YVHRDLAARNVLVESEHQVKIGDFGLTKAIEKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALL
Search OCA for entries with sequence similar to this one (with E=10)

ATOM 3449 N TYR B 999 24.867 7.809 18.540 1.00 19.61 N ATOM 3450 CA TYR B 999 24.421 8.550 17.373 1.00 18.68 C ATOM 3451 C TYR B 999 23.017 9.099 17.583 1.00 19.70 C ATOM 3452 O TYR B 999 22.178 8.467 18.242 1.00 18.92 O ATOM 3453 CB TYR B 999 24.409 7.668 16.113 1.00 20.00 C ATOM 3454 CG TYR B 999 25.766 7.209 15.634 1.00 21.11 C ATOM 3455 CD1 TYR B 999 26.661 8.101 15.053 1.00 22.90 C ATOM 3456 CD2 TYR B 999 26.109 5.857 15.649 1.00 21.33 C ATOM 3457 CE1 TYR B 999 27.910 7.678 14.599 1.00 25.03 C ATOM 3458 CE2 TYR B 999 27.347 5.420 15.185 1.00 21.57 C ATOM 3459 CZ TYR B 999 28.240 6.331 14.652 1.00 31.43 C ATOM 3460 OH TYR B 999 29.446 5.894 14.172 1.00 36.00 O ATOM 3461 N VAL B1000 22.764 10.282 16.987 1.00 14.89 N ATOM 3462 CA VAL B1000 21.439 10.899 16.899 1.00 14.73 C ATOM 3463 C VAL B1000 21.047 10.827 15.431 1.00 17.09 C ATOM 3464 O VAL B1000 21.860 11.172 14.578 1.00 16.30 O ATOM 3465 CB VAL B1000 21.299 12.319 17.495 1.00 19.60 C ATOM 3466 CG1 VAL B1000 21.230 12.259 19.006 1.00 19.33 C ATOM 3467 CG2 VAL B1000 22.407 13.265 17.031 1.00 19.91 C ATOM 3468 N HIS B1001 19.840 10.331 15.134 1.00 13.96 N ATOM 3469 CA HIS B1001 19.364 10.144 13.750 1.00 12.38 C ATOM 3470 C HIS B1001 18.987 11.442 13.050 1.00 14.44 C ATOM 3471 O HIS B1001 19.392 11.664 11.899 1.00 13.60 O ATOM 3472 CB HIS B1001 18.209 9.123 13.695 1.00 11.81 C ATOM 3473 CG HIS B1001 17.892 8.710 12.293 1.00 14.59 C ATOM 3474 ND1 HIS B1001 17.006 9.434 11.513 1.00 16.28 N ATOM 3475 CD2 HIS B1001 18.386 7.687 11.560 1.00 15.94 C ATOM 3476 CE1 HIS B1001 16.971 8.816 10.340 1.00 15.12 C ATOM 3477 NE2 HIS B1001 17.785 7.763 10.318 1.00 15.63 N ATOM 3478 N ARG B1002 18.147 12.256 13.712 1.00 13.15 N ATOM 3479 CA ARG B1002 17.675 13.587 13.275 1.00 13.66 C ATOM 3480 C ARG B1002 16.677 13.591 12.108 1.00 16.95 C ATOM 3481 O ARG B1002 16.280 14.665 11.662 1.00 16.58 O ATOM 3482 CB ARG B1002 18.839 14.558 12.997 1.00 13.41 C ATOM 3483 CG ARG B1002 19.845 14.730 14.133 1.00 19.09 C ATOM 3484 CD ARG B1002 21.108 15.463 13.679 1.00 18.62 C ATOM 3485 NE ARG B1002 20.826 16.764 13.090 1.00 38.89 N ATOM 3486 CZ ARG B1002 21.328 17.198 11.940 1.00 50.39 C ATOM 3487 NH1 ARG B1002 22.155 16.435 11.236 1.00 30.89 N ATOM 3488 NH2 ARG B1002 21.016 18.402 11.489 1.00 47.93 N ATOM 3489 N ASP B1003 16.254 12.407 11.621 1.00 14.25 N ATOM 3490 CA ASP B1003 15.334 12.353 10.474 1.00 14.09 C ATOM 3491 C ASP B1003 14.436 11.117 10.543 1.00 16.08 C ATOM 3492 O ASP B1003 14.117 10.500 9.520 1.00 14.84 O ATOM 3493 CB ASP B1003 16.153 12.389 9.171 1.00 15.50 C ATOM 3494 CG ASP B1003 15.411 12.848 7.932 1.00 18.31 C ATOM 3495 OD1 ASP B1003 14.279 13.386 8.070 1.00 17.69 O ATOM 3496 OD2 ASP B1003 15.935 12.643 6.829 1.00 17.95 O ATOM 3497 N LEU B1004 14.024 10.756 11.754 1.00 12.86 N ATOM 3498 CA LEU B1004 13.167 9.593 11.928 1.00 13.28 C ATOM 3499 C LEU B1004 11.731 9.958 11.531 1.00 16.12 C ATOM 3500 O LEU B1004 11.113 10.826 12.141 1.00 14.13 O ATOM 3501 CB LEU B1004 13.248 9.024 13.358 1.00 13.35 C ATOM 3502 CG LEU B1004 12.391 7.771 13.608 1.00 18.06 C ATOM 3503 CD1 LEU B1004 12.780 6.622 12.654 1.00 17.41 C ATOM 3504 CD2 LEU B1004 12.518 7.319 15.043 1.00 19.43 C ATOM 3505 N ALA B1005 11.269 9.363 10.422 1.00 13.34 N ATOM 3506 CA ALA B1005 9.943 9.584 9.858 1.00 13.70 C ATOM 3507 C ALA B1005 9.602 8.338 9.054 1.00 15.45 C ATOM 3508 O ALA B1005 10.508 7.598 8.661 1.00 13.24 O ATOM 3509 CB ALA B1005 9.938 10.811 8.960 1.00 14.55 C ATOM 3510 N ALA B1006 8.300 8.086 8.833 1.00 13.09 N ATOM 3511 CA ALA B1006 7.833 6.907 8.095 1.00 13.73 C ATOM 3512 C ALA B1006 8.444 6.808 6.694 1.00 17.19 C ATOM 3513 O ALA B1006 8.683 5.705 6.203 1.00 18.23 O ATOM 3514 CB ALA B1006 6.315 6.930 7.996 1.00 14.68 C ATOM 3515 N ARG B1007 8.738 7.951 6.073 1.00 13.32 N ATOM 3516 CA ARG B1007 9.331 7.983 4.726 1.00 12.79 C ATOM 3517 C ARG B1007 10.776 7.457 4.711 1.00 14.36 C ATOM 3518 O ARG B1007 11.305 7.166 3.632 1.00 13.50 O ATOM 3519 CB ARG B1007 9.258 9.403 4.140 1.00 12.87 C ATOM 3520 CG ARG B1007 10.359 10.314 4.636 1.00 20.48 C ATOM 3521 CD ARG B1007 9.833 11.543 5.300 1.00 41.73 C ATOM 3522 NE ARG B1007 10.249 12.761 4.622 1.00 48.08 N ATOM 3523 CZ ARG B1007 11.254 13.536 5.015 1.00 56.72 C ATOM 3524 NH1 ARG B1007 11.526 14.662 4.363 1.00 29.41 N ATOM 3525 NH2 ARG B1007 11.985 13.201 6.075 1.00 33.83 N ATOM 3526 N ASN B1008 11.404 7.337 5.902 1.00 11.78 N ATOM 3527 CA ASN B1008 12.774 6.823 6.043 1.00 11.73 C ATOM 3528 C ASN B1008 12.833 5.396 6.607 1.00 15.72 C ATOM 3529 O ASN B1008 13.922 4.869 6.853 1.00 13.62 O ATOM 3530 CB ASN B1008 13.634 7.795 6.859 1.00 12.78 C ATOM 3531 CG ASN B1008 13.945 9.056 6.105 1.00 20.69 C ATOM 3532 OD1 ASN B1008 14.088 9.056 4.884 1.00 16.62 O ATOM 3533 ND2 ASN B1008 14.121 10.141 6.812 1.00 14.73 N ATOM 3534 N VAL B1009 11.652 4.773 6.811 1.00 12.45 N ATOM 3535 CA VAL B1009 11.548 3.403 7.316 1.00 11.64 C ATOM 3536 C VAL B1009 11.127 2.510 6.155 1.00 14.50 C ATOM 3537 O VAL B1009 10.099 2.753 5.536 1.00 13.95 O ATOM 3538 CB VAL B1009 10.603 3.283 8.546 1.00 15.10 C ATOM 3539 CG1 VAL B1009 10.521 1.845 9.043 1.00 14.39 C ATOM 3540 CG2 VAL B1009 11.053 4.211 9.680 1.00 15.06 C ATOM 3541 N LEU B1010 11.912 1.476 5.880 1.00 11.45 N ATOM 3542 CA LEU B1010 11.670 0.572 4.761 1.00 10.99 C ATOM 3543 C LEU B1010 10.985 -0.693 5.186 1.00 13.99 C ATOM 3544 O LEU B1010 11.158 -1.134 6.307 1.00 11.91 O ATOM 3545 CB LEU B1010 12.999 0.217 4.063 1.00 10.78 C ATOM 3546 CG LEU B1010 13.951 1.371 3.725 1.00 13.19 C ATOM 3547 CD1 LEU B1010 15.265 0.827 3.200 1.00 12.65 C ATOM 3548 CD2 LEU B1010 13.311 2.378 2.752 1.00 13.33 C ATOM 3549 N VAL B1011 10.253 -1.303 4.262 1.00 12.40 N ATOM 3550 CA VAL B1011 9.533 -2.544 4.488 1.00 11.97 C ATOM 3551 C VAL B1011 10.322 -3.684 3.879 1.00 15.71 C ATOM 3552 O VAL B1011 10.463 -3.772 2.650 1.00 16.10 O ATOM 3553 CB VAL B1011 8.094 -2.462 3.915 1.00 14.98 C ATOM 3554 CG1 VAL B1011 7.357 -3.798 4.086 1.00 13.94 C ATOM 3555 CG2 VAL B1011 7.325 -1.315 4.562 1.00 14.07 C ATOM 3556 N GLU B1012 10.869 -4.546 4.745 1.00 12.94 N ATOM 3557 CA GLU B1012 11.623 -5.735 4.355 1.00 13.21 C ATOM 3558 C GLU B1012 10.638 -6.820 3.887 1.00 18.41 C ATOM 3559 O GLU B1012 10.848 -7.452 2.860 1.00 18.31 O ATOM 3560 CB GLU B1012 12.520 -6.221 5.524 1.00 14.63 C ATOM 3561 CG GLU B1012 13.108 -7.622 5.356 1.00 21.11 C ATOM 3562 CD GLU B1012 14.031 -7.849 4.174 1.00 35.41 C ATOM 3563 OE1 GLU B1012 14.678 -6.878 3.721 1.00 23.50 O ATOM 3564 OE2 GLU B1012 14.140 -9.015 3.728 1.00 39.27 O ATOM 3565 N SER B1013 9.541 -6.983 4.626 1.00 16.21 N ATOM 3566 CA SER B1013 8.454 -7.924 4.354 1.00 16.15 C ATOM 3567 C SER B1013 7.269 -7.419 5.143 1.00 19.50 C ATOM 3568 O SER B1013 7.405 -6.462 5.900 1.00 19.14 O ATOM 3569 CB SER B1013 8.826 -9.325 4.854 1.00 19.32 C ATOM 3570 OG SER B1013 8.787 -9.368 6.274 1.00 21.97 O ATOM 3571 N GLU B1014 6.137 -8.112 5.053 1.00 17.04 N ATOM 3572 CA GLU B1014 4.936 -7.778 5.822 1.00 17.48 C ATOM 3573 C GLU B1014 5.228 -7.817 7.347 1.00 19.61 C ATOM 3574 O GLU B1014 4.556 -7.137 8.112 1.00 19.67 O ATOM 3575 CB GLU B1014 3.861 -8.809 5.511 1.00 19.33 C ATOM 3576 CG GLU B1014 2.477 -8.450 6.004 1.00 27.92 C ATOM 3577 CD GLU B1014 1.506 -9.611 5.910 1.00 41.50 C ATOM 3578 OE1 GLU B1014 1.508 -10.320 4.877 1.00 26.73 O ATOM 3579 OE2 GLU B1014 0.751 -9.819 6.884 1.00 29.03 O ATOM 3580 N HIS B1015 6.237 -8.601 7.761 1.00 15.76 N ATOM 3581 CA HIS B1015 6.595 -8.802 9.169 1.00 15.78 C ATOM 3582 C HIS B1015 7.842 -8.052 9.633 1.00 19.00 C ATOM 3583 O HIS B1015 8.203 -8.173 10.814 1.00 19.24 O ATOM 3584 CB HIS B1015 6.808 -10.306 9.411 1.00 17.61 C ATOM 3585 CG HIS B1015 5.693 -11.143 8.872 1.00 22.55 C ATOM 3586 ND1 HIS B1015 4.439 -11.117 9.443 1.00 24.86 N ATOM 3587 CD2 HIS B1015 5.665 -11.944 7.782 1.00 25.84 C ATOM 3588 CE1 HIS B1015 3.694 -11.921 8.706 1.00 25.18 C ATOM 3589 NE2 HIS B1015 4.390 -12.443 7.698 1.00 25.72 N ATOM 3590 N GLN B1016 8.516 -7.314 8.737 1.00 14.10 N ATOM 3591 CA GLN B1016 9.776 -6.666 9.119 1.00 13.77 C ATOM 3592 C GLN B1016 10.029 -5.317 8.469 1.00 16.94 C ATOM 3593 O GLN B1016 9.884 -5.179 7.252 1.00 16.34 O ATOM 3594 CB GLN B1016 10.940 -7.640 8.842 1.00 14.99 C ATOM 3595 CG GLN B1016 12.299 -7.168 9.365 1.00 18.46 C ATOM 3596 CD GLN B1016 13.437 -8.080 8.964 1.00 32.35 C ATOM 3597 OE1 GLN B1016 13.257 -9.171 8.424 1.00 29.68 O ATOM 3598 NE2 GLN B1016 14.646 -7.644 9.218 1.00 24.21 N ATOM 3599 N VAL B1017 10.450 -4.332 9.285 1.00 13.39 N ATOM 3600 CA VAL B1017 10.827 -2.987 8.836 1.00 12.76 C ATOM 3601 C VAL B1017 12.295 -2.729 9.177 1.00 15.14 C ATOM 3602 O VAL B1017 12.845 -3.365 10.093 1.00 12.98 O ATOM 3603 CB VAL B1017 9.922 -1.833 9.339 1.00 17.06 C ATOM 3604 CG1 VAL B1017 8.527 -1.909 8.718 1.00 16.81 C ATOM 3605 CG2 VAL B1017 9.859 -1.782 10.876 1.00 17.11 C ATOM 3606 N LYS B1018 12.923 -1.798 8.451 1.00 12.10 N ATOM 3607 CA LYS B1018 14.320 -1.400 8.663 1.00 11.59 C ATOM 3608 C LYS B1018 14.466 0.113 8.485 1.00 15.12 C ATOM 3609 O LYS B1018 13.880 0.669 7.566 1.00 15.51 O ATOM 3610 CB LYS B1018 15.245 -2.091 7.644 1.00 12.82 C ATOM 3611 CG LYS B1018 15.230 -3.627 7.631 1.00 13.87 C ATOM 3612 CD LYS B1018 16.450 -4.163 6.881 1.00 13.48 C ATOM 3613 CE LYS B1018 16.403 -5.671 6.680 1.00 14.52 C ATOM 3614 NZ LYS B1018 17.730 -6.205 6.290 1.00 18.87 N ATOM 3615 N AILE B1019 15.244 0.776 9.346 0.50 11.47 N ATOM 3616 N BILE B1019 15.260 0.771 9.345 0.50 12.84 N ATOM 3617 CA AILE B1019 15.520 2.217 9.200 0.50 10.13 C ATOM 3618 CA BILE B1019 15.564 2.211 9.223 0.50 12.22 C ATOM 3619 C AILE B1019 16.415 2.310 7.966 0.50 13.99 C ATOM 3620 C BILE B1019 16.423 2.301 7.958 0.50 15.03 C ATOM 3621 O AILE B1019 17.420 1.611 7.890 0.50 13.94 O ATOM 3622 O BILE B1019 17.417 1.584 7.855 0.50 15.08 O ATOM 3623 CB AILE B1019 16.154 2.829 10.470 0.50 11.89 C ATOM 3624 CB BILE B1019 16.295 2.776 10.478 0.50 14.90 C ATOM 3625 CG1AILE B1019 15.194 2.671 11.667 0.50 11.55 C ATOM 3626 CG1BILE B1019 15.611 2.364 11.821 0.50 15.77 C ATOM 3627 CG2AILE B1019 16.519 4.314 10.247 0.50 11.97 C ATOM 3628 CG2BILE B1019 16.526 4.298 10.377 0.50 15.12 C ATOM 3629 CD1AILE B1019 15.888 2.644 13.022 0.50 10.34 C ATOM 3630 CD1BILE B1019 14.118 2.775 12.062 0.50 22.25 C ATOM 3631 N GLY B1020 16.015 3.124 7.013 1.00 12.26 N ATOM 3632 CA GLY B1020 16.587 3.134 5.700 1.00 13.27 C ATOM 3633 C GLY B1020 17.359 4.318 5.148 1.00 16.64 C ATOM 3634 O GLY B1020 17.692 4.291 4.011 1.00 15.05 O ATOM 3635 N ASP B1021 17.636 5.321 5.965 1.00 12.65 N ATOM 3636 CA ASP B1021 18.423 6.475 5.537 1.00 12.93 C ATOM 3637 C ASP B1021 19.094 7.075 6.751 1.00 14.85 C ATOM 3638 O ASP B1021 18.469 7.156 7.814 1.00 15.44 O ATOM 3639 CB ASP B1021 17.590 7.534 4.791 1.00 14.64 C ATOM 3640 CG ASP B1021 18.479 8.531 4.075 1.00 19.20 C ATOM 3641 OD1 ASP B1021 18.894 8.242 2.923 1.00 16.86 O ATOM 3642 OD2 ASP B1021 18.771 9.596 4.666 1.00 18.63 O ATOM 3643 N PHE B1022 20.363 7.457 6.600 1.00 11.66 N ATOM 3644 CA PHE B1022 21.201 7.993 7.680 1.00 11.76 C ATOM 3645 C PHE B1022 21.893 9.309 7.276 1.00 16.61 C ATOM 3646 O PHE B1022 22.948 9.648 7.814 1.00 16.09 O ATOM 3647 CB PHE B1022 22.216 6.909 8.137 1.00 12.75 C ATOM 3648 CG PHE B1022 21.518 5.705 8.729 1.00 13.28 C ATOM 3649 CD1 PHE B1022 21.179 5.670 10.080 1.00 15.87 C ATOM 3650 CD2 PHE B1022 21.107 4.655 7.921 1.00 13.86 C ATOM 3651 CE1 PHE B1022 20.473 4.587 10.612 1.00 16.82 C ATOM 3652 CE2 PHE B1022 20.389 3.579 8.451 1.00 16.25 C ATOM 3653 CZ PHE B1022 20.079 3.550 9.794 1.00 14.54 C ATOM 3654 N GLY B1023 21.275 10.037 6.348 1.00 15.20 N ATOM 3655 CA GLY B1023 21.796 11.284 5.783 1.00 15.67 C ATOM 3656 C GLY B1023 22.067 12.414 6.752 1.00 19.76 C ATOM 3657 O GLY B1023 22.943 13.242 6.502 1.00 19.21 O ATOM 3658 N LEU B1024 21.337 12.447 7.876 1.00 16.93 N ATOM 3659 CA LEU B1024 21.494 13.485 8.902 1.00 15.83 C ATOM 3660 C LEU B1024 22.113 12.945 10.200 1.00 18.56 C ATOM 3661 O LEU B1024 22.258 13.701 11.163 1.00 17.08 O ATOM 3662 CB LEU B1024 20.117 14.105 9.220 1.00 15.67 C ATOM 3663 CG LEU B1024 19.402 14.915 8.125 1.00 20.67 C ATOM 3664 CD1 LEU B1024 18.252 15.719 8.736 1.00 19.97 C ATOM 3665 CD2 LEU B1024 20.357 15.883 7.391 1.00 23.58 C ATOM 3666 N THR B1025 22.417 11.638 10.249 1.00 14.84 N ATOM 3667 CA THR B1025 22.961 10.968 11.425 1.00 14.15 C ATOM 3668 C THR B1025 24.299 11.582 11.886 1.00 17.84 C ATOM 3669 O THR B1025 25.227 11.713 11.093 1.00 17.18 O ATOM 3670 CB THR B1025 22.955 9.445 11.236 1.00 17.29 C ATOM 3671 OG1 THR B1025 21.592 9.031 11.110 1.00 13.80 O ATOM 3672 CG2 THR B1025 23.585 8.693 12.421 1.00 14.37 C ATOM 3673 N LYS B1026 24.371 11.942 13.171 1.00 14.80 N ATOM 3674 CA LYS B1026 25.545 12.586 13.772 1.00 15.80 C ATOM 3675 C LYS B1026 25.933 11.891 15.053 1.00 22.68 C ATOM 3676 O LYS B1026 25.064 11.451 15.818 1.00 21.08 O ATOM 3677 CB LYS B1026 25.255 14.073 14.106 1.00 17.58 C ATOM 3678 CG LYS B1026 24.970 14.987 12.916 1.00 21.20 C ATOM 3679 CD LYS B1026 26.229 15.392 12.181 1.00 24.25 C ATOM 3680 CE LYS B1026 25.928 16.366 11.071 1.00 24.19 C ATOM 3681 NZ LYS B1026 27.149 16.707 10.299 1.00 32.15 N ATOM 3682 N ALA B1027 27.253 11.836 15.307 1.00 21.82 N ATOM 3683 CA ALA B1027 27.793 11.274 16.539 1.00 23.67 C ATOM 3684 C ALA B1027 27.679 12.324 17.644 1.00 30.23 C ATOM 3685 O ALA B1027 27.878 13.521 17.386 1.00 29.84 O ATOM 3686 CB ALA B1027 29.262 10.890 16.342 1.00 24.46 C ATOM 3687 N ILE B1028 27.289 11.881 18.849 1.00 28.25 N ATOM 3688 CA ILE B1028 27.260 12.728 20.031 1.00 29.11 C ATOM 3689 C ILE B1028 28.659 12.522 20.636 1.00 36.09 C ATOM 3690 O ILE B1028 29.069 11.368 20.870 1.00 35.43 O ATOM 3691 CB ILE B1028 26.167 12.339 21.068 1.00 31.62 C ATOM 3692 CG1 ILE B1028 24.743 12.383 20.480 1.00 31.24 C ATOM 3693 CG2 ILE B1028 26.273 13.232 22.329 1.00 31.57 C ATOM 3694 CD1 ILE B1028 23.768 11.668 21.372 1.00 33.82 C ATOM 3695 N GLU B1029 29.380 13.640 20.862 1.00 34.12 N ATOM 3696 CA GLU B1029 30.738 13.695 21.437 1.00 59.31 C ATOM 3697 C GLU B1029 30.886 12.901 22.744 1.00 91.15 C ATOM 3698 O GLU B1029 29.917 12.718 23.485 1.00 53.55 O ATOM 3699 CB GLU B1029 31.181 15.152 21.669 1.00 60.67 C ATOM 3700 CG GLU B1029 31.501 15.932 20.400 1.00 70.63 C ATOM 3701 CD GLU B1029 32.033 17.343 20.588 0.00 89.80 C ATOM 3702 OE1 GLU B1029 31.900 17.901 21.702 0.00 83.33 O ATOM 3703 OE2 GLU B1029 32.570 17.901 19.605 0.00 83.36 O ATOM 3704 N LYS B1032 29.143 14.419 26.483 1.00 40.57 N ATOM 3705 CA LYS B1032 28.144 15.390 26.045 1.00 39.64 C ATOM 3706 C LYS B1032 26.795 14.693 25.788 1.00 40.22 C ATOM 3707 O LYS B1032 26.765 13.475 25.594 1.00 39.51 O ATOM 3708 CB LYS B1032 28.648 16.172 24.818 1.00 42.43 C ATOM 3709 CG LYS B1032 29.999 16.880 25.023 1.00 58.50 C ATOM 3710 CD LYS B1032 29.898 18.140 25.884 0.00 68.78 C ATOM 3711 CE LYS B1032 31.244 18.654 26.322 0.00 79.85 C ATOM 3712 NZ LYS B1032 31.107 19.827 27.222 0.00 89.07 N ATOM 3713 N GLU B1033 25.680 15.447 25.862 1.00 34.07 N ATOM 3714 CA GLU B1033 24.328 14.897 25.694 1.00 33.09 C ATOM 3715 C GLU B1033 23.620 15.233 24.375 1.00 33.76 C ATOM 3716 O GLU B1033 22.570 14.668 24.082 1.00 33.65 O ATOM 3717 CB GLU B1033 23.432 15.290 26.885 1.00 34.59 C ATOM 3718 CG GLU B1033 23.781 14.592 28.193 1.00 46.97 C ATOM 3719 CD GLU B1033 22.627 13.997 28.988 1.00 77.85 C ATOM 3720 OE1 GLU B1033 22.193 12.869 28.654 1.00 76.77 O ATOM 3721 OE2 GLU B1033 22.233 14.608 30.007 1.00 79.09 O HETATM 3722 N PTR B1034 24.150 16.164 23.603 1.00 28.62 N HETATM 3723 CA PTR B1034 23.494 16.541 22.365 1.00 27.49 C HETATM 3724 C PTR B1034 24.466 17.011 21.309 1.00 28.58 C HETATM 3725 O PTR B1034 25.618 17.327 21.605 1.00 27.14 O HETATM 3726 CB PTR B1034 22.550 17.720 22.708 1.00 28.53 C HETATM 3727 CG PTR B1034 23.238 18.969 23.300 1.00 29.75 C HETATM 3728 CD1 PTR B1034 23.313 19.144 24.695 1.00 30.86 C HETATM 3729 CD2 PTR B1034 23.784 19.955 22.460 1.00 30.56 C HETATM 3730 CE1 PTR B1034 23.943 20.284 25.233 1.00 32.51 C HETATM 3731 CE2 PTR B1034 24.413 21.096 22.977 1.00 32.42 C HETATM 3732 CZ PTR B1034 24.501 21.288 24.380 1.00 34.63 C HETATM 3733 OH PTR B1034 25.151 22.458 24.788 1.00 39.54 O HETATM 3734 P PTR B1034 25.318 22.770 26.301 1.00 43.50 P HETATM 3735 O1P PTR B1034 26.055 24.099 26.301 1.00 44.77 O HETATM 3736 O2P PTR B1034 26.106 21.706 27.038 1.00 43.57 O HETATM 3737 O3P PTR B1034 23.956 22.900 26.975 1.00 43.98 O HETATM 3738 N PTR B1035 23.970 17.107 20.074 1.00 24.35 N HETATM 3739 CA PTR B1035 24.729 17.619 18.949 1.00 24.00 C HETATM 3740 C PTR B1035 24.148 19.000 18.638 1.00 25.37 C HETATM 3741 O PTR B1035 22.924 19.154 18.630 1.00 23.06 O HETATM 3742 CB PTR B1035 24.486 16.730 17.687 1.00 26.27 C HETATM 3743 CG PTR B1035 25.191 17.287 16.443 1.00 28.84 C HETATM 3744 CD1 PTR B1035 24.457 18.018 15.464 1.00 29.97 C HETATM 3745 CD2 PTR B1035 26.563 17.101 16.260 1.00 29.64 C HETATM 3746 CE1 PTR B1035 25.104 18.550 14.331 1.00 30.87 C HETATM 3747 CE2 PTR B1035 27.214 17.630 15.114 1.00 30.21 C HETATM 3748 CZ PTR B1035 26.511 18.383 14.134 1.00 31.68 C HETATM 3749 OH PTR B1035 27.068 18.934 12.955 1.00 34.15 O HETATM 3750 P PTR B1035 28.649 18.953 12.719 1.00 36.68 P HETATM 3751 O1P PTR B1035 29.187 17.600 12.377 1.00 37.47 O HETATM 3752 O2P PTR B1035 29.418 19.460 13.925 1.00 36.42 O HETATM 3753 O3P PTR B1035 28.875 19.842 11.515 1.00 37.78 O ATOM 3754 N THR B1036 25.011 19.997 18.396 1.00 21.49 N ATOM 3755 CA THR B1036 24.561 21.347 18.048 1.00 22.35 C ATOM 3756 C THR B1036 24.435 21.453 16.525 1.00 26.19 C ATOM 3757 O THR B1036 25.427 21.312 15.806 1.00 24.42 O ATOM 3758 CB THR B1036 25.467 22.424 18.699 1.00 30.80 C ATOM 3759 OG1 THR B1036 25.369 22.309 20.122 1.00 29.40 O ATOM 3760 CG2 THR B1036 25.087 23.840 18.281 1.00 30.97 C ATOM 3761 N VAL B1037 23.203 21.714 16.057 1.00 24.44 N ATOM 3762 CA VAL B1037 22.804 21.823 14.651 1.00 25.63 C ATOM 3763 C VAL B1037 23.239 23.173 14.058 1.00 30.50 C ATOM 3764 O VAL B1037 22.955 24.224 14.642 1.00 29.74 O ATOM 3765 CB VAL B1037 21.255 21.623 14.512 1.00 29.91 C ATOM 3766 CG1 VAL B1037 20.817 21.689 13.054 1.00 29.53 C ATOM 3767 CG2 VAL B1037 20.792 20.305 15.145 1.00 29.77 C ATOM 3768 N LYS B1038 23.892 23.133 12.882 1.00 27.40 N ATOM 3769 CA LYS B1038 24.329 24.331 12.150 1.00 27.29 C ATOM 3770 C LYS B1038 23.524 24.437 10.855 1.00 30.79 C ATOM 3771 O LYS B1038 22.930 25.477 10.585 1.00 30.56 O ATOM 3772 CB LYS B1038 25.846 24.299 11.846 1.00 29.75 C ATOM 3773 CG LYS B1038 26.759 24.334 13.076 1.00 39.40 C ATOM 3774 CD LYS B1038 27.228 22.942 13.478 1.00 46.89 C ATOM 3775 CE LYS B1038 28.117 22.964 14.695 1.00 53.85 C ATOM 3776 NZ LYS B1038 28.254 21.609 15.299 1.00 59.15 N ATOM 3777 N ASP B1039 23.497 23.353 10.060 1.00 26.77 N ATOM 3778 CA ASP B1039 22.761 23.299 8.799 1.00 25.98 C ATOM 3779 C ASP B1039 21.332 22.859 9.159 1.00 27.99 C ATOM 3780 O ASP B1039 21.117 21.706 9.530 1.00 26.64 O ATOM 3781 CB ASP B1039 23.456 22.304 7.846 1.00 27.97 C ATOM 3782 CG ASP B1039 22.826 22.109 6.475 1.00 33.94 C ATOM 3783 OD1 ASP B1039 21.694 22.602 6.257 1.00 34.45 O ATOM 3784 OD2 ASP B1039 23.459 21.450 5.625 1.00 35.17 O ATOM 3785 N ASP B1040 20.363 23.782 9.066 1.00 22.95 N ATOM 3786 CA ASP B1040 18.991 23.503 9.493 1.00 21.43 C ATOM 3787 C ASP B1040 17.886 24.013 8.580 1.00 25.73 C ATOM 3788 O ASP B1040 16.717 23.826 8.906 1.00 25.32 O ATOM 3789 CB ASP B1040 18.783 24.073 10.915 1.00 21.77 C ATOM 3790 CG ASP B1040 18.992 25.584 11.021 1.00 24.15 C ATOM 3791 OD1 ASP B1040 19.320 26.221 9.989 1.00 24.00 O ATOM 3792 OD2 ASP B1040 18.862 26.120 12.130 1.00 23.72 O ATOM 3793 N ARG B1041 18.229 24.663 7.455 1.00 23.61 N ATOM 3794 CA ARG B1041 17.227 25.225 6.552 1.00 23.96 C ATOM 3795 C ARG B1041 16.196 24.222 6.021 1.00 28.28 C ATOM 3796 O ARG B1041 15.052 24.616 5.810 1.00 28.24 O ATOM 3797 CB ARG B1041 17.865 26.080 5.441 1.00 24.42 C ATOM 3798 CG ARG B1041 18.332 25.314 4.198 1.00 31.27 C ATOM 3799 CD ARG B1041 18.979 26.208 3.170 1.00 36.89 C ATOM 3800 NE ARG B1041 18.010 27.108 2.552 1.00 49.79 N ATOM 3801 CZ ARG B1041 18.124 28.433 2.514 1.00 66.83 C ATOM 3802 NH1 ARG B1041 19.182 29.033 3.048 1.00 54.83 N ATOM 3803 NH2 ARG B1041 17.187 29.168 1.933 1.00 53.15 N ATOM 3804 N ASP B1042 16.585 22.941 5.823 1.00 24.32 N ATOM 3805 CA ASP B1042 15.669 21.904 5.330 1.00 24.02 C ATOM 3806 C ASP B1042 15.214 20.949 6.431 1.00 27.52 C ATOM 3807 O ASP B1042 14.831 19.812 6.137 1.00 28.26 O ATOM 3808 CB ASP B1042 16.273 21.153 4.132 1.00 26.25 C ATOM 3809 CG ASP B1042 16.592 22.052 2.947 1.00 40.03 C ATOM 3810 OD1 ASP B1042 15.771 22.940 2.635 1.00 40.01 O ATOM 3811 OD2 ASP B1042 17.664 21.872 2.339 1.00 50.15 O ATOM 3812 N SER B1043 15.213 21.423 7.694 1.00 21.99 N ATOM 3813 CA SER B1043 14.802 20.635 8.862 1.00 22.01 C ATOM 3814 C SER B1043 13.359 20.102 8.728 1.00 23.37 C ATOM 3815 O SER B1043 12.466 20.888 8.374 1.00 21.69 O ATOM 3816 CB SER B1043 14.880 21.480 10.136 1.00 27.13 C ATOM 3817 OG SER B1043 16.215 21.742 10.542 1.00 37.09 O ATOM 3818 N PRO B1044 13.104 18.799 9.047 1.00 18.23 N ATOM 3819 CA PRO B1044 11.712 18.288 9.030 1.00 16.73 C ATOM 3820 C PRO B1044 11.032 18.755 10.325 1.00 16.60 C ATOM 3821 O PRO B1044 10.829 17.979 11.263 1.00 14.68 O ATOM 3822 CB PRO B1044 11.899 16.765 8.986 1.00 18.64 C ATOM 3823 CG PRO B1044 13.229 16.515 9.634 1.00 22.94 C ATOM 3824 CD PRO B1044 14.069 17.756 9.473 1.00 19.13 C ATOM 3825 N VAL B1045 10.730 20.070 10.385 1.00 13.92 N ATOM 3826 CA VAL B1045 10.184 20.743 11.569 1.00 14.62 C ATOM 3827 C VAL B1045 8.999 20.084 12.270 1.00 18.62 C ATOM 3828 O VAL B1045 8.935 20.098 13.498 1.00 17.44 O ATOM 3829 CB VAL B1045 9.982 22.265 11.368 1.00 18.16 C ATOM 3830 CG1 VAL B1045 11.299 22.938 10.979 1.00 18.61 C ATOM 3831 CG2 VAL B1045 8.892 22.558 10.337 1.00 17.63 C ATOM 3832 N PHE B1046 8.069 19.508 11.500 1.00 15.41 N ATOM 3833 CA PHE B1046 6.880 18.871 12.075 1.00 15.70 C ATOM 3834 C PHE B1046 7.136 17.522 12.783 1.00 18.17 C ATOM 3835 O PHE B1046 6.232 16.957 13.402 1.00 16.08 O ATOM 3836 CB PHE B1046 5.754 18.837 11.047 1.00 17.21 C ATOM 3837 CG PHE B1046 5.389 20.242 10.600 1.00 18.15 C ATOM 3838 CD1 PHE B1046 4.756 21.126 11.470 1.00 20.56 C ATOM 3839 CD2 PHE B1046 5.695 20.683 9.321 1.00 18.99 C ATOM 3840 CE1 PHE B1046 4.432 22.432 11.060 1.00 21.36 C ATOM 3841 CE2 PHE B1046 5.358 21.982 8.911 1.00 22.52 C ATOM 3842 CZ PHE B1046 4.744 22.850 9.786 1.00 20.35 C ATOM 3843 N TRP B1047 8.393 17.061 12.757 1.00 15.85 N ATOM 3844 CA TRP B1047 8.829 15.833 13.436 1.00 16.27 C ATOM 3845 C TRP B1047 9.788 16.189 14.573 1.00 17.54 C ATOM 3846 O TRP B1047 10.235 15.306 15.295 1.00 14.35 O ATOM 3847 CB TRP B1047 9.548 14.903 12.421 1.00 15.50 C ATOM 3848 CG TRP B1047 8.607 14.046 11.623 1.00 16.52 C ATOM 3849 CD1 TRP B1047 8.358 12.719 11.806 1.00 18.87 C ATOM 3850 CD2 TRP B1047 7.785 14.463 10.522 1.00 16.73 C ATOM 3851 NE1 TRP B1047 7.447 12.277 10.880 1.00 18.79 N ATOM 3852 CE2 TRP B1047 7.076 13.328 10.078 1.00 20.13 C ATOM 3853 CE3 TRP B1047 7.606 15.685 9.839 1.00 18.76 C ATOM 3854 CZ2 TRP B1047 6.190 13.374 8.996 1.00 19.52 C ATOM 3855 CZ3 TRP B1047 6.717 15.735 8.774 1.00 20.24 C ATOM 3856 CH2 TRP B1047 6.010 14.591 8.371 1.00 20.81 C ATOM 3857 N TYR B1048 10.087 17.487 14.735 1.00 15.22 N ATOM 3858 CA TYR B1048 11.091 17.980 15.678 1.00 14.93 C ATOM 3859 C TYR B1048 10.613 18.420 17.041 1.00 19.63 C ATOM 3860 O TYR B1048 9.615 19.132 17.164 1.00 19.12 O ATOM 3861 CB TYR B1048 11.951 19.085 15.031 1.00 15.38 C ATOM 3862 CG TYR B1048 13.138 18.580 14.236 1.00 17.63 C ATOM 3863 CD1 TYR B1048 13.240 17.237 13.868 1.00 19.42 C ATOM 3864 CD2 TYR B1048 14.154 19.442 13.841 1.00 18.00 C ATOM 3865 CE1 TYR B1048 14.332 16.767 13.147 1.00 18.62 C ATOM 3866 CE2 TYR B1048 15.240 18.988 13.100 1.00 18.67 C ATOM 3867 CZ TYR B1048 15.338 17.643 12.773 1.00 24.07 C ATOM 3868 OH TYR B1048 16.414 17.188 12.042 1.00 20.76 O ATOM 3869 N ALA B1049 11.399 18.041 18.060 1.00 15.43 N ATOM 3870 CA ALA B1049 11.182 18.378 19.461 1.00 14.56 C ATOM 3871 C ALA B1049 11.446 19.890 19.692 1.00 19.46 C ATOM 3872 O ALA B1049 12.199 20.505 18.925 1.00 17.96 O ATOM 3873 CB ALA B1049 12.106 17.551 20.338 1.00 14.81 C ATOM 3874 N PRO B1050 10.823 20.501 20.732 1.00 17.91 N ATOM 3875 CA PRO B1050 11.020 21.944 20.978 1.00 17.56 C ATOM 3876 C PRO B1050 12.471 22.411 21.105 1.00 21.46 C ATOM 3877 O PRO B1050 12.793 23.488 20.604 1.00 20.50 O ATOM 3878 CB PRO B1050 10.229 22.176 22.270 1.00 18.79 C ATOM 3879 CG PRO B1050 9.184 21.131 22.258 1.00 22.80 C ATOM 3880 CD PRO B1050 9.892 19.926 21.728 1.00 18.80 C ATOM 3881 N GLU B1051 13.338 21.622 21.765 1.00 17.88 N ATOM 3882 CA GLU B1051 14.755 21.993 21.929 1.00 18.28 C ATOM 3883 C GLU B1051 15.502 22.085 20.586 1.00 22.48 C ATOM 3884 O GLU B1051 16.429 22.891 20.461 1.00 22.59 O ATOM 3885 CB GLU B1051 15.485 21.103 22.965 1.00 19.47 C ATOM 3886 CG GLU B1051 15.670 19.637 22.572 1.00 23.54 C ATOM 3887 CD GLU B1051 14.484 18.706 22.739 1.00 25.20 C ATOM 3888 OE1 GLU B1051 13.396 19.168 23.155 1.00 22.91 O ATOM 3889 OE2 GLU B1051 14.644 17.499 22.445 1.00 20.36 O ATOM 3890 N CYS B1052 15.063 21.294 19.577 1.00 18.79 N ATOM 3891 CA CYS B1052 15.619 21.307 18.213 1.00 18.31 C ATOM 3892 C CYS B1052 15.186 22.595 17.525 1.00 21.95 C ATOM 3893 O CYS B1052 15.995 23.246 16.866 1.00 22.86 O ATOM 3894 CB CYS B1052 15.158 20.089 17.413 1.00 18.70 C ATOM 3895 SG CYS B1052 15.455 18.507 18.234 1.00 22.56 S ATOM 3896 N LEU B1053 13.894 22.931 17.644 1.00 17.87 N ATOM 3897 CA LEU B1053 13.333 24.115 17.004 1.00 17.48 C ATOM 3898 C LEU B1053 13.812 25.424 17.634 1.00 23.84 C ATOM 3899 O LEU B1053 14.010 26.391 16.909 1.00 24.61 O ATOM 3900 CB LEU B1053 11.795 24.066 17.015 1.00 16.85 C ATOM 3901 CG LEU B1053 11.106 22.870 16.343 1.00 19.28 C ATOM 3902 CD1 LEU B1053 9.600 22.918 16.585 1.00 18.69 C ATOM 3903 CD2 LEU B1053 11.408 22.814 14.851 1.00 20.69 C ATOM 3904 N MET B1054 13.960 25.459 18.973 1.00 21.11 N ATOM 3905 CA MET B1054 14.317 26.673 19.710 1.00 21.95 C ATOM 3906 C MET B1054 15.813 26.927 19.845 1.00 28.39 C ATOM 3907 O MET B1054 16.251 28.063 19.654 1.00 27.46 O ATOM 3908 CB MET B1054 13.687 26.675 21.118 1.00 24.65 C ATOM 3909 CG MET B1054 12.188 26.471 21.134 1.00 28.79 C ATOM 3910 SD MET B1054 11.420 26.268 22.781 1.00 34.33 S ATOM 3911 CE MET B1054 12.482 25.051 23.542 1.00 31.37 C ATOM 3912 N GLN B1055 16.586 25.894 20.227 1.00 27.58 N ATOM 3913 CA GLN B1055 18.020 26.022 20.494 1.00 28.65 C ATOM 3914 C GLN B1055 18.964 25.297 19.538 1.00 32.31 C ATOM 3915 O GLN B1055 20.186 25.378 19.730 1.00 31.86 O ATOM 3916 CB GLN B1055 18.316 25.615 21.945 1.00 30.78 C ATOM 3917 CG GLN B1055 17.727 26.563 22.974 1.00 52.62 C ATOM 3918 CD GLN B1055 18.048 26.102 24.369 1.00 79.57 C ATOM 3919 OE1 GLN B1055 17.508 25.101 24.865 1.00 76.82 O ATOM 3920 NE2 GLN B1055 18.943 26.823 25.028 1.00 76.30 N ATOM 3921 N SER B1056 18.422 24.594 18.512 1.00 28.58 N ATOM 3922 CA SER B1056 19.200 23.817 17.530 1.00 28.59 C ATOM 3923 C SER B1056 20.065 22.727 18.223 1.00 30.77 C ATOM 3924 O SER B1056 21.176 22.424 17.784 1.00 31.05 O ATOM 3925 CB SER B1056 20.059 24.733 16.656 1.00 34.58 C ATOM 3926 OG SER B1056 19.411 25.968 16.389 1.00 44.38 O ATOM 3927 N LYS B1057 19.544 22.155 19.315 1.00 23.96 N ATOM 3928 CA LYS B1057 20.226 21.115 20.068 1.00 21.68 C ATOM 3929 C LYS B1057 19.496 19.793 19.841 1.00 23.49 C ATOM 3930 O LYS B1057 18.272 19.730 20.001 1.00 23.87 O ATOM 3931 CB LYS B1057 20.266 21.464 21.563 1.00 23.25 C ATOM 3932 CG LYS B1057 21.115 22.698 21.884 1.00 26.07 C ATOM 3933 CD LYS B1057 21.102 23.003 23.375 1.00 31.10 C ATOM 3934 CE LYS B1057 21.817 24.292 23.698 1.00 36.28 C ATOM 3935 NZ LYS B1057 21.700 24.634 25.140 1.00 44.20 N ATOM 3936 N PHE B1058 20.238 18.757 19.443 1.00 18.01 N ATOM 3937 CA PHE B1058 19.646 17.451 19.170 1.00 17.91 C ATOM 3938 C PHE B1058 20.150 16.378 20.138 1.00 21.17 C ATOM 3939 O PHE B1058 21.338 16.062 20.147 1.00 21.18 O ATOM 3940 CB PHE B1058 19.843 17.052 17.694 1.00 19.72 C ATOM 3941 CG PHE B1058 18.703 16.199 17.187 1.00 21.94 C ATOM 3942 CD1 PHE B1058 18.603 14.855 17.542 1.00 24.76 C ATOM 3943 CD2 PHE B1058 17.709 16.745 16.386 1.00 24.21 C ATOM 3944 CE1 PHE B1058 17.534 14.072 17.095 1.00 25.28 C ATOM 3945 CE2 PHE B1058 16.633 15.960 15.947 1.00 26.73 C ATOM 3946 CZ PHE B1058 16.545 14.636 16.322 1.00 24.90 C ATOM 3947 N TYR B1059 19.232 15.824 20.960 1.00 17.73 N ATOM 3948 CA TYR B1059 19.529 14.779 21.958 1.00 17.29 C ATOM 3949 C TYR B1059 18.996 13.431 21.473 1.00 20.21 C ATOM 3950 O TYR B1059 18.243 13.392 20.513 1.00 18.64 O ATOM 3951 CB TYR B1059 18.785 15.088 23.283 1.00 18.74 C ATOM 3952 CG TYR B1059 19.143 16.399 23.954 1.00 20.41 C ATOM 3953 CD1 TYR B1059 18.659 17.609 23.465 1.00 22.52 C ATOM 3954 CD2 TYR B1059 19.882 16.421 25.136 1.00 21.94 C ATOM 3955 CE1 TYR B1059 18.956 18.817 24.096 1.00 24.67 C ATOM 3956 CE2 TYR B1059 20.174 17.622 25.785 1.00 22.79 C ATOM 3957 CZ TYR B1059 19.705 18.818 25.263 1.00 31.53 C ATOM 3958 OH TYR B1059 20.004 20.012 25.879 1.00 35.80 O ATOM 3959 N ILE B1060 19.307 12.334 22.194 1.00 18.17 N ATOM 3960 CA ILE B1060 18.705 11.025 21.893 1.00 18.64 C ATOM 3961 C ILE B1060 17.191 11.145 22.182 1.00 19.92 C ATOM 3962 O ILE B1060 16.366 10.622 21.425 1.00 17.83 O ATOM 3963 CB ILE B1060 19.399 9.876 22.680 1.00 21.41 C ATOM 3964 CG1 ILE B1060 20.753 9.524 22.010 1.00 22.48 C ATOM 3965 CG2 ILE B1060 18.494 8.628 22.795 1.00 21.35 C ATOM 3966 CD1 ILE B1060 21.716 8.641 22.860 1.00 27.96 C ATOM 3967 N ALA B1061 16.836 11.927 23.229 1.00 16.79 N ATOM 3968 CA ALA B1061 15.445 12.184 23.595 1.00 16.49 C ATOM 3969 C ALA B1061 14.698 12.923 22.467 1.00 18.93 C ATOM 3970 O ALA B1061 13.473 12.804 22.354 1.00 18.82 O ATOM 3971 CB ALA B1061 15.387 12.984 24.888 1.00 17.68 C ATOM 3972 N SER B1062 15.436 13.650 21.611 1.00 14.75 N ATOM 3973 CA SER B1062 14.849 14.356 20.461 1.00 14.52 C ATOM 3974 C SER B1062 14.441 13.323 19.394 1.00 18.36 C ATOM 3975 O SER B1062 13.426 13.511 18.722 1.00 18.90 O ATOM 3976 CB SER B1062 15.821 15.373 19.888 1.00 17.47 C ATOM 3977 OG SER B1062 16.295 16.266 20.886 1.00 23.41 O ATOM 3978 N ASP B1063 15.210 12.224 19.269 1.00 14.22 N ATOM 3979 CA ASP B1063 14.851 11.109 18.368 1.00 14.32 C ATOM 3980 C ASP B1063 13.603 10.388 18.890 1.00 17.87 C ATOM 3981 O ASP B1063 12.786 9.930 18.089 1.00 15.83 O ATOM 3982 CB ASP B1063 16.005 10.122 18.223 1.00 15.26 C ATOM 3983 CG ASP B1063 17.000 10.494 17.152 1.00 18.06 C ATOM 3984 OD1 ASP B1063 16.611 11.220 16.195 1.00 17.07 O ATOM 3985 OD2 ASP B1063 18.152 10.025 17.233 1.00 24.03 O ATOM 3986 N VAL B1064 13.436 10.306 20.233 1.00 15.14 N ATOM 3987 CA VAL B1064 12.245 9.708 20.861 1.00 14.37 C ATOM 3988 C VAL B1064 10.991 10.517 20.472 1.00 18.20 C ATOM 3989 O VAL B1064 9.966 9.919 20.125 1.00 15.63 O ATOM 3990 CB VAL B1064 12.395 9.534 22.401 1.00 17.44 C ATOM 3991 CG1 VAL B1064 11.092 9.032 23.033 1.00 17.32 C ATOM 3992 CG2 VAL B1064 13.531 8.573 22.729 1.00 17.06 C ATOM 3993 N TRP B1065 11.086 11.876 20.483 1.00 15.74 N ATOM 3994 CA TRP B1065 9.984 12.752 20.075 1.00 15.31 C ATOM 3995 C TRP B1065 9.619 12.449 18.614 1.00 15.89 C ATOM 3996 O TRP B1065 8.445 12.262 18.305 1.00 15.44 O ATOM 3997 CB TRP B1065 10.376 14.234 20.237 1.00 14.57 C ATOM 3998 CG TRP B1065 9.349 15.222 19.739 1.00 16.08 C ATOM 3999 CD1 TRP B1065 9.009 15.473 18.441 1.00 19.26 C ATOM 4000 CD2 TRP B1065 8.557 16.114 20.540 1.00 16.35 C ATOM 4001 NE1 TRP B1065 8.028 16.433 18.383 1.00 18.56 N ATOM 4002 CE2 TRP B1065 7.746 16.861 19.657 1.00 20.34 C ATOM 4003 CE3 TRP B1065 8.490 16.389 21.920 1.00 17.61 C ATOM 4004 CZ2 TRP B1065 6.840 17.834 20.110 1.00 20.12 C ATOM 4005 CZ3 TRP B1065 7.586 17.340 22.369 1.00 19.22 C ATOM 4006 CH2 TRP B1065 6.776 18.055 21.472 1.00 20.08 C ATOM 4007 N SER B1066 10.625 12.363 17.735 1.00 12.20 N ATOM 4008 CA SER B1066 10.427 12.049 16.308 1.00 11.94 C ATOM 4009 C SER B1066 9.800 10.666 16.139 1.00 15.49 C ATOM 4010 O SER B1066 8.985 10.478 15.229 1.00 15.13 O ATOM 4011 CB SER B1066 11.753 12.109 15.562 1.00 14.85 C ATOM 4012 OG SER B1066 12.314 13.408 15.631 1.00 20.24 O ATOM 4013 N PHE B1067 10.151 9.712 17.021 1.00 12.61 N ATOM 4014 CA PHE B1067 9.538 8.378 16.983 1.00 12.28 C ATOM 4015 C PHE B1067 8.038 8.476 17.272 1.00 16.48 C ATOM 4016 O PHE B1067 7.254 7.756 16.640 1.00 15.81 O ATOM 4017 CB PHE B1067 10.202 7.377 17.952 1.00 14.23 C ATOM 4018 CG PHE B1067 9.372 6.107 18.078 1.00 15.74 C ATOM 4019 CD1 PHE B1067 9.355 5.163 17.054 1.00 17.08 C ATOM 4020 CD2 PHE B1067 8.502 5.925 19.157 1.00 15.57 C ATOM 4021 CE1 PHE B1067 8.528 4.032 17.130 1.00 17.06 C ATOM 4022 CE2 PHE B1067 7.659 4.808 19.220 1.00 17.23 C ATOM 4023 CZ PHE B1067 7.672 3.872 18.206 1.00 15.81 C ATOM 4024 N GLY B1068 7.656 9.315 18.242 1.00 13.99 N ATOM 4025 CA GLY B1068 6.247 9.508 18.590 1.00 13.60 C ATOM 4026 C GLY B1068 5.440 9.956 17.389 1.00 16.79 C ATOM 4027 O GLY B1068 4.326 9.474 17.149 1.00 16.10 O ATOM 4028 N VAL B1069 6.024 10.871 16.603 1.00 12.94 N ATOM 4029 CA VAL B1069 5.408 11.394 15.374 1.00 12.66 C ATOM 4030 C VAL B1069 5.363 10.271 14.302 1.00 15.38 C ATOM 4031 O VAL B1069 4.353 10.130 13.612 1.00 13.70 O ATOM 4032 CB VAL B1069 6.140 12.670 14.890 1.00 16.01 C ATOM 4033 CG1 VAL B1069 5.485 13.229 13.641 1.00 15.83 C ATOM 4034 CG2 VAL B1069 6.181 13.735 15.987 1.00 15.89 C ATOM 4035 N THR B1070 6.448 9.459 14.195 1.00 13.24 N ATOM 4036 CA THR B1070 6.546 8.334 13.252 1.00 13.47 C ATOM 4037 C THR B1070 5.449 7.305 13.602 1.00 16.68 C ATOM 4038 O THR B1070 4.802 6.763 12.704 1.00 14.67 O ATOM 4039 CB THR B1070 7.963 7.718 13.266 1.00 17.81 C ATOM 4040 OG1 THR B1070 8.887 8.726 12.910 1.00 13.85 O ATOM 4041 CG2 THR B1070 8.123 6.536 12.296 1.00 17.27 C ATOM 4042 N LEU B1071 5.239 7.060 14.903 1.00 14.05 N ATOM 4043 CA LEU B1071 4.206 6.139 15.400 1.00 15.42 C ATOM 4044 C LEU B1071 2.813 6.633 14.994 1.00 18.45 C ATOM 4045 O LEU B1071 1.997 5.828 14.525 1.00 18.20 O ATOM 4046 CB LEU B1071 4.330 5.993 16.944 1.00 15.76 C ATOM 4047 CG LEU B1071 3.299 5.108 17.650 1.00 20.90 C ATOM 4048 CD1 LEU B1071 3.380 3.648 17.170 1.00 21.00 C ATOM 4049 CD2 LEU B1071 3.481 5.185 19.159 1.00 22.68 C ATOM 4050 N HIS B1072 2.571 7.955 15.100 1.00 14.74 N ATOM 4051 CA HIS B1072 1.310 8.577 14.673 1.00 14.44 C ATOM 4052 C HIS B1072 1.099 8.306 13.168 1.00 16.86 C ATOM 4053 O HIS B1072 0.018 7.900 12.769 1.00 16.55 O ATOM 4054 CB HIS B1072 1.310 10.095 14.975 1.00 14.83 C ATOM 4055 CG HIS B1072 -0.044 10.728 14.864 1.00 18.19 C ATOM 4056 ND1 HIS B1072 -0.611 11.013 13.636 1.00 20.01 N ATOM 4057 CD2 HIS B1072 -0.897 11.121 15.841 1.00 19.49 C ATOM 4058 CE1 HIS B1072 -1.792 11.553 13.903 1.00 19.27 C ATOM 4059 NE2 HIS B1072 -2.007 11.632 15.211 1.00 19.47 N ATOM 4060 N GLU B1073 2.157 8.446 12.349 1.00 12.40 N ATOM 4061 CA GLU B1073 2.093 8.195 10.896 1.00 11.81 C ATOM 4062 C GLU B1073 1.692 6.738 10.605 1.00 18.35 C ATOM 4063 O GLU B1073 0.839 6.478 9.745 1.00 17.24 O ATOM 4064 CB GLU B1073 3.460 8.447 10.241 1.00 12.47 C ATOM 4065 CG GLU B1073 3.950 9.887 10.281 1.00 15.80 C ATOM 4066 CD GLU B1073 5.191 10.002 9.434 1.00 21.11 C ATOM 4067 OE1 GLU B1073 6.304 9.792 9.973 1.00 15.52 O ATOM 4068 OE2 GLU B1073 5.038 10.150 8.201 1.00 17.35 O ATOM 4069 N LEU B1074 2.317 5.815 11.311 1.00 17.45 N ATOM 4070 CA LEU B1074 2.056 4.407 11.145 1.00 18.60 C ATOM 4071 C LEU B1074 0.611 4.100 11.429 1.00 20.97 C ATOM 4072 O LEU B1074 -0.017 3.479 10.663 1.00 21.11 O ATOM 4073 CB LEU B1074 2.839 3.650 12.214 1.00 19.88 C ATOM 4074 CG LEU B1074 3.885 2.703 11.791 1.00 28.49 C ATOM 4075 CD1 LEU B1074 4.725 2.302 12.975 1.00 28.91 C ATOM 4076 CD2 LEU B1074 3.194 1.522 11.158 1.00 35.05 C ATOM 4077 N LEU B1075 0.103 4.600 12.524 1.00 17.23 N ATOM 4078 CA LEU B1075 -1.279 4.414 12.978 1.00 17.46 C ATOM 4079 C LEU B1075 -2.329 5.038 12.062 1.00 21.14 C ATOM 4080 O LEU B1075 -3.464 4.558 12.049 1.00 21.09 O ATOM 4081 CB LEU B1075 -1.444 4.882 14.450 1.00 17.03 C ATOM 4082 CG LEU B1075 -0.693 4.028 15.494 1.00 22.84 C ATOM 4083 CD1 LEU B1075 -0.560 4.747 16.804 1.00 23.79 C ATOM 4084 CD2 LEU B1075 -1.370 2.697 15.714 1.00 26.27 C ATOM 4085 N THR B1076 -1.951 6.087 11.292 1.00 15.80 N ATOM 4086 CA THR B1076 -2.835 6.750 10.330 1.00 15.54 C ATOM 4087 C THR B1076 -2.575 6.187 8.929 1.00 20.46 C ATOM 4088 O THR B1076 -3.079 6.731 7.944 1.00 21.99 O ATOM 4089 CB THR B1076 -2.697 8.280 10.375 1.00 20.73 C ATOM 4090 OG1 THR B1076 -1.432 8.666 9.844 1.00 25.15 O ATOM 4091 CG2 THR B1076 -2.899 8.845 11.746 1.00 18.21 C ATOM 4092 N TYR B1077 -1.768 5.104 8.841 1.00 16.64 N ATOM 4093 CA TYR B1077 -1.396 4.429 7.591 1.00 16.37 C ATOM 4094 C TYR B1077 -0.727 5.387 6.594 1.00 19.17 C ATOM 4095 O TYR B1077 -0.892 5.229 5.385 1.00 18.05 O ATOM 4096 CB TYR B1077 -2.612 3.713 6.964 1.00 18.32 C ATOM 4097 CG TYR B1077 -3.135 2.564 7.799 1.00 19.72 C ATOM 4098 CD1 TYR B1077 -2.584 1.292 7.691 1.00 21.11 C ATOM 4099 CD2 TYR B1077 -4.199 2.743 8.682 1.00 20.76 C ATOM 4100 CE1 TYR B1077 -3.080 0.221 8.433 1.00 20.90 C ATOM 4101 CE2 TYR B1077 -4.684 1.684 9.455 1.00 21.60 C ATOM 4102 CZ TYR B1077 -4.131 0.420 9.316 1.00 30.06 C ATOM 4103 OH TYR B1077 -4.597 -0.632 10.078 1.00 30.58 O ATOM 4104 N CYS B1078 0.016 6.400 7.113 1.00 15.74 N ATOM 4105 CA CYS B1078 0.707 7.392 6.293 1.00 16.15 C ATOM 4106 C CYS B1078 -0.201 8.133 5.317 1.00 22.44 C ATOM 4107 O CYS B1078 0.257 8.523 4.238 1.00 22.03 O ATOM 4108 CB CYS B1078 1.897 6.767 5.577 1.00 16.29 C ATOM 4109 SG CYS B1078 3.238 6.297 6.683 1.00 19.26 S ATOM 4110 N ASP B1079 -1.487 8.305 5.664 1.00 20.93 N ATOM 4111 CA ASP B1079 -2.358 9.031 4.747 1.00 20.01 C ATOM 4112 C ASP B1079 -1.939 10.494 4.741 1.00 20.20 C ATOM 4113 O ASP B1079 -1.751 11.079 5.802 1.00 18.37 O ATOM 4114 CB ASP B1079 -3.844 8.886 5.108 1.00 21.12 C ATOM 4115 CG ASP B1079 -4.691 9.607 4.084 1.00 27.29 C ATOM 4116 OD1 ASP B1079 -4.826 9.086 2.959 1.00 28.73 O ATOM 4117 OD2 ASP B1079 -5.095 10.749 4.357 1.00 29.40 O ATOM 4118 N SER B1080 -1.739 11.049 3.541 1.00 19.36 N ATOM 4119 CA SER B1080 -1.300 12.437 3.336 1.00 21.02 C ATOM 4120 C SER B1080 -2.179 13.482 4.017 1.00 26.43 C ATOM 4121 O SER B1080 -1.650 14.456 4.539 1.00 25.75 O ATOM 4122 CB SER B1080 -1.121 12.736 1.849 1.00 26.29 C ATOM 4123 OG SER B1080 -2.330 12.507 1.144 1.00 40.87 O ATOM 4124 N ASP B1081 -3.513 13.261 4.070 1.00 24.03 N ATOM 4125 CA ASP B1081 -4.438 14.198 4.732 1.00 23.05 C ATOM 4126 C ASP B1081 -4.389 14.183 6.257 1.00 26.07 C ATOM 4127 O ASP B1081 -4.883 15.109 6.892 1.00 26.39 O ATOM 4128 CB ASP B1081 -5.873 14.055 4.193 1.00 24.32 C ATOM 4129 CG ASP B1081 -5.994 14.586 2.786 1.00 33.62 C ATOM 4130 OD1 ASP B1081 -5.976 15.827 2.619 1.00 35.81 O ATOM 4131 OD2 ASP B1081 -6.032 13.767 1.849 1.00 36.03 O ATOM 4132 N SER B1082 -3.761 13.164 6.848 1.00 22.17 N ATOM 4133 CA SER B1082 -3.599 13.058 8.305 1.00 21.59 C ATOM 4134 C SER B1082 -2.111 13.140 8.681 1.00 24.94 C ATOM 4135 O SER B1082 -1.740 12.806 9.804 1.00 23.55 O ATOM 4136 CB SER B1082 -4.175 11.733 8.809 1.00 25.04 C ATOM 4137 OG SER B1082 -5.574 11.668 8.617 1.00 36.82 O ATOM 4138 N SER B1083 -1.261 13.565 7.738 1.00 23.74 N ATOM 4139 CA SER B1083 0.179 13.658 7.970 1.00 23.77 C ATOM 4140 C SER B1083 0.483 14.679 9.083 1.00 26.66 C ATOM 4141 O SER B1083 -0.271 15.644 9.258 1.00 26.71 O ATOM 4142 CB SER B1083 0.917 14.031 6.685 1.00 27.33 C ATOM 4143 OG SER B1083 0.939 15.437 6.491 1.00 35.68 O ATOM 4144 N PRO B1084 1.588 14.489 9.830 1.00 22.20 N ATOM 4145 CA PRO B1084 1.941 15.450 10.892 1.00 21.26 C ATOM 4146 C PRO B1084 2.010 16.906 10.428 1.00 23.84 C ATOM 4147 O PRO B1084 1.615 17.789 11.179 1.00 22.06 O ATOM 4148 CB PRO B1084 3.300 14.938 11.363 1.00 23.02 C ATOM 4149 CG PRO B1084 3.219 13.466 11.114 1.00 27.41 C ATOM 4150 CD PRO B1084 2.559 13.377 9.779 1.00 23.32 C ATOM 4151 N MET B1085 2.472 17.152 9.191 1.00 22.77 N ATOM 4152 CA MET B1085 2.532 18.492 8.598 1.00 23.65 C ATOM 4153 C MET B1085 1.105 19.048 8.372 1.00 27.48 C ATOM 4154 O MET B1085 0.813 20.149 8.824 1.00 26.45 O ATOM 4155 CB MET B1085 3.339 18.469 7.287 1.00 26.89 C ATOM 4156 CG MET B1085 3.238 19.760 6.485 1.00 32.28 C ATOM 4157 SD MET B1085 4.603 20.032 5.332 1.00 38.30 S ATOM 4158 CE MET B1085 4.227 18.813 4.093 1.00 35.47 C ATOM 4159 N ALA B1086 0.221 18.274 7.708 1.00 23.93 N ATOM 4160 CA ALA B1086 -1.175 18.675 7.452 1.00 23.23 C ATOM 4161 C ALA B1086 -1.934 18.975 8.751 1.00 26.79 C ATOM 4162 O ALA B1086 -2.658 19.979 8.820 1.00 27.29 O ATOM 4163 CB ALA B1086 -1.898 17.595 6.659 1.00 23.67 C ATOM 4164 N LEU B1087 -1.752 18.130 9.785 1.00 20.90 N ATOM 4165 CA LEU B1087 -2.407 18.322 11.085 1.00 19.70 C ATOM 4166 C LEU B1087 -1.891 19.539 11.833 1.00 23.76 C ATOM 4167 O LEU B1087 -2.693 20.324 12.352 1.00 23.27 O ATOM 4168 CB LEU B1087 -2.349 17.070 11.967 1.00 19.20 C ATOM 4169 CG LEU B1087 -3.049 15.792 11.442 1.00 23.70 C ATOM 4170 CD1 LEU B1087 -2.932 14.672 12.464 1.00 23.42 C ATOM 4171 CD2 LEU B1087 -4.527 16.041 11.103 1.00 25.60 C ATOM 4172 N PHE B1088 -0.557 19.714 11.891 1.00 19.81 N ATOM 4173 CA PHE B1088 0.004 20.884 12.563 1.00 19.47 C ATOM 4174 C PHE B1088 -0.345 22.188 11.839 1.00 25.24 C ATOM 4175 O PHE B1088 -0.656 23.172 12.501 1.00 27.32 O ATOM 4176 CB PHE B1088 1.516 20.745 12.756 1.00 20.95 C ATOM 4177 CG PHE B1088 1.913 20.062 14.041 1.00 21.96 C ATOM 4178 CD1 PHE B1088 1.497 20.560 15.272 1.00 24.20 C ATOM 4179 CD2 PHE B1088 2.751 18.949 14.027 1.00 22.70 C ATOM 4180 CE1 PHE B1088 1.887 19.938 16.465 1.00 24.59 C ATOM 4181 CE2 PHE B1088 3.162 18.347 15.218 1.00 24.84 C ATOM 4182 CZ PHE B1088 2.720 18.835 16.429 1.00 23.74 C ATOM 4183 N LEU B1089 -0.342 22.184 10.495 1.00 22.20 N ATOM 4184 CA LEU B1089 -0.709 23.360 9.701 1.00 22.46 C ATOM 4185 C LEU B1089 -2.170 23.755 9.915 1.00 29.77 C ATOM 4186 O LEU B1089 -2.472 24.940 9.904 1.00 28.92 O ATOM 4187 CB LEU B1089 -0.391 23.196 8.206 1.00 22.11 C ATOM 4188 CG LEU B1089 1.094 23.323 7.806 1.00 26.77 C ATOM 4189 CD1 LEU B1089 1.292 23.014 6.326 1.00 26.39 C ATOM 4190 CD2 LEU B1089 1.665 24.713 8.139 1.00 28.65 C ATOM 4191 N LYS B1090 -3.059 22.775 10.167 1.00 28.24 N ATOM 4192 CA LYS B1090 -4.468 23.049 10.457 1.00 28.71 C ATOM 4193 C LYS B1090 -4.571 23.690 11.852 1.00 32.75 C ATOM 4194 O LYS B1090 -5.360 24.619 12.034 1.00 32.45 O ATOM 4195 CB LYS B1090 -5.304 21.758 10.380 1.00 31.83 C ATOM 4196 CG LYS B1090 -6.773 21.979 10.033 1.00 48.92 C ATOM 4197 CD LYS B1090 -7.007 22.010 8.522 0.00 59.51 C ATOM 4198 CE LYS B1090 -8.446 22.306 8.180 0.00 71.01 C ATOM 4199 NZ LYS B1090 -8.677 22.286 6.711 0.00 80.44 N ATOM 4200 N MET B1091 -3.729 23.230 12.815 1.00 29.20 N ATOM 4201 CA MET B1091 -3.698 23.747 14.187 1.00 29.46 C ATOM 4202 C MET B1091 -3.168 25.178 14.266 1.00 33.96 C ATOM 4203 O MET B1091 -3.761 26.011 14.953 1.00 34.50 O ATOM 4204 CB MET B1091 -2.828 22.863 15.090 1.00 32.13 C ATOM 4205 CG MET B1091 -3.488 21.579 15.531 1.00 36.41 C ATOM 4206 SD MET B1091 -2.281 20.395 16.178 1.00 40.75 S ATOM 4207 CE MET B1091 -1.930 21.128 17.767 1.00 37.51 C ATOM 4208 N ILE B1092 -2.033 25.452 13.592 1.00 28.90 N ATOM 4209 CA ILE B1092 -1.341 26.747 13.656 1.00 27.97 C ATOM 4210 C ILE B1092 -1.694 27.756 12.554 1.00 30.69 C ATOM 4211 O ILE B1092 -1.489 28.961 12.739 1.00 31.47 O ATOM 4212 CB ILE B1092 0.200 26.551 13.830 1.00 30.78 C ATOM 4213 CG1 ILE B1092 0.884 26.083 12.522 1.00 31.21 C ATOM 4214 CG2 ILE B1092 0.513 25.623 15.019 1.00 31.83 C ATOM 4215 CD1 ILE B1092 2.420 25.964 12.573 1.00 39.19 C ATOM 4216 N GLY B1093 -2.186 27.255 11.426 1.00 24.87 N ATOM 4217 CA GLY B1093 -2.510 28.060 10.260 1.00 24.15 C ATOM 4218 C GLY B1093 -1.491 27.844 9.153 1.00 27.98 C ATOM 4219 O GLY B1093 -0.289 27.777 9.434 1.00 27.73 O ATOM 4220 N PRO B1094 -1.930 27.702 7.881 1.00 24.49 N ATOM 4221 CA PRO B1094 -0.967 27.427 6.794 1.00 24.16 C ATOM 4222 C PRO B1094 -0.406 28.644 6.052 1.00 29.73 C ATOM 4223 O PRO B1094 0.352 28.472 5.094 1.00 29.91 O ATOM 4224 CB PRO B1094 -1.786 26.548 5.847 1.00 25.93 C ATOM 4225 CG PRO B1094 -3.198 27.074 5.993 1.00 30.43 C ATOM 4226 CD PRO B1094 -3.322 27.669 7.382 1.00 26.12 C ATOM 4227 N THR B1095 -0.777 29.867 6.465 1.00 27.34 N ATOM 4228 CA THR B1095 -0.354 31.078 5.753 1.00 27.51 C ATOM 4229 C THR B1095 0.670 31.931 6.512 1.00 29.97 C ATOM 4230 O THR B1095 0.765 33.137 6.259 1.00 29.52 O ATOM 4231 CB THR B1095 -1.592 31.900 5.325 1.00 38.41 C ATOM 4232 OG1 THR B1095 -2.312 32.283 6.495 1.00 40.24 O ATOM 4233 CG2 THR B1095 -2.513 31.142 4.368 1.00 38.87 C ATOM 4234 N HIS B1096 1.464 31.313 7.405 1.00 25.33 N ATOM 4235 CA HIS B1096 2.429 32.073 8.202 1.00 24.84 C ATOM 4236 C HIS B1096 3.851 32.249 7.646 1.00 26.98 C ATOM 4237 O HIS B1096 4.618 33.022 8.215 1.00 24.88 O ATOM 4238 CB HIS B1096 2.404 31.632 9.668 1.00 25.58 C ATOM 4239 CG HIS B1096 1.047 31.764 10.283 1.00 29.27 C ATOM 4240 ND1 HIS B1096 0.504 33.003 10.578 1.00 31.12 N ATOM 4241 CD2 HIS B1096 0.155 30.804 10.623 1.00 31.50 C ATOM 4242 CE1 HIS B1096 -0.700 32.757 11.074 1.00 30.83 C ATOM 4243 NE2 HIS B1096 -0.947 31.451 11.136 1.00 31.27 N ATOM 4244 N GLY B1097 4.171 31.575 6.541 1.00 23.17 N ATOM 4245 CA GLY B1097 5.482 31.661 5.906 1.00 22.66 C ATOM 4246 C GLY B1097 6.636 31.487 6.875 1.00 23.89 C ATOM 4247 O GLY B1097 6.669 30.507 7.623 1.00 21.07 O ATOM 4248 N GLN B1098 7.536 32.498 6.933 1.00 20.35 N ATOM 4249 CA GLN B1098 8.719 32.528 7.811 1.00 19.79 C ATOM 4250 C GLN B1098 8.380 32.459 9.317 1.00 21.81 C ATOM 4251 O GLN B1098 9.267 32.195 10.124 1.00 22.22 O ATOM 4252 CB GLN B1098 9.602 33.765 7.508 1.00 21.61 C ATOM 4253 CG GLN B1098 8.943 35.106 7.831 1.00 28.07 C ATOM 4254 CD GLN B1098 9.807 36.316 7.536 1.00 42.93 C ATOM 4255 OE1 GLN B1098 11.038 36.315 7.716 1.00 35.45 O ATOM 4256 NE2 GLN B1098 9.160 37.404 7.128 1.00 30.35 N ATOM 4257 N MET B1099 7.112 32.719 9.687 1.00 17.80 N ATOM 4258 CA MET B1099 6.655 32.684 11.084 1.00 17.79 C ATOM 4259 C MET B1099 6.108 31.316 11.518 1.00 22.55 C ATOM 4260 O MET B1099 5.743 31.150 12.686 1.00 22.05 O ATOM 4261 CB MET B1099 5.575 33.760 11.334 1.00 19.81 C ATOM 4262 CG MET B1099 5.989 35.163 10.936 1.00 22.41 C ATOM 4263 SD MET B1099 7.553 35.720 11.643 1.00 25.50 S ATOM 4264 CE MET B1099 7.126 35.838 13.386 1.00 20.47 C ATOM 4265 N THR B1100 6.044 30.347 10.594 1.00 19.17 N ATOM 4266 CA THR B1100 5.500 29.003 10.869 1.00 18.59 C ATOM 4267 C THR B1100 6.149 28.306 12.065 1.00 20.78 C ATOM 4268 O THR B1100 5.435 27.853 12.965 1.00 18.99 O ATOM 4269 CB THR B1100 5.462 28.151 9.588 1.00 22.07 C ATOM 4270 OG1 THR B1100 4.671 28.831 8.614 1.00 21.85 O ATOM 4271 CG2 THR B1100 4.863 26.770 9.818 1.00 22.34 C ATOM 4272 N VAL B1101 7.494 28.227 12.080 1.00 18.70 N ATOM 4273 CA VAL B1101 8.252 27.559 13.144 1.00 18.08 C ATOM 4274 C VAL B1101 8.033 28.189 14.533 1.00 20.14 C ATOM 4275 O VAL B1101 7.851 27.455 15.500 1.00 18.79 O ATOM 4276 CB VAL B1101 9.755 27.341 12.772 1.00 22.31 C ATOM 4277 CG1 VAL B1101 10.521 26.669 13.909 1.00 22.46 C ATOM 4278 CG2 VAL B1101 9.896 26.523 11.487 1.00 21.95 C ATOM 4279 N THR B1102 8.043 29.535 14.651 1.00 18.23 N ATOM 4280 CA THR B1102 7.786 30.156 15.963 1.00 17.83 C ATOM 4281 C THR B1102 6.342 29.894 16.417 1.00 20.74 C ATOM 4282 O THR B1102 6.103 29.743 17.611 1.00 20.59 O ATOM 4283 CB THR B1102 8.118 31.659 15.996 1.00 27.53 C ATOM 4284 OG1 THR B1102 7.715 32.276 14.778 1.00 25.74 O ATOM 4285 CG2 THR B1102 9.580 31.925 16.251 1.00 28.93 C ATOM 4286 N ARG B1103 5.393 29.841 15.468 1.00 18.86 N ATOM 4287 CA ARG B1103 3.986 29.525 15.782 1.00 19.42 C ATOM 4288 C ARG B1103 3.870 28.062 16.241 1.00 23.92 C ATOM 4289 O ARG B1103 3.119 27.760 17.170 1.00 23.68 O ATOM 4290 CB ARG B1103 3.086 29.805 14.586 1.00 17.81 C ATOM 4291 CG ARG B1103 2.841 31.309 14.425 1.00 20.73 C ATOM 4292 CD ARG B1103 1.588 31.600 13.680 1.00 32.03 C ATOM 4293 NE ARG B1103 1.318 33.037 13.613 1.00 32.90 N ATOM 4294 CZ ARG B1103 0.303 33.640 14.224 1.00 41.66 C ATOM 4295 NH1 ARG B1103 -0.563 32.934 14.941 1.00 27.86 N ATOM 4296 NH2 ARG B1103 0.123 34.948 14.091 1.00 23.99 N ATOM 4297 N LEU B1104 4.685 27.178 15.638 1.00 20.64 N ATOM 4298 CA LEU B1104 4.742 25.756 16.012 1.00 19.75 C ATOM 4299 C LEU B1104 5.322 25.609 17.429 1.00 24.73 C ATOM 4300 O LEU B1104 4.730 24.903 18.251 1.00 25.19 O ATOM 4301 CB LEU B1104 5.569 24.980 14.986 1.00 19.59 C ATOM 4302 CG LEU B1104 5.779 23.469 15.230 1.00 22.71 C ATOM 4303 CD1 LEU B1104 4.446 22.713 15.262 1.00 21.19 C ATOM 4304 CD2 LEU B1104 6.678 22.891 14.168 1.00 22.49 C ATOM 4305 N VAL B1105 6.431 26.327 17.730 1.00 20.49 N ATOM 4306 CA VAL B1105 7.070 26.354 19.055 1.00 20.06 C ATOM 4307 C VAL B1105 6.055 26.853 20.104 1.00 24.25 C ATOM 4308 O VAL B1105 5.951 26.259 21.179 1.00 21.31 O ATOM 4309 CB VAL B1105 8.368 27.224 19.040 1.00 23.85 C ATOM 4310 CG1 VAL B1105 8.821 27.604 20.449 1.00 24.47 C ATOM 4311 CG2 VAL B1105 9.490 26.513 18.304 1.00 22.92 C ATOM 4312 N ASN B1106 5.301 27.938 19.777 1.00 22.59 N ATOM 4313 CA ASN B1106 4.317 28.509 20.705 1.00 22.54 C ATOM 4314 C ASN B1106 3.193 27.530 21.040 1.00 26.80 C ATOM 4315 O ASN B1106 2.823 27.409 22.207 1.00 26.90 O ATOM 4316 CB ASN B1106 3.768 29.845 20.205 1.00 21.80 C ATOM 4317 CG ASN B1106 3.122 30.652 21.307 1.00 33.25 C ATOM 4318 OD1 ASN B1106 3.692 30.861 22.376 1.00 29.58 O ATOM 4319 ND2 ASN B1106 1.910 31.096 21.076 1.00 29.54 N ATOM 4320 N THR B1107 2.680 26.816 20.025 1.00 24.52 N ATOM 4321 CA THR B1107 1.644 25.780 20.178 1.00 24.73 C ATOM 4322 C THR B1107 2.174 24.633 21.068 1.00 26.68 C ATOM 4323 O THR B1107 1.471 24.181 21.968 1.00 25.49 O ATOM 4324 CB THR B1107 1.163 25.324 18.787 1.00 39.76 C ATOM 4325 OG1 THR B1107 0.527 26.424 18.146 1.00 44.85 O ATOM 4326 CG2 THR B1107 0.189 24.180 18.838 1.00 40.41 C ATOM 4327 N LEU B1108 3.425 24.192 20.844 1.00 22.79 N ATOM 4328 CA LEU B1108 4.022 23.116 21.650 1.00 21.85 C ATOM 4329 C LEU B1108 4.244 23.551 23.105 1.00 26.83 C ATOM 4330 O LEU B1108 4.012 22.756 24.021 1.00 25.64 O ATOM 4331 CB LEU B1108 5.316 22.570 21.014 1.00 21.18 C ATOM 4332 CG LEU B1108 5.179 21.930 19.608 1.00 24.56 C ATOM 4333 CD1 LEU B1108 6.559 21.604 19.009 1.00 23.75 C ATOM 4334 CD2 LEU B1108 4.274 20.671 19.623 1.00 24.48 C ATOM 4335 N LYS B1109 4.656 24.827 23.317 1.00 25.20 N ATOM 4336 CA LYS B1109 4.860 25.414 24.649 1.00 25.97 C ATOM 4337 C LYS B1109 3.542 25.411 25.428 1.00 31.23 C ATOM 4338 O LYS B1109 3.549 25.131 26.621 1.00 30.60 O ATOM 4339 CB LYS B1109 5.374 26.866 24.544 1.00 27.97 C ATOM 4340 CG LYS B1109 6.883 27.014 24.419 1.00 42.57 C ATOM 4341 CD LYS B1109 7.266 28.488 24.507 1.00 52.15 C ATOM 4342 CE LYS B1109 8.745 28.732 24.391 1.00 67.51 C ATOM 4343 NZ LYS B1109 9.060 30.183 24.408 1.00 75.43 N ATOM 4344 N GLU B1110 2.416 25.689 24.740 1.00 30.49 N ATOM 4345 CA GLU B1110 1.061 25.704 25.310 1.00 30.76 C ATOM 4346 C GLU B1110 0.537 24.302 25.686 1.00 36.19 C ATOM 4347 O GLU B1110 -0.522 24.199 26.309 1.00 36.33 O ATOM 4348 CB GLU B1110 0.083 26.423 24.361 1.00 32.19 C ATOM 4349 CG GLU B1110 0.272 27.935 24.352 1.00 42.10 C ATOM 4350 CD GLU B1110 -0.489 28.730 23.308 1.00 72.30 C ATOM 4351 OE1 GLU B1110 -1.018 28.125 22.348 1.00 73.06 O ATOM 4352 OE2 GLU B1110 -0.528 29.976 23.436 1.00 73.51 O ATOM 4353 N GLY B1111 1.277 23.251 25.320 1.00 31.74 N ATOM 4354 CA GLY B1111 0.919 21.867 25.623 1.00 30.22 C ATOM 4355 C GLY B1111 0.098 21.153 24.572 1.00 31.73 C ATOM 4356 O GLY B1111 -0.338 20.018 24.792 1.00 31.29 O ATOM 4357 N LYS B1112 -0.108 21.795 23.417 1.00 27.67 N ATOM 4358 CA LYS B1112 -0.864 21.201 22.321 1.00 27.09 C ATOM 4359 C LYS B1112 -0.008 20.159 21.583 1.00 29.65 C ATOM 4360 O LYS B1112 1.209 20.327 21.447 1.00 27.81 O ATOM 4361 CB LYS B1112 -1.432 22.270 21.379 1.00 30.71 C ATOM 4362 CG LYS B1112 -2.323 23.290 22.095 1.00 43.83 C ATOM 4363 CD LYS B1112 -3.074 24.191 21.130 1.00 56.90 C ATOM 4364 CE LYS B1112 -3.574 25.459 21.791 1.00 68.86 C ATOM 4365 NZ LYS B1112 -4.630 25.248 22.805 1.00 80.60 N ATOM 4366 N ARG B1113 -0.639 19.044 21.190 1.00 26.62 N ATOM 4367 CA ARG B1113 0.026 17.908 20.544 1.00 26.34 C ATOM 4368 C ARG B1113 -0.852 17.316 19.462 1.00 27.87 C ATOM 4369 O ARG B1113 -2.046 17.613 19.427 1.00 26.57 O ATOM 4370 CB ARG B1113 0.319 16.807 21.594 1.00 26.08 C ATOM 4371 CG ARG B1113 1.266 17.184 22.733 1.00 32.00 C ATOM 4372 CD ARG B1113 2.688 17.458 22.261 1.00 27.46 C ATOM 4373 NE ARG B1113 3.590 17.736 23.379 1.00 26.44 N ATOM 4374 CZ ARG B1113 3.794 18.940 23.907 1.00 29.52 C ATOM 4375 NH1 ARG B1113 3.152 20.001 23.432 1.00 21.52 N ATOM 4376 NH2 ARG B1113 4.635 19.092 24.915 1.00 24.05 N ATOM 4377 N LEU B1114 -0.283 16.430 18.608 1.00 24.28 N ATOM 4378 CA LEU B1114 -1.063 15.727 17.573 1.00 23.79 C ATOM 4379 C LEU B1114 -2.183 14.909 18.251 1.00 29.05 C ATOM 4380 O LEU B1114 -1.967 14.393 19.359 1.00 28.86 O ATOM 4381 CB LEU B1114 -0.174 14.810 16.712 1.00 23.40 C ATOM 4382 CG LEU B1114 0.832 15.494 15.782 1.00 26.24 C ATOM 4383 CD1 LEU B1114 1.749 14.454 15.126 1.00 25.61 C ATOM 4384 CD2 LEU B1114 0.131 16.320 14.707 1.00 26.10 C ATOM 4385 N PRO B1115 -3.401 14.848 17.667 1.00 26.95 N ATOM 4386 CA PRO B1115 -4.490 14.131 18.344 1.00 27.22 C ATOM 4387 C PRO B1115 -4.378 12.617 18.211 1.00 31.25 C ATOM 4388 O PRO B1115 -3.637 12.134 17.347 1.00 29.42 O ATOM 4389 CB PRO B1115 -5.737 14.660 17.638 1.00 28.83 C ATOM 4390 CG PRO B1115 -5.289 14.943 16.261 1.00 33.44 C ATOM 4391 CD PRO B1115 -3.851 15.419 16.380 1.00 28.92 C ATOM 4392 N CYS B1116 -5.121 11.874 19.060 1.00 27.70 N ATOM 4393 CA CYS B1116 -5.146 10.414 19.025 1.00 27.22 C ATOM 4394 C CYS B1116 -5.607 9.966 17.639 1.00 29.76 C ATOM 4395 O CYS B1116 -6.659 10.417 17.176 1.00 30.23 O ATOM 4396 CB CYS B1116 -6.041 9.850 20.128 1.00 27.29 C ATOM 4397 SG CYS B1116 -6.005 8.039 20.262 1.00 30.78 S ATOM 4398 N PRO B1117 -4.802 9.151 16.917 1.00 25.21 N ATOM 4399 CA PRO B1117 -5.237 8.686 15.590 1.00 24.39 C ATOM 4400 C PRO B1117 -6.577 7.950 15.669 1.00 28.14 C ATOM 4401 O PRO B1117 -6.881 7.385 16.722 1.00 26.40 O ATOM 4402 CB PRO B1117 -4.115 7.723 15.162 1.00 25.18 C ATOM 4403 CG PRO B1117 -2.936 8.121 15.970 1.00 29.35 C ATOM 4404 CD PRO B1117 -3.506 8.550 17.294 1.00 26.11 C ATOM 4405 N PRO B1118 -7.402 7.951 14.596 1.00 26.69 N ATOM 4406 CA PRO B1118 -8.668 7.195 14.647 1.00 27.26 C ATOM 4407 C PRO B1118 -8.392 5.713 14.883 1.00 30.82 C ATOM 4408 O PRO B1118 -7.394 5.179 14.383 1.00 29.23 O ATOM 4409 CB PRO B1118 -9.275 7.425 13.255 1.00 29.17 C ATOM 4410 CG PRO B1118 -8.618 8.667 12.751 1.00 33.82 C ATOM 4411 CD PRO B1118 -7.214 8.568 13.271 1.00 29.00 C ATOM 4412 N ASN B1119 -9.230 5.075 15.716 1.00 27.51 N ATOM 4413 CA ASN B1119 -9.147 3.658 16.082 1.00 27.71 C ATOM 4414 C ASN B1119 -7.937 3.289 16.937 1.00 31.74 C ATOM 4415 O ASN B1119 -7.716 2.110 17.204 1.00 30.92 O ATOM 4416 CB ASN B1119 -9.290 2.740 14.849 1.00 28.92 C ATOM 4417 CG ASN B1119 -10.504 3.068 14.025 1.00 54.30 C ATOM 4418 OD1 ASN B1119 -11.643 2.867 14.454 1.00 49.33 O ATOM 4419 ND2 ASN B1119 -10.291 3.660 12.861 1.00 44.65 N ATOM 4420 N CYS B1120 -7.169 4.289 17.391 1.00 28.46 N ATOM 4421 CA CYS B1120 -6.014 4.027 18.234 1.00 27.37 C ATOM 4422 C CYS B1120 -6.477 3.939 19.687 1.00 32.28 C ATOM 4423 O CYS B1120 -7.083 4.900 20.173 1.00 32.69 O ATOM 4424 CB CYS B1120 -4.942 5.096 18.048 1.00 26.45 C ATOM 4425 SG CYS B1120 -3.497 4.885 19.116 1.00 29.54 S ATOM 4426 N PRO B1121 -6.214 2.814 20.391 1.00 28.75 N ATOM 4427 CA PRO B1121 -6.615 2.727 21.807 1.00 28.59 C ATOM 4428 C PRO B1121 -5.836 3.707 22.668 1.00 33.37 C ATOM 4429 O PRO B1121 -4.676 4.007 22.360 1.00 31.29 O ATOM 4430 CB PRO B1121 -6.277 1.287 22.208 1.00 29.86 C ATOM 4431 CG PRO B1121 -5.851 0.600 20.994 1.00 34.76 C ATOM 4432 CD PRO B1121 -5.494 1.604 19.958 1.00 30.58 C ATOM 4433 N ASP B1122 -6.461 4.176 23.765 1.00 32.12 N ATOM 4434 CA ASP B1122 -5.846 5.118 24.698 1.00 32.92 C ATOM 4435 C ASP B1122 -4.494 4.636 25.215 1.00 35.56 C ATOM 4436 O ASP B1122 -3.581 5.447 25.315 1.00 35.45 O ATOM 4437 CB ASP B1122 -6.788 5.454 25.869 1.00 36.05 C ATOM 4438 CG ASP B1122 -6.361 6.677 26.665 1.00 54.36 C ATOM 4439 OD1 ASP B1122 -6.126 7.744 26.044 1.00 56.52 O ATOM 4440 OD2 ASP B1122 -6.275 6.574 27.907 1.00 62.69 O ATOM 4441 N GLU B1123 -4.341 3.317 25.487 1.00 31.35 N ATOM 4442 CA GLU B1123 -3.082 2.739 25.974 1.00 31.01 C ATOM 4443 C GLU B1123 -1.923 2.903 24.978 1.00 32.08 C ATOM 4444 O GLU B1123 -0.773 3.062 25.401 1.00 31.74 O ATOM 4445 CB GLU B1123 -3.248 1.279 26.445 1.00 32.99 C ATOM 4446 CG GLU B1123 -3.863 0.330 25.422 1.00 47.51 C ATOM 4447 CD GLU B1123 -5.370 0.141 25.474 1.00 67.42 C ATOM 4448 OE1 GLU B1123 -6.084 1.062 25.937 1.00 54.99 O ATOM 4449 OE2 GLU B1123 -5.842 -0.913 24.990 1.00 63.72 O ATOM 4450 N VAL B1124 -2.228 2.902 23.662 1.00 25.17 N ATOM 4451 CA VAL B1124 -1.208 3.127 22.627 1.00 23.22 C ATOM 4452 C VAL B1124 -0.895 4.637 22.584 1.00 24.98 C ATOM 4453 O VAL B1124 0.277 5.014 22.589 1.00 24.01 O ATOM 4454 CB VAL B1124 -1.589 2.544 21.236 1.00 25.34 C ATOM 4455 CG1 VAL B1124 -0.507 2.859 20.194 1.00 25.11 C ATOM 4456 CG2 VAL B1124 -1.814 1.033 21.326 1.00 24.26 C ATOM 4457 N TYR B1125 -1.938 5.481 22.601 1.00 21.64 N ATOM 4458 CA TYR B1125 -1.803 6.947 22.599 1.00 22.04 C ATOM 4459 C TYR B1125 -1.027 7.475 23.798 1.00 27.12 C ATOM 4460 O TYR B1125 -0.272 8.443 23.657 1.00 26.98 O ATOM 4461 CB TYR B1125 -3.169 7.646 22.481 1.00 23.92 C ATOM 4462 CG TYR B1125 -3.069 9.149 22.276 1.00 26.70 C ATOM 4463 CD1 TYR B1125 -2.287 9.685 21.254 1.00 28.33 C ATOM 4464 CD2 TYR B1125 -3.767 10.033 23.095 1.00 28.63 C ATOM 4465 CE1 TYR B1125 -2.187 11.063 21.063 1.00 28.36 C ATOM 4466 CE2 TYR B1125 -3.690 11.415 22.902 1.00 29.69 C ATOM 4467 CZ TYR B1125 -2.894 11.926 21.886 1.00 35.85 C ATOM 4468 OH TYR B1125 -2.804 13.288 21.695 1.00 34.12 O ATOM 4469 N GLN B1126 -1.193 6.838 24.970 1.00 25.36 N ATOM 4470 CA GLN B1126 -0.473 7.240 26.187 1.00 25.77 C ATOM 4471 C GLN B1126 1.031 7.020 26.067 1.00 30.10 C ATOM 4472 O GLN B1126 1.800 7.848 26.556 1.00 29.05 O ATOM 4473 CB GLN B1126 -1.071 6.611 27.464 1.00 27.04 C ATOM 4474 CG GLN B1126 -2.441 7.205 27.856 1.00 34.27 C ATOM 4475 CD GLN B1126 -2.498 8.720 27.824 1.00 48.30 C ATOM 4476 OE1 GLN B1126 -1.728 9.418 28.495 1.00 47.17 O ATOM 4477 NE2 GLN B1126 -3.388 9.267 27.008 1.00 38.16 N ATOM 4478 N LEU B1127 1.449 5.949 25.358 1.00 26.13 N ATOM 4479 CA LEU B1127 2.864 5.675 25.094 1.00 25.78 C ATOM 4480 C LEU B1127 3.407 6.729 24.130 1.00 27.34 C ATOM 4481 O LEU B1127 4.518 7.232 24.320 1.00 28.02 O ATOM 4482 CB LEU B1127 3.050 4.268 24.516 1.00 26.30 C ATOM 4483 CG LEU B1127 3.061 3.110 25.526 1.00 31.33 C ATOM 4484 CD1 LEU B1127 2.981 1.784 24.812 1.00 31.87 C ATOM 4485 CD2 LEU B1127 4.318 3.137 26.400 1.00 33.27 C ATOM 4486 N MET B1128 2.595 7.089 23.122 1.00 21.35 N ATOM 4487 CA MET B1128 2.906 8.126 22.140 1.00 21.06 C ATOM 4488 C MET B1128 3.102 9.473 22.857 1.00 25.74 C ATOM 4489 O MET B1128 4.070 10.166 22.563 1.00 24.89 O ATOM 4490 CB MET B1128 1.779 8.230 21.110 1.00 22.73 C ATOM 4491 CG MET B1128 2.097 9.118 19.937 1.00 25.76 C ATOM 4492 SD MET B1128 0.654 9.395 18.884 1.00 29.43 S ATOM 4493 CE MET B1128 0.394 7.774 18.298 1.00 25.72 C ATOM 4494 N ARG B1129 2.221 9.809 23.828 1.00 22.57 N ATOM 4495 CA ARG B1129 2.306 11.070 24.591 1.00 22.20 C ATOM 4496 C ARG B1129 3.570 11.174 25.446 1.00 24.41 C ATOM 4497 O ARG B1129 4.085 12.279 25.622 1.00 23.48 O ATOM 4498 CB ARG B1129 1.036 11.312 25.419 1.00 24.71 C ATOM 4499 CG ARG B1129 -0.165 11.748 24.585 1.00 36.05 C ATOM 4500 CD ARG B1129 -1.286 12.314 25.446 1.00 44.62 C ATOM 4501 NE ARG B1129 -0.959 13.634 25.991 1.00 51.55 N ATOM 4502 CZ ARG B1129 -1.219 14.793 25.390 1.00 57.86 C ATOM 4503 NH1 ARG B1129 -1.824 14.818 24.209 1.00 31.97 N ATOM 4504 NH2 ARG B1129 -0.883 15.937 25.971 1.00 45.73 N ATOM 4505 N LYS B1130 4.100 10.030 25.928 1.00 20.58 N ATOM 4506 CA LYS B1130 5.351 9.955 26.702 1.00 20.94 C ATOM 4507 C LYS B1130 6.576 10.346 25.851 1.00 22.10 C ATOM 4508 O LYS B1130 7.603 10.733 26.404 1.00 21.59 O ATOM 4509 CB LYS B1130 5.532 8.555 27.324 1.00 24.92 C ATOM 4510 CG LYS B1130 4.587 8.286 28.496 1.00 35.50 C ATOM 4511 CD LYS B1130 4.867 6.936 29.140 1.00 46.25 C ATOM 4512 CE LYS B1130 3.946 6.645 30.304 1.00 62.12 C ATOM 4513 NZ LYS B1130 4.268 7.468 31.506 1.00 73.90 N ATOM 4514 N CYS B1131 6.463 10.257 24.507 1.00 16.85 N ATOM 4515 CA CYS B1131 7.526 10.687 23.588 1.00 16.52 C ATOM 4516 C CYS B1131 7.518 12.215 23.496 1.00 22.71 C ATOM 4517 O CYS B1131 8.487 12.790 23.023 1.00 22.79 O ATOM 4518 CB CYS B1131 7.309 10.087 22.201 1.00 15.91 C ATOM 4519 SG CYS B1131 7.302 8.280 22.173 1.00 19.34 S ATOM 4520 N TRP B1132 6.385 12.850 23.846 1.00 20.73 N ATOM 4521 CA TRP B1132 6.182 14.278 23.659 1.00 21.69 C ATOM 4522 C TRP B1132 6.184 15.175 24.887 1.00 25.77 C ATOM 4523 O TRP B1132 5.570 16.247 24.862 1.00 25.41 O ATOM 4524 CB TRP B1132 4.943 14.529 22.804 1.00 21.02 C ATOM 4525 CG TRP B1132 4.925 13.829 21.475 1.00 21.90 C ATOM 4526 CD1 TRP B1132 5.995 13.529 20.682 1.00 24.52 C ATOM 4527 CD2 TRP B1132 3.763 13.449 20.741 1.00 21.48 C ATOM 4528 NE1 TRP B1132 5.569 12.947 19.513 1.00 23.71 N ATOM 4529 CE2 TRP B1132 4.200 12.901 19.514 1.00 24.96 C ATOM 4530 CE3 TRP B1132 2.384 13.500 21.008 1.00 22.65 C ATOM 4531 CZ2 TRP B1132 3.306 12.415 18.549 1.00 24.33 C ATOM 4532 CZ3 TRP B1132 1.501 13.023 20.049 1.00 23.82 C ATOM 4533 CH2 TRP B1132 1.963 12.492 18.835 1.00 24.26 C ATOM 4534 N GLU B1133 6.904 14.773 25.937 1.00 22.57 N ATOM 4535 CA GLU B1133 7.067 15.606 27.128 1.00 22.63 C ATOM 4536 C GLU B1133 7.906 16.791 26.653 1.00 27.32 C ATOM 4537 O GLU B1133 8.808 16.583 25.840 1.00 26.17 O ATOM 4538 CB GLU B1133 7.810 14.825 28.221 1.00 23.73 C ATOM 4539 CG GLU B1133 6.892 13.959 29.063 1.00 34.65 C ATOM 4540 CD GLU B1133 5.913 14.726 29.936 1.00 50.63 C ATOM 4541 OE1 GLU B1133 6.288 15.792 30.477 1.00 44.47 O ATOM 4542 OE2 GLU B1133 4.754 14.269 30.056 1.00 41.76 O ATOM 4543 N PHE B1134 7.564 18.029 27.074 1.00 25.45 N ATOM 4544 CA PHE B1134 8.280 19.221 26.630 1.00 25.01 C ATOM 4545 C PHE B1134 9.774 19.132 26.905 1.00 28.93 C ATOM 4546 O PHE B1134 10.575 19.421 26.014 1.00 28.66 O ATOM 4547 CB PHE B1134 7.673 20.513 27.212 1.00 26.35 C ATOM 4548 CG PHE B1134 8.177 21.767 26.526 1.00 26.92 C ATOM 4549 CD1 PHE B1134 7.538 22.269 25.396 1.00 27.73 C ATOM 4550 CD2 PHE B1134 9.294 22.442 27.006 1.00 29.72 C ATOM 4551 CE1 PHE B1134 8.008 23.424 24.761 1.00 30.40 C ATOM 4552 CE2 PHE B1134 9.771 23.591 26.361 1.00 29.52 C ATOM 4553 CZ PHE B1134 9.124 24.072 25.243 1.00 28.46 C ATOM 4554 N GLN B1135 10.148 18.711 28.126 1.00 26.70 N ATOM 4555 CA GLN B1135 11.545 18.586 28.513 1.00 26.38 C ATOM 4556 C GLN B1135 12.112 17.242 28.078 1.00 29.62 C ATOM 4557 O GLN B1135 11.520 16.217 28.411 1.00 28.20 O ATOM 4558 CB GLN B1135 11.731 18.780 30.032 1.00 27.93 C ATOM 4559 CG GLN B1135 11.442 20.204 30.538 1.00 43.65 C ATOM 4560 CD GLN B1135 12.330 21.276 29.939 1.00 66.38 C ATOM 4561 OE1 GLN B1135 11.849 22.304 29.446 1.00 62.65 O ATOM 4562 NE2 GLN B1135 13.646 21.075 29.971 1.00 60.30 N ATOM 4563 N PRO B1136 13.280 17.230 27.376 1.00 26.56 N ATOM 4564 CA PRO B1136 13.875 15.947 26.949 1.00 26.40 C ATOM 4565 C PRO B1136 14.035 14.919 28.074 1.00 29.94 C ATOM 4566 O PRO B1136 13.711 13.750 27.860 1.00 28.15 O ATOM 4567 CB PRO B1136 15.244 16.341 26.373 1.00 27.85 C ATOM 4568 CG PRO B1136 15.334 17.796 26.441 1.00 32.36 C ATOM 4569 CD PRO B1136 14.060 18.387 26.894 1.00 27.66 C ATOM 4570 N SER B1137 14.488 15.358 29.278 1.00 26.62 N ATOM 4571 CA SER B1137 14.704 14.469 30.430 1.00 26.44 C ATOM 4572 C SER B1137 13.457 13.743 30.953 1.00 29.16 C ATOM 4573 O SER B1137 13.605 12.711 31.616 1.00 29.55 O ATOM 4574 CB SER B1137 15.403 15.209 31.568 1.00 29.48 C ATOM 4575 OG SER B1137 14.613 16.299 32.010 1.00 36.13 O ATOM 4576 N ASN B1138 12.245 14.271 30.670 1.00 24.29 N ATOM 4577 CA ASN B1138 10.964 13.687 31.102 1.00 23.86 C ATOM 4578 C ASN B1138 10.362 12.705 30.094 1.00 27.78 C ATOM 4579 O ASN B1138 9.328 12.092 30.369 1.00 26.81 O ATOM 4580 CB ASN B1138 9.945 14.786 31.427 1.00 26.51 C ATOM 4581 CG ASN B1138 10.311 15.592 32.651 1.00 46.16 C ATOM 4582 OD1 ASN B1138 10.947 15.094 33.587 1.00 39.52 O ATOM 4583 ND2 ASN B1138 9.913 16.853 32.673 1.00 40.24 N ATOM 4584 N ARG B1139 10.994 12.576 28.931 1.00 24.55 N ATOM 4585 CA ARG B1139 10.522 11.691 27.875 1.00 23.46 C ATOM 4586 C ARG B1139 10.882 10.255 28.163 1.00 24.14 C ATOM 4587 O ARG B1139 11.920 9.982 28.769 1.00 22.58 O ATOM 4588 CB ARG B1139 11.125 12.104 26.530 1.00 23.11 C ATOM 4589 CG ARG B1139 10.361 13.237 25.881 1.00 27.38 C ATOM 4590 CD ARG B1139 11.051 13.769 24.644 1.00 19.44 C ATOM 4591 NE ARG B1139 10.827 15.214 24.552 1.00 18.90 N ATOM 4592 CZ ARG B1139 11.655 16.062 23.965 1.00 30.08 C ATOM 4593 NH1 ARG B1139 12.748 15.618 23.350 1.00 19.52 N ATOM 4594 NH2 ARG B1139 11.396 17.364 23.975 1.00 20.98 N ATOM 4595 N THR B1140 10.071 9.326 27.636 1.00 20.73 N ATOM 4596 CA THR B1140 10.335 7.895 27.736 1.00 20.74 C ATOM 4597 C THR B1140 11.608 7.552 26.944 1.00 24.51 C ATOM 4598 O THR B1140 12.009 8.310 26.061 1.00 24.94 O ATOM 4599 CB THR B1140 9.119 7.086 27.212 1.00 30.06 C ATOM 4600 OG1 THR B1140 9.424 5.695 27.321 1.00 32.36 O ATOM 4601 CG2 THR B1140 8.760 7.418 25.759 1.00 27.82 C ATOM 4602 N SER B1141 12.238 6.415 27.265 1.00 19.64 N ATOM 4603 CA SER B1141 13.398 5.932 26.528 1.00 18.03 C ATOM 4604 C SER B1141 12.876 4.932 25.485 1.00 19.10 C ATOM 4605 O SER B1141 11.718 4.510 25.584 1.00 17.18 O ATOM 4606 CB SER B1141 14.343 5.206 27.478 1.00 20.93 C ATOM 4607 OG SER B1141 13.730 4.020 27.955 1.00 20.26 O ATOM 4608 N PHE B1142 13.727 4.531 24.515 1.00 16.49 N ATOM 4609 CA PHE B1142 13.339 3.516 23.527 1.00 16.07 C ATOM 4610 C PHE B1142 13.142 2.162 24.221 1.00 20.68 C ATOM 4611 O PHE B1142 12.205 1.438 23.888 1.00 18.60 O ATOM 4612 CB PHE B1142 14.368 3.420 22.387 1.00 17.09 C ATOM 4613 CG PHE B1142 14.189 4.513 21.353 1.00 17.57 C ATOM 4614 CD1 PHE B1142 13.027 4.590 20.593 1.00 18.69 C ATOM 4615 CD2 PHE B1142 15.192 5.454 21.130 1.00 18.44 C ATOM 4616 CE1 PHE B1142 12.857 5.607 19.650 1.00 18.67 C ATOM 4617 CE2 PHE B1142 15.025 6.469 20.178 1.00 19.96 C ATOM 4618 CZ PHE B1142 13.856 6.547 19.456 1.00 18.03 C ATOM 4619 N GLN B1143 13.996 1.849 25.226 1.00 19.88 N ATOM 4620 CA GLN B1143 13.872 0.597 25.986 1.00 20.71 C ATOM 4621 C GLN B1143 12.502 0.498 26.709 1.00 23.90 C ATOM 4622 O GLN B1143 11.871 -0.561 26.657 1.00 24.00 O ATOM 4623 CB GLN B1143 15.068 0.402 26.951 1.00 23.16 C ATOM 4624 CG GLN B1143 15.275 -1.054 27.421 1.00 46.31 C ATOM 4625 CD GLN B1143 15.196 -2.071 26.302 1.00 68.11 C ATOM 4626 OE1 GLN B1143 16.068 -2.141 25.426 1.00 66.15 O ATOM 4627 NE2 GLN B1143 14.122 -2.859 26.290 1.00 55.41 N ATOM 4628 N ASN B1144 12.012 1.621 27.292 1.00 19.52 N ATOM 4629 CA ASN B1144 10.718 1.676 27.979 1.00 18.62 C ATOM 4630 C ASN B1144 9.546 1.528 26.991 1.00 22.08 C ATOM 4631 O ASN B1144 8.539 0.884 27.311 1.00 21.62 O ATOM 4632 CB ASN B1144 10.589 2.957 28.807 1.00 20.10 C ATOM 4633 CG ASN B1144 9.309 3.032 29.606 1.00 33.49 C ATOM 4634 OD1 ASN B1144 8.452 3.889 29.375 1.00 33.00 O ATOM 4635 ND2 ASN B1144 9.132 2.098 30.518 1.00 24.01 N ATOM 4636 N LEU B1145 9.687 2.107 25.777 1.00 16.99 N ATOM 4637 CA LEU B1145 8.676 1.968 24.713 1.00 15.52 C ATOM 4638 C LEU B1145 8.562 0.509 24.266 1.00 18.95 C ATOM 4639 O LEU B1145 7.449 0.026 24.105 1.00 19.53 O ATOM 4640 CB LEU B1145 9.008 2.866 23.505 1.00 14.57 C ATOM 4641 CG LEU B1145 8.721 4.346 23.684 1.00 17.75 C ATOM 4642 CD1 LEU B1145 9.491 5.167 22.683 1.00 18.53 C ATOM 4643 CD2 LEU B1145 7.224 4.644 23.599 1.00 16.71 C ATOM 4644 N ILE B1146 9.699 -0.198 24.104 1.00 17.34 N ATOM 4645 CA ILE B1146 9.723 -1.621 23.709 1.00 17.96 C ATOM 4646 C ILE B1146 8.943 -2.456 24.723 1.00 23.23 C ATOM 4647 O ILE B1146 8.068 -3.231 24.337 1.00 21.92 O ATOM 4648 CB ILE B1146 11.165 -2.155 23.469 1.00 21.04 C ATOM 4649 CG1 ILE B1146 11.803 -1.499 22.225 1.00 20.01 C ATOM 4650 CG2 ILE B1146 11.169 -3.710 23.320 1.00 21.98 C ATOM 4651 CD1 ILE B1146 13.336 -1.398 22.248 1.00 21.09 C ATOM 4652 N GLU B1147 9.216 -2.242 26.021 1.00 21.56 N ATOM 4653 CA GLU B1147 8.510 -2.929 27.115 1.00 21.57 C ATOM 4654 C GLU B1147 7.005 -2.651 27.075 1.00 25.48 C ATOM 4655 O GLU B1147 6.219 -3.584 27.176 1.00 25.63 O ATOM 4656 CB GLU B1147 9.113 -2.538 28.468 1.00 22.66 C ATOM 4657 CG GLU B1147 10.432 -3.241 28.739 1.00 32.83 C ATOM 4658 CD GLU B1147 11.067 -2.989 30.096 1.00 51.45 C ATOM 4659 OE1 GLU B1147 10.362 -2.514 31.018 1.00 45.13 O ATOM 4660 OE2 GLU B1147 12.279 -3.273 30.235 1.00 42.33 O ATOM 4661 N GLY B1148 6.628 -1.387 26.875 1.00 22.44 N ATOM 4662 CA GLY B1148 5.241 -0.952 26.772 1.00 21.91 C ATOM 4663 C GLY B1148 4.489 -1.612 25.631 1.00 26.02 C ATOM 4664 O GLY B1148 3.387 -2.130 25.839 1.00 25.21 O ATOM 4665 N PHE B1149 5.080 -1.617 24.413 1.00 22.03 N ATOM 4666 CA PHE B1149 4.435 -2.259 23.258 1.00 20.62 C ATOM 4667 C PHE B1149 4.343 -3.775 23.434 1.00 24.88 C ATOM 4668 O PHE B1149 3.287 -4.349 23.157 1.00 23.35 O ATOM 4669 CB PHE B1149 5.151 -1.916 21.943 1.00 21.20 C ATOM 4670 CG PHE B1149 5.133 -0.456 21.561 1.00 21.55 C ATOM 4671 CD1 PHE B1149 3.933 0.226 21.408 1.00 24.52 C ATOM 4672 CD2 PHE B1149 6.317 0.225 21.307 1.00 22.89 C ATOM 4673 CE1 PHE B1149 3.923 1.587 21.061 1.00 25.63 C ATOM 4674 CE2 PHE B1149 6.305 1.581 20.967 1.00 25.30 C ATOM 4675 CZ PHE B1149 5.112 2.249 20.837 1.00 24.18 C ATOM 4676 N GLU B1150 5.436 -4.412 23.912 1.00 23.39 N ATOM 4677 CA GLU B1150 5.489 -5.861 24.174 1.00 25.26 C ATOM 4678 C GLU B1150 4.371 -6.281 25.137 1.00 32.15 C ATOM 4679 O GLU B1150 3.764 -7.333 24.934 1.00 32.69 O ATOM 4680 CB GLU B1150 6.854 -6.284 24.735 1.00 26.56 C ATOM 4681 CG GLU B1150 7.955 -6.398 23.690 1.00 32.19 C ATOM 4682 CD GLU B1150 9.340 -6.729 24.218 1.00 51.50 C ATOM 4683 OE1 GLU B1150 9.591 -6.551 25.432 1.00 49.12 O ATOM 4684 OE2 GLU B1150 10.193 -7.133 23.397 1.00 45.48 O ATOM 4685 N ALA B1151 4.078 -5.437 26.154 1.00 30.10 N ATOM 4686 CA ALA B1151 3.003 -5.673 27.130 1.00 30.54 C ATOM 4687 C ALA B1151 1.639 -5.637 26.445 1.00 35.07 C ATOM 4688 O ALA B1151 0.781 -6.459 26.755 1.00 35.70 O ATOM 4689 CB ALA B1151 3.056 -4.637 28.242 1.00 31.38 C ATOM 4690 N LEU B1152 1.451 -4.716 25.489 1.00 31.09 N ATOM 4691 CA LEU B1152 0.203 -4.600 24.736 1.00 30.38 C ATOM 4692 C LEU B1152 0.045 -5.721 23.715 1.00 33.69 C ATOM 4693 O LEU B1152 -1.079 -6.104 23.393 1.00 34.29 O ATOM 4694 CB LEU B1152 0.072 -3.220 24.072 1.00 30.57 C ATOM 4695 CG LEU B1152 0.100 -2.006 25.012 1.00 35.02 C ATOM 4696 CD1 LEU B1152 0.103 -0.705 24.222 1.00 35.02 C ATOM 4697 CD2 LEU B1152 -1.062 -2.027 25.988 1.00 37.74 C ATOM 4698 N LEU B1153 1.168 -6.278 23.245 1.00 28.96 N ATOM 4699 CA LEU B1153 1.182 -7.369 22.272 1.00 27.74 C ATOM 4700 C LEU B1153 0.932 -8.728 22.924 1.00 59.89 C ATOM 4701 O LEU B1153 0.469 -9.643 22.253 1.00 31.80 O ATOM 4702 CB LEU B1153 2.512 -7.385 21.494 1.00 27.20 C ATOM 4703 CG LEU B1153 2.682 -6.297 20.425 1.00 29.68 C ATOM 4704 CD1 LEU B1153 4.128 -6.179 20.000 1.00 29.33 C ATOM 4705 CD2 LEU B1153 1.773 -6.546 19.224 1.00 29.10 C TER 4706 LEU B1153 HETATM 4707 C7 0NT A1201 8.875 51.678 1.484 1.00 16.85 C HETATM 4708 C2 0NT A1201 6.801 49.446 3.656 1.00 16.86 C HETATM 4709 C10 0NT A1201 6.435 52.217 1.715 1.00 16.47 C HETATM 4710 C6 0NT A1201 9.187 50.294 0.888 1.00 19.27 C HETATM 4711 C1 0NT A1201 6.622 47.919 3.635 1.00 18.46 C HETATM 4712 C3 0NT A1201 5.418 50.015 4.007 1.00 16.39 C HETATM 4713 N4 0NT A1201 7.328 49.966 2.357 1.00 17.92 N HETATM 4714 C5 0NT A1201 8.659 49.374 2.001 1.00 17.77 C HETATM 4715 C8 0NT A1201 7.589 51.451 2.340 1.00 17.46 C HETATM 4716 O11 0NT A1201 5.661 51.581 1.000 1.00 17.79 O HETATM 4717 N12 0NT A1201 6.261 53.564 1.900 1.00 15.52 N HETATM 4718 C13 0NT A1201 5.147 54.284 1.240 1.00 15.29 C HETATM 4719 C14 0NT A1201 5.698 55.454 0.381 1.00 15.25 C HETATM 4720 C15 0NT A1201 6.634 56.336 1.230 1.00 15.29 C HETATM 4721 C16 0NT A1201 7.767 55.535 1.921 1.00 17.27 C HETATM 4722 C17 0NT A1201 7.140 54.403 2.764 1.00 15.50 C HETATM 4723 N18 0NT A1201 7.143 57.541 0.552 1.00 13.94 N HETATM 4724 C19 0NT A1201 8.400 57.717 0.015 1.00 13.65 C HETATM 4725 N20 0NT A1201 8.543 58.940 -0.408 1.00 15.04 N HETATM 4726 C21 0NT A1201 7.409 59.644 -0.160 1.00 14.31 C HETATM 4727 C22 0NT A1201 6.498 58.755 0.460 1.00 13.43 C HETATM 4728 C23 0NT A1201 5.242 59.250 0.860 1.00 12.77 C HETATM 4729 C24 0NT A1201 4.066 58.663 1.516 1.00 14.09 C HETATM 4730 C25 0NT A1201 3.168 59.656 1.634 1.00 15.97 C HETATM 4731 N26 0NT A1201 3.677 60.818 1.116 1.00 17.50 N HETATM 4732 C28 0NT A1201 4.940 60.611 0.616 1.00 15.33 C HETATM 4733 N29 0NT A1201 5.839 61.415 0.019 1.00 14.97 N HETATM 4734 C30 0NT A1201 7.031 60.983 -0.367 1.00 13.96 C HETATM 4735 H9 0NT A1201 7.800 51.799 3.343 1.00 17.50 H HETATM 4736 H27 0NT A1201 3.202 61.666 1.084 1.00 17.68 H HETATM 4737 C1 PEG B1201 12.568 31.886 4.608 1.00 79.52 C HETATM 4738 O1 PEG B1201 13.161 32.941 5.351 1.00 80.05 O HETATM 4739 C2 PEG B1201 11.251 31.490 5.187 1.00 79.09 C HETATM 4740 O2 PEG B1201 10.660 30.457 4.414 1.00 79.03 O HETATM 4741 C3 PEG B1201 9.271 30.298 4.667 1.00 78.16 C HETATM 4742 C4 PEG B1201 8.958 28.858 4.928 1.00 77.77 C HETATM 4743 O4 PEG B1201 7.587 28.663 5.234 1.00 77.51 O HETATM 4744 C7 0NT B1202 12.465 9.837 0.948 1.00 16.31 C HETATM 4745 C2 0NT B1202 14.496 12.032 3.089 1.00 19.36 C HETATM 4746 C10 0NT B1202 14.958 9.320 1.089 1.00 16.47 C HETATM 4747 C6 0NT B1202 12.161 11.181 0.269 1.00 18.06 C HETATM 4748 C1 0NT B1202 14.623 13.559 3.154 1.00 21.59 C HETATM 4749 C3 0NT B1202 15.888 11.489 3.448 1.00 17.93 C HETATM 4750 N4 0NT B1202 14.028 11.549 1.755 1.00 17.48 N HETATM 4751 C5 0NT B1202 12.735 12.157 1.306 1.00 17.16 C HETATM 4752 C8 0NT B1202 13.788 10.064 1.724 1.00 16.81 C HETATM 4753 O11 0NT B1202 15.751 9.963 0.401 1.00 16.58 O HETATM 4754 N12 0NT B1202 15.130 7.974 1.250 1.00 15.59 N HETATM 4755 C13 0NT B1202 16.261 7.262 0.601 1.00 14.91 C HETATM 4756 C14 0NT B1202 15.696 6.151 -0.306 1.00 14.02 C HETATM 4757 C15 0NT B1202 14.815 5.219 0.537 1.00 15.17 C HETATM 4758 C16 0NT B1202 13.665 5.960 1.259 1.00 12.08 C HETATM 4759 C17 0NT B1202 14.234 7.136 2.075 1.00 12.68 C HETATM 4760 N18 0NT B1202 14.297 4.066 -0.207 1.00 15.36 N HETATM 4761 C19 0NT B1202 13.050 3.961 -0.768 1.00 15.90 C HETATM 4762 N20 0NT B1202 12.883 2.766 -1.249 1.00 14.43 N HETATM 4763 C21 0NT B1202 13.985 2.014 -0.995 1.00 13.94 C HETATM 4764 C22 0NT B1202 14.910 2.843 -0.316 1.00 13.61 C HETATM 4765 C23 0NT B1202 16.141 2.294 0.088 1.00 12.03 C HETATM 4766 C24 0NT B1202 17.325 2.797 0.788 1.00 12.32 C HETATM 4767 C25 0NT B1202 18.185 1.767 0.886 1.00 15.28 C HETATM 4768 N26 0NT B1202 17.629 0.648 0.316 1.00 15.03 N HETATM 4769 C28 0NT B1202 16.385 0.930 -0.183 1.00 14.15 C HETATM 4770 N29 0NT B1202 15.467 0.183 -0.815 1.00 15.52 N HETATM 4771 C30 0NT B1202 14.326 0.684 -1.259 1.00 14.61 C HETATM 4772 H9 0NT B1202 13.611 9.703 2.730 1.00 17.50 H HETATM 4773 H27 0NT B1202 18.062 -0.218 0.258 1.00 15.46 H HETATM 4774 O HOH A1301 3.181 54.835 21.010 1.00 19.51 O HETATM 4775 O HOH A1302 1.737 50.856 10.061 1.00 17.14 O HETATM 4776 O HOH A1303 10.392 66.825 1.413 1.00 17.90 O HETATM 4777 O HOH A1304 13.111 42.541 8.803 1.00 19.48 O HETATM 4778 O HOH A1305 10.726 59.076 -2.228 1.00 21.76 O HETATM 4779 O HOH A1306 3.177 55.852 23.615 1.00 20.39 O HETATM 4780 O HOH A1307 -0.401 48.944 2.902 1.00 28.57 O HETATM 4781 O HOH A1308 9.270 29.189 9.598 1.00 21.76 O HETATM 4782 O HOH A1309 -12.112 59.704 3.597 1.00 19.15 O HETATM 4783 O HOH A1310 6.793 48.899 14.957 1.00 17.53 O HETATM 4784 O HOH A1311 -3.828 70.342 -8.755 1.00 20.14 O HETATM 4785 O HOH A1312 16.808 44.904 18.133 1.00 21.68 O HETATM 4786 O HOH A1313 15.127 70.058 13.563 1.00 18.25 O HETATM 4787 O HOH A1314 14.137 41.508 15.999 1.00 21.54 O HETATM 4788 O HOH A1315 15.067 43.793 16.242 1.00 18.99 O HETATM 4789 O HOH A1316 2.815 51.525 1.276 1.00 18.67 O HETATM 4790 O HOH A1317 -3.903 71.204 -13.508 1.00 22.94 O HETATM 4791 O HOH A1318 14.305 51.013 7.062 1.00 15.28 O HETATM 4792 O HOH A1319 2.035 55.840 2.913 1.00 14.81 O HETATM 4793 O HOH A1320 0.427 48.591 24.971 1.00 23.02 O HETATM 4794 O HOH A1321 21.655 50.379 11.305 1.00 22.77 O HETATM 4795 O HOH A1322 -0.944 64.851 10.567 1.00 18.90 O HETATM 4796 O HOH A1323 5.341 55.190 25.290 1.00 18.77 O HETATM 4797 O HOH A1324 1.910 66.986 9.375 1.00 20.77 O HETATM 4798 O HOH A1325 23.183 69.043 10.847 1.00 23.95 O HETATM 4799 O HOH A1326 -9.475 49.787 -4.359 1.00 30.24 O HETATM 4800 O HOH A1327 -9.987 52.917 10.858 1.00 35.66 O HETATM 4801 O HOH A1328 26.386 56.255 29.519 1.00 40.62 O HETATM 4802 O HOH A1329 -2.769 63.117 8.611 1.00 18.56 O HETATM 4803 O HOH A1330 -2.258 66.109 -17.754 1.00 27.43 O HETATM 4804 O HOH A1331 13.509 42.814 30.504 1.00 31.04 O HETATM 4805 O HOH A1332 3.775 32.663 17.564 1.00 28.00 O HETATM 4806 O HOH A1333 2.228 52.839 19.537 1.00 20.38 O HETATM 4807 O HOH A1334 19.196 45.019 19.402 1.00 23.20 O HETATM 4808 O HOH A1335 11.518 54.234 1.808 1.00 18.81 O HETATM 4809 O HOH A1336 21.312 51.106 8.234 1.00 23.05 O HETATM 4810 O HOH A1337 24.755 55.906 4.350 1.00 24.88 O HETATM 4811 O HOH A1338 20.051 70.926 14.132 1.00 30.62 O HETATM 4812 O HOH A1339 26.377 61.570 2.008 1.00 30.99 O HETATM 4813 O HOH A1340 2.951 70.198 -5.692 1.00 23.63 O HETATM 4814 O HOH A1341 -6.435 49.177 11.332 1.00 28.69 O HETATM 4815 O HOH A1342 -6.724 41.990 7.553 1.00 47.85 O HETATM 4816 O HOH A1343 2.342 39.702 6.865 1.00 24.67 O HETATM 4817 O HOH A1344 19.317 32.745 7.958 1.00 28.06 O HETATM 4818 O HOH A1345 3.979 72.031 -1.946 1.00 54.73 O HETATM 4819 O HOH A1346 -12.280 54.995 4.814 1.00 24.38 O HETATM 4820 O HOH A1347 5.064 57.770 26.307 1.00 20.62 O HETATM 4821 O HOH A1348 -12.574 52.317 9.600 1.00 32.12 O HETATM 4822 O HOH A1349 -14.480 62.027 -12.957 1.00 40.74 O HETATM 4823 O HOH A1350 12.019 30.177 12.598 1.00 22.33 O HETATM 4824 O HOH A1351 -0.270 55.683 5.012 1.00 24.98 O HETATM 4825 O HOH A1352 18.694 50.987 7.272 1.00 27.85 O HETATM 4826 O HOH A1353 -5.016 66.375 17.280 1.00 44.28 O HETATM 4827 O HOH A1354 1.497 67.229 -1.832 1.00 19.27 O HETATM 4828 O HOH A1355 -12.731 57.147 2.989 1.00 37.79 O HETATM 4829 O HOH A1356 4.708 68.592 -2.360 1.00 29.34 O HETATM 4830 O HOH A1357 -14.919 56.568 1.593 1.00 35.10 O HETATM 4831 O HOH A1358 23.012 52.430 1.359 1.00 34.64 O HETATM 4832 O HOH A1359 -3.880 50.496 9.065 1.00 20.75 O HETATM 4833 O HOH A1360 10.123 68.325 18.130 1.00 27.48 O HETATM 4834 O HOH A1361 -41.299 66.313 -23.940 1.00 23.52 O HETATM 4835 O HOH A1362 7.353 51.159 26.667 1.00 25.60 O HETATM 4836 O HOH A1363 12.752 51.933 0.798 1.00 25.68 O HETATM 4837 O HOH A1364 1.952 68.651 16.146 1.00 24.33 O HETATM 4838 O HOH A1365 -2.644 34.867 16.198 1.00 36.40 O HETATM 4839 O HOH A1366 11.280 61.399 -3.672 1.00 22.04 O HETATM 4840 O HOH A1367 -6.292 41.501 18.998 1.00 34.82 O HETATM 4841 O HOH A1368 -30.317 65.399 -9.463 1.00 80.67 O HETATM 4842 O HOH A1369 16.301 61.992 -0.618 1.00 26.28 O HETATM 4843 O HOH A1370 17.566 39.635 26.659 1.00 33.58 O HETATM 4844 O HOH A1371 7.600 68.125 16.697 1.00 27.35 O HETATM 4845 O HOH A1372 22.349 31.366 15.024 1.00 30.74 O HETATM 4846 O HOH A1373 20.049 57.278 -1.330 1.00 37.86 O HETATM 4847 O HOH A1374 12.641 40.609 7.080 1.00 24.83 O HETATM 4848 O HOH A1375 2.093 49.297 4.200 1.00 32.26 O HETATM 4849 O HOH A1376 3.404 50.828 7.671 1.00 24.13 O HETATM 4850 O HOH A1377 5.235 52.789 26.805 1.00 31.08 O HETATM 4851 O HOH A1378 6.182 42.625 30.221 1.00 34.08 O HETATM 4852 O HOH A1379 -1.521 67.653 10.341 1.00 27.56 O HETATM 4853 O HOH A1380 4.014 66.884 19.907 1.00 26.07 O HETATM 4854 O HOH A1381 -5.045 65.752 -16.680 1.00 24.85 O HETATM 4855 O HOH A1382 20.889 25.712 6.726 1.00 23.55 O HETATM 4856 O HOH A1383 7.383 49.498 28.818 1.00 34.94 O HETATM 4857 O HOH A1384 10.593 55.318 -0.360 1.00 28.82 O HETATM 4858 O HOH A1385 -3.952 41.780 -5.838 1.00 51.03 O HETATM 4859 O HOH A1386 -1.318 54.409 -6.246 1.00 20.63 O HETATM 4860 O HOH A1387 8.303 45.388 17.648 1.00 24.84 O HETATM 4861 O HOH A1388 26.613 64.239 2.099 1.00 29.67 O HETATM 4862 O HOH A1389 14.433 30.130 19.723 1.00 26.81 O HETATM 4863 O HOH A1390 8.731 68.973 13.924 1.00 26.70 O HETATM 4864 O HOH A1391 24.889 54.482 2.093 1.00 36.34 O HETATM 4865 O HOH A1392 -39.317 68.054 -23.358 1.00 35.81 O HETATM 4866 O HOH A1393 7.326 34.560 4.904 1.00 29.65 O HETATM 4867 O HOH A1394 -4.845 66.621 6.930 1.00 36.11 O HETATM 4868 O HOH A1395 -1.766 69.204 2.591 1.00 34.58 O HETATM 4869 O HOH A1396 2.766 42.245 7.674 1.00 32.90 O HETATM 4870 O HOH A1397 19.724 61.874 28.602 1.00 33.01 O HETATM 4871 O HOH A1398 0.156 42.218 8.590 1.00 46.02 O HETATM 4872 O HOH A1399 -7.058 51.083 -4.467 1.00 22.70 O HETATM 4873 O HOH A1400 9.384 49.732 -2.651 1.00 28.46 O HETATM 4874 O HOH A1401 3.989 70.289 6.793 1.00 48.03 O HETATM 4875 O HOH A1402 27.898 64.374 9.568 1.00 31.06 O HETATM 4876 O HOH A1403 -7.215 58.271 13.830 1.00 27.34 O HETATM 4877 O HOH A1404 -8.057 53.512 18.527 1.00 35.95 O HETATM 4878 O HOH A1405 17.453 46.348 5.974 1.00 51.51 O HETATM 4879 O HOH A1406 0.910 69.521 2.401 1.00 36.88 O HETATM 4880 O HOH A1407 8.850 69.096 1.507 1.00 37.35 O HETATM 4881 O HOH A1408 -5.557 48.769 7.873 1.00 32.70 O HETATM 4882 O HOH A1409 8.616 63.746 27.537 1.00 31.85 O HETATM 4883 O HOH A1410 -4.204 57.272 -11.377 1.00 37.42 O HETATM 4884 O HOH A1411 8.235 23.511 6.580 1.00 27.25 O HETATM 4885 O AHOH A1412 27.277 54.728 8.500 0.50 17.73 O HETATM 4886 O BHOH A1412 28.065 54.437 10.270 0.50 21.17 O HETATM 4887 O HOH A1413 -33.826 67.807 -6.591 1.00 30.23 O HETATM 4888 O HOH A1414 2.973 51.079 27.177 1.00 28.47 O HETATM 4889 O HOH A1415 5.521 68.973 -4.802 1.00 28.08 O HETATM 4890 O HOH A1416 9.462 47.966 10.485 1.00 32.08 O HETATM 4891 O HOH A1417 10.862 56.922 -3.783 1.00 32.10 O HETATM 4892 O HOH A1418 11.162 71.401 2.539 1.00 38.09 O HETATM 4893 O HOH A1419 -2.797 54.608 25.167 1.00 40.31 O HETATM 4894 O HOH A1420 -16.872 48.786 -1.037 1.00 68.10 O HETATM 4895 O HOH A1421 -0.871 67.558 17.432 1.00 36.29 O HETATM 4896 O HOH A1422 27.615 34.941 9.913 1.00 41.54 O HETATM 4897 O HOH A1423 -12.431 60.207 -13.119 1.00 24.95 O HETATM 4898 O HOH A1424 20.702 42.181 27.004 1.00 36.64 O HETATM 4899 O HOH A1425 28.037 47.913 21.306 1.00 37.50 O HETATM 4900 O HOH A1426 19.316 48.129 3.478 1.00 37.87 O HETATM 4901 O HOH A1427 5.936 68.834 0.905 1.00 35.32 O HETATM 4902 O HOH A1428 26.423 57.586 15.442 1.00 25.15 O HETATM 4903 O HOH A1429 4.742 68.935 3.211 1.00 29.90 O HETATM 4904 O HOH A1430 14.989 48.821 5.243 1.00 35.51 O HETATM 4905 O HOH A1431 27.764 51.790 10.611 1.00 44.42 O HETATM 4906 O HOH A1432 14.489 45.645 5.524 1.00 51.21 O HETATM 4907 O HOH A1433 2.996 48.717 26.083 1.00 23.91 O HETATM 4908 O HOH A1434 -10.340 54.647 -6.903 1.00 33.04 O HETATM 4909 O HOH A1435 14.597 49.361 2.384 1.00 37.45 O HETATM 4910 O HOH A1436 23.608 71.455 7.868 1.00 36.38 O HETATM 4911 O HOH A1437 10.344 54.866 30.962 1.00 26.58 O HETATM 4912 O HOH A1438 -7.063 46.837 15.511 1.00 95.32 O HETATM 4913 O HOH A1439 -7.562 48.670 13.693 1.00 39.58 O HETATM 4914 O HOH A1440 -7.010 51.566 -7.070 1.00 31.18 O HETATM 4915 O HOH A1441 19.054 46.113 25.447 1.00 42.50 O HETATM 4916 O HOH A1442 13.089 68.276 17.362 1.00 30.85 O HETATM 4917 O HOH A1443 -9.557 52.143 -6.978 1.00 44.99 O HETATM 4918 O HOH A1444 22.807 70.620 13.959 1.00 30.64 O HETATM 4919 O HOH A1445 12.128 44.746 7.129 1.00 29.44 O HETATM 4920 O HOH A1446 -13.112 48.620 6.701 1.00 29.87 O HETATM 4921 O HOH A1447 30.941 57.200 24.535 1.00 39.81 O HETATM 4922 O HOH A1448 -12.615 59.124 -9.707 1.00 37.96 O HETATM 4923 O HOH A1449 16.789 42.414 28.262 1.00 34.11 O HETATM 4924 O HOH A1450 8.655 54.246 -10.674 1.00 30.61 O HETATM 4925 O HOH A1451 10.772 70.629 13.176 1.00 34.13 O HETATM 4926 O HOH A1452 -4.448 42.624 9.178 1.00 35.31 O HETATM 4927 O HOH A1453 18.446 31.762 4.661 1.00 48.47 O HETATM 4928 O HOH A1454 -39.207 68.692 -20.737 1.00 34.89 O HETATM 4929 O HOH A1455 -5.201 69.492 -2.279 1.00 36.62 O HETATM 4930 O HOH A1456 20.818 51.557 29.073 1.00 33.97 O HETATM 4931 O HOH A1457 -10.780 70.257 -15.129 1.00 39.22 O HETATM 4932 O HOH A1458 -17.617 52.000 -9.059 1.00 60.56 O HETATM 4933 O HOH A1459 -7.168 73.673 -19.360 1.00 55.59 O HETATM 4934 O HOH A1460 21.865 57.922 28.643 1.00 37.88 O HETATM 4935 O HOH A1461 4.564 73.699 -14.393 1.00 61.66 O HETATM 4936 O HOH A1462 26.923 41.888 13.094 1.00 37.36 O HETATM 4937 O HOH A1463 9.296 58.118 -13.621 1.00 27.42 O HETATM 4938 O HOH A1464 17.649 68.927 2.668 1.00 28.04 O HETATM 4939 O HOH A1465 9.087 39.792 25.313 1.00 27.97 O HETATM 4940 O HOH A1466 7.298 45.854 6.649 1.00 42.21 O HETATM 4941 O HOH A1467 25.073 30.116 11.578 1.00 37.23 O HETATM 4942 O HOH A1468 -4.529 43.190 -8.182 1.00 66.08 O HETATM 4943 O HOH A1469 4.648 72.970 -11.812 1.00 35.87 O HETATM 4944 O HOH A1470 1.400 71.750 -3.700 1.00 48.96 O HETATM 4945 O HOH A1471 10.169 40.134 6.251 1.00 42.28 O HETATM 4946 O HOH A1472 27.928 64.540 14.107 1.00 46.59 O HETATM 4947 O HOH A1473 15.364 71.679 3.960 1.00 31.37 O HETATM 4948 O HOH A1474 29.276 62.685 16.413 1.00 43.62 O HETATM 4949 O HOH A1475 -6.513 44.848 21.415 1.00 39.66 O HETATM 4950 O HOH A1476 -9.008 63.737 15.596 1.00 41.53 O HETATM 4951 O HOH A1477 16.677 70.313 24.610 1.00 37.00 O HETATM 4952 O HOH A1478 -9.493 67.737 -5.305 1.00 36.19 O HETATM 4953 O HOH A1479 3.905 47.310 5.679 1.00 32.18 O HETATM 4954 O HOH A1480 27.493 55.814 12.452 1.00 46.15 O HETATM 4955 O HOH A1481 8.666 24.123 3.949 1.00 49.01 O HETATM 4956 O HOH A1482 -0.966 34.707 20.636 1.00 40.72 O HETATM 4957 O HOH A1483 8.179 61.832 31.825 1.00 42.73 O HETATM 4958 O HOH A1484 -1.807 40.961 11.658 1.00 37.17 O HETATM 4959 O HOH A1485 8.198 52.578 30.751 1.00 46.96 O HETATM 4960 O HOH A1486 -7.454 69.385 -1.302 1.00 49.66 O HETATM 4961 O HOH A1487 -7.276 68.168 1.255 1.00 34.72 O HETATM 4962 O HOH A1488 8.735 20.917 6.682 1.00 31.59 O HETATM 4963 O HOH A1489 -12.163 63.693 3.346 1.00 21.64 O HETATM 4964 O HOH A1490 8.440 27.226 7.850 1.00 33.69 O HETATM 4965 O HOH A1491 11.679 47.475 2.710 1.00 26.28 O HETATM 4966 O HOH A1492 7.133 63.445 30.072 1.00 28.46 O HETATM 4967 O HOH A1493 24.817 40.226 6.596 1.00 30.59 O HETATM 4968 O HOH A1494 20.410 29.396 18.129 1.00 37.66 O HETATM 4969 O HOH A1495 20.920 31.929 17.423 1.00 28.36 O HETATM 4970 O HOH A1496 -9.110 51.421 12.966 1.00 40.77 O HETATM 4971 O HOH A1497 -8.810 51.768 20.392 1.00 42.19 O HETATM 4972 O HOH A1498 31.464 64.949 5.676 1.00 45.07 O HETATM 4973 O HOH A1499 2.837 42.766 13.301 1.00 40.47 O HETATM 4974 O HOH A1500 1.094 69.340 -0.481 1.00 43.84 O HETATM 4975 O HOH A1501 11.736 68.969 0.004 1.00 53.45 O HETATM 4976 O HOH A1502 14.687 68.389 2.688 1.00 30.50 O HETATM 4977 O HOH A1503 16.080 66.143 -0.909 1.00 28.71 O HETATM 4978 O HOH A1504 11.539 47.235 8.386 1.00 20.18 O HETATM 4979 O HOH A1505 -10.993 68.227 -9.033 1.00 37.44 O HETATM 4980 O HOH A1506 -7.303 73.183 -10.378 1.00 47.96 O HETATM 4981 O HOH A1507 -6.662 65.794 -18.613 1.00 35.58 O HETATM 4982 O HOH A1508 -4.890 70.234 -6.446 1.00 31.61 O HETATM 4983 O HOH A1509 4.301 70.136 9.601 1.00 55.46 O HETATM 4984 O HOH A1510 1.695 70.300 10.245 1.00 55.38 O HETATM 4985 O HOH A1511 -4.990 64.691 8.781 1.00 49.93 O HETATM 4986 O HOH A1512 -9.516 65.390 7.388 1.00 45.80 O HETATM 4987 O HOH A1513 29.343 57.969 12.027 1.00 29.50 O HETATM 4988 O HOH A1514 28.531 60.358 13.035 1.00 38.22 O HETATM 4989 O HOH A1515 -11.885 43.914 1.926 1.00 33.04 O HETATM 4990 O HOH A1516 9.463 66.296 27.594 1.00 48.19 O HETATM 4991 O HOH A1517 8.181 67.428 25.317 1.00 45.25 O HETATM 4992 O HOH A1518 6.493 65.755 24.180 1.00 32.62 O HETATM 4993 O HOH B1301 -3.339 5.493 4.096 1.00 19.25 O HETATM 4994 O HOH B1302 9.625 14.101 2.464 1.00 29.64 O HETATM 4995 O HOH B1303 19.639 10.482 9.338 1.00 12.75 O HETATM 4996 O HOH B1304 8.347 18.721 8.519 1.00 17.21 O HETATM 4997 O HOH B1305 10.940 -5.238 0.354 1.00 15.65 O HETATM 4998 O HOH B1306 7.079 10.382 6.600 1.00 14.50 O HETATM 4999 O HOH B1307 -0.050 10.869 10.875 1.00 19.89 O HETATM 5000 O HOH B1308 33.624 -2.094 2.584 1.00 23.17 O HETATM 5001 O HOH B1309 10.630 2.767 -2.933 1.00 17.54 O HETATM 5002 O HOH B1310 12.713 -7.702 12.827 1.00 18.82 O HETATM 5003 O HOH B1311 13.246 15.815 17.259 1.00 16.41 O HETATM 5004 O HOH B1312 1.973 28.599 8.213 1.00 25.29 O HETATM 5005 O HOH B1313 17.958 10.594 7.007 1.00 19.10 O HETATM 5006 O HOH B1314 18.637 10.037 0.587 1.00 19.97 O HETATM 5007 O HOH B1315 19.428 5.636 2.078 1.00 17.00 O HETATM 5008 O HOH B1316 14.653 12.210 14.322 1.00 22.15 O HETATM 5009 O HOH B1317 6.349 -8.750 12.736 1.00 16.06 O HETATM 5010 O HOH B1318 4.088 21.527 26.477 1.00 30.76 O HETATM 5011 O HOH B1319 0.087 10.232 7.827 1.00 19.45 O HETATM 5012 O HOH B1320 13.624 -6.974 15.642 1.00 24.72 O HETATM 5013 O HOH B1321 8.317 18.019 30.425 1.00 27.02 O HETATM 5014 O HOH B1322 19.165 12.167 3.799 1.00 31.28 O HETATM 5015 O HOH B1323 18.410 6.175 20.304 1.00 18.51 O HETATM 5016 O HOH B1324 -3.973 23.842 6.322 1.00 28.61 O HETATM 5017 O HOH B1325 19.439 -5.791 8.487 1.00 19.84 O HETATM 5018 O HOH B1326 4.985 -0.382 -1.350 1.00 21.46 O HETATM 5019 O HOH B1327 2.615 10.573 6.836 1.00 22.38 O HETATM 5020 O HOH B1328 15.521 18.199 30.036 1.00 33.89 O HETATM 5021 O HOH B1329 16.326 5.815 24.488 1.00 21.62 O HETATM 5022 O HOH B1330 31.506 8.392 10.189 1.00 25.33 O HETATM 5023 O HOH B1331 3.856 -7.359 1.835 1.00 23.30 O HETATM 5024 O HOH B1332 9.432 31.153 12.596 1.00 22.20 O HETATM 5025 O HOH B1333 -1.410 -9.208 13.182 1.00 29.85 O HETATM 5026 O HOH B1334 17.566 14.033 5.201 1.00 27.64 O HETATM 5027 O HOH B1335 23.585 18.167 8.230 1.00 41.21 O HETATM 5028 O HOH B1336 9.931 7.342 1.222 1.00 18.60 O HETATM 5029 O HOH B1337 14.140 27.002 4.802 1.00 27.05 O HETATM 5030 O HOH B1338 18.411 5.248 22.886 1.00 23.67 O HETATM 5031 O HOH B1339 16.662 -7.586 2.119 1.00 23.69 O HETATM 5032 O HOH B1340 -5.200 -2.754 1.505 1.00 24.06 O HETATM 5033 O HOH B1341 5.773 -10.321 3.137 1.00 32.02 O HETATM 5034 O HOH B1342 -5.146 -0.117 1.100 1.00 30.16 O HETATM 5035 O HOH B1343 0.442 35.718 7.104 1.00 24.84 O HETATM 5036 O HOH B1344 17.748 -5.317 19.253 1.00 26.81 O HETATM 5037 O HOH B1345 9.882 14.249 7.902 1.00 22.17 O HETATM 5038 O HOH B1346 18.923 21.712 6.454 1.00 22.71 O HETATM 5039 O HOH B1347 -8.793 4.368 2.393 1.00 37.37 O HETATM 5040 O HOH B1348 21.694 12.507 2.209 1.00 33.78 O HETATM 5041 O HOH B1349 0.633 -9.090 9.386 1.00 32.52 O HETATM 5042 O HOH B1350 25.581 -9.621 -14.200 1.00 31.62 O HETATM 5043 O HOH B1351 21.220 12.452 24.305 1.00 22.62 O HETATM 5044 O HOH B1352 25.377 10.798 8.401 1.00 21.93 O HETATM 5045 O HOH B1353 22.359 -3.630 9.350 1.00 18.81 O HETATM 5046 O HOH B1354 6.432 17.393 15.955 1.00 21.93 O HETATM 5047 O HOH B1355 10.844 -10.691 7.141 1.00 27.41 O HETATM 5048 O HOH B1356 13.550 5.941 -14.294 1.00 23.20 O HETATM 5049 O HOH B1357 19.423 8.376 18.803 1.00 18.53 O HETATM 5050 O HOH B1358 12.149 32.083 9.581 1.00 23.50 O HETATM 5051 O HOH B1359 33.198 -3.445 5.271 1.00 29.08 O HETATM 5052 O HOH B1360 27.907 12.122 10.705 1.00 26.28 O HETATM 5053 O HOH B1361 1.234 -9.663 13.162 1.00 29.23 O HETATM 5054 O HOH B1362 12.270 11.980 -2.940 1.00 27.99 O HETATM 5055 O HOH B1363 -6.122 5.541 11.975 1.00 26.28 O HETATM 5056 O HOH B1364 14.520 15.623 0.233 1.00 37.37 O HETATM 5057 O HOH B1365 24.017 -1.816 7.680 1.00 20.01 O HETATM 5058 O HOH B1366 33.671 6.515 4.166 1.00 24.76 O HETATM 5059 O HOH B1367 2.413 15.974 18.978 1.00 28.31 O HETATM 5060 O HOH B1368 11.405 -7.398 17.147 1.00 21.57 O HETATM 5061 O HOH B1369 14.313 9.881 25.963 1.00 27.27 O HETATM 5062 O HOH B1370 11.983 13.473 9.737 1.00 25.17 O HETATM 5063 O HOH B1371 9.661 -2.337 -6.142 1.00 36.69 O HETATM 5064 O HOH B1372 16.617 -6.932 -3.677 1.00 36.41 O HETATM 5065 O HOH B1373 5.204 -4.737 -1.540 1.00 29.21 O HETATM 5066 O HOH B1374 -4.982 3.750 14.966 1.00 23.70 O HETATM 5067 O HOH B1375 7.047 30.887 19.741 1.00 31.17 O HETATM 5068 O HOH B1376 10.908 6.504 -1.158 1.00 26.18 O HETATM 5069 O HOH B1377 4.873 16.123 18.066 1.00 21.92 O HETATM 5070 O HOH B1378 -0.967 29.962 15.156 1.00 31.90 O HETATM 5071 O HOH B1379 28.710 2.962 13.016 1.00 28.13 O HETATM 5072 O HOH B1380 -6.628 7.391 10.093 1.00 41.42 O HETATM 5073 O HOH B1381 28.005 19.362 6.907 1.00 40.63 O HETATM 5074 O HOH B1382 20.507 5.559 24.571 1.00 26.53 O HETATM 5075 O HOH B1383 -1.827 -7.825 9.902 1.00 23.88 O HETATM 5076 O HOH B1384 -2.425 30.922 8.688 1.00 37.74 O HETATM 5077 O HOH B1385 18.716 18.599 13.032 1.00 37.57 O HETATM 5078 O HOH B1386 -7.717 -0.097 1.961 1.00 28.40 O HETATM 5079 O HOH B1387 30.744 -3.900 6.714 1.00 41.64 O HETATM 5080 O HOH B1388 7.361 19.779 15.814 1.00 18.74 O HETATM 5081 O HOH B1389 27.775 19.579 18.277 1.00 35.16 O HETATM 5082 O HOH B1390 18.699 12.400 25.460 1.00 28.13 O HETATM 5083 O HOH B1391 21.626 19.084 -7.230 1.00 52.95 O HETATM 5084 O HOH B1392 21.728 5.689 4.317 1.00 26.93 O HETATM 5085 O HOH B1393 -4.918 -5.923 15.890 1.00 34.81 O HETATM 5086 O HOH B1394 -3.675 -10.258 14.309 1.00 51.22 O HETATM 5087 O HOH B1395 22.837 7.225 -6.810 1.00 22.06 O HETATM 5088 O HOH B1396 16.501 8.152 25.896 1.00 31.67 O HETATM 5089 O HOH B1397 -4.757 18.012 19.303 1.00 46.36 O HETATM 5090 O HOH B1398 28.608 10.549 -5.023 1.00 23.34 O HETATM 5091 O HOH B1399 -1.771 9.264 1.084 1.00 40.09 O HETATM 5092 O HOH B1400 2.371 -6.413 -0.457 1.00 58.56 O HETATM 5093 O HOH B1401 20.429 -8.144 1.527 1.00 30.23 O HETATM 5094 O HOH B1402 -6.563 4.753 0.962 1.00 35.70 O HETATM 5095 O HOH B1403 4.124 -10.516 11.778 1.00 30.61 O HETATM 5096 O HOH B1404 17.993 28.509 17.304 1.00 29.19 O HETATM 5097 O HOH B1405 14.602 11.221 28.286 1.00 27.18 O HETATM 5098 O HOH B1406 19.760 -5.672 -2.893 1.00 19.13 O HETATM 5099 O HOH B1407 28.763 1.212 15.205 1.00 37.32 O HETATM 5100 O HOH B1408 12.337 21.239 24.931 1.00 26.31 O HETATM 5101 O HOH B1409 8.631 -7.320 16.249 1.00 26.12 O HETATM 5102 O HOH B1410 2.083 -1.291 28.087 1.00 32.75 O HETATM 5103 O HOH B1411 17.608 21.325 12.785 1.00 42.09 O HETATM 5104 O HOH B1412 18.599 19.199 7.402 1.00 30.83 O HETATM 5105 O HOH B1413 30.456 22.158 12.208 1.00 43.20 O HETATM 5106 O HOH B1414 23.883 6.456 24.383 1.00 44.01 O HETATM 5107 O HOH B1415 -1.652 -10.704 10.621 1.00 53.08 O HETATM 5108 O HOH B1416 26.904 -3.295 8.120 1.00 30.43 O HETATM 5109 O HOH B1417 13.333 17.635 5.521 1.00 31.05 O HETATM 5110 O HOH B1418 2.805 29.779 4.867 1.00 35.29 O HETATM 5111 O HOH B1419 25.396 -8.648 -9.365 1.00 31.99 O HETATM 5112 O HOH B1420 24.350 -0.788 19.430 1.00 55.62 O HETATM 5113 O HOH B1421 -9.562 1.785 2.773 1.00 19.97 O HETATM 5114 O HOH B1422 22.691 -6.302 9.205 1.00 36.73 O HETATM 5115 O HOH B1423 8.549 9.580 0.430 1.00 23.47 O HETATM 5116 O HOH B1424 3.022 -12.960 12.241 1.00 34.69 O HETATM 5117 O HOH B1425 18.569 9.877 26.471 1.00 25.92 O HETATM 5118 O HOH B1426 13.780 15.270 6.268 1.00 32.50 O HETATM 5119 O HOH B1427 -6.520 -3.011 9.152 1.00 28.71 O HETATM 5120 O HOH B1428 2.078 13.387 2.962 1.00 35.96 O HETATM 5121 O HOH B1429 7.040 31.045 22.257 1.00 36.52 O HETATM 5122 O HOH B1430 6.505 -6.795 1.489 1.00 32.56 O HETATM 5123 O HOH B1431 4.327 -14.115 5.618 1.00 35.61 O HETATM 5124 O HOH B1432 16.613 3.041 25.398 1.00 25.29 O HETATM 5125 O HOH B1433 17.639 25.422 14.316 1.00 42.68 O HETATM 5126 O HOH B1434 -0.723 -10.825 25.120 1.00 47.40 O HETATM 5127 O HOH B1435 20.179 3.766 -17.110 1.00 27.87 O HETATM 5128 O HOH B1436 11.372 26.507 3.669 1.00 46.52 O HETATM 5129 O HOH B1437 0.687 29.231 17.662 1.00 28.78 O HETATM 5130 O HOH B1438 18.238 -2.291 20.227 1.00 24.46 O HETATM 5131 O HOH B1439 19.659 -7.655 15.043 1.00 23.18 O HETATM 5132 O HOH B1440 29.289 -8.616 -3.174 1.00 40.50 O HETATM 5133 O HOH B1441 27.137 12.580 7.293 1.00 25.96 O HETATM 5134 O HOH B1442 10.373 -9.402 12.268 1.00 35.39 O HETATM 5135 O HOH B1443 21.630 23.266 3.673 1.00 46.45 O HETATM 5136 O HOH B1444 -5.302 19.302 13.068 1.00 36.72 O HETATM 5137 O HOH B1445 19.173 -9.035 9.386 1.00 44.39 O HETATM 5138 O HOH B1446 25.409 13.120 5.444 1.00 35.00 O HETATM 5139 O HOH B1447 36.783 -0.230 -10.088 1.00 67.85 O HETATM 5140 O HOH B1448 23.697 20.557 11.376 1.00 33.12 O HETATM 5141 O HOH B1449 25.468 -6.997 3.059 1.00 30.60 O HETATM 5142 O HOH B1450 31.022 11.718 -5.114 1.00 42.72 O HETATM 5143 O HOH B1451 16.013 27.462 15.451 1.00 41.98 O HETATM 5144 O HOH B1452 34.257 1.269 -13.526 1.00 36.52 O HETATM 5145 O HOH B1453 -5.501 -7.595 1.563 1.00 34.98 O HETATM 5146 O HOH B1454 13.205 7.880 -11.478 1.00 27.93 O HETATM 5147 O HOH B1455 26.602 -5.160 16.179 1.00 34.05 O HETATM 5148 O HOH B1456 28.648 14.428 9.574 1.00 59.54 O HETATM 5149 O HOH B1457 -3.166 18.417 23.024 1.00 41.40 O HETATM 5150 O HOH B1458 36.146 0.689 -3.349 1.00 51.48 O HETATM 5151 O HOH B1459 4.256 13.046 5.654 1.00 38.62 O HETATM 5152 O HOH B1460 23.892 26.420 16.197 1.00 35.52 O HETATM 5153 O HOH B1461 6.836 12.890 5.211 1.00 46.50 O HETATM 5154 O HOH B1462 5.794 1.167 -4.036 1.00 60.56 O HETATM 5155 O HOH B1463 18.227 -11.888 -17.872 1.00 63.43 O HETATM 5156 O HOH B1464 26.773 15.318 7.945 1.00 47.09 O HETATM 5157 O HOH B1465 18.084 -8.613 -7.324 1.00 36.15 O HETATM 5158 O HOH B1466 -9.289 3.351 23.846 1.00 47.22 O HETATM 5159 O HOH B1467 12.993 34.287 7.784 1.00 40.63 O HETATM 5160 O HOH B1468 22.518 -6.706 15.966 1.00 40.79 O HETATM 5161 O HOH B1469 34.939 -1.496 -0.811 1.00 31.53 O HETATM 5162 O HOH B1470 23.008 -2.225 21.152 1.00 39.49 O HETATM 5163 O HOH B1471 4.467 -14.509 10.503 1.00 39.81 O HETATM 5164 O HOH B1472 -3.464 7.131 1.845 1.00 35.93 O HETATM 5165 O HOH B1473 -3.577 21.183 6.652 1.00 29.39 O HETATM 5166 O HOH B1474 25.146 11.926 3.226 1.00 46.08 O HETATM 5167 O HOH B1475 28.107 16.189 20.444 1.00 37.50 O HETATM 5168 O HOH B1476 24.806 -12.262 -13.016 1.00 37.68 O HETATM 5169 O HOH B1477 -8.323 -6.032 7.766 1.00 47.12 O HETATM 5170 O HOH B1478 9.300 16.668 6.803 1.00 29.47 O HETATM 5171 O HOH B1479 6.605 16.242 5.173 1.00 45.31 O HETATM 5172 O HOH B1480 16.556 16.484 4.863 1.00 45.43 O HETATM 5173 O HOH B1481 15.949 17.157 2.313 1.00 33.52 O HETATM 5174 O HOH B1482 10.442 9.833 -2.475 1.00 42.84 O HETATM 5175 O HOH B1483 10.138 0.408 -4.535 1.00 33.23 O HETATM 5176 O HOH B1484 10.433 5.071 -4.700 1.00 41.32 O HETATM 5177 O HOH B1485 8.392 12.138 1.026 1.00 39.30 O HETATM 5178 O HOH B1486 28.849 -8.063 -6.062 1.00 37.09 O HETATM 5179 O HOH B1487 26.509 -8.421 -7.002 1.00 50.07 O HETATM 5180 O HOH B1488 28.706 -6.802 0.148 1.00 33.14 O HETATM 5181 O HOH B1489 26.890 -7.908 -2.249 1.00 49.63 O HETATM 5182 O HOH B1490 29.191 -5.915 5.573 1.00 43.28 O HETATM 5183 O HOH B1491 35.172 3.426 11.544 1.00 28.79 O HETATM 5184 O HOH B1492 34.178 8.778 9.171 1.00 30.92 O HETATM 5185 O HOH B1493 24.699 -15.074 -20.367 1.00 36.38 O HETATM 5186 O HOH B1494 22.576 14.088 3.997 1.00 49.22 O HETATM 5187 O HOH B1495 5.674 -4.743 -4.301 1.00 44.54 O HETATM 5188 O HOH B1496 -1.886 -9.965 6.783 1.00 42.76 O HETATM 5189 O HOH B1497 9.621 -7.760 20.865 1.00 43.34 O HETATM 5190 O HOH B1498 7.609 -7.327 18.816 1.00 39.89 O HETATM 5191 O HOH B1499 6.008 1.392 28.932 1.00 44.03 O HETATM 5192 O HOH B1500 26.182 18.744 8.738 1.00 31.24 O HETATM 5193 O HOH B1501 28.949 12.664 13.153 1.00 41.16 O HETATM 5194 O HOH B1502 29.903 15.368 13.483 1.00 40.56 O HETATM 5195 O HOH B1503 34.511 12.893 6.237 1.00 33.35 O CONECT 1399 1406 CONECT 1406 1399 1407 CONECT 1407 1406 1408 1410 CONECT 1408 1407 1409 1422 CONECT 1409 1408 CONECT 1410 1407 1411 CONECT 1411 1410 1412 1413 CONECT 1412 1411 1414 CONECT 1413 1411 1415 CONECT 1414 1412 1416 CONECT 1415 1413 1416 CONECT 1416 1414 1415 1417 CONECT 1417 1416 1418 CONECT 1418 1417 1419 1420 1421 CONECT 1419 1418 CONECT 1420 1418 CONECT 1421 1418 CONECT 1422 1408 1423 CONECT 1423 1422 1424 1426 CONECT 1424 1423 1425 1438 CONECT 1425 1424 CONECT 1426 1423 1427 CONECT 1427 1426 1428 1429 CONECT 1428 1427 1430 CONECT 1429 1427 1431 CONECT 1430 1428 1432 CONECT 1431 1429 1432 CONECT 1432 1430 1431 1433 CONECT 1433 1432 1434 CONECT 1434 1433 1435 1436 1437 CONECT 1435 1434 CONECT 1436 1434 CONECT 1437 1434 CONECT 1438 1424 CONECT 3715 3722 CONECT 3722 3715 3723 CONECT 3723 3722 3724 3726 CONECT 3724 3723 3725 3738 CONECT 3725 3724 CONECT 3726 3723 3727 CONECT 3727 3726 3728 3729 CONECT 3728 3727 3730 CONECT 3729 3727 3731 CONECT 3730 3728 3732 CONECT 3731 3729 3732 CONECT 3732 3730 3731 3733 CONECT 3733 3732 3734 CONECT 3734 3733 3735 3736 3737 CONECT 3735 3734 CONECT 3736 3734 CONECT 3737 3734 CONECT 3738 3724 3739 CONECT 3739 3738 3740 3742 CONECT 3740 3739 3741 3754 CONECT 3741 3740 CONECT 3742 3739 3743 CONECT 3743 3742 3744 3745 CONECT 3744 3743 3746 CONECT 3745 3743 3747 CONECT 3746 3744 3748 CONECT 3747 3745 3748 CONECT 3748 3746 3747 3749 CONECT 3749 3748 3750 CONECT 3750 3749 3751 3752 3753 CONECT 3751 3750 CONECT 3752 3750 CONECT 3753 3750 CONECT 3754 3740 CONECT 4707 4710 4715 CONECT 4708 4711 4712 4713 CONECT 4709 4715 4716 4717 CONECT 4710 4707 4714 CONECT 4711 4708 CONECT 4712 4708 CONECT 4713 4708 4714 4715 CONECT 4714 4710 4713 CONECT 4715 4707 4709 4713 4735 CONECT 4716 4709 CONECT 4717 4709 4718 4722 CONECT 4718 4717 4719 CONECT 4719 4718 4720 CONECT 4720 4719 4721 4723 CONECT 4721 4720 4722 CONECT 4722 4717 4721 CONECT 4723 4720 4724 4727 CONECT 4724 4723 4725 CONECT 4725 4724 4726 CONECT 4726 4725 4727 4734 CONECT 4727 4723 4726 4728 CONECT 4728 4727 4729 4732 CONECT 4729 4728 4730 CONECT 4730 4729 4731 CONECT 4731 4730 4732 4736 CONECT 4732 4728 4731 4733 CONECT 4733 4732 4734 CONECT 4734 4726 4733 CONECT 4735 4715 CONECT 4736 4731 CONECT 4737 4738 4739 CONECT 4738 4737 CONECT 4739 4737 4740 CONECT 4740 4739 4741 CONECT 4741 4740 4742 CONECT 4742 4741 4743 CONECT 4743 4742 CONECT 4744 4747 4752 CONECT 4745 4748 4749 4750 CONECT 4746 4752 4753 4754 CONECT 4747 4744 4751 CONECT 4748 4745 CONECT 4749 4745 CONECT 4750 4745 4751 4752 CONECT 4751 4747 4750 CONECT 4752 4744 4746 4750 4772 CONECT 4753 4746 CONECT 4754 4746 4755 4759 CONECT 4755 4754 4756 CONECT 4756 4755 4757 CONECT 4757 4756 4758 4760 CONECT 4758 4757 4759 CONECT 4759 4754 4758 CONECT 4760 4757 4761 4764 CONECT 4761 4760 4762 CONECT 4762 4761 4763 CONECT 4763 4762 4764 4771 CONECT 4764 4760 4763 4765 CONECT 4765 4764 4766 4769 CONECT 4766 4765 4767 CONECT 4767 4766 4768 CONECT 4768 4767 4769 4773 CONECT 4769 4765 4768 4770 CONECT 4770 4769 4771 CONECT 4771 4763 4770 CONECT 4772 4752 CONECT 4773 4768 MASTER 326 0 7 30 22 0 11 6 5155 2 135 48 END