>>5UNF:HELIX   33 AD6 GLY B  245  MET B  284  1                                  40    
GKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWM
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 33 AD6 GLY B 245 MET B 284 1 40 ATOM 5468 N GLY B 245 112.456 11.994 -4.601 1.00151.45 N ANISOU 5468 N GLY B 245 13455 18380 25709 572 1813 1339 N ATOM 5469 CA GLY B 245 111.775 10.925 -5.334 1.00149.16 C ANISOU 5469 CA GLY B 245 13524 18099 25052 758 1957 1393 C ATOM 5470 C GLY B 245 111.184 9.835 -4.460 1.00150.56 C ANISOU 5470 C GLY B 245 13868 18377 24962 861 1721 1281 C ATOM 5471 O GLY B 245 110.065 9.382 -4.716 1.00147.77 O ANISOU 5471 O GLY B 245 13862 18006 24280 916 1704 1236 O ATOM 5472 N LYS B 246 111.936 9.401 -3.425 1.00147.57 N ANISOU 5472 N LYS B 246 13236 18106 24725 895 1543 1246 N ATOM 5473 CA LYS B 246 111.487 8.371 -2.478 1.00145.40 C ANISOU 5473 CA LYS B 246 13104 17929 24211 996 1317 1156 C ATOM 5474 C LYS B 246 110.366 8.912 -1.574 1.00144.96 C ANISOU 5474 C LYS B 246 13222 17861 23996 846 1065 989 C ATOM 5475 O LYS B 246 109.449 8.166 -1.219 1.00142.81 O ANISOU 5475 O LYS B 246 13233 17605 23422 906 968 929 O ATOM 5476 CB LYS B 246 112.659 7.864 -1.621 1.00150.18 C ANISOU 5476 CB LYS B 246 13378 18667 25018 1058 1153 1156 C ATOM 5477 N ASN B 247 110.437 10.210 -1.219 1.00139.65 N ANISOU 5477 N ASN B 247 12367 17150 23545 648 971 916 N ATOM 5478 CA ASN B 247 109.446 10.862 -0.361 1.00136.50 C ANISOU 5478 CA ASN B 247 12082 16737 23044 493 727 743 C ATOM 5479 C ASN B 247 108.297 11.472 -1.195 1.00134.34 C ANISOU 5479 C ASN B 247 12096 16328 22617 421 875 753 C ATOM 5480 O ASN B 247 107.353 12.005 -0.614 1.00132.66 O ANISOU 5480 O ASN B 247 12019 16090 22296 307 710 623 O ATOM 5481 CB ASN B 247 110.115 11.944 0.491 1.00140.12 C ANISOU 5481 CB ASN B 247 12201 17209 23831 314 542 639 C ATOM 5482 N ARG B 248 108.364 11.352 -2.545 1.00127.66 N ANISOU 5482 N ARG B 248 11345 15406 21752 501 1187 909 N ATOM 5483 CA ARG B 248 107.350 11.848 -3.492 1.00124.39 C ANISOU 5483 CA ARG B 248 11196 14878 21187 465 1356 949 C ATOM 5484 C ARG B 248 106.149 10.887 -3.538 1.00121.84 C ANISOU 5484 C ARG B 248 11248 14577 20468 572 1315 908 C ATOM 5485 O ARG B 248 105.004 11.333 -3.453 1.00119.25 O ANISOU 5485 O ARG B 248 11132 14197 19979 492 1255 839 O ATOM 5486 CB ARG B 248 107.981 12.010 -4.889 1.00126.38 C ANISOU 5486 CB ARG B 248 11386 15064 21568 531 1703 1138 C ATOM 5487 CG ARG B 248 107.086 12.577 -5.978 1.00135.84 C ANISOU 5487 CG ARG B 248 12834 16155 22623 510 1897 1206 C ATOM 5488 CD ARG B 248 107.881 12.697 -7.262 1.00149.70 C ANISOU 5488 CD ARG B 248 14518 17869 24494 601 2246 1405 C ATOM 5489 NE ARG B 248 107.075 13.217 -8.364 1.00159.72 N ANISOU 5489 NE ARG B 248 16035 19053 25601 604 2433 1483 N ATOM 5490 CZ ARG B 248 107.540 13.444 -9.590 1.00176.02 C ANISOU 5490 CZ ARG B 248 18103 21077 27700 690 2752 1664 C ATOM 5491 NH1 ARG B 248 108.815 13.207 -9.879 1.00162.42 N ANISOU 5491 NH1 ARG B 248 16146 19384 26183 777 2935 1787 N ATOM 5492 NH2 ARG B 248 106.738 13.918 -10.533 1.00164.83 N ANISOU 5492 NH2 ARG B 248 16923 19598 26109 699 2894 1730 N ATOM 5493 N ILE B 249 106.425 9.571 -3.683 1.00115.93 N ANISOU 5493 N ILE B 249 10571 13896 19581 751 1356 953 N ATOM 5494 CA ILE B 249 105.437 8.487 -3.699 1.00112.60 C ANISOU 5494 CA ILE B 249 10480 13486 18818 859 1321 917 C ATOM 5495 C ILE B 249 104.610 8.539 -2.389 1.00112.69 C ANISOU 5495 C ILE B 249 10571 13544 18704 774 1019 766 C ATOM 5496 O ILE B 249 103.376 8.554 -2.442 1.00109.88 O ANISOU 5496 O ILE B 249 10479 13149 18121 744 979 711 O ATOM 5497 CB ILE B 249 106.160 7.101 -3.890 1.00116.53 C ANISOU 5497 CB ILE B 249 10981 14034 19261 1068 1416 994 C ATOM 5498 CG1 ILE B 249 106.930 7.000 -5.243 1.00118.63 C ANISOU 5498 CG1 ILE B 249 11203 14257 19615 1176 1742 1144 C ATOM 5499 CG2 ILE B 249 105.212 5.916 -3.711 1.00115.17 C ANISOU 5499 CG2 ILE B 249 11122 13863 18775 1168 1346 942 C ATOM 5500 CD1 ILE B 249 106.070 7.067 -6.584 1.00125.32 C ANISOU 5500 CD1 ILE B 249 12351 15018 20248 1206 1956 1188 C ATOM 5501 N THR B 250 105.312 8.625 -1.232 1.00108.84 N ANISOU 5501 N THR B 250 9843 13145 18366 738 812 702 N ATOM 5502 CA THR B 250 104.750 8.676 0.123 1.00106.86 C ANISOU 5502 CA THR B 250 9631 12965 18007 678 522 563 C ATOM 5503 C THR B 250 103.873 9.931 0.299 1.00108.35 C ANISOU 5503 C THR B 250 9887 13086 18194 497 444 460 C ATOM 5504 O THR B 250 102.831 9.853 0.946 1.00106.06 O ANISOU 5504 O THR B 250 9779 12816 17703 468 291 365 O ATOM 5505 CB THR B 250 105.893 8.651 1.169 1.00115.46 C ANISOU 5505 CB THR B 250 10412 14175 19283 687 333 524 C ATOM 5506 OG1 THR B 250 106.765 7.550 0.905 1.00116.16 O ANISOU 5506 OG1 THR B 250 10419 14316 19402 864 433 638 O ATOM 5507 CG2 THR B 250 105.383 8.562 2.601 1.00112.86 C ANISOU 5507 CG2 THR B 250 10135 13944 18803 664 37 390 C ATOM 5508 N ARG B 251 104.282 11.071 -0.298 1.00105.20 N ANISOU 5508 N ARG B 251 9344 12600 18025 384 566 490 N ATOM 5509 CA ARG B 251 103.553 12.344 -0.217 1.00103.91 C ANISOU 5509 CA ARG B 251 9225 12350 17905 217 522 408 C ATOM 5510 C ARG B 251 102.204 12.273 -0.962 1.00103.90 C ANISOU 5510 C ARG B 251 9555 12274 17648 235 634 437 C ATOM 5511 O ARG B 251 101.181 12.678 -0.411 1.00101.69 O ANISOU 5511 O ARG B 251 9417 11980 17240 160 500 334 O ATOM 5512 CB ARG B 251 104.405 13.489 -0.802 1.00106.39 C ANISOU 5512 CB ARG B 251 9290 12573 18560 106 658 465 C ATOM 5513 CG ARG B 251 103.794 14.880 -0.616 1.00114.89 C ANISOU 5513 CG ARG B 251 10375 13543 19737 -72 602 374 C ATOM 5514 CD ARG B 251 104.467 15.918 -1.483 1.00124.61 C ANISOU 5514 CD ARG B 251 11418 14647 21279 -163 808 477 C ATOM 5515 NE ARG B 251 104.184 15.690 -2.899 1.00133.23 N ANISOU 5515 NE ARG B 251 12679 15679 22264 -67 1103 656 N ATOM 5516 CZ ARG B 251 104.684 16.420 -3.889 1.00152.31 C ANISOU 5516 CZ ARG B 251 14989 17990 24893 -103 1344 796 C ATOM 5517 NH1 ARG B 251 105.520 17.420 -3.629 1.00144.35 N ANISOU 5517 NH1 ARG B 251 13691 16907 24250 -246 1335 781 N ATOM 5518 NH2 ARG B 251 104.373 16.141 -5.148 1.00138.81 N ANISOU 5518 NH2 ARG B 251 13460 16248 23034 7 1599 952 N ATOM 5519 N ASP B 252 102.223 11.794 -2.224 1.00 99.54 N ANISOU 5519 N ASP B 252 9117 11679 17025 337 877 574 N ATOM 5520 CA ASP B 252 101.045 11.713 -3.083 1.00 96.93 C ANISOU 5520 CA ASP B 252 9083 11285 16460 363 992 609 C ATOM 5521 C ASP B 252 100.024 10.694 -2.556 1.00 97.24 C ANISOU 5521 C ASP B 252 9368 11376 16201 427 854 535 C ATOM 5522 O ASP B 252 98.832 10.945 -2.699 1.00 95.69 O ANISOU 5522 O ASP B 252 9377 11139 15841 384 832 498 O ATOM 5523 CB ASP B 252 101.435 11.354 -4.525 1.00 99.52 C ANISOU 5523 CB ASP B 252 9467 11576 16769 477 1276 762 C ATOM 5524 CG ASP B 252 102.237 12.424 -5.257 1.00111.27 C ANISOU 5524 CG ASP B 252 10750 12996 18532 418 1464 870 C ATOM 5525 OD1 ASP B 252 102.654 13.416 -4.604 1.00112.75 O ANISOU 5525 OD1 ASP B 252 10707 13160 18974 283 1366 820 O ATOM 5526 OD2 ASP B 252 102.441 12.277 -6.479 1.00117.83 O ANISOU 5526 OD2 ASP B 252 11650 13795 19327 510 1712 1003 O ATOM 5527 N GLN B 253 100.464 9.580 -1.926 1.00 92.50 N ANISOU 5527 N GLN B 253 8739 10860 15546 529 763 521 N ATOM 5528 CA GLN B 253 99.524 8.588 -1.383 1.00 89.94 C ANISOU 5528 CA GLN B 253 8638 10572 14965 589 644 466 C ATOM 5529 C GLN B 253 98.760 9.174 -0.177 1.00 90.77 C ANISOU 5529 C GLN B 253 8761 10709 15020 476 418 341 C ATOM 5530 O GLN B 253 97.596 8.830 0.011 1.00 88.69 O ANISOU 5530 O GLN B 253 8713 10435 14548 475 361 301 O ATOM 5531 CB GLN B 253 100.212 7.268 -0.990 1.00 92.11 C ANISOU 5531 CB GLN B 253 8875 10917 15207 735 616 500 C ATOM 5532 CG GLN B 253 100.746 6.490 -2.196 1.00111.94 C ANISOU 5532 CG GLN B 253 11426 13390 17715 873 848 612 C ATOM 5533 CD GLN B 253 101.220 5.095 -1.876 1.00134.38 C ANISOU 5533 CD GLN B 253 14297 16273 20486 1031 832 642 C ATOM 5534 OE1 GLN B 253 100.597 4.361 -1.100 1.00128.63 O ANISOU 5534 OE1 GLN B 253 13719 15561 19594 1059 705 596 O ATOM 5535 NE2 GLN B 253 102.206 4.627 -2.631 1.00129.97 N ANISOU 5535 NE2 GLN B 253 13644 15712 20028 1153 1003 735 N ATOM 5536 N VAL B 254 99.389 10.085 0.598 1.00 87.20 N ANISOU 5536 N VAL B 254 8080 10288 14763 380 296 273 N ATOM 5537 CA VAL B 254 98.743 10.779 1.724 1.00 85.77 C ANISOU 5537 CA VAL B 254 7907 10135 14546 275 89 138 C ATOM 5538 C VAL B 254 97.682 11.745 1.141 1.00 87.68 C ANISOU 5538 C VAL B 254 8286 10271 14758 172 162 121 C ATOM 5539 O VAL B 254 96.573 11.832 1.672 1.00 85.91 O ANISOU 5539 O VAL B 254 8215 10051 14375 137 58 46 O ATOM 5540 CB VAL B 254 99.778 11.505 2.638 1.00 91.38 C ANISOU 5540 CB VAL B 254 8333 10906 15483 203 -68 52 C ATOM 5541 CG1 VAL B 254 99.093 12.337 3.714 1.00 90.64 C ANISOU 5541 CG1 VAL B 254 8263 10830 15345 97 -268 -104 C ATOM 5542 CG2 VAL B 254 100.735 10.505 3.279 1.00 92.47 C ANISOU 5542 CG2 VAL B 254 8342 11167 15626 321 -161 75 C ATOM 5543 N LEU B 255 98.016 12.414 0.016 1.00 84.24 N ANISOU 5543 N LEU B 255 7800 9742 14466 140 354 208 N ATOM 5544 CA LEU B 255 97.120 13.331 -0.692 1.00 82.90 C ANISOU 5544 CA LEU B 255 7753 9469 14276 64 450 225 C ATOM 5545 C LEU B 255 95.956 12.572 -1.330 1.00 85.04 C ANISOU 5545 C LEU B 255 8309 9734 14267 138 507 263 C ATOM 5546 O LEU B 255 94.849 13.111 -1.375 1.00 83.94 O ANISOU 5546 O LEU B 255 8307 9554 14033 81 476 225 O ATOM 5547 CB LEU B 255 97.870 14.137 -1.767 1.00 84.29 C ANISOU 5547 CB LEU B 255 7803 9555 14669 35 662 338 C ATOM 5548 CG LEU B 255 98.909 15.156 -1.268 1.00 91.11 C ANISOU 5548 CG LEU B 255 8369 10386 15863 -74 628 305 C ATOM 5549 CD1 LEU B 255 99.732 15.718 -2.414 1.00 92.81 C ANISOU 5549 CD1 LEU B 255 8467 10513 16284 -78 878 455 C ATOM 5550 CD2 LEU B 255 98.258 16.274 -0.486 1.00 93.34 C ANISOU 5550 CD2 LEU B 255 8631 10614 16219 -215 477 169 C ATOM 5551 N LYS B 256 96.196 11.325 -1.811 1.00 80.91 N ANISOU 5551 N LYS B 256 7871 9248 13623 266 586 330 N ATOM 5552 CA LYS B 256 95.149 10.469 -2.393 1.00 79.03 C ANISOU 5552 CA LYS B 256 7895 9000 13132 336 627 351 C ATOM 5553 C LYS B 256 94.126 10.089 -1.321 1.00 81.43 C ANISOU 5553 C LYS B 256 8313 9349 13279 313 436 254 C ATOM 5554 O LYS B 256 92.925 10.122 -1.590 1.00 80.36 O ANISOU 5554 O LYS B 256 8362 9185 12986 295 429 239 O ATOM 5555 CB LYS B 256 95.730 9.203 -3.050 1.00 82.09 C ANISOU 5555 CB LYS B 256 8335 9404 13450 479 746 425 C ATOM 5556 CG LYS B 256 96.530 9.454 -4.324 1.00102.76 C ANISOU 5556 CG LYS B 256 10896 11981 16166 529 974 536 C ATOM 5557 CD LYS B 256 97.073 8.145 -4.915 1.00114.45 C ANISOU 5557 CD LYS B 256 12443 13477 17564 685 1090 592 C ATOM 5558 CE LYS B 256 97.895 8.334 -6.174 1.00125.70 C ANISOU 5558 CE LYS B 256 13814 14874 19072 757 1333 708 C ATOM 5559 NZ LYS B 256 99.142 9.111 -5.930 1.00135.41 N ANISOU 5559 NZ LYS B 256 14746 16114 20591 712 1376 759 N ATOM 5560 N MET B 257 94.603 9.766 -0.096 1.00 77.58 N ANISOU 5560 N MET B 257 7708 8937 12833 318 283 195 N ATOM 5561 CA MET B 257 93.754 9.437 1.056 1.00 76.30 C ANISOU 5561 CA MET B 257 7634 8831 12527 307 109 115 C ATOM 5562 C MET B 257 92.981 10.674 1.536 1.00 79.10 C ANISOU 5562 C MET B 257 7989 9165 12902 187 22 27 C ATOM 5563 O MET B 257 91.863 10.544 2.048 1.00 77.49 O ANISOU 5563 O MET B 257 7915 8981 12547 174 -67 -21 O ATOM 5564 CB MET B 257 94.589 8.861 2.210 1.00 79.67 C ANISOU 5564 CB MET B 257 7925 9357 12988 364 -23 88 C ATOM 5565 CG MET B 257 95.232 7.534 1.892 1.00 84.23 C ANISOU 5565 CG MET B 257 8517 9953 13535 499 52 174 C ATOM 5566 SD MET B 257 96.263 6.953 3.260 1.00 90.30 S ANISOU 5566 SD MET B 257 9104 10851 14355 578 -113 158 S ATOM 5567 CE MET B 257 96.875 5.472 2.593 1.00 87.61 C ANISOU 5567 CE MET B 257 8815 10490 13984 741 23 275 C ATOM 5568 N ALA B 258 93.592 11.869 1.368 1.00 75.22 N ANISOU 5568 N ALA B 258 7344 8625 12610 103 57 11 N ATOM 5569 CA ALA B 258 93.034 13.163 1.757 1.00 73.81 C ANISOU 5569 CA ALA B 258 7147 8402 12497 -10 -7 -74 C ATOM 5570 C ALA B 258 91.946 13.620 0.765 1.00 74.88 C ANISOU 5570 C ALA B 258 7445 8448 12558 -36 113 -20 C ATOM 5571 O ALA B 258 90.914 14.143 1.186 1.00 72.84 O ANISOU 5571 O ALA B 258 7270 8172 12235 -88 46 -83 O ATOM 5572 CB ALA B 258 94.151 14.202 1.835 1.00 75.96 C ANISOU 5572 CB ALA B 258 7182 8637 13043 -91 -7 -106 C ATOM 5573 N ALA B 259 92.182 13.430 -0.544 1.00 71.41 N ANISOU 5573 N ALA B 259 7048 7961 12122 11 289 96 N ATOM 5574 CA ALA B 259 91.242 13.824 -1.593 1.00 70.63 C ANISOU 5574 CA ALA B 259 7103 7796 11939 6 401 159 C ATOM 5575 C ALA B 259 90.045 12.886 -1.644 1.00 74.22 C ANISOU 5575 C ALA B 259 7769 8286 12144 59 357 152 C ATOM 5576 O ALA B 259 89.003 13.253 -2.180 1.00 73.29 O ANISOU 5576 O ALA B 259 7780 8134 11934 42 386 170 O ATOM 5577 CB ALA B 259 91.945 13.834 -2.940 1.00 72.41 C ANISOU 5577 CB ALA B 259 7306 7977 12230 56 602 285 C ATOM 5578 N ALA B 260 90.197 11.666 -1.107 1.00 71.31 N ANISOU 5578 N ALA B 260 7432 7983 11678 123 289 131 N ATOM 5579 CA ALA B 260 89.147 10.658 -1.116 1.00 70.05 C ANISOU 5579 CA ALA B 260 7458 7844 11313 167 250 126 C ATOM 5580 C ALA B 260 88.056 10.967 -0.084 1.00 74.62 C ANISOU 5580 C ALA B 260 8083 8449 11818 109 111 48 C ATOM 5581 O ALA B 260 86.905 10.601 -0.319 1.00 73.75 O ANISOU 5581 O ALA B 260 8121 8332 11567 113 97 51 O ATOM 5582 CB ALA B 260 89.742 9.287 -0.844 1.00 70.94 C ANISOU 5582 CB ALA B 260 7579 7999 11377 258 239 142 C ATOM 5583 N VAL B 261 88.395 11.634 1.046 1.00 72.30 N ANISOU 5583 N VAL B 261 7663 8187 11619 59 7 -26 N ATOM 5584 CA VAL B 261 87.391 11.917 2.084 1.00 71.97 C ANISOU 5584 CA VAL B 261 7670 8180 11497 21 -114 -104 C ATOM 5585 C VAL B 261 86.497 13.112 1.643 1.00 76.22 C ANISOU 5585 C VAL B 261 8250 8649 12060 -49 -78 -115 C ATOM 5586 O VAL B 261 85.314 13.117 1.989 1.00 76.14 O ANISOU 5586 O VAL B 261 8341 8650 11939 -59 -124 -137 O ATOM 5587 CB VAL B 261 87.974 12.168 3.509 1.00 76.66 C ANISOU 5587 CB VAL B 261 8136 8846 12145 8 -253 -197 C ATOM 5588 CG1 VAL B 261 88.701 10.934 4.036 1.00 76.61 C ANISOU 5588 CG1 VAL B 261 8100 8920 12088 94 -300 -172 C ATOM 5589 CG2 VAL B 261 88.878 13.394 3.560 1.00 77.84 C ANISOU 5589 CG2 VAL B 261 8114 8957 12503 -61 -256 -250 C ATOM 5590 N VAL B 262 87.039 14.084 0.865 1.00 72.38 N ANISOU 5590 N VAL B 262 7684 8089 11726 -88 13 -86 N ATOM 5591 CA VAL B 262 86.273 15.254 0.410 1.00 71.18 C ANISOU 5591 CA VAL B 262 7567 7862 11617 -142 58 -80 C ATOM 5592 C VAL B 262 85.403 14.836 -0.815 1.00 73.39 C ANISOU 5592 C VAL B 262 8001 8123 11761 -99 150 16 C ATOM 5593 O VAL B 262 84.207 15.131 -0.812 1.00 72.83 O ANISOU 5593 O VAL B 262 8019 8043 11608 -114 122 8 O ATOM 5594 CB VAL B 262 87.166 16.509 0.106 1.00 76.16 C ANISOU 5594 CB VAL B 262 8051 8406 12481 -202 127 -74 C ATOM 5595 CG1 VAL B 262 88.306 16.208 -0.860 1.00 77.26 C ANISOU 5595 CG1 VAL B 262 8119 8526 12709 -167 257 25 C ATOM 5596 CG2 VAL B 262 86.339 17.694 -0.373 1.00 75.65 C ANISOU 5596 CG2 VAL B 262 8030 8248 12464 -245 185 -51 C ATOM 5597 N LEU B 263 85.978 14.122 -1.811 1.00 69.32 N ANISOU 5597 N LEU B 263 7518 7609 11213 -40 250 98 N ATOM 5598 CA LEU B 263 85.256 13.672 -3.012 1.00 68.91 C ANISOU 5598 CA LEU B 263 7616 7549 11017 9 324 171 C ATOM 5599 C LEU B 263 84.089 12.718 -2.675 1.00 70.55 C ANISOU 5599 C LEU B 263 7954 7802 11048 23 229 132 C ATOM 5600 O LEU B 263 83.014 12.879 -3.251 1.00 69.47 O ANISOU 5600 O LEU B 263 7918 7658 10819 21 230 154 O ATOM 5601 CB LEU B 263 86.197 12.974 -4.009 1.00 70.23 C ANISOU 5601 CB LEU B 263 7797 7717 11171 83 446 244 C ATOM 5602 CG LEU B 263 86.814 13.817 -5.145 1.00 77.09 C ANISOU 5602 CG LEU B 263 8624 8533 12134 99 607 344 C ATOM 5603 CD1 LEU B 263 87.607 15.022 -4.628 1.00 78.84 C ANISOU 5603 CD1 LEU B 263 8658 8703 12596 28 626 338 C ATOM 5604 CD2 LEU B 263 87.695 12.957 -6.027 1.00 80.71 C ANISOU 5604 CD2 LEU B 263 9116 9008 12543 192 729 409 C ATOM 5605 N ALA B 264 84.290 11.749 -1.749 1.00 66.24 N ANISOU 5605 N ALA B 264 7398 7303 10467 38 147 84 N ATOM 5606 CA ALA B 264 83.245 10.796 -1.348 1.00 65.02 C ANISOU 5606 CA ALA B 264 7353 7179 10174 46 69 59 C ATOM 5607 C ALA B 264 82.055 11.513 -0.699 1.00 68.44 C ANISOU 5607 C ALA B 264 7799 7621 10584 -9 -4 22 C ATOM 5608 O ALA B 264 80.907 11.185 -1.002 1.00 68.30 O ANISOU 5608 O ALA B 264 7878 7605 10467 -14 -28 32 O ATOM 5609 CB ALA B 264 83.806 9.761 -0.389 1.00 65.95 C ANISOU 5609 CB ALA B 264 7440 7338 10279 80 10 34 C ATOM 5610 N PHE B 265 82.326 12.514 0.160 1.00 64.06 N ANISOU 5610 N PHE B 265 7143 7067 10131 -49 -39 -25 N ATOM 5611 CA PHE B 265 81.286 13.285 0.836 1.00 62.52 C ANISOU 5611 CA PHE B 265 6955 6876 9926 -89 -96 -68 C ATOM 5612 C PHE B 265 80.465 14.086 -0.188 1.00 65.25 C ANISOU 5612 C PHE B 265 7351 7170 10272 -103 -35 -17 C ATOM 5613 O PHE B 265 79.239 14.124 -0.076 1.00 64.45 O ANISOU 5613 O PHE B 265 7308 7081 10098 -111 -70 -17 O ATOM 5614 CB PHE B 265 81.912 14.219 1.890 1.00 64.59 C ANISOU 5614 CB PHE B 265 7099 7140 10301 -122 -145 -150 C ATOM 5615 CG PHE B 265 80.928 14.957 2.771 1.00 65.55 C ANISOU 5615 CG PHE B 265 7230 7273 10404 -147 -206 -216 C ATOM 5616 CD1 PHE B 265 80.433 14.371 3.929 1.00 67.30 C ANISOU 5616 CD1 PHE B 265 7477 7571 10521 -125 -288 -261 C ATOM 5617 CD2 PHE B 265 80.555 16.266 2.482 1.00 67.90 C ANISOU 5617 CD2 PHE B 265 7506 7499 10794 -183 -171 -229 C ATOM 5618 CE1 PHE B 265 79.544 15.062 4.753 1.00 68.14 C ANISOU 5618 CE1 PHE B 265 7594 7694 10603 -135 -329 -322 C ATOM 5619 CE2 PHE B 265 79.671 16.957 3.311 1.00 70.28 C ANISOU 5619 CE2 PHE B 265 7817 7805 11082 -194 -218 -297 C ATOM 5620 CZ PHE B 265 79.172 16.350 4.442 1.00 67.67 C ANISOU 5620 CZ PHE B 265 7516 7561 10636 -169 -295 -346 C ATOM 5621 N ILE B 266 81.133 14.691 -1.195 1.00 61.89 N ANISOU 5621 N ILE B 266 6899 6692 9926 -97 60 38 N ATOM 5622 CA ILE B 266 80.470 15.493 -2.236 1.00 61.77 C ANISOU 5622 CA ILE B 266 6930 6632 9907 -92 128 108 C ATOM 5623 C ILE B 266 79.626 14.557 -3.141 1.00 66.08 C ANISOU 5623 C ILE B 266 7605 7215 10287 -51 125 154 C ATOM 5624 O ILE B 266 78.439 14.825 -3.323 1.00 66.62 O ANISOU 5624 O ILE B 266 7726 7291 10297 -55 96 171 O ATOM 5625 CB ILE B 266 81.487 16.344 -3.070 1.00 65.29 C ANISOU 5625 CB ILE B 266 7310 7011 10485 -88 249 174 C ATOM 5626 CG1 ILE B 266 82.226 17.359 -2.160 1.00 65.72 C ANISOU 5626 CG1 ILE B 266 7227 7012 10733 -148 235 111 C ATOM 5627 CG2 ILE B 266 80.786 17.073 -4.229 1.00 65.78 C ANISOU 5627 CG2 ILE B 266 7440 7038 10515 -59 330 274 C ATOM 5628 CD1 ILE B 266 83.360 18.149 -2.802 1.00 68.28 C ANISOU 5628 CD1 ILE B 266 7450 7256 11236 -162 354 171 C ATOM 5629 N ILE B 267 80.208 13.459 -3.661 1.00 61.50 N ANISOU 5629 N ILE B 267 7072 6657 9638 -12 148 165 N ATOM 5630 CA ILE B 267 79.488 12.531 -4.546 1.00 60.86 C ANISOU 5630 CA ILE B 267 7117 6600 9406 24 136 184 C ATOM 5631 C ILE B 267 78.220 11.981 -3.841 1.00 64.52 C ANISOU 5631 C ILE B 267 7620 7094 9799 -11 25 138 C ATOM 5632 O ILE B 267 77.165 11.930 -4.473 1.00 64.87 O ANISOU 5632 O ILE B 267 7737 7153 9759 -9 -5 154 O ATOM 5633 CB ILE B 267 80.407 11.359 -5.022 1.00 64.05 C ANISOU 5633 CB ILE B 267 7563 7009 9766 75 182 183 C ATOM 5634 CG1 ILE B 267 81.553 11.897 -5.921 1.00 64.84 C ANISOU 5634 CG1 ILE B 267 7628 7084 9923 122 316 250 C ATOM 5635 CG2 ILE B 267 79.591 10.284 -5.783 1.00 65.08 C ANISOU 5635 CG2 ILE B 267 7831 7154 9744 102 145 166 C ATOM 5636 CD1 ILE B 267 82.603 10.895 -6.314 1.00 72.72 C ANISOU 5636 CD1 ILE B 267 8644 8084 10902 186 383 254 C ATOM 5637 N CYS B 268 78.312 11.628 -2.541 1.00 60.68 N ANISOU 5637 N CYS B 268 7080 6623 9351 -40 -34 88 N ATOM 5638 CA CYS B 268 77.212 11.000 -1.798 1.00 59.68 C ANISOU 5638 CA CYS B 268 6983 6524 9168 -67 -116 60 C ATOM 5639 C CYS B 268 76.162 12.016 -1.316 1.00 64.44 C ANISOU 5639 C CYS B 268 7550 7137 9796 -98 -148 57 C ATOM 5640 O CYS B 268 74.988 11.642 -1.265 1.00 65.55 O ANISOU 5640 O CYS B 268 7726 7297 9883 -115 -195 63 O ATOM 5641 CB CYS B 268 77.755 10.221 -0.613 1.00 59.27 C ANISOU 5641 CB CYS B 268 6900 6493 9129 -62 -151 27 C ATOM 5642 SG CYS B 268 78.698 8.750 -1.073 1.00 63.25 S ANISOU 5642 SG CYS B 268 7457 6976 9598 -14 -119 36 S ATOM 5643 N TRP B 269 76.545 13.245 -0.922 1.00 61.03 N ANISOU 5643 N TRP B 269 7044 6687 9456 -107 -124 43 N ATOM 5644 CA TRP B 269 75.545 14.169 -0.368 1.00 60.92 C ANISOU 5644 CA TRP B 269 7001 6676 9470 -125 -148 30 C ATOM 5645 C TRP B 269 75.161 15.353 -1.302 1.00 64.09 C ANISOU 5645 C TRP B 269 7402 7034 9915 -116 -98 83 C ATOM 5646 O TRP B 269 74.084 15.901 -1.096 1.00 63.14 O ANISOU 5646 O TRP B 269 7278 6920 9792 -117 -119 92 O ATOM 5647 CB TRP B 269 76.028 14.768 0.956 1.00 60.05 C ANISOU 5647 CB TRP B 269 6816 6569 9432 -137 -168 -42 C ATOM 5648 CG TRP B 269 75.977 13.792 2.095 1.00 60.82 C ANISOU 5648 CG TRP B 269 6918 6728 9464 -132 -226 -80 C ATOM 5649 CD1 TRP B 269 77.018 13.088 2.621 1.00 63.67 C ANISOU 5649 CD1 TRP B 269 7260 7115 9819 -117 -245 -104 C ATOM 5650 CD2 TRP B 269 74.793 13.321 2.763 1.00 60.49 C ANISOU 5650 CD2 TRP B 269 6903 6730 9352 -131 -261 -74 C ATOM 5651 NE1 TRP B 269 76.569 12.265 3.631 1.00 62.80 N ANISOU 5651 NE1 TRP B 269 7170 7061 9632 -102 -290 -111 N ATOM 5652 CE2 TRP B 269 75.204 12.379 3.728 1.00 64.29 C ANISOU 5652 CE2 TRP B 269 7385 7259 9782 -114 -294 -91 C ATOM 5653 CE3 TRP B 269 73.422 13.622 2.653 1.00 61.75 C ANISOU 5653 CE3 TRP B 269 7074 6895 9493 -139 -263 -47 C ATOM 5654 CZ2 TRP B 269 74.297 11.743 4.584 1.00 63.92 C ANISOU 5654 CZ2 TRP B 269 7358 7259 9668 -105 -314 -74 C ATOM 5655 CZ3 TRP B 269 72.525 12.989 3.499 1.00 63.27 C ANISOU 5655 CZ3 TRP B 269 7274 7137 9630 -136 -287 -38 C ATOM 5656 CH2 TRP B 269 72.963 12.066 4.453 1.00 64.02 C ANISOU 5656 CH2 TRP B 269 7376 7273 9676 -121 -306 -48 C ATOM 5657 N LEU B 270 75.993 15.751 -2.293 1.00 61.15 N ANISOU 5657 N LEU B 270 7032 6621 9583 -97 -24 130 N ATOM 5658 CA LEU B 270 75.647 16.893 -3.158 1.00 61.18 C ANISOU 5658 CA LEU B 270 7039 6581 9627 -76 36 202 C ATOM 5659 C LEU B 270 74.309 16.644 -3.930 1.00 65.07 C ANISOU 5659 C LEU B 270 7602 7120 10004 -49 -4 255 C ATOM 5660 O LEU B 270 73.488 17.568 -3.928 1.00 65.19 O ANISOU 5660 O LEU B 270 7598 7118 10055 -39 -2 287 O ATOM 5661 CB LEU B 270 76.765 17.235 -4.158 1.00 61.84 C ANISOU 5661 CB LEU B 270 7119 6620 9757 -50 139 268 C ATOM 5662 CG LEU B 270 76.551 18.463 -5.062 1.00 67.46 C ANISOU 5662 CG LEU B 270 7833 7276 10522 -18 225 368 C ATOM 5663 CD1 LEU B 270 76.329 19.741 -4.243 1.00 67.61 C ANISOU 5663 CD1 LEU B 270 7776 7219 10695 -50 233 341 C ATOM 5664 CD2 LEU B 270 77.728 18.647 -5.999 1.00 71.01 C ANISOU 5664 CD2 LEU B 270 8277 7689 11016 11 345 444 C ATOM 5665 N PRO B 271 74.020 15.446 -4.541 1.00 60.56 N ANISOU 5665 N PRO B 271 7104 6601 9304 -39 -49 256 N ATOM 5666 CA PRO B 271 72.730 15.282 -5.248 1.00 59.97 C ANISOU 5666 CA PRO B 271 7078 6573 9134 -21 -108 291 C ATOM 5667 C PRO B 271 71.512 15.584 -4.351 1.00 64.09 C ANISOU 5667 C PRO B 271 7546 7114 9690 -50 -171 272 C ATOM 5668 O PRO B 271 70.606 16.291 -4.800 1.00 64.96 O ANISOU 5668 O PRO B 271 7648 7238 9795 -23 -184 325 O ATOM 5669 CB PRO B 271 72.741 13.813 -5.667 1.00 61.27 C ANISOU 5669 CB PRO B 271 7318 6774 9189 -26 -159 254 C ATOM 5670 CG PRO B 271 74.169 13.474 -5.780 1.00 65.92 C ANISOU 5670 CG PRO B 271 7919 7331 9795 -10 -85 242 C ATOM 5671 CD PRO B 271 74.849 14.229 -4.681 1.00 61.51 C ANISOU 5671 CD PRO B 271 7265 6734 9370 -38 -49 221 C ATOM 5672 N PHE B 272 71.511 15.107 -3.083 1.00 59.37 N ANISOU 5672 N PHE B 272 6911 6522 9127 -90 -200 206 N ATOM 5673 CA PHE B 272 70.415 15.344 -2.149 1.00 58.64 C ANISOU 5673 CA PHE B 272 6767 6452 9062 -107 -238 192 C ATOM 5674 C PHE B 272 70.220 16.845 -1.854 1.00 64.27 C ANISOU 5674 C PHE B 272 7428 7125 9866 -82 -191 208 C ATOM 5675 O PHE B 272 69.079 17.314 -1.859 1.00 65.87 O ANISOU 5675 O PHE B 272 7604 7346 10077 -64 -209 242 O ATOM 5676 CB PHE B 272 70.628 14.598 -0.824 1.00 59.88 C ANISOU 5676 CB PHE B 272 6903 6626 9223 -137 -258 130 C ATOM 5677 CG PHE B 272 69.555 14.900 0.203 1.00 61.72 C ANISOU 5677 CG PHE B 272 7085 6888 9478 -140 -274 121 C ATOM 5678 CD1 PHE B 272 68.342 14.214 0.192 1.00 65.01 C ANISOU 5678 CD1 PHE B 272 7493 7347 9863 -159 -320 151 C ATOM 5679 CD2 PHE B 272 69.742 15.899 1.156 1.00 64.40 C ANISOU 5679 CD2 PHE B 272 7380 7209 9878 -123 -240 80 C ATOM 5680 CE1 PHE B 272 67.338 14.521 1.112 1.00 66.42 C ANISOU 5680 CE1 PHE B 272 7613 7555 10069 -153 -315 158 C ATOM 5681 CE2 PHE B 272 68.736 16.207 2.076 1.00 67.34 C ANISOU 5681 CE2 PHE B 272 7713 7613 10260 -109 -239 73 C ATOM 5682 CZ PHE B 272 67.539 15.519 2.043 1.00 65.79 C ANISOU 5682 CZ PHE B 272 7502 7464 10031 -121 -269 120 C ATOM 5683 N HIS B 273 71.307 17.580 -1.553 1.00 59.33 N ANISOU 5683 N HIS B 273 6779 6439 9324 -81 -133 179 N ATOM 5684 CA HIS B 273 71.219 18.991 -1.178 1.00 58.55 C ANISOU 5684 CA HIS B 273 6634 6276 9337 -65 -85 173 C ATOM 5685 C HIS B 273 70.924 19.879 -2.402 1.00 63.20 C ANISOU 5685 C HIS B 273 7237 6823 9954 -21 -34 276 C ATOM 5686 O HIS B 273 70.346 20.955 -2.223 1.00 63.81 O ANISOU 5686 O HIS B 273 7283 6851 10112 5 -3 295 O ATOM 5687 CB HIS B 273 72.494 19.444 -0.476 1.00 59.08 C ANISOU 5687 CB HIS B 273 6663 6284 9501 -91 -53 96 C ATOM 5688 CG HIS B 273 72.645 18.784 0.857 1.00 61.84 C ANISOU 5688 CG HIS B 273 6996 6686 9815 -113 -108 0 C ATOM 5689 ND1 HIS B 273 72.022 19.290 1.982 1.00 63.50 N ANISOU 5689 ND1 HIS B 273 7181 6907 10040 -104 -125 -63 N ATOM 5690 CD2 HIS B 273 73.252 17.622 1.181 1.00 63.46 C ANISOU 5690 CD2 HIS B 273 7214 6940 9957 -130 -144 -29 C ATOM 5691 CE1 HIS B 273 72.295 18.441 2.955 1.00 62.93 C ANISOU 5691 CE1 HIS B 273 7109 6898 9903 -113 -170 -124 C ATOM 5692 NE2 HIS B 273 73.035 17.421 2.521 1.00 63.15 N ANISOU 5692 NE2 HIS B 273 7157 6947 9889 -130 -185 -102 N ATOM 5693 N VAL B 274 71.223 19.409 -3.632 1.00 60.21 N ANISOU 5693 N VAL B 274 6912 6467 9498 -1 -24 346 N ATOM 5694 CA VAL B 274 70.862 20.158 -4.846 1.00 61.02 C ANISOU 5694 CA VAL B 274 7040 6553 9591 60 20 461 C ATOM 5695 C VAL B 274 69.332 20.154 -4.958 1.00 64.12 C ANISOU 5695 C VAL B 274 7424 7007 9929 89 -50 497 C ATOM 5696 O VAL B 274 68.728 21.222 -5.075 1.00 65.14 O ANISOU 5696 O VAL B 274 7523 7099 10128 134 -17 556 O ATOM 5697 CB VAL B 274 71.551 19.617 -6.140 1.00 65.26 C ANISOU 5697 CB VAL B 274 7649 7118 10028 91 50 524 C ATOM 5698 CG1 VAL B 274 70.896 20.182 -7.409 1.00 65.93 C ANISOU 5698 CG1 VAL B 274 7777 7229 10046 171 66 649 C ATOM 5699 CG2 VAL B 274 73.054 19.899 -6.129 1.00 64.91 C ANISOU 5699 CG2 VAL B 274 7588 6999 10075 76 149 522 C ATOM 5700 N LEU B 275 68.716 18.960 -4.827 1.00 58.73 N ANISOU 5700 N LEU B 275 6756 6411 9145 61 -145 458 N ATOM 5701 CA LEU B 275 67.257 18.762 -4.897 1.00 58.10 C ANISOU 5701 CA LEU B 275 6649 6402 9024 73 -227 483 C ATOM 5702 C LEU B 275 66.537 19.472 -3.746 1.00 61.96 C ANISOU 5702 C LEU B 275 7059 6868 9614 73 -211 461 C ATOM 5703 O LEU B 275 65.433 19.971 -3.958 1.00 63.01 O ANISOU 5703 O LEU B 275 7150 7028 9762 116 -233 520 O ATOM 5704 CB LEU B 275 66.904 17.265 -4.875 1.00 57.10 C ANISOU 5704 CB LEU B 275 6544 6346 8804 21 -321 430 C ATOM 5705 CG LEU B 275 67.490 16.396 -5.997 1.00 60.91 C ANISOU 5705 CG LEU B 275 7117 6855 9170 25 -348 428 C ATOM 5706 CD1 LEU B 275 67.221 14.952 -5.742 1.00 60.91 C ANISOU 5706 CD1 LEU B 275 7136 6890 9120 -37 -429 356 C ATOM 5707 CD2 LEU B 275 66.956 16.798 -7.366 1.00 63.06 C ANISOU 5707 CD2 LEU B 275 7427 7178 9356 94 -380 511 C ATOM 5708 N THR B 276 67.163 19.519 -2.538 1.00 56.98 N ANISOU 5708 N THR B 276 6409 6195 9046 36 -175 374 N ATOM 5709 CA THR B 276 66.634 20.176 -1.332 1.00 56.62 C ANISOU 5709 CA THR B 276 6305 6129 9078 45 -150 329 C ATOM 5710 C THR B 276 66.622 21.707 -1.539 1.00 63.56 C ANISOU 5710 C THR B 276 7166 6918 10068 101 -75 368 C ATOM 5711 O THR B 276 65.666 22.370 -1.124 1.00 64.55 O ANISOU 5711 O THR B 276 7245 7037 10243 143 -60 382 O ATOM 5712 CB THR B 276 67.460 19.773 -0.102 1.00 59.11 C ANISOU 5712 CB THR B 276 6622 6435 9402 1 -142 221 C ATOM 5713 OG1 THR B 276 67.389 18.361 0.049 1.00 60.44 O ANISOU 5713 OG1 THR B 276 6811 6675 9480 -41 -200 206 O ATOM 5714 CG2 THR B 276 66.975 20.420 1.175 1.00 55.99 C ANISOU 5714 CG2 THR B 276 6183 6031 9057 22 -116 160 C ATOM 5715 N PHE B 277 67.674 22.265 -2.181 1.00 60.52 N ANISOU 5715 N PHE B 277 6810 6454 9729 105 -18 395 N ATOM 5716 CA PHE B 277 67.742 23.698 -2.453 1.00 60.85 C ANISOU 5716 CA PHE B 277 6838 6388 9897 155 66 447 C ATOM 5717 C PHE B 277 66.703 24.070 -3.532 1.00 66.03 C ANISOU 5717 C PHE B 277 7496 7078 10514 232 59 587 C ATOM 5718 O PHE B 277 66.048 25.109 -3.404 1.00 67.59 O ANISOU 5718 O PHE B 277 7661 7216 10804 292 104 633 O ATOM 5719 CB PHE B 277 69.160 24.127 -2.870 1.00 62.65 C ANISOU 5719 CB PHE B 277 7083 6516 10203 130 140 450 C ATOM 5720 CG PHE B 277 69.281 25.603 -3.192 1.00 64.96 C ANISOU 5720 CG PHE B 277 7360 6672 10652 173 240 514 C ATOM 5721 CD1 PHE B 277 69.315 26.555 -2.178 1.00 68.41 C ANISOU 5721 CD1 PHE B 277 7757 7001 11235 164 277 423 C ATOM 5722 CD2 PHE B 277 69.397 26.038 -4.506 1.00 67.84 C ANISOU 5722 CD2 PHE B 277 7753 7006 11015 229 303 666 C ATOM 5723 CE1 PHE B 277 69.398 27.923 -2.478 1.00 70.68 C ANISOU 5723 CE1 PHE B 277 8030 7135 11689 202 376 480 C ATOM 5724 CE2 PHE B 277 69.504 27.405 -4.803 1.00 72.05 C ANISOU 5724 CE2 PHE B 277 8271 7396 11709 272 409 744 C ATOM 5725 CZ PHE B 277 69.501 28.337 -3.787 1.00 70.38 C ANISOU 5725 CZ PHE B 277 8015 7060 11665 254 446 649 C ATOM 5726 N LEU B 278 66.529 23.209 -4.565 1.00 61.39 N ANISOU 5726 N LEU B 278 6947 6589 9789 238 -5 649 N ATOM 5727 CA LEU B 278 65.526 23.414 -5.619 1.00 61.55 C ANISOU 5727 CA LEU B 278 6969 6674 9742 315 -44 771 C ATOM 5728 C LEU B 278 64.113 23.319 -5.032 1.00 66.88 C ANISOU 5728 C LEU B 278 7570 7414 10426 329 -110 762 C ATOM 5729 O LEU B 278 63.237 24.082 -5.440 1.00 67.74 O ANISOU 5729 O LEU B 278 7642 7528 10567 410 -106 857 O ATOM 5730 CB LEU B 278 65.698 22.408 -6.763 1.00 61.16 C ANISOU 5730 CB LEU B 278 6986 6722 9530 314 -113 804 C ATOM 5731 CG LEU B 278 66.969 22.492 -7.601 1.00 65.27 C ANISOU 5731 CG LEU B 278 7582 7200 10019 327 -36 845 C ATOM 5732 CD1 LEU B 278 67.053 21.339 -8.560 1.00 65.37 C ANISOU 5732 CD1 LEU B 278 7667 7317 9852 328 -112 844 C ATOM 5733 CD2 LEU B 278 67.047 23.794 -8.365 1.00 68.53 C ANISOU 5733 CD2 LEU B 278 8004 7543 10493 418 64 987 C ATOM 5734 N ASP B 279 63.909 22.400 -4.044 1.00 62.98 N ANISOU 5734 N ASP B 279 7048 6967 9913 258 -160 658 N ATOM 5735 CA ASP B 279 62.651 22.230 -3.302 1.00 63.40 C ANISOU 5735 CA ASP B 279 7020 7079 9990 262 -201 645 C ATOM 5736 C ASP B 279 62.308 23.506 -2.530 1.00 69.54 C ANISOU 5736 C ASP B 279 7752 7774 10895 322 -111 645 C ATOM 5737 O ASP B 279 61.159 23.946 -2.557 1.00 71.30 O ANISOU 5737 O ASP B 279 7905 8029 11155 383 -119 705 O ATOM 5738 CB ASP B 279 62.736 21.037 -2.334 1.00 64.31 C ANISOU 5738 CB ASP B 279 7128 7240 10066 177 -239 545 C ATOM 5739 CG ASP B 279 61.505 20.831 -1.455 1.00 74.07 C ANISOU 5739 CG ASP B 279 8274 8533 11335 179 -255 540 C ATOM 5740 OD1 ASP B 279 60.372 20.963 -1.972 1.00 74.96 O ANISOU 5740 OD1 ASP B 279 8319 8701 11460 220 -298 619 O ATOM 5741 OD2 ASP B 279 61.674 20.451 -0.280 1.00 79.56 O ANISOU 5741 OD2 ASP B 279 8963 9229 12036 141 -228 464 O ATOM 5742 N ALA B 280 63.309 24.099 -1.846 1.00 65.08 N ANISOU 5742 N ALA B 280 7222 7100 10406 306 -30 570 N ATOM 5743 CA ALA B 280 63.150 25.338 -1.087 1.00 65.29 C ANISOU 5743 CA ALA B 280 7223 7023 10563 358 58 540 C ATOM 5744 C ALA B 280 62.695 26.475 -1.996 1.00 71.45 C ANISOU 5744 C ALA B 280 7990 7741 11417 453 106 671 C ATOM 5745 O ALA B 280 61.805 27.237 -1.601 1.00 72.70 O ANISOU 5745 O ALA B 280 8097 7872 11652 526 144 694 O ATOM 5746 CB ALA B 280 64.451 25.706 -0.401 1.00 65.53 C ANISOU 5746 CB ALA B 280 7292 6945 10660 309 113 426 C ATOM 5747 N LEU B 281 63.269 26.564 -3.234 1.00 67.67 N ANISOU 5747 N LEU B 281 7559 7247 10906 465 109 768 N ATOM 5748 CA LEU B 281 62.912 27.596 -4.224 1.00 68.34 C ANISOU 5748 CA LEU B 281 7643 7281 11042 567 158 921 C ATOM 5749 C LEU B 281 61.463 27.413 -4.697 1.00 72.73 C ANISOU 5749 C LEU B 281 8139 7962 11531 641 77 1019 C ATOM 5750 O LEU B 281 60.794 28.403 -4.977 1.00 73.44 O ANISOU 5750 O LEU B 281 8198 8012 11693 746 120 1129 O ATOM 5751 CB LEU B 281 63.871 27.584 -5.434 1.00 68.07 C ANISOU 5751 CB LEU B 281 7679 7225 10957 570 185 1011 C ATOM 5752 CG LEU B 281 65.341 27.958 -5.166 1.00 70.62 C ANISOU 5752 CG LEU B 281 8039 7408 11384 508 281 948 C ATOM 5753 CD1 LEU B 281 66.189 27.705 -6.377 1.00 69.68 C ANISOU 5753 CD1 LEU B 281 7982 7303 11189 511 307 1042 C ATOM 5754 CD2 LEU B 281 65.477 29.400 -4.722 1.00 72.43 C ANISOU 5754 CD2 LEU B 281 8247 7455 11819 546 398 955 C ATOM 5755 N ALA B 282 60.973 26.154 -4.747 1.00 68.35 N ANISOU 5755 N ALA B 282 7558 7552 10858 586 -39 978 N ATOM 5756 CA ALA B 282 59.590 25.851 -5.112 1.00 68.56 C ANISOU 5756 CA ALA B 282 7504 7705 10840 634 -133 1051 C ATOM 5757 C ALA B 282 58.621 26.386 -4.043 1.00 74.72 C ANISOU 5757 C ALA B 282 8190 8462 11739 680 -84 1033 C ATOM 5758 O ALA B 282 57.597 26.972 -4.400 1.00 76.08 O ANISOU 5758 O ALA B 282 8290 8664 11952 779 -92 1140 O ATOM 5759 CB ALA B 282 59.409 24.359 -5.299 1.00 68.37 C ANISOU 5759 CB ALA B 282 7474 7812 10691 544 -260 994 C ATOM 5760 N TRP B 283 58.971 26.239 -2.739 1.00 71.17 N ANISOU 5760 N TRP B 283 7744 7961 11339 622 -27 901 N ATOM 5761 CA TRP B 283 58.162 26.758 -1.629 1.00 71.74 C ANISOU 5761 CA TRP B 283 7743 8009 11505 672 39 866 C ATOM 5762 C TRP B 283 58.231 28.286 -1.559 1.00 78.01 C ANISOU 5762 C TRP B 283 8552 8653 12436 773 156 897 C ATOM 5763 O TRP B 283 57.261 28.909 -1.128 1.00 80.35 O ANISOU 5763 O TRP B 283 8778 8936 12814 860 207 921 O ATOM 5764 CB TRP B 283 58.581 26.164 -0.276 1.00 69.53 C ANISOU 5764 CB TRP B 283 7480 7729 11207 594 65 715 C ATOM 5765 CG TRP B 283 58.253 24.710 -0.120 1.00 69.73 C ANISOU 5765 CG TRP B 283 7475 7887 11131 508 -28 695 C ATOM 5766 CD1 TRP B 283 59.121 23.660 -0.178 1.00 71.56 C ANISOU 5766 CD1 TRP B 283 7771 8145 11273 409 -82 635 C ATOM 5767 CD2 TRP B 283 56.944 24.141 0.031 1.00 69.93 C ANISOU 5767 CD2 TRP B 283 7389 8027 11155 516 -75 748 C ATOM 5768 NE1 TRP B 283 58.440 22.474 -0.025 1.00 70.77 N ANISOU 5768 NE1 TRP B 283 7617 8154 11119 351 -156 641 N ATOM 5769 CE2 TRP B 283 57.100 22.741 0.096 1.00 72.86 C ANISOU 5769 CE2 TRP B 283 7768 8475 11441 409 -154 709 C ATOM 5770 CE3 TRP B 283 55.650 24.683 0.131 1.00 72.22 C ANISOU 5770 CE3 TRP B 283 7563 8355 11522 604 -52 827 C ATOM 5771 CZ2 TRP B 283 56.018 21.878 0.267 1.00 72.54 C ANISOU 5771 CZ2 TRP B 283 7621 8537 11402 375 -209 746 C ATOM 5772 CZ3 TRP B 283 54.577 23.825 0.290 1.00 73.83 C ANISOU 5772 CZ3 TRP B 283 7653 8678 11724 573 -110 867 C ATOM 5773 CH2 TRP B 283 54.765 22.444 0.365 1.00 73.71 C ANISOU 5773 CH2 TRP B 283 7645 8726 11634 454 -188 825 C ATOM 5774 N MET B 284 59.355 28.889 -1.994 1.00 73.92 N ATOM 5775 CA MET B 284 59.530 30.348 -2.028 1.00 75.15 C ATOM 5776 C MET B 284 58.765 30.984 -3.210 1.00 78.37 C ATOM 5777 O MET B 284 58.639 32.209 -3.275 1.00 79.47 O ATOM 5778 CB MET B 284 61.016 30.714 -2.119 1.00 77.78 C ATOM 5779 CG MET B 284 61.784 30.406 -0.861 1.00 81.54 C ATOM 5780 SD MET B 284 63.549 30.730 -1.036 1.00 86.65 S ATOM 5781 CE MET B 284 64.095 30.324 0.583 1.00 82.87 C