>>2XH1:HELIX   16  16 SER A  296  THR A  342  1                                  47    
STFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLT
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 16 16 SER A 296 THR A 342 1 47 ATOM 2214 N SER A 296 11.542 43.783 24.727 1.00 15.36 N ATOM 2215 CA SER A 296 11.843 43.454 26.104 1.00 15.93 C ATOM 2216 C SER A 296 10.550 43.652 26.950 1.00 15.63 C ATOM 2217 O SER A 296 9.932 44.768 26.943 1.00 15.28 O ATOM 2218 CB SER A 296 12.912 44.387 26.622 1.00 15.50 C ATOM 2219 OG SER A 296 13.131 44.135 28.001 1.00 20.75 O ATOM 2220 N THR A 297 10.138 42.593 27.639 1.00 14.73 N ATOM 2221 CA THR A 297 8.922 42.621 28.483 1.00 15.64 C ATOM 2222 C THR A 297 9.121 43.656 29.601 1.00 16.19 C ATOM 2223 O THR A 297 8.264 44.492 29.867 1.00 16.54 O ATOM 2224 CB THR A 297 8.595 41.200 29.077 1.00 14.03 C ATOM 2225 OG1 THR A 297 8.634 40.221 28.016 1.00 13.97 O ATOM 2226 CG2 THR A 297 7.177 41.201 29.642 1.00 15.12 C ATOM 2227 N PHE A 298 10.316 43.631 30.175 1.00 15.70 N ATOM 2228 CA PHE A 298 10.735 44.515 31.230 1.00 15.92 C ATOM 2229 C PHE A 298 10.637 46.004 30.826 1.00 16.20 C ATOM 2230 O PHE A 298 10.128 46.837 31.582 1.00 14.36 O ATOM 2231 CB PHE A 298 12.175 44.133 31.592 1.00 17.83 C ATOM 2232 CG PHE A 298 12.696 44.764 32.877 1.00 20.08 C ATOM 2233 CD1 PHE A 298 13.083 46.082 32.908 1.00 22.87 C ATOM 2234 CD2 PHE A 298 12.871 44.000 34.018 1.00 23.72 C ATOM 2235 CE1 PHE A 298 13.581 46.669 34.104 1.00 25.08 C ATOM 2236 CE2 PHE A 298 13.383 44.586 35.213 1.00 25.05 C ATOM 2237 CZ PHE A 298 13.734 45.920 35.230 1.00 23.02 C ATOM 2238 N ASN A 299 11.131 46.347 29.634 1.00 15.18 N ATOM 2239 CA ASN A 299 11.162 47.759 29.247 1.00 14.39 C ATOM 2240 C ASN A 299 9.737 48.248 28.914 1.00 13.55 C ATOM 2241 O ASN A 299 9.414 49.392 29.161 1.00 14.90 O ATOM 2242 CB ASN A 299 12.079 47.962 28.055 1.00 13.73 C ATOM 2243 CG ASN A 299 13.501 47.518 28.333 1.00 17.50 C ATOM 2244 OD1 ASN A 299 14.306 47.441 27.412 1.00 22.63 O ATOM 2245 ND2 ASN A 299 13.837 47.258 29.615 1.00 14.31 N ATOM 2246 N GLN A 300 8.927 47.371 28.337 1.00 12.89 N ATOM 2247 CA GLN A 300 7.530 47.658 28.041 1.00 14.59 C ATOM 2248 C GLN A 300 6.755 47.980 29.333 1.00 15.20 C ATOM 2249 O GLN A 300 6.022 48.997 29.431 1.00 15.26 O ATOM 2250 CB GLN A 300 6.888 46.472 27.358 1.00 14.19 C ATOM 2251 CG GLN A 300 7.203 46.421 25.861 1.00 17.02 C ATOM 2252 CD GLN A 300 6.401 45.376 25.231 1.00 14.92 C ATOM 2253 OE1 GLN A 300 5.235 45.600 24.850 1.00 15.72 O ATOM 2254 NE2 GLN A 300 6.965 44.192 25.161 1.00 14.22 N ATOM 2255 N LEU A 301 6.958 47.145 30.345 1.00 14.69 N ATOM 2256 CA LEU A 301 6.321 47.416 31.623 1.00 15.89 C ATOM 2257 C LEU A 301 6.794 48.718 32.270 1.00 16.70 C ATOM 2258 O LEU A 301 5.990 49.463 32.822 1.00 17.74 O ATOM 2259 CB LEU A 301 6.554 46.193 32.506 1.00 16.11 C ATOM 2260 CG LEU A 301 5.525 45.140 32.826 1.00 17.68 C ATOM 2261 CD1 LEU A 301 4.119 45.240 32.239 1.00 16.49 C ATOM 2262 CD2 LEU A 301 6.143 43.689 32.922 1.00 20.97 C ATOM 2263 N MET A 302 8.092 49.024 32.221 1.00 17.02 N ATOM 2264 CA MET A 302 8.555 50.309 32.766 1.00 19.10 C ATOM 2265 C MET A 302 7.754 51.442 32.099 1.00 19.03 C ATOM 2266 O MET A 302 7.227 52.333 32.769 1.00 18.54 O ATOM 2267 CB MET A 302 10.050 50.579 32.476 1.00 18.41 C ATOM 2268 CG MET A 302 11.103 49.693 33.137 1.00 22.36 C ATOM 2269 SD MET A 302 12.788 49.943 32.434 1.00 23.85 S ATOM 2270 CE MET A 302 13.102 51.660 32.877 1.00 24.49 C ATOM 2271 N ILE A 303 7.703 51.413 30.759 1.00 18.25 N ATOM 2272 CA ILE A 303 7.041 52.464 30.022 1.00 18.10 C ATOM 2273 C ILE A 303 5.523 52.460 30.241 1.00 16.66 C ATOM 2274 O ILE A 303 4.949 53.520 30.431 1.00 16.62 O ATOM 2275 CB ILE A 303 7.448 52.454 28.516 1.00 18.33 C ATOM 2276 CG1 ILE A 303 8.897 52.905 28.393 1.00 19.12 C ATOM 2277 CG2 ILE A 303 6.553 53.360 27.673 1.00 18.26 C ATOM 2278 CD1 ILE A 303 9.493 52.603 27.031 1.00 22.85 C ATOM 2279 N SER A 304 4.903 51.289 30.273 1.00 15.89 N ATOM 2280 CA SER A 304 3.472 51.221 30.462 1.00 17.07 C ATOM 2281 C SER A 304 3.081 51.822 31.816 1.00 17.81 C ATOM 2282 O SER A 304 2.114 52.562 31.921 1.00 17.55 O ATOM 2283 CB SER A 304 2.985 49.773 30.421 1.00 17.61 C ATOM 2284 OG SER A 304 1.553 49.763 30.363 1.00 17.29 O ATOM 2285 N GLN A 305 3.853 51.496 32.840 1.00 17.98 N ATOM 2286 CA GLN A 305 3.630 52.073 34.171 1.00 19.95 C ATOM 2287 C GLN A 305 3.734 53.605 34.196 1.00 19.79 C ATOM 2288 O GLN A 305 2.813 54.288 34.711 1.00 19.87 O ATOM 2289 CB GLN A 305 4.566 51.429 35.205 1.00 18.65 C ATOM 2290 CG GLN A 305 4.009 50.070 35.613 1.00 26.31 C ATOM 2291 CD GLN A 305 4.426 49.653 37.008 1.00 33.96 C ATOM 2292 OE1 GLN A 305 4.647 48.470 37.245 1.00 38.08 O ATOM 2293 NE2 GLN A 305 4.545 50.615 37.943 1.00 35.01 N ATOM 2294 N LEU A 306 4.839 54.142 33.659 1.00 18.24 N ATOM 2295 CA LEU A 306 5.008 55.605 33.522 1.00 17.61 C ATOM 2296 C LEU A 306 3.791 56.242 32.868 1.00 18.17 C ATOM 2297 O LEU A 306 3.202 57.205 33.386 1.00 16.75 O ATOM 2298 CB LEU A 306 6.218 55.913 32.662 1.00 17.71 C ATOM 2299 CG LEU A 306 6.564 57.373 32.398 1.00 16.54 C ATOM 2300 CD1 LEU A 306 7.254 57.999 33.559 1.00 12.35 C ATOM 2301 CD2 LEU A 306 7.490 57.433 31.152 1.00 16.73 C ATOM 2302 N LEU A 307 3.434 55.723 31.699 1.00 17.90 N ATOM 2303 CA LEU A 307 2.353 56.324 30.878 1.00 18.70 C ATOM 2304 C LEU A 307 0.992 56.260 31.579 1.00 19.18 C ATOM 2305 O LEU A 307 0.234 57.207 31.556 1.00 18.23 O ATOM 2306 CB LEU A 307 2.241 55.533 29.564 1.00 18.78 C ATOM 2307 CG LEU A 307 2.919 56.037 28.269 1.00 21.12 C ATOM 2308 CD1 LEU A 307 3.944 57.173 28.418 1.00 18.34 C ATOM 2309 CD2 LEU A 307 3.336 54.926 27.344 1.00 17.48 C ATOM 2310 N HIS A 308 0.682 55.113 32.166 1.00 19.91 N ATOM 2311 CA HIS A 308 -0.576 54.952 32.895 1.00 22.42 C ATOM 2312 C HIS A 308 -0.696 55.894 34.083 1.00 23.74 C ATOM 2313 O HIS A 308 -1.715 56.515 34.257 1.00 23.25 O ATOM 2314 CB HIS A 308 -0.769 53.509 33.337 1.00 22.67 C ATOM 2315 CG HIS A 308 -1.351 52.646 32.276 1.00 23.82 C ATOM 2316 ND1 HIS A 308 -0.576 52.019 31.323 1.00 22.25 N ATOM 2317 CD2 HIS A 308 -2.639 52.360 31.971 1.00 23.97 C ATOM 2318 CE1 HIS A 308 -1.362 51.322 30.521 1.00 24.56 C ATOM 2319 NE2 HIS A 308 -2.618 51.523 30.883 1.00 24.82 N ATOM 2320 N GLU A 309 0.371 56.031 34.857 1.00 25.00 N ATOM 2321 CA GLU A 309 0.359 56.940 35.977 1.00 26.61 C ATOM 2322 C GLU A 309 0.350 58.386 35.528 1.00 27.11 C ATOM 2323 O GLU A 309 -0.344 59.206 36.139 1.00 27.15 O ATOM 2324 CB GLU A 309 1.485 56.644 36.968 1.00 26.70 C ATOM 2325 CG GLU A 309 1.311 55.246 37.619 1.00 31.22 C ATOM 2326 CD GLU A 309 -0.139 55.000 38.106 1.00 37.88 C ATOM 2327 OE1 GLU A 309 -0.715 55.926 38.756 1.00 40.02 O ATOM 2328 OE2 GLU A 309 -0.692 53.892 37.830 1.00 39.61 O ATOM 2329 N TRP A 310 1.082 58.699 34.454 1.00 25.74 N ATOM 2330 CA TRP A 310 1.070 60.061 33.931 1.00 24.67 C ATOM 2331 C TRP A 310 -0.329 60.455 33.500 1.00 24.13 C ATOM 2332 O TRP A 310 -0.755 61.546 33.772 1.00 24.38 O ATOM 2333 CB TRP A 310 1.965 60.194 32.719 1.00 23.73 C ATOM 2334 CG TRP A 310 3.316 60.627 32.961 1.00 23.46 C ATOM 2335 CD1 TRP A 310 3.845 61.106 34.132 1.00 23.57 C ATOM 2336 CD2 TRP A 310 4.365 60.678 31.988 1.00 23.10 C ATOM 2337 NE1 TRP A 310 5.160 61.454 33.931 1.00 23.00 N ATOM 2338 CE2 TRP A 310 5.502 61.200 32.626 1.00 21.26 C ATOM 2339 CE3 TRP A 310 4.439 60.355 30.634 1.00 23.78 C ATOM 2340 CZ2 TRP A 310 6.721 61.400 31.960 1.00 22.17 C ATOM 2341 CZ3 TRP A 310 5.670 60.526 29.975 1.00 25.30 C ATOM 2342 CH2 TRP A 310 6.785 61.056 30.642 1.00 21.23 C ATOM 2343 N GLY A 311 -1.024 59.588 32.790 1.00 23.95 N ATOM 2344 CA GLY A 311 -2.256 59.986 32.136 1.00 25.77 C ATOM 2345 C GLY A 311 -2.008 61.159 31.188 1.00 27.26 C ATOM 2346 O GLY A 311 -0.847 61.446 30.809 1.00 24.36 O ATOM 2347 N GLU A 312 -3.085 61.864 30.835 1.00 29.86 N ATOM 2348 CA GLU A 312 -2.994 62.989 29.866 1.00 32.97 C ATOM 2349 C GLU A 312 -2.247 64.171 30.448 1.00 33.95 C ATOM 2350 O GLU A 312 -1.309 64.738 29.837 1.00 35.09 O ATOM 2351 CB GLU A 312 -4.379 63.421 29.434 1.00 33.83 C ATOM 2352 CG GLU A 312 -4.356 64.328 28.201 1.00 39.60 C ATOM 2353 CD GLU A 312 -5.612 64.133 27.324 1.00 46.28 C ATOM 2354 OE1 GLU A 312 -5.502 63.450 26.243 1.00 48.36 O ATOM 2355 OE2 GLU A 312 -6.690 64.647 27.749 1.00 41.54 O ATOM 2356 N GLU A 313 -2.658 64.531 31.653 1.00 34.44 N ATOM 2357 CA GLU A 313 -1.988 65.539 32.466 1.00 34.90 C ATOM 2358 C GLU A 313 -0.443 65.408 32.467 1.00 33.04 C ATOM 2359 O GLU A 313 0.277 66.341 32.078 1.00 33.01 O ATOM 2360 CB GLU A 313 -2.567 65.468 33.895 1.00 36.12 C ATOM 2361 CG GLU A 313 -2.884 64.006 34.396 1.00 41.86 C ATOM 2362 CD GLU A 313 -4.232 63.392 33.883 1.00 48.46 C ATOM 2363 OE1 GLU A 313 -5.211 64.141 33.632 1.00 51.71 O ATOM 2364 OE2 GLU A 313 -4.320 62.139 33.756 1.00 51.63 O ATOM 2365 N GLY A 314 0.058 64.251 32.885 1.00 30.24 N ATOM 2366 CA GLY A 314 1.492 64.057 33.026 1.00 27.85 C ATOM 2367 C GLY A 314 2.270 63.972 31.709 1.00 26.34 C ATOM 2368 O GLY A 314 3.395 64.477 31.611 1.00 25.07 O ATOM 2369 N PHE A 315 1.678 63.298 30.735 1.00 25.42 N ATOM 2370 CA PHE A 315 2.281 63.136 29.424 1.00 26.53 C ATOM 2371 C PHE A 315 2.441 64.521 28.743 1.00 27.57 C ATOM 2372 O PHE A 315 3.551 64.848 28.286 1.00 27.09 O ATOM 2373 CB PHE A 315 1.464 62.163 28.571 1.00 25.68 C ATOM 2374 CG PHE A 315 2.089 61.863 27.222 1.00 27.28 C ATOM 2375 CD1 PHE A 315 3.015 60.819 27.082 1.00 26.10 C ATOM 2376 CD2 PHE A 315 1.758 62.641 26.101 1.00 26.68 C ATOM 2377 CE1 PHE A 315 3.625 60.536 25.828 1.00 30.20 C ATOM 2378 CE2 PHE A 315 2.322 62.367 24.833 1.00 31.43 C ATOM 2379 CZ PHE A 315 3.280 61.309 24.697 1.00 29.00 C ATOM 2380 N MET A 316 1.362 65.330 28.731 1.00 28.21 N ATOM 2381 CA MET A 316 1.376 66.681 28.148 1.00 30.96 C ATOM 2382 C MET A 316 2.407 67.515 28.827 1.00 28.63 C ATOM 2383 O MET A 316 3.136 68.253 28.163 1.00 29.48 O ATOM 2384 CB MET A 316 0.033 67.424 28.302 1.00 31.20 C ATOM 2385 CG MET A 316 -1.129 66.890 27.490 1.00 32.86 C ATOM 2386 SD MET A 316 -2.686 67.861 27.684 1.00 40.23 S ATOM 2387 CE MET A 316 -2.776 68.376 29.415 1.00 42.43 C ATOM 2388 N ALA A 317 2.481 67.410 30.155 1.00 26.99 N ATOM 2389 CA ALA A 317 3.434 68.213 30.890 1.00 25.36 C ATOM 2390 C ALA A 317 4.879 67.817 30.557 1.00 24.75 C ATOM 2391 O ALA A 317 5.764 68.667 30.467 1.00 24.40 O ATOM 2392 CB ALA A 317 3.180 68.140 32.387 1.00 25.97 C ATOM 2393 N HIS A 318 5.116 66.529 30.365 1.00 23.50 N ATOM 2394 CA HIS A 318 6.471 66.068 30.072 1.00 22.91 C ATOM 2395 C HIS A 318 6.899 66.601 28.700 1.00 22.23 C ATOM 2396 O HIS A 318 7.954 67.218 28.572 1.00 21.72 O ATOM 2397 CB HIS A 318 6.543 64.542 30.072 1.00 22.23 C ATOM 2398 CG HIS A 318 7.889 64.024 29.670 1.00 20.31 C ATOM 2399 ND1 HIS A 318 8.129 63.413 28.453 1.00 22.14 N ATOM 2400 CD2 HIS A 318 9.074 64.070 30.307 1.00 16.55 C ATOM 2401 CE1 HIS A 318 9.410 63.101 28.369 1.00 15.38 C ATOM 2402 NE2 HIS A 318 10.002 63.484 29.484 1.00 22.90 N ATOM 2403 N VAL A 319 6.051 66.378 27.696 1.00 23.33 N ATOM 2404 CA VAL A 319 6.368 66.795 26.325 1.00 24.45 C ATOM 2405 C VAL A 319 6.536 68.316 26.216 1.00 24.83 C ATOM 2406 O VAL A 319 7.433 68.776 25.517 1.00 24.76 O ATOM 2407 CB VAL A 319 5.408 66.188 25.209 1.00 24.56 C ATOM 2408 CG1 VAL A 319 5.292 64.691 25.318 1.00 23.06 C ATOM 2409 CG2 VAL A 319 4.069 66.808 25.236 1.00 28.77 C ATOM 2410 N ASP A 320 5.697 69.100 26.916 1.00 25.50 N ATOM 2411 CA ASP A 320 5.934 70.571 27.026 1.00 26.17 C ATOM 2412 C ASP A 320 7.321 70.933 27.546 1.00 25.59 C ATOM 2413 O ASP A 320 8.005 71.782 26.953 1.00 26.51 O ATOM 2414 CB ASP A 320 4.854 71.302 27.841 1.00 27.04 C ATOM 2415 CG ASP A 320 4.915 72.831 27.647 1.00 32.85 C ATOM 2416 OD1 ASP A 320 5.229 73.564 28.632 1.00 38.02 O ATOM 2417 OD2 ASP A 320 4.696 73.301 26.496 1.00 34.34 O ATOM 2418 N ARG A 321 7.768 70.299 28.628 1.00 24.60 N ATOM 2419 CA ARG A 321 9.119 70.579 29.151 1.00 24.09 C ATOM 2420 C ARG A 321 10.220 70.214 28.182 1.00 23.37 C ATOM 2421 O ARG A 321 11.223 70.943 28.057 1.00 21.91 O ATOM 2422 CB ARG A 321 9.382 69.827 30.453 1.00 24.62 C ATOM 2423 CG ARG A 321 8.477 70.266 31.631 1.00 29.57 C ATOM 2424 CD ARG A 321 8.964 69.585 32.967 1.00 34.42 C ATOM 2425 NE ARG A 321 8.636 68.152 33.050 1.00 34.12 N ATOM 2426 CZ ARG A 321 7.432 67.691 33.369 1.00 35.71 C ATOM 2427 NH1 ARG A 321 6.430 68.534 33.600 1.00 37.26 N ATOM 2428 NH2 ARG A 321 7.213 66.391 33.458 1.00 33.52 N ATOM 2429 N VAL A 322 10.086 69.066 27.514 1.00 23.04 N ATOM 2430 CA VAL A 322 11.133 68.739 26.549 1.00 23.49 C ATOM 2431 C VAL A 322 11.077 69.694 25.333 1.00 22.34 C ATOM 2432 O VAL A 322 12.112 70.192 24.942 1.00 22.16 O ATOM 2433 CB VAL A 322 11.342 67.185 26.227 1.00 24.42 C ATOM 2434 CG1 VAL A 322 10.584 66.245 27.184 1.00 24.16 C ATOM 2435 CG2 VAL A 322 11.202 66.864 24.738 1.00 26.04 C ATOM 2436 N ILE A 323 9.890 70.001 24.803 1.00 22.50 N ATOM 2437 CA ILE A 323 9.801 71.049 23.743 1.00 23.40 C ATOM 2438 C ILE A 323 10.485 72.339 24.195 1.00 23.94 C ATOM 2439 O ILE A 323 11.339 72.842 23.474 1.00 24.26 O ATOM 2440 CB ILE A 323 8.370 71.356 23.250 1.00 23.49 C ATOM 2441 CG1 ILE A 323 7.766 70.167 22.511 1.00 23.46 C ATOM 2442 CG2 ILE A 323 8.366 72.636 22.357 1.00 23.78 C ATOM 2443 CD1 ILE A 323 6.193 70.194 22.462 1.00 24.78 C ATOM 2444 N ASP A 324 10.150 72.832 25.393 1.00 24.91 N ATOM 2445 CA ASP A 324 10.771 74.056 25.932 1.00 26.40 C ATOM 2446 C ASP A 324 12.297 73.966 25.973 1.00 26.29 C ATOM 2447 O ASP A 324 12.962 74.921 25.599 1.00 25.37 O ATOM 2448 CB ASP A 324 10.215 74.443 27.325 1.00 27.63 C ATOM 2449 CG ASP A 324 8.837 75.087 27.257 1.00 31.56 C ATOM 2450 OD1 ASP A 324 8.405 75.513 26.157 1.00 36.19 O ATOM 2451 OD2 ASP A 324 8.151 75.157 28.309 1.00 36.41 O ATOM 2452 N PHE A 325 12.849 72.808 26.387 1.00 25.92 N ATOM 2453 CA PHE A 325 14.301 72.619 26.341 1.00 26.47 C ATOM 2454 C PHE A 325 14.902 72.719 24.930 1.00 25.60 C ATOM 2455 O PHE A 325 15.878 73.416 24.730 1.00 26.50 O ATOM 2456 CB PHE A 325 14.748 71.268 26.962 1.00 27.69 C ATOM 2457 CG PHE A 325 16.238 70.988 26.777 1.00 29.35 C ATOM 2458 CD1 PHE A 325 17.186 71.633 27.582 1.00 32.50 C ATOM 2459 CD2 PHE A 325 16.685 70.103 25.800 1.00 29.29 C ATOM 2460 CE1 PHE A 325 18.567 71.414 27.417 1.00 31.66 C ATOM 2461 CE2 PHE A 325 18.068 69.864 25.620 1.00 30.80 C ATOM 2462 CZ PHE A 325 19.014 70.530 26.444 1.00 31.43 C ATOM 2463 N TYR A 326 14.347 71.978 23.974 1.00 24.67 N ATOM 2464 CA TYR A 326 14.894 71.923 22.627 1.00 23.50 C ATOM 2465 C TYR A 326 14.730 73.287 21.900 1.00 24.45 C ATOM 2466 O TYR A 326 15.603 73.649 21.106 1.00 24.15 O ATOM 2467 CB TYR A 326 14.274 70.759 21.846 1.00 23.00 C ATOM 2468 CG TYR A 326 14.923 69.402 22.196 1.00 23.33 C ATOM 2469 CD1 TYR A 326 16.152 69.055 21.678 1.00 22.83 C ATOM 2470 CD2 TYR A 326 14.310 68.485 23.060 1.00 24.01 C ATOM 2471 CE1 TYR A 326 16.769 67.838 21.994 1.00 26.45 C ATOM 2472 CE2 TYR A 326 14.935 67.233 23.359 1.00 21.40 C ATOM 2473 CZ TYR A 326 16.159 66.937 22.825 1.00 24.90 C ATOM 2474 OH TYR A 326 16.818 65.741 23.097 1.00 26.42 O ATOM 2475 N SER A 327 13.663 74.057 22.186 1.00 23.60 N ATOM 2476 CA SER A 327 13.553 75.365 21.520 1.00 25.96 C ATOM 2477 C SER A 327 14.479 76.439 22.079 1.00 25.78 C ATOM 2478 O SER A 327 14.938 77.281 21.315 1.00 26.40 O ATOM 2479 CB SER A 327 12.119 75.876 21.331 1.00 25.63 C ATOM 2480 OG SER A 327 11.441 75.830 22.539 1.00 31.34 O ATOM 2481 N ASN A 328 14.792 76.392 23.377 1.00 26.67 N ATOM 2482 CA ASN A 328 15.883 77.200 23.913 1.00 27.30 C ATOM 2483 C ASN A 328 17.189 76.861 23.212 1.00 27.31 C ATOM 2484 O ASN A 328 17.857 77.777 22.710 1.00 28.03 O ATOM 2485 CB ASN A 328 16.039 77.030 25.412 1.00 29.06 C ATOM 2486 CG ASN A 328 14.942 77.720 26.214 1.00 32.48 C ATOM 2487 OD1 ASN A 328 14.718 77.370 27.371 1.00 38.88 O ATOM 2488 ND2 ASN A 328 14.263 78.702 25.621 1.00 34.39 N ATOM 2489 N GLN A 329 17.538 75.565 23.121 1.00 25.70 N ATOM 2490 CA GLN A 329 18.707 75.117 22.325 1.00 24.04 C ATOM 2491 C GLN A 329 18.670 75.629 20.870 1.00 23.74 C ATOM 2492 O GLN A 329 19.676 76.100 20.346 1.00 23.84 O ATOM 2493 CB GLN A 329 18.836 73.579 22.282 1.00 23.32 C ATOM 2494 CG GLN A 329 19.079 72.878 23.631 1.00 25.12 C ATOM 2495 CD GLN A 329 20.430 73.235 24.224 1.00 27.84 C ATOM 2496 OE1 GLN A 329 20.513 74.102 25.082 1.00 30.91 O ATOM 2497 NE2 GLN A 329 21.496 72.591 23.750 1.00 28.96 N ATOM 2498 N LYS A 330 17.535 75.479 20.202 1.00 23.72 N ATOM 2499 CA LYS A 330 17.396 75.979 18.851 1.00 23.57 C ATOM 2500 C LYS A 330 17.641 77.516 18.788 1.00 23.81 C ATOM 2501 O LYS A 330 18.345 77.999 17.921 1.00 23.64 O ATOM 2502 CB LYS A 330 16.009 75.636 18.316 1.00 23.97 C ATOM 2503 CG LYS A 330 15.769 76.139 16.879 1.00 23.78 C ATOM 2504 CD LYS A 330 14.325 76.445 16.735 1.00 28.74 C ATOM 2505 CE LYS A 330 14.002 77.827 17.203 1.00 29.35 C ATOM 2506 NZ LYS A 330 12.709 77.821 17.886 1.00 32.13 N ATOM 2507 N ASP A 331 17.084 78.269 19.734 1.00 25.14 N ATOM 2508 CA ASP A 331 17.312 79.729 19.779 1.00 25.78 C ATOM 2509 C ASP A 331 18.816 80.027 19.953 1.00 25.61 C ATOM 2510 O ASP A 331 19.342 80.934 19.297 1.00 26.24 O ATOM 2511 CB ASP A 331 16.499 80.388 20.886 1.00 25.40 C ATOM 2512 CG ASP A 331 15.014 80.362 20.609 1.00 29.89 C ATOM 2513 OD1 ASP A 331 14.596 80.110 19.442 1.00 30.39 O ATOM 2514 OD2 ASP A 331 14.247 80.594 21.572 1.00 33.75 O ATOM 2515 N ALA A 332 19.499 79.252 20.805 1.00 24.09 N ATOM 2516 CA ALA A 332 20.932 79.373 20.973 1.00 23.35 C ATOM 2517 C ALA A 332 21.773 79.090 19.716 1.00 23.28 C ATOM 2518 O ALA A 332 22.744 79.831 19.417 1.00 23.34 O ATOM 2519 CB ALA A 332 21.415 78.491 22.149 1.00 23.47 C ATOM 2520 N ILE A 333 21.446 78.028 18.971 1.00 22.13 N ATOM 2521 CA ILE A 333 22.304 77.700 17.836 1.00 21.06 C ATOM 2522 C ILE A 333 22.073 78.706 16.726 1.00 20.63 C ATOM 2523 O ILE A 333 22.983 78.998 15.953 1.00 20.37 O ATOM 2524 CB ILE A 333 22.193 76.205 17.342 1.00 21.53 C ATOM 2525 CG1 ILE A 333 23.480 75.827 16.603 1.00 21.56 C ATOM 2526 CG2 ILE A 333 20.843 75.931 16.523 1.00 19.39 C ATOM 2527 CD1 ILE A 333 23.523 74.399 16.100 1.00 26.52 C ATOM 2528 N LEU A 334 20.857 79.249 16.695 1.00 20.98 N ATOM 2529 CA LEU A 334 20.453 80.232 15.712 1.00 21.72 C ATOM 2530 C LEU A 334 21.153 81.550 15.982 1.00 22.35 C ATOM 2531 O LEU A 334 21.608 82.174 15.049 1.00 22.78 O ATOM 2532 CB LEU A 334 18.943 80.409 15.715 1.00 21.83 C ATOM 2533 CG LEU A 334 18.071 79.848 14.563 1.00 23.91 C ATOM 2534 CD1 LEU A 334 18.675 78.782 13.620 1.00 20.21 C ATOM 2535 CD2 LEU A 334 16.624 79.488 15.039 1.00 22.53 C ATOM 2536 N ALA A 335 21.244 81.947 17.254 1.00 23.74 N ATOM 2537 CA ALA A 335 22.045 83.111 17.682 1.00 25.56 C ATOM 2538 C ALA A 335 23.498 82.990 17.260 1.00 26.03 C ATOM 2539 O ALA A 335 24.123 83.970 16.833 1.00 26.81 O ATOM 2540 CB ALA A 335 21.983 83.287 19.206 1.00 25.88 C ATOM 2541 N ALA A 336 24.036 81.779 17.386 1.00 25.76 N ATOM 2542 CA ALA A 336 25.428 81.565 17.110 1.00 25.79 C ATOM 2543 C ALA A 336 25.662 81.562 15.583 1.00 26.59 C ATOM 2544 O ALA A 336 26.699 82.052 15.086 1.00 26.09 O ATOM 2545 CB ALA A 336 25.907 80.256 17.788 1.00 24.35 C ATOM 2546 N ALA A 337 24.693 81.030 14.834 1.00 26.55 N ATOM 2547 CA ALA A 337 24.810 81.032 13.379 1.00 27.31 C ATOM 2548 C ALA A 337 24.750 82.488 12.829 1.00 27.63 C ATOM 2549 O ALA A 337 25.575 82.844 12.014 1.00 27.72 O ATOM 2550 CB ALA A 337 23.755 80.161 12.753 1.00 26.07 C ATOM 2551 N ASP A 338 23.785 83.289 13.288 1.00 29.28 N ATOM 2552 CA ASP A 338 23.704 84.737 13.005 1.00 30.72 C ATOM 2553 C ASP A 338 25.011 85.495 13.267 1.00 31.77 C ATOM 2554 O ASP A 338 25.461 86.283 12.430 1.00 31.89 O ATOM 2555 CB ASP A 338 22.586 85.382 13.828 1.00 31.12 C ATOM 2556 CG ASP A 338 21.190 84.973 13.360 1.00 33.80 C ATOM 2557 OD1 ASP A 338 21.025 84.483 12.208 1.00 35.87 O ATOM 2558 OD2 ASP A 338 20.250 85.126 14.164 1.00 35.00 O ATOM 2559 N LYS A 339 25.623 85.245 14.424 1.00 32.82 N ATOM 2560 CA LYS A 339 26.845 85.939 14.827 1.00 32.70 C ATOM 2561 C LYS A 339 28.003 85.659 13.872 1.00 32.46 C ATOM 2562 O LYS A 339 28.650 86.591 13.405 1.00 32.76 O ATOM 2563 CB LYS A 339 27.213 85.550 16.259 1.00 33.37 C ATOM 2564 CG LYS A 339 28.316 86.403 16.911 1.00 36.11 C ATOM 2565 CD LYS A 339 28.537 85.996 18.396 1.00 39.24 C ATOM 2566 CE LYS A 339 29.980 86.257 18.911 1.00 40.66 C ATOM 2567 NZ LYS A 339 30.279 85.553 20.237 1.00 41.34 N ATOM 2568 N TRP A 340 28.240 84.390 13.554 1.00 31.33 N ATOM 2569 CA TRP A 340 29.463 83.988 12.870 1.00 30.86 C ATOM 2570 C TRP A 340 29.302 83.689 11.396 1.00 30.01 C ATOM 2571 O TRP A 340 30.278 83.748 10.666 1.00 30.74 O ATOM 2572 CB TRP A 340 30.103 82.772 13.576 1.00 32.73 C ATOM 2573 CG TRP A 340 30.521 83.113 14.964 1.00 34.77 C ATOM 2574 CD1 TRP A 340 29.850 82.837 16.113 1.00 37.67 C ATOM 2575 CD2 TRP A 340 31.686 83.867 15.345 1.00 37.59 C ATOM 2576 NE1 TRP A 340 30.530 83.364 17.198 1.00 39.75 N ATOM 2577 CE2 TRP A 340 31.662 83.993 16.752 1.00 39.23 C ATOM 2578 CE3 TRP A 340 32.759 84.433 14.628 1.00 38.48 C ATOM 2579 CZ2 TRP A 340 32.663 84.673 17.465 1.00 39.30 C ATOM 2580 CZ3 TRP A 340 33.766 85.105 15.337 1.00 39.15 C ATOM 2581 CH2 TRP A 340 33.704 85.224 16.740 1.00 38.46 C ATOM 2582 N LEU A 341 28.110 83.299 10.961 1.00 27.84 N ATOM 2583 CA LEU A 341 27.953 82.769 9.604 1.00 27.67 C ATOM 2584 C LEU A 341 27.155 83.673 8.651 1.00 27.22 C ATOM 2585 O LEU A 341 26.900 83.312 7.498 1.00 25.63 O ATOM 2586 CB LEU A 341 27.307 81.376 9.646 1.00 27.93 C ATOM 2587 CG LEU A 341 28.150 80.094 9.716 1.00 29.82 C ATOM 2588 CD1 LEU A 341 29.556 80.217 10.311 1.00 26.66 C ATOM 2589 CD2 LEU A 341 27.310 78.999 10.418 1.00 29.25 C ATOM 2590 N THR A 342 26.741 84.841 9.126 1.00 28.10 N ATOM 2591 CA THR A 342 26.006 85.742 8.241 1.00 29.43 C ATOM 2592 C THR A 342 26.844 86.064 6.975 1.00 29.00 C ATOM 2593 O THR A 342 28.019 86.359 7.074 1.00 29.46 O ATOM 2594 CB THR A 342 25.470 86.929 9.026 1.00 30.20 C ATOM 2595 OG1 THR A 342 24.515 86.411 9.976 1.00 31.76 O ATOM 2596 CG2 THR A 342 24.780 87.963 8.105 1.00 30.09 C