 2422 CG2 VAL A 319 42.466 12.934 55.187 1.00 36.17 C ATOM 2423 N ASP A 320 42.173 8.715 56.893 1.00 39.34 N ATOM 2424 CA ASP A 320 42.050 7.250 56.926 1.00 40.25 C ATOM 2425 C ASP A 320 40.758 6.721 57.529 1.00 39.32 C ATOM 2426 O ASP A 320 40.130 5.844 56.950 1.00 38.25 O ATOM 2427 CB ASP A 320 43.227 6.673 57.674 1.00 42.22 C ATOM 2428 CG ASP A 320 44.254 6.141 56.746 1.00 47.17 C ATOM 2429 OD1 ASP A 320 44.017 4.973 56.288 1.00 53.16 O ATOM 2430 OD2 ASP A 320 45.252 6.889 56.468 1.00 50.18 O ATOM 2431 N ARG A 321 40.355 7.281 58.675 1.00 39.15 N ATOM 2432 CA ARG A 321 39.016 6.999 59.247 1.00 39.72 C ATOM 2433 C ARG A 321 37.787 7.333 58.362 1.00 39.04 C ATOM 2434 O ARG A 321 36.789 6.612 58.378 1.00 38.80 O ATOM 2435 CB ARG A 321 38.858 7.726 60.582 1.00 39.81 C ATOM 2436 CG ARG A 321 39.809 7.229 61.668 1.00 40.86 C ATOM 2437 CD ARG A 321 39.413 7.767 63.036 1.00 43.01 C ATOM 2438 NE ARG A 321 39.652 9.207 63.188 1.00 44.73 N ATOM 2439 CZ ARG A 321 40.839 9.747 63.483 1.00 43.32 C ATOM 2440 NH1 ARG A 321 41.915 8.977 63.606 1.00 41.79 N ATOM 2441 NH2 ARG A 321 40.947 11.068 63.626 1.00 42.04 N ATOM 2442 N VAL A 322 37.846 8.448 57.625 1.00 38.98 N ATOM 2443 CA VAL A 322 36.750 8.836 56.689 1.00 37.88 C ATOM 2444 C VAL A 322 36.658 7.863 55.485 1.00 37.30 C ATOM 2445 O VAL A 322 35.552 7.422 55.117 1.00 35.75 O ATOM 2446 CB VAL A 322 36.914 10.295 56.236 1.00 38.40 C ATOM 2447 CG1 VAL A 322 35.822 10.685 55.270 1.00 38.71 C ATOM 2448 CG2 VAL A 322 36.881 11.218 57.469 1.00 39.05 C ATOM 2449 N ILE A 323 37.817 7.525 54.894 1.00 37.16 N ATOM 2450 CA ILE A 323 37.907 6.493 53.844 1.00 38.53 C ATOM 2451 C ILE A 323 37.285 5.167 54.346 1.00 39.20 C ATOM 2452 O ILE A 323 36.417 4.645 53.681 1.00 39.83 O ATOM 2453 CB ILE A 323 39.389 6.218 53.380 1.00 38.60 C ATOM 2454 CG1 ILE A 323 40.015 7.483 52.774 1.00 40.03 C ATOM 2455 CG2 ILE A 323 39.418 5.082 52.344 1.00 39.23 C ATOM 2456 CD1 ILE A 323 41.503 7.364 52.389 1.00 38.39 C ATOM 2457 N ASP A 324 37.699 4.669 55.529 1.00 39.76 N ATOM 2458 CA ASP A 324 37.178 3.408 56.097 1.00 40.48 C ATOM 2459 C ASP A 324 35.643 3.509 56.230 1.00 38.79 C ATOM 2460 O ASP A 324 34.890 2.634 55.783 1.00 38.35 O ATOM 2461 CB ASP A 324 37.826 3.063 57.458 1.00 41.10 C ATOM 2462 CG ASP A 324 39.360 2.710 57.361 1.00 48.46 C ATOM 2463 OD1 ASP A 324 39.872 2.195 56.304 1.00 54.18 O ATOM 2464 OD2 ASP A 324 40.072 2.939 58.386 1.00 53.04 O ATOM 2465 N PHE A 325 35.161 4.588 56.813 1.00 37.81 N ATOM 2466 CA PHE A 325 33.711 4.762 56.800 1.00 37.37 C ATOM 2467 C PHE A 325 33.037 4.697 55.408 1.00 37.43 C ATOM 2468 O PHE A 325 32.088 3.933 55.228 1.00 37.87 O ATOM 2469 CB PHE A 325 33.252 6.010 57.547 1.00 36.64 C ATOM 2470 CG PHE A 325 31.788 6.262 57.394 1.00 36.87 C ATOM 2471 CD1 PHE A 325 30.867 5.562 58.184 1.00 37.78 C ATOM 2472 CD2 PHE A 325 31.310 7.124 56.396 1.00 35.45 C ATOM 2473 CE1 PHE A 325 29.460 5.759 58.034 1.00 36.68 C ATOM 2474 CE2 PHE A 325 29.936 7.323 56.219 1.00 36.61 C ATOM 2475 CZ PHE A 325 28.989 6.615 57.059 1.00 36.14 C ATOM 2476 N TYR A 326 33.502 5.492 54.442 1.00 36.98 N ATOM 2477 CA TYR A 326 32.865 5.539 53.128 1.00 36.31 C ATOM 2478 C TYR A 326 33.040 4.228 52.433 1.00 37.38 C ATOM 2479 O TYR A 326 32.156 3.787 51.671 1.00 37.27 O ATOM 2480 CB TYR A 326 33.412 6.692 52.235 1.00 35.49 C ATOM 2481 CG TYR A 326 32.741 8.008 52.535 1.00 34.55 C ATOM 2482 CD1 TYR A 326 31.585 8.382 51.863 1.00 35.43 C ATOM 2483 CD2 TYR A 326 33.226 8.858 53.530 1.00 33.79 C ATOM 2484 CE1 TYR A 326 30.945 9.606 52.145 1.00 33.52 C ATOM 2485 CE2 TYR A 326 32.579 10.086 53.833 1.00 32.39 C ATOM 2486 CZ TYR A 326 31.450 10.434 53.128 1.00 32.59 C ATOM 2487 OH TYR A 326 30.786 11.595 53.408 1.00 33.85 O ATOM 2488 N SER A 327 34.172 3.592 52.715 1.00 38.38 N ATOM 2489 CA SER A 327 34.509 2.314 52.099 1.00 39.91 C ATOM 2490 C SER A 327 33.544 1.216 52.531 1.00 40.85 C ATOM 2491 O SER A 327 33.218 0.332 51.718 1.00 41.49 O ATOM 2492 CB SER A 327 35.933 1.902 52.465 1.00 40.00 C ATOM 2493 OG SER A 327 36.456 1.080 51.452 1.00 41.16 O ATOM 2494 N ASN A 328 33.108 1.258 53.794 1.00 41.43 N ATOM 2495 CA ASN A 328 32.046 0.358 54.256 1.00 42.90 C ATOM 2496 C ASN A 328 30.696 0.694 53.629 1.00 43.13 C ATOM 2497 O ASN A 328 29.889 -0.208 53.356 1.00 43.97 O ATOM 2498 CB ASN A 328 31.913 0.336 55.783 1.00 43.69 C ATOM 2499 CG ASN A 328 33.022 -0.484 56.473 1.00 47.49 C ATOM 2500 OD1 ASN A 328 33.386 -0.201 57.623 1.00 49.89 O ATOM 2501 ND2 ASN A 328 33.563 -1.499 55.770 1.00 49.84 N ATOM 2502 N GLN A 329 30.442 1.975 53.377 1.00 41.93 N ATOM 2503 CA GLN A 329 29.182 2.336 52.706 1.00 41.62 C ATOM 2504 C GLN A 329 29.189 1.797 51.265 1.00 41.53 C ATOM 2505 O GLN A 329 28.155 1.330 50.761 1.00 41.72 O ATOM 2506 CB GLN A 329 28.942 3.842 52.733 1.00 39.54 C ATOM 2507 CG GLN A 329 28.821 4.390 54.142 1.00 39.34 C ATOM 2508 CD GLN A 329 27.434 4.136 54.716 1.00 40.19 C ATOM 2509 OE1 GLN A 329 27.296 3.358 55.656 1.00 45.05 O ATOM 2510 NE2 GLN A 329 26.399 4.760 54.137 1.00 34.96 N ATOM 2511 N LYS A 330 30.350 1.880 50.617 1.00 41.15 N ATOM 2512 CA LYS A 330 30.502 1.374 49.269 1.00 41.56 C ATOM 2513 C LYS A 330 30.160 -0.114 49.235 1.00 41.18 C ATOM 2514 O LYS A 330 29.295 -0.510 48.478 1.00 40.99 O ATOM 2515 CB LYS A 330 31.895 1.663 48.699 1.00 41.31 C ATOM 2516 CG LYS A 330 32.167 0.939 47.379 1.00 44.26 C ATOM 2517 CD LYS A 330 33.577 1.130 46.842 1.00 47.29 C ATOM 2518 CE LYS A 330 34.627 0.405 47.678 1.00 51.35 C ATOM 2519 NZ LYS A 330 34.464 -1.067 47.628 1.00 55.31 N ATOM 2520 N ASP A 331 30.819 -0.921 50.070 1.00 41.72 N ATOM 2521 CA ASP A 331 30.477 -2.341 50.213 1.00 42.39 C ATOM 2522 C ASP A 331 28.982 -2.572 50.433 1.00 41.56 C ATOM 2523 O ASP A 331 28.348 -3.391 49.743 1.00 42.45 O ATOM 2524 CB ASP A 331 31.258 -2.969 51.354 1.00 43.20 C ATOM 2525 CG ASP A 331 32.747 -2.903 51.141 1.00 47.99 C ATOM 2526 OD1 ASP A 331 33.225 -2.933 49.963 1.00 52.21 O ATOM 2527 OD2 ASP A 331 33.451 -2.819 52.169 1.00 52.77 O ATOM 2528 N ALA A 332 28.404 -1.833 51.364 1.00 40.41 N ATOM 2529 CA ALA A 332 26.972 -1.964 51.628 1.00 39.98 C ATOM 2530 C ALA A 332 26.128 -1.708 50.399 1.00 39.86 C ATOM 2531 O ALA A 332 25.200 -2.469 50.140 1.00 39.75 O ATOM 2532 CB ALA A 332 26.528 -1.029 52.782 1.00 39.86 C ATOM 2533 N ILE A 333 26.413 -0.636 49.642 1.00 39.23 N ATOM 2534 CA ILE A 333 25.546 -0.329 48.516 1.00 38.88 C ATOM 2535 C ILE A 333 25.773 -1.323 47.376 1.00 39.02 C ATOM 2536 O ILE A 333 24.857 -1.606 46.615 1.00 39.08 O ATOM 2537 CB ILE A 333 25.618 1.136 48.044 1.00 39.59 C ATOM 2538 CG1 ILE A 333 24.271 1.516 47.408 1.00 38.72 C ATOM 2539 CG2 ILE A 333 26.919 1.391 47.145 1.00 39.81 C ATOM 2540 CD1 ILE A 333 24.098 2.900 46.840 1.00 39.48 C ATOM 2541 N LEU A 334 26.981 -1.880 47.292 1.00 39.80 N ATOM 2542 CA LEU A 334 27.285 -2.879 46.267 1.00 40.52 C ATOM 2543 C LEU A 334 26.543 -4.200 46.527 1.00 40.82 C ATOM 2544 O LEU A 334 26.024 -4.811 45.580 1.00 41.62 O ATOM 2545 CB LEU A 334 28.806 -3.091 46.110 1.00 40.37 C ATOM 2546 CG LEU A 334 29.549 -1.899 45.465 1.00 42.07 C ATOM 2547 CD1 LEU A 334 31.079 -2.117 45.397 1.00 42.48 C ATOM 2548 CD2 LEU A 334 28.983 -1.551 44.077 1.00 40.21 C ATOM 2549 N ALA A 335 26.492 -4.623 47.796 1.00 40.66 N ATOM 2550 CA ALA A 335 25.720 -5.800 48.202 1.00 41.05 C ATOM 2551 C ALA A 335 24.265 -5.567 47.886 1.00 41.48 C ATOM 2552 O ALA A 335 23.629 -6.388 47.253 1.00 43.00 O ATOM 2553 CB ALA A 335 25.912 -6.119 49.686 1.00 39.74 C ATOM 2554 N ALA A 336 23.724 -4.432 48.288 1.00 42.25 N ATOM 2555 CA ALA A 336 22.339 -4.155 47.955 1.00 42.85 C ATOM 2556 C ALA A 336 22.124 -4.220 46.448 1.00 43.82 C ATOM 2557 O ALA A 336 21.112 -4.736 46.018 1.00 44.25 O ATOM 2558 CB ALA A 336 21.899 -2.831 48.496 1.00 42.27 C ATOM 2559 N ALA A 337 23.058 -3.688 45.654 1.00 45.20 N ATOM 2560 CA ALA A 337 22.961 -3.759 44.182 1.00 46.38 C ATOM 2561 C ALA A 337 22.992 -5.224 43.677 1.00 47.51 C ATOM 2562 O ALA A 337 22.182 -5.610 42.832 1.00 46.70 O ATOM 2563 CB ALA A 337 24.068 -2.917 43.517 1.00 45.59 C ATOM 2564 N ASP A 338 23.906 -6.039 44.213 1.00 49.16 N ATOM 2565 CA ASP A 338 23.965 -7.437 43.793 1.00 51.77 C ATOM 2566 C ASP A 338 22.699 -8.182 44.134 1.00 52.35 C ATOM 2567 O ASP A 338 22.180 -8.917 43.298 1.00 52.58 O ATOM 2568 CB ASP A 338 25.154 -8.178 44.379 1.00 52.28 C ATOM 2569 CG ASP A 338 26.452 -7.668 43.850 1.00 54.99 C ATOM 2570 OD1 ASP A 338 26.467 -7.159 42.701 1.00 58.06 O ATOM 2571 OD2 ASP A 338 27.457 -7.749 44.602 1.00 58.17 O ATOM 2572 N LYS A 339 22.198 -7.985 45.347 1.00 53.11 N ATOM 2573 CA LYS A 339 20.945 -8.624 45.759 1.00 54.14 C ATOM 2574 C LYS A 339 19.776 -8.336 44.789 1.00 53.94 C ATOM 2575 O LYS A 339 19.183 -9.262 44.234 1.00 53.64 O ATOM 2576 CB LYS A 339 20.588 -8.232 47.195 1.00 54.36 C ATOM 2577 CG LYS A 339 19.391 -8.966 47.800 1.00 56.43 C ATOM 2578 CD LYS A 339 19.148 -8.368 49.185 1.00 61.60 C ATOM 2579 CE LYS A 339 17.990 -9.005 49.947 1.00 63.76 C ATOM 2580 NZ LYS A 339 18.424 -10.254 50.633 1.00 66.15 N ATOM 2581 N TRP A 340 19.479 -7.065 44.554 1.00 53.57 N ATOM 2582 CA TRP A 340 18.242 -6.702 43.855 1.00 53.87 C ATOM 2583 C TRP A 340 18.330 -6.458 42.356 1.00 53.23 C ATOM 2584 O TRP A 340 17.314 -6.452 41.689 1.00 53.12 O ATOM 2585 CB TRP A 340 17.598 -5.485 44.525 1.00 54.81 C ATOM 2586 CG TRP A 340 17.158 -5.819 45.870 1.00 56.53 C ATOM 2587 CD1 TRP A 340 17.776 -5.495 47.039 1.00 58.30 C ATOM 2588 CD2 TRP A 340 16.013 -6.609 46.216 1.00 58.58 C ATOM 2589 NE1 TRP A 340 17.076 -6.015 48.096 1.00 59.45 N ATOM 2590 CE2 TRP A 340 15.993 -6.712 47.622 1.00 59.22 C ATOM 2591 CE3 TRP A 340 15.006 -7.248 45.468 1.00 58.89 C ATOM 2592 CZ2 TRP A 340 14.996 -7.430 48.315 1.00 58.77 C ATOM 2593 CZ3 TRP A 340 14.020 -7.966 46.150 1.00 59.37 C ATOM 2594 CH2 TRP A 340 14.019 -8.040 47.565 1.00 58.43 C ATOM 2595 N LEU A 341 19.527 -6.241 41.825 1.00 53.15 N ATOM 2596 CA LEU A 341 19.641 -5.664 40.484 1.00 53.13 C ATOM 2597 C LEU A 341 20.395 -6.501 39.468 1.00 53.10 C ATOM 2598 O LEU A 341 20.468 -6.130 38.294 1.00 53.24 O ATOM 2599 CB LEU A 341 20.272 -4.267 40.555 1.00 52.84 C ATOM 2600 CG LEU A 341 19.499 -3.135 41.229 1.00 52.18 C ATOM 2601 CD1 LEU A 341 20.205 -1.828 40.967 1.00 50.43 C ATOM 2602 CD2 LEU A 341 18.082 -3.061 40.726 1.00 50.75 C ATOM 2603 N THR A 342 20.978 -7.604 39.920 1.00 53.37 N ATOM 2604 CA THR A 342 21.645 -8.539 39.025 1.00 53.64 C ATOM 2605 C THR A 342 20.762 -8.888 37.818 1.00 53.70 C ATOM 2606 O THR A 342 19.599 -9.289 37.963 1.00 52.76 O ATOM 2607 CB THR A 342 22.091 -9.794 39.780 1.00 53.84 C ATOM 2608 OG1 THR A 342 23.062 -9.413 40.762 1.00 53.63 O ATOM 2609 CG2 THR A 342 22.713 -10.815 38.821 1.00 53.78 C