>>5UNF:HELIX   27 AC9 PHE B  112  TYR B  148  1                                  37    
FGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIY
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 27 AC9 PHE B 112 TYR B 148 1 37 ATOM 4460 N PHE B 112 53.282 2.086 11.984 1.00 91.58 N ANISOU 4460 N PHE B 112 9639 10817 14340 -612 680 1619 N ATOM 4461 CA PHE B 112 54.075 1.915 13.204 1.00 91.26 C ANISOU 4461 CA PHE B 112 9730 10827 14118 -478 815 1690 C ATOM 4462 C PHE B 112 53.614 2.861 14.346 1.00 96.17 C ANISOU 4462 C PHE B 112 10321 11603 14617 -323 969 1758 C ATOM 4463 O PHE B 112 54.239 2.884 15.409 1.00 96.03 O ANISOU 4463 O PHE B 112 10416 11659 14413 -190 1072 1801 O ATOM 4464 CB PHE B 112 55.562 2.170 12.898 1.00 91.14 C ANISOU 4464 CB PHE B 112 9904 10814 13912 -425 698 1543 C ATOM 4465 CG PHE B 112 56.187 1.233 11.890 1.00 92.34 C ANISOU 4465 CG PHE B 112 10116 10821 14146 -544 567 1472 C ATOM 4466 CD1 PHE B 112 56.779 0.040 12.297 1.00 96.56 C ANISOU 4466 CD1 PHE B 112 10727 11262 14700 -553 623 1553 C ATOM 4467 CD2 PHE B 112 56.235 1.567 10.542 1.00 93.26 C ANISOU 4467 CD2 PHE B 112 10229 10901 14307 -628 392 1322 C ATOM 4468 CE1 PHE B 112 57.378 -0.818 11.367 1.00 96.96 C ANISOU 4468 CE1 PHE B 112 10842 11170 14827 -651 510 1476 C ATOM 4469 CE2 PHE B 112 56.829 0.709 9.614 1.00 95.77 C ANISOU 4469 CE2 PHE B 112 10615 11090 14682 -723 278 1245 C ATOM 4470 CZ PHE B 112 57.399 -0.478 10.032 1.00 94.61 C ANISOU 4470 CZ PHE B 112 10541 10841 14567 -735 339 1316 C ATOM 4471 N GLY B 113 52.538 3.613 14.121 1.00 93.34 N ANISOU 4471 N GLY B 113 9813 11296 14357 -334 980 1763 N ATOM 4472 CA GLY B 113 52.008 4.550 15.107 1.00 94.06 C ANISOU 4472 CA GLY B 113 9866 11523 14348 -186 1129 1816 C ATOM 4473 C GLY B 113 52.660 5.918 15.036 1.00 97.23 C ANISOU 4473 C GLY B 113 10380 12011 14553 -73 1054 1649 C ATOM 4474 O GLY B 113 53.824 6.023 14.643 1.00 95.35 O ANISOU 4474 O GLY B 113 10290 11748 14190 -69 936 1524 O ATOM 4475 N PRO B 114 51.957 7.001 15.454 1.00 94.86 N ANISOU 4475 N PRO B 114 10010 11806 14226 28 1132 1645 N ATOM 4476 CA PRO B 114 52.544 8.354 15.333 1.00 93.33 C ANISOU 4476 CA PRO B 114 9918 11669 13874 127 1061 1478 C ATOM 4477 C PRO B 114 53.693 8.621 16.310 1.00 95.22 C ANISOU 4477 C PRO B 114 10345 11974 13861 260 1101 1411 C ATOM 4478 O PRO B 114 54.430 9.593 16.111 1.00 93.59 O ANISOU 4478 O PRO B 114 10236 11785 13539 315 1014 1253 O ATOM 4479 CB PRO B 114 51.368 9.286 15.655 1.00 96.58 C ANISOU 4479 CB PRO B 114 10199 12156 14342 212 1171 1520 C ATOM 4480 CG PRO B 114 50.138 8.432 15.484 1.00102.64 C ANISOU 4480 CG PRO B 114 10762 12890 15345 109 1232 1684 C ATOM 4481 CD PRO B 114 50.560 7.069 15.926 1.00 98.42 C ANISOU 4481 CD PRO B 114 10273 12303 14820 46 1283 1789 C ATOM 4482 N VAL B 115 53.855 7.772 17.346 1.00 91.74 N ANISOU 4482 N VAL B 115 9951 11568 13340 313 1228 1532 N ATOM 4483 CA VAL B 115 54.924 7.922 18.339 1.00 90.89 C ANISOU 4483 CA VAL B 115 10015 11540 12979 448 1257 1479 C ATOM 4484 C VAL B 115 56.266 7.564 17.664 1.00 91.97 C ANISOU 4484 C VAL B 115 10270 11606 13069 378 1079 1364 C ATOM 4485 O VAL B 115 57.213 8.343 17.769 1.00 91.14 O ANISOU 4485 O VAL B 115 10280 11544 12807 449 1000 1213 O ATOM 4486 CB VAL B 115 54.665 7.082 19.624 1.00 96.39 C ANISOU 4486 CB VAL B 115 10724 12304 13596 538 1451 1668 C ATOM 4487 CG1 VAL B 115 55.830 7.188 20.603 1.00 96.02 C ANISOU 4487 CG1 VAL B 115 10859 12354 13269 683 1453 1610 C ATOM 4488 CG2 VAL B 115 53.365 7.513 20.303 1.00 98.06 C ANISOU 4488 CG2 VAL B 115 10818 12596 13845 624 1644 1781 C ATOM 4489 N MET B 116 56.316 6.449 16.906 1.00 87.21 N ANISOU 4489 N MET B 116 9629 10888 12619 235 1014 1424 N ATOM 4490 CA MET B 116 57.534 6.018 16.219 1.00 85.60 C ANISOU 4490 CA MET B 116 9528 10609 12386 172 863 1329 C ATOM 4491 C MET B 116 57.836 6.909 15.001 1.00 83.30 C ANISOU 4491 C MET B 116 9237 10274 12140 107 701 1159 C ATOM 4492 O MET B 116 58.961 6.881 14.500 1.00 82.49 O ANISOU 4492 O MET B 116 9229 10133 11980 86 584 1055 O ATOM 4493 CB MET B 116 57.451 4.555 15.787 1.00 89.53 C ANISOU 4493 CB MET B 116 9994 10987 13036 52 861 1443 C ATOM 4494 CG MET B 116 57.367 3.618 16.954 1.00 96.77 C ANISOU 4494 CG MET B 116 10932 11932 13903 123 1022 1622 C ATOM 4495 SD MET B 116 57.485 1.879 16.503 1.00103.69 S ANISOU 4495 SD MET B 116 11793 12639 14966 -9 1029 1754 S ATOM 4496 CE MET B 116 57.022 1.134 18.126 1.00103.08 C ANISOU 4496 CE MET B 116 11729 12638 14798 128 1272 1997 C ATOM 4497 N CYS B 117 56.862 7.726 14.555 1.00 75.60 N ANISOU 4497 N CYS B 117 8155 9309 11261 90 702 1141 N ATOM 4498 CA CYS B 117 57.068 8.706 13.483 1.00 71.88 C ANISOU 4498 CA CYS B 117 7683 8808 10819 56 571 1002 C ATOM 4499 C CYS B 117 58.010 9.804 14.002 1.00 74.42 C ANISOU 4499 C CYS B 117 8119 9191 10968 171 557 868 C ATOM 4500 O CYS B 117 58.948 10.182 13.297 1.00 72.61 O ANISOU 4500 O CYS B 117 7952 8919 10719 144 439 747 O ATOM 4501 CB CYS B 117 55.734 9.267 12.995 1.00 71.30 C ANISOU 4501 CB CYS B 117 7459 8740 10893 27 589 1042 C ATOM 4502 SG CYS B 117 55.867 10.607 11.774 1.00 73.06 S ANISOU 4502 SG CYS B 117 7678 8937 11145 16 451 903 S ATOM 4503 N LYS B 118 57.811 10.240 15.269 1.00 71.38 N ANISOU 4503 N LYS B 118 7763 8902 10457 301 679 888 N ATOM 4504 CA LYS B 118 58.680 11.212 15.930 1.00 70.67 C ANISOU 4504 CA LYS B 118 7782 8873 10196 414 665 749 C ATOM 4505 C LYS B 118 59.990 10.592 16.363 1.00 74.84 C ANISOU 4505 C LYS B 118 8429 9419 10589 434 609 712 C ATOM 4506 O LYS B 118 61.032 11.208 16.169 1.00 73.18 O ANISOU 4506 O LYS B 118 8293 9204 10308 452 512 566 O ATOM 4507 CB LYS B 118 58.015 11.841 17.164 1.00 74.15 C ANISOU 4507 CB LYS B 118 8220 9421 10533 559 814 770 C ATOM 4508 CG LYS B 118 56.892 12.782 16.858 1.00 84.46 C ANISOU 4508 CG LYS B 118 9423 10720 11946 581 870 768 C ATOM 4509 CD LYS B 118 56.433 13.511 18.101 1.00 91.04 C ANISOU 4509 CD LYS B 118 10281 11659 12651 745 1019 758 C ATOM 4510 CE LYS B 118 55.383 14.545 17.789 1.00 95.49 C ANISOU 4510 CE LYS B 118 10747 12210 13323 785 1077 744 C ATOM 4511 NZ LYS B 118 55.892 15.604 16.881 1.00 98.96 N ANISOU 4511 NZ LYS B 118 11221 12571 13810 759 951 583 N ATOM 4512 N VAL B 119 59.936 9.397 17.003 1.00 73.00 N ANISOU 4512 N VAL B 119 8205 9206 10325 440 678 852 N ATOM 4513 CA VAL B 119 61.102 8.730 17.586 1.00 73.12 C ANISOU 4513 CA VAL B 119 8328 9254 10203 484 642 847 C ATOM 4514 C VAL B 119 62.096 8.329 16.468 1.00 77.92 C ANISOU 4514 C VAL B 119 8962 9757 10886 376 493 777 C ATOM 4515 O VAL B 119 63.228 8.807 16.506 1.00 77.25 O ANISOU 4515 O VAL B 119 8948 9693 10709 409 400 648 O ATOM 4516 CB VAL B 119 60.714 7.507 18.459 1.00 77.52 C ANISOU 4516 CB VAL B 119 8884 9844 10726 525 770 1043 C ATOM 4517 CG1 VAL B 119 61.952 6.757 18.946 1.00 77.23 C ANISOU 4517 CG1 VAL B 119 8954 9835 10556 576 720 1049 C ATOM 4518 CG2 VAL B 119 59.862 7.939 19.645 1.00 78.72 C ANISOU 4518 CG2 VAL B 119 9022 10116 10772 656 933 1115 C ATOM 4519 N PHE B 120 61.690 7.485 15.489 1.00 76.02 N ANISOU 4519 N PHE B 120 8663 9409 10813 250 471 853 N ATOM 4520 CA PHE B 120 62.612 7.050 14.428 1.00 75.71 C ANISOU 4520 CA PHE B 120 8659 9273 10833 160 346 790 C ATOM 4521 C PHE B 120 62.935 8.196 13.463 1.00 77.29 C ANISOU 4521 C PHE B 120 8855 9446 11066 126 245 641 C ATOM 4522 O PHE B 120 64.029 8.204 12.898 1.00 76.83 O ANISOU 4522 O PHE B 120 8850 9348 10994 101 151 558 O ATOM 4523 CB PHE B 120 62.088 5.849 13.642 1.00 78.51 C ANISOU 4523 CB PHE B 120 8964 9516 11351 41 345 889 C ATOM 4524 CG PHE B 120 62.063 4.591 14.476 1.00 82.47 C ANISOU 4524 CG PHE B 120 9481 10009 11843 65 442 1041 C ATOM 4525 CD1 PHE B 120 63.238 3.918 14.785 1.00 86.08 C ANISOU 4525 CD1 PHE B 120 10032 10461 12214 111 418 1051 C ATOM 4526 CD2 PHE B 120 60.862 4.044 14.902 1.00 87.04 C ANISOU 4526 CD2 PHE B 120 9973 10577 12519 41 561 1188 C ATOM 4527 CE1 PHE B 120 63.219 2.765 15.571 1.00 88.70 C ANISOU 4527 CE1 PHE B 120 10383 10779 12539 147 517 1210 C ATOM 4528 CE2 PHE B 120 60.842 2.876 15.672 1.00 91.57 C ANISOU 4528 CE2 PHE B 120 10562 11130 13100 65 667 1348 C ATOM 4529 CZ PHE B 120 62.023 2.242 15.998 1.00 89.55 C ANISOU 4529 CZ PHE B 120 10412 10868 12745 122 645 1361 C ATOM 4530 N GLY B 121 62.032 9.166 13.336 1.00 71.83 N ANISOU 4530 N GLY B 121 8100 8775 10416 136 274 618 N ATOM 4531 CA GLY B 121 62.271 10.360 12.535 1.00 69.99 C ANISOU 4531 CA GLY B 121 7864 8515 10215 121 199 495 C ATOM 4532 C GLY B 121 63.440 11.148 13.098 1.00 72.44 C ANISOU 4532 C GLY B 121 8254 8863 10405 196 160 366 C ATOM 4533 O GLY B 121 64.325 11.576 12.353 1.00 70.97 O ANISOU 4533 O GLY B 121 8096 8626 10244 160 73 274 O ATOM 4534 N SER B 122 63.472 11.285 14.439 1.00 69.49 N ANISOU 4534 N SER B 122 7916 8585 9900 302 226 361 N ATOM 4535 CA SER B 122 64.527 11.961 15.190 1.00 69.18 C ANISOU 4535 CA SER B 122 7950 8603 9733 381 181 228 C ATOM 4536 C SER B 122 65.792 11.132 15.241 1.00 73.79 C ANISOU 4536 C SER B 122 8588 9190 10258 372 108 224 C ATOM 4537 O SER B 122 66.883 11.689 15.142 1.00 73.05 O ANISOU 4537 O SER B 122 8525 9091 10138 376 20 100 O ATOM 4538 CB SER B 122 64.061 12.248 16.609 1.00 73.41 C ANISOU 4538 CB SER B 122 8513 9254 10127 509 274 228 C ATOM 4539 OG SER B 122 62.893 13.045 16.590 1.00 80.81 O ANISOU 4539 OG SER B 122 9393 10186 11125 530 355 238 O ATOM 4540 N PHE B 123 65.649 9.799 15.431 1.00 71.06 N ANISOU 4540 N PHE B 123 8247 8848 9904 362 150 365 N ATOM 4541 CA PHE B 123 66.758 8.848 15.521 1.00 70.71 C ANISOU 4541 CA PHE B 123 8252 8803 9813 367 97 391 C ATOM 4542 C PHE B 123 67.550 8.844 14.208 1.00 72.16 C ANISOU 4542 C PHE B 123 8429 8881 10108 270 1 329 C ATOM 4543 O PHE B 123 68.777 8.729 14.231 1.00 72.12 O ANISOU 4543 O PHE B 123 8457 8882 10063 286 -70 277 O ATOM 4544 CB PHE B 123 66.232 7.447 15.855 1.00 73.49 C ANISOU 4544 CB PHE B 123 8603 9148 10170 370 184 571 C ATOM 4545 CG PHE B 123 67.283 6.391 16.108 1.00 75.78 C ANISOU 4545 CG PHE B 123 8948 9437 10410 398 150 622 C ATOM 4546 CD1 PHE B 123 67.860 6.249 17.365 1.00 80.30 C ANISOU 4546 CD1 PHE B 123 9574 10130 10805 527 156 637 C ATOM 4547 CD2 PHE B 123 67.623 5.476 15.119 1.00 77.79 C ANISOU 4547 CD2 PHE B 123 9199 9571 10787 308 117 665 C ATOM 4548 CE1 PHE B 123 68.801 5.248 17.612 1.00 81.77 C ANISOU 4548 CE1 PHE B 123 9803 10317 10948 567 128 704 C ATOM 4549 CE2 PHE B 123 68.555 4.466 15.370 1.00 81.29 C ANISOU 4549 CE2 PHE B 123 9690 10003 11194 346 100 724 C ATOM 4550 CZ PHE B 123 69.142 4.361 16.614 1.00 80.42 C ANISOU 4550 CZ PHE B 123 9624 10013 10917 477 105 750 C ATOM 4551 N LEU B 124 66.843 9.010 13.073 1.00 66.07 N ANISOU 4551 N LEU B 124 7610 8023 9469 178 -1 337 N ATOM 4552 CA LEU B 124 67.424 9.114 11.739 1.00 64.01 C ANISOU 4552 CA LEU B 124 7348 7671 9303 96 -77 282 C ATOM 4553 C LEU B 124 68.303 10.353 11.631 1.00 68.53 C ANISOU 4553 C LEU B 124 7928 8252 9859 117 -136 144 C ATOM 4554 O LEU B 124 69.458 10.246 11.221 1.00 69.97 O ANISOU 4554 O LEU B 124 8131 8408 10046 105 -195 94 O ATOM 4555 CB LEU B 124 66.297 9.166 10.686 1.00 63.21 C ANISOU 4555 CB LEU B 124 7194 7503 9322 13 -67 323 C ATOM 4556 CG LEU B 124 66.669 9.583 9.261 1.00 66.14 C ANISOU 4556 CG LEU B 124 7566 7796 9769 -54 -138 264 C ATOM 4557 CD1 LEU B 124 67.517 8.526 8.564 1.00 65.41 C ANISOU 4557 CD1 LEU B 124 7518 7641 9695 -97 -178 281 C ATOM 4558 CD2 LEU B 124 65.430 9.870 8.464 1.00 68.35 C ANISOU 4558 CD2 LEU B 124 7787 8049 10136 -104 -135 296 C ATOM 4559 N THR B 125 67.755 11.521 12.011 1.00 63.35 N ANISOU 4559 N THR B 125 7249 7623 9196 150 -111 84 N ATOM 4560 CA THR B 125 68.406 12.822 11.917 1.00 62.05 C ANISOU 4560 CA THR B 125 7083 7442 9049 161 -155 -50 C ATOM 4561 C THR B 125 69.564 12.904 12.927 1.00 67.45 C ANISOU 4561 C THR B 125 7802 8195 9632 223 -205 -140 C ATOM 4562 O THR B 125 70.615 13.455 12.600 1.00 68.29 O ANISOU 4562 O THR B 125 7902 8267 9781 201 -270 -236 O ATOM 4563 CB THR B 125 67.364 13.913 12.150 1.00 62.04 C ANISOU 4563 CB THR B 125 7055 7446 9072 192 -101 -78 C ATOM 4564 OG1 THR B 125 66.251 13.661 11.297 1.00 57.06 O ANISOU 4564 OG1 THR B 125 6380 6775 8528 142 -65 22 O ATOM 4565 CG2 THR B 125 67.898 15.299 11.879 1.00 59.35 C ANISOU 4565 CG2 THR B 125 6710 7050 8791 191 -135 -207 C ATOM 4566 N LEU B 126 69.387 12.322 14.125 1.00 64.01 N ANISOU 4566 N LEU B 126 7396 7860 9066 302 -175 -99 N ATOM 4567 CA LEU B 126 70.391 12.295 15.196 1.00 63.75 C ANISOU 4567 CA LEU B 126 7396 7920 8905 379 -234 -175 C ATOM 4568 C LEU B 126 71.672 11.618 14.701 1.00 67.98 C ANISOU 4568 C LEU B 126 7927 8427 9475 344 -311 -172 C ATOM 4569 O LEU B 126 72.737 12.233 14.740 1.00 68.20 O ANISOU 4569 O LEU B 126 7936 8453 9522 339 -393 -293 O ATOM 4570 CB LEU B 126 69.815 11.554 16.434 1.00 64.15 C ANISOU 4570 CB LEU B 126 7487 8088 8800 479 -168 -81 C ATOM 4571 CG LEU B 126 70.574 11.603 17.768 1.00 69.04 C ANISOU 4571 CG LEU B 126 8153 8844 9236 595 -220 -154 C ATOM 4572 CD1 LEU B 126 69.719 11.095 18.877 1.00 70.43 C ANISOU 4572 CD1 LEU B 126 8371 9129 9260 701 -120 -42 C ATOM 4573 CD2 LEU B 126 71.840 10.807 17.737 1.00 71.05 C ANISOU 4573 CD2 LEU B 126 8409 9116 9472 597 -313 -151 C ATOM 4574 N ASN B 127 71.559 10.363 14.223 1.00 64.11 N ANISOU 4574 N ASN B 127 7447 7904 9007 318 -281 -37 N ATOM 4575 CA ASN B 127 72.692 9.569 13.752 1.00 63.39 C ANISOU 4575 CA ASN B 127 7356 7782 8947 300 -333 -15 C ATOM 4576 C ASN B 127 73.201 10.070 12.390 1.00 66.87 C ANISOU 4576 C ASN B 127 7765 8116 9529 211 -366 -73 C ATOM 4577 O ASN B 127 74.374 9.853 12.092 1.00 66.90 O ANISOU 4577 O ASN B 127 7753 8107 9560 209 -419 -105 O ATOM 4578 CB ASN B 127 72.314 8.099 13.666 1.00 61.43 C ANISOU 4578 CB ASN B 127 7136 7507 8696 301 -277 141 C ATOM 4579 CG ASN B 127 72.027 7.503 15.022 1.00 67.98 C ANISOU 4579 CG ASN B 127 8000 8443 9386 402 -234 225 C ATOM 4580 OD1 ASN B 127 72.873 7.486 15.922 1.00 53.80 O ANISOU 4580 OD1 ASN B 127 6221 6750 7472 493 -285 190 O ATOM 4581 ND2 ASN B 127 70.840 6.967 15.185 1.00 58.95 N ANISOU 4581 ND2 ASN B 127 6864 7278 8256 392 -139 348 N ATOM 4582 N MET B 128 72.354 10.755 11.581 1.00 62.84 N ANISOU 4582 N MET B 128 7239 7535 9103 149 -330 -79 N ATOM 4583 CA MET B 128 72.808 11.337 10.311 1.00 62.02 C ANISOU 4583 CA MET B 128 7111 7339 9114 81 -350 -122 C ATOM 4584 C MET B 128 73.807 12.455 10.585 1.00 67.65 C ANISOU 4584 C MET B 128 7790 8060 9854 91 -402 -250 C ATOM 4585 O MET B 128 74.886 12.468 9.994 1.00 68.05 O ANISOU 4585 O MET B 128 7815 8074 9966 67 -435 -275 O ATOM 4586 CB MET B 128 71.646 11.865 9.461 1.00 63.80 C ANISOU 4586 CB MET B 128 7326 7506 9408 33 -307 -95 C ATOM 4587 CG MET B 128 72.121 12.472 8.149 1.00 66.75 C ANISOU 4587 CG MET B 128 7685 7794 9882 -21 -319 -122 C ATOM 4588 SD MET B 128 70.902 13.458 7.264 1.00 70.18 S ANISOU 4588 SD MET B 128 8100 8176 10390 -52 -284 -104 S ATOM 4589 CE MET B 128 70.699 14.816 8.380 1.00 67.42 C ANISOU 4589 CE MET B 128 7727 7855 10036 -3 -272 -201 C ATOM 4590 N PHE B 129 73.443 13.389 11.495 1.00 64.55 N ANISOU 4590 N PHE B 129 7391 7712 9423 127 -407 -334 N ATOM 4591 CA PHE B 129 74.313 14.491 11.879 1.00 64.61 C ANISOU 4591 CA PHE B 129 7364 7718 9466 131 -466 -478 C ATOM 4592 C PHE B 129 75.493 13.981 12.698 1.00 70.80 C ANISOU 4592 C PHE B 129 8136 8589 10175 177 -547 -522 C ATOM 4593 O PHE B 129 76.593 14.491 12.513 1.00 71.76 O ANISOU 4593 O PHE B 129 8203 8684 10377 149 -607 -607 O ATOM 4594 CB PHE B 129 73.567 15.584 12.650 1.00 66.44 C ANISOU 4594 CB PHE B 129 7607 7969 9669 167 -450 -570 C ATOM 4595 CG PHE B 129 72.749 16.482 11.757 1.00 66.89 C ANISOU 4595 CG PHE B 129 7651 7922 9842 123 -389 -561 C ATOM 4596 CD1 PHE B 129 73.369 17.400 10.910 1.00 69.73 C ANISOU 4596 CD1 PHE B 129 7971 8175 10348 66 -400 -618 C ATOM 4597 CD2 PHE B 129 71.368 16.497 11.841 1.00 67.65 C ANISOU 4597 CD2 PHE B 129 7766 8030 9907 149 -318 -493 C ATOM 4598 CE1 PHE B 129 72.617 18.240 10.093 1.00 70.06 C ANISOU 4598 CE1 PHE B 129 8005 8123 10491 41 -340 -594 C ATOM 4599 CE2 PHE B 129 70.618 17.362 11.047 1.00 70.31 C ANISOU 4599 CE2 PHE B 129 8084 8281 10350 123 -269 -479 C ATOM 4600 CZ PHE B 129 71.247 18.224 10.176 1.00 68.54 C ANISOU 4600 CZ PHE B 129 7833 7951 10258 74 -281 -526 C ATOM 4601 N ALA B 130 75.298 12.945 13.545 1.00 66.77 N ANISOU 4601 N ALA B 130 7667 8179 9523 249 -545 -450 N ATOM 4602 CA ALA B 130 76.404 12.377 14.313 1.00 66.62 C ANISOU 4602 CA ALA B 130 7636 8254 9420 310 -626 -471 C ATOM 4603 C ALA B 130 77.460 11.800 13.365 1.00 69.87 C ANISOU 4603 C ALA B 130 8005 8606 9935 267 -648 -427 C ATOM 4604 O ALA B 130 78.648 11.947 13.625 1.00 71.33 O ANISOU 4604 O ALA B 130 8136 8833 10135 285 -732 -495 O ATOM 4605 CB ALA B 130 75.903 11.319 15.269 1.00 67.75 C ANISOU 4605 CB ALA B 130 7839 8502 9400 402 -596 -365 C ATOM 4606 N SER B 131 77.028 11.241 12.216 1.00 64.35 N ANISOU 4606 N SER B 131 7324 7810 9318 210 -575 -328 N ATOM 4607 CA SER B 131 77.929 10.719 11.183 1.00 63.28 C ANISOU 4607 CA SER B 131 7159 7607 9276 176 -574 -289 C ATOM 4608 C SER B 131 78.714 11.861 10.535 1.00 67.44 C ANISOU 4608 C SER B 131 7614 8073 9938 118 -598 -388 C ATOM 4609 O SER B 131 79.943 11.835 10.546 1.00 68.08 O ANISOU 4609 O SER B 131 7629 8172 10068 126 -651 -428 O ATOM 4610 CB SER B 131 77.147 9.941 10.124 1.00 63.92 C ANISOU 4610 CB SER B 131 7292 7602 9391 136 -495 -177 C ATOM 4611 OG SER B 131 77.998 9.473 9.091 1.00 67.82 O ANISOU 4611 OG SER B 131 7773 8033 9963 115 -484 -149 O ATOM 4612 N ILE B 132 77.997 12.883 10.025 1.00 62.98 N ANISOU 4612 N ILE B 132 7052 7438 9441 64 -558 -422 N ATOM 4613 CA ILE B 132 78.561 14.050 9.334 1.00 62.62 C ANISOU 4613 CA ILE B 132 6944 7308 9541 5 -555 -494 C ATOM 4614 C ILE B 132 79.507 14.850 10.286 1.00 67.30 C ANISOU 4614 C ILE B 132 7462 7944 10166 12 -647 -638 C ATOM 4615 O ILE B 132 80.569 15.292 9.841 1.00 67.63 O ANISOU 4615 O ILE B 132 7422 7935 10341 -30 -665 -681 O ATOM 4616 CB ILE B 132 77.413 14.956 8.786 1.00 64.80 C ANISOU 4616 CB ILE B 132 7250 7509 9864 -32 -492 -489 C ATOM 4617 CG1 ILE B 132 76.519 14.165 7.792 1.00 64.11 C ANISOU 4617 CG1 ILE B 132 7222 7389 9747 -44 -426 -361 C ATOM 4618 CG2 ILE B 132 77.979 16.217 8.121 1.00 64.72 C ANISOU 4618 CG2 ILE B 132 7177 7397 10015 -87 -475 -548 C ATOM 4619 CD1 ILE B 132 75.260 14.876 7.296 1.00 68.82 C ANISOU 4619 CD1 ILE B 132 7843 7936 10370 -64 -375 -336 C ATOM 4620 N PHE B 133 79.142 15.015 11.573 1.00 63.64 N ANISOU 4620 N PHE B 133 7025 7575 9582 67 -705 -712 N ATOM 4621 CA PHE B 133 79.972 15.787 12.492 1.00 64.36 C ANISOU 4621 CA PHE B 133 7053 7714 9686 76 -811 -872 C ATOM 4622 C PHE B 133 81.217 15.007 12.882 1.00 68.68 C ANISOU 4622 C PHE B 133 7537 8346 10211 111 -899 -871 C ATOM 4623 O PHE B 133 82.259 15.631 13.055 1.00 69.82 O ANISOU 4623 O PHE B 133 7582 8482 10465 76 -978 -981 O ATOM 4624 CB PHE B 133 79.216 16.222 13.754 1.00 67.04 C ANISOU 4624 CB PHE B 133 7452 8141 9880 140 -847 -964 C ATOM 4625 CG PHE B 133 77.974 17.064 13.541 1.00 68.16 C ANISOU 4625 CG PHE B 133 7645 8208 10047 122 -764 -979 C ATOM 4626 CD1 PHE B 133 77.938 18.044 12.554 1.00 70.65 C ANISOU 4626 CD1 PHE B 133 7922 8377 10546 42 -717 -1005 C ATOM 4627 CD2 PHE B 133 76.921 17.013 14.443 1.00 71.62 C ANISOU 4627 CD2 PHE B 133 8159 8725 10328 197 -736 -978 C ATOM 4628 CE1 PHE B 133 76.806 18.837 12.370 1.00 72.01 C ANISOU 4628 CE1 PHE B 133 8135 8480 10746 39 -642 -1011 C ATOM 4629 CE2 PHE B 133 75.806 17.839 14.286 1.00 74.98 C ANISOU 4629 CE2 PHE B 133 8618 9084 10787 191 -659 -996 C ATOM 4630 CZ PHE B 133 75.751 18.739 13.240 1.00 72.49 C ANISOU 4630 CZ PHE B 133 8266 8621 10657 114 -616 -1011 C ATOM 4631 N PHE B 134 81.148 13.659 12.984 1.00 64.66 N ANISOU 4631 N PHE B 134 7074 7910 9585 177 -883 -744 N ATOM 4632 CA PHE B 134 82.353 12.879 13.297 1.00 64.72 C ANISOU 4632 CA PHE B 134 7017 7993 9580 224 -959 -725 C ATOM 4633 C PHE B 134 83.266 12.782 12.039 1.00 68.91 C ANISOU 4633 C PHE B 134 7469 8422 10293 161 -913 -676 C ATOM 4634 O PHE B 134 84.480 12.685 12.204 1.00 69.95 O ANISOU 4634 O PHE B 134 7499 8593 10487 174 -984 -706 O ATOM 4635 CB PHE B 134 82.045 11.486 13.864 1.00 65.90 C ANISOU 4635 CB PHE B 134 7241 8238 9560 324 -948 -597 C ATOM 4636 CG PHE B 134 81.637 11.513 15.323 1.00 67.80 C ANISOU 4636 CG PHE B 134 7533 8619 9608 414 -1012 -644 C ATOM 4637 CD1 PHE B 134 82.565 11.803 16.317 1.00 72.52 C ANISOU 4637 CD1 PHE B 134 8071 9341 10142 472 -1155 -759 C ATOM 4638 CD2 PHE B 134 80.368 11.116 15.713 1.00 68.68 C ANISOU 4638 CD2 PHE B 134 7751 8751 9593 454 -931 -562 C ATOM 4639 CE1 PHE B 134 82.193 11.816 17.668 1.00 74.49 C ANISOU 4639 CE1 PHE B 134 8383 9738 10183 573 -1214 -804 C ATOM 4640 CE2 PHE B 134 80.000 11.113 17.065 1.00 72.66 C ANISOU 4640 CE2 PHE B 134 8309 9395 9904 554 -971 -592 C ATOM 4641 CZ PHE B 134 80.913 11.468 18.033 1.00 72.63 C ANISOU 4641 CZ PHE B 134 8262 9519 9816 619 -1112 -714 C ATOM 4642 N ILE B 135 82.700 12.894 10.807 1.00 64.60 N ANISOU 4642 N ILE B 135 6961 7753 9830 99 -798 -607 N ATOM 4643 CA ILE B 135 83.463 12.985 9.543 1.00 64.06 C ANISOU 4643 CA ILE B 135 6831 7586 9923 46 -734 -563 C ATOM 4644 C ILE B 135 84.277 14.288 9.577 1.00 70.23 C ANISOU 4644 C ILE B 135 7490 8325 10870 -20 -780 -686 C ATOM 4645 O ILE B 135 85.458 14.296 9.215 1.00 71.12 O ANISOU 4645 O ILE B 135 7492 8421 11110 -37 -789 -686 O ATOM 4646 CB ILE B 135 82.518 12.906 8.286 1.00 65.53 C ANISOU 4646 CB ILE B 135 7104 7669 10126 8 -610 -467 C ATOM 4647 CG1 ILE B 135 81.896 11.501 8.144 1.00 65.13 C ANISOU 4647 CG1 ILE B 135 7156 7643 9948 59 -572 -354 C ATOM 4648 CG2 ILE B 135 83.255 13.304 6.988 1.00 65.28 C ANISOU 4648 CG2 ILE B 135 7013 7539 10250 -39 -534 -432 C ATOM 4649 CD1 ILE B 135 80.810 11.361 7.071 1.00 70.14 C ANISOU 4649 CD1 ILE B 135 7879 8197 10575 23 -481 -280 C ATOM 4650 N THR B 136 83.634 15.377 10.051 1.00 67.71 N ANISOU 4650 N THR B 136 7187 7982 10559 -54 -806 -792 N ATOM 4651 CA THR B 136 84.216 16.709 10.197 1.00 69.33 C ANISOU 4651 CA THR B 136 7289 8123 10930 -124 -853 -930 C ATOM 4652 C THR B 136 85.343 16.668 11.245 1.00 76.96 C ANISOU 4652 C THR B 136 8148 9195 11898 -102 -1005 -1047 C ATOM 4653 O THR B 136 86.396 17.255 11.001 1.00 78.08 O ANISOU 4653 O THR B 136 8153 9286 12228 -164 -1038 -1111 O ATOM 4654 CB THR B 136 83.124 17.713 10.569 1.00 74.56 C ANISOU 4654 CB THR B 136 8020 8738 11572 -144 -841 -1013 C ATOM 4655 OG1 THR B 136 82.095 17.656 9.585 1.00 67.95 O ANISOU 4655 OG1 THR B 136 7267 7818 10734 -156 -712 -892 O ATOM 4656 CG2 THR B 136 83.646 19.132 10.695 1.00 74.58 C ANISOU 4656 CG2 THR B 136 7929 8647 11762 -220 -883 -1167 C ATOM 4657 N CYS B 137 85.140 15.947 12.382 1.00 75.01 N ANISOU 4657 N CYS B 137 7956 9099 11447 -9 -1095 -1064 N ATOM 4658 CA CYS B 137 86.163 15.788 13.426 1.00 77.30 C ANISOU 4658 CA CYS B 137 8154 9520 11698 36 -1256 -1165 C ATOM 4659 C CYS B 137 87.397 15.116 12.849 1.00 82.06 C ANISOU 4659 C CYS B 137 8634 10129 12416 37 -1259 -1083 C ATOM 4660 O CYS B 137 88.496 15.586 13.109 1.00 83.51 O ANISOU 4660 O CYS B 137 8668 10335 12728 4 -1365 -1186 O ATOM 4661 CB CYS B 137 85.633 15.006 14.621 1.00 78.32 C ANISOU 4661 CB CYS B 137 8385 9812 11562 156 -1322 -1151 C ATOM 4662 SG CYS B 137 84.456 15.920 15.639 1.00 83.07 S ANISOU 4662 SG CYS B 137 9101 10445 12017 179 -1347 -1288 S ATOM 4663 N MET B 138 87.218 14.040 12.051 1.00 77.79 N ANISOU 4663 N MET B 138 8153 9564 11840 74 -1143 -907 N ATOM 4664 CA MET B 138 88.307 13.293 11.415 1.00 78.50 C ANISOU 4664 CA MET B 138 8147 9653 12029 95 -1116 -812 C ATOM 4665 C MET B 138 89.190 14.188 10.533 1.00 82.38 C ANISOU 4665 C MET B 138 8490 10030 12778 -5 -1073 -846 C ATOM 4666 O MET B 138 90.409 14.039 10.573 1.00 82.77 O ANISOU 4666 O MET B 138 8387 10118 12943 0 -1130 -858 O ATOM 4667 CB MET B 138 87.775 12.129 10.558 1.00 79.82 C ANISOU 4667 CB MET B 138 8430 9777 12120 141 -978 -636 C ATOM 4668 CG MET B 138 87.249 10.937 11.361 1.00 83.88 C ANISOU 4668 CG MET B 138 9055 10395 12420 250 -1007 -562 C ATOM 4669 SD MET B 138 88.471 10.198 12.480 1.00 91.00 S ANISOU 4669 SD MET B 138 9854 11463 13257 365 -1154 -567 S ATOM 4670 CE MET B 138 89.834 9.827 11.324 1.00 87.87 C ANISOU 4670 CE MET B 138 9322 10998 13067 357 -1085 -488 C ATOM 4671 N SER B 139 88.586 15.099 9.742 1.00 78.27 N ANISOU 4671 N SER B 139 8009 9373 12356 -90 -968 -849 N ATOM 4672 CA SER B 139 89.341 15.999 8.863 1.00 78.65 C ANISOU 4672 CA SER B 139 7928 9299 12658 -184 -899 -857 C ATOM 4673 C SER B 139 90.138 17.030 9.688 1.00 83.81 C ANISOU 4673 C SER B 139 8422 9959 13466 -252 -1039 -1034 C ATOM 4674 O SER B 139 91.282 17.324 9.341 1.00 83.93 O ANISOU 4674 O SER B 139 8264 9933 13692 -303 -1037 -1039 O ATOM 4675 CB SER B 139 88.411 16.706 7.884 1.00 81.25 C ANISOU 4675 CB SER B 139 8352 9488 13033 -240 -757 -806 C ATOM 4676 OG SER B 139 87.782 15.766 7.030 1.00 89.51 O ANISOU 4676 OG SER B 139 9528 10527 13954 -186 -642 -656 O ATOM 4677 N VAL B 140 89.548 17.537 10.793 1.00 80.95 N ANISOU 4677 N VAL B 140 8112 9650 12996 -248 -1162 -1183 N ATOM 4678 CA VAL B 140 90.182 18.493 11.713 1.00 82.68 C ANISOU 4678 CA VAL B 140 8201 9882 13330 -308 -1323 -1388 C ATOM 4679 C VAL B 140 91.329 17.780 12.460 1.00 88.71 C ANISOU 4679 C VAL B 140 8835 10807 14062 -248 -1481 -1423 C ATOM 4680 O VAL B 140 92.387 18.382 12.657 1.00 90.10 O ANISOU 4680 O VAL B 140 8823 10972 14439 -316 -1579 -1531 O ATOM 4681 CB VAL B 140 89.144 19.115 12.695 1.00 86.39 C ANISOU 4681 CB VAL B 140 8794 10372 13657 -298 -1397 -1538 C ATOM 4682 CG1 VAL B 140 89.817 19.961 13.775 1.00 88.59 C ANISOU 4682 CG1 VAL B 140 8959 10690 14013 -341 -1591 -1777 C ATOM 4683 CG2 VAL B 140 88.101 19.935 11.944 1.00 84.87 C ANISOU 4683 CG2 VAL B 140 8700 10012 13537 -357 -1246 -1506 C ATOM 4684 N ASP B 141 91.129 16.487 12.828 1.00 84.88 N ANISOU 4684 N ASP B 141 8443 10466 13343 -120 -1500 -1320 N ATOM 4685 CA ASP B 141 92.116 15.664 13.538 1.00 85.84 C ANISOU 4685 CA ASP B 141 8459 10751 13404 -34 -1640 -1320 C ATOM 4686 C ASP B 141 93.297 15.331 12.618 1.00 90.01 C ANISOU 4686 C ASP B 141 8817 11234 14148 -56 -1574 -1214 C ATOM 4687 O ASP B 141 94.445 15.507 13.034 1.00 91.97 O ANISOU 4687 O ASP B 141 8873 11553 14518 -66 -1708 -1291 O ATOM 4688 CB ASP B 141 91.479 14.374 14.080 1.00 86.71 C ANISOU 4688 CB ASP B 141 8726 10995 13223 112 -1641 -1206 C ATOM 4689 CG ASP B 141 92.420 13.548 14.933 1.00 99.49 C ANISOU 4689 CG ASP B 141 10249 12791 14762 222 -1789 -1193 C ATOM 4690 OD1 ASP B 141 92.686 13.954 16.092 1.00102.45 O ANISOU 4690 OD1 ASP B 141 10576 13296 15055 250 -1981 -1348 O ATOM 4691 OD2 ASP B 141 92.865 12.477 14.459 1.00103.78 O ANISOU 4691 OD2 ASP B 141 10770 13346 15316 289 -1715 -1031 O ATOM 4692 N ARG B 142 93.020 14.864 11.372 1.00 84.30 N ANISOU 4692 N ARG B 142 8159 10402 13470 -59 -1370 -1043 N ATOM 4693 CA ARG B 142 94.060 14.556 10.386 1.00 84.31 C ANISOU 4693 CA ARG B 142 8018 10351 13665 -69 -1270 -931 C ATOM 4694 C ARG B 142 94.855 15.810 10.029 1.00 92.07 C ANISOU 4694 C ARG B 142 8802 11230 14952 -203 -1275 -1023 C ATOM 4695 O ARG B 142 96.065 15.707 9.862 1.00 94.16 O ANISOU 4695 O ARG B 142 8865 11520 15393 -210 -1303 -1008 O ATOM 4696 CB ARG B 142 93.490 13.923 9.109 1.00 80.37 C ANISOU 4696 CB ARG B 142 7655 9753 13128 -42 -1050 -751 C ATOM 4697 CG ARG B 142 93.095 12.458 9.243 1.00 83.62 C ANISOU 4697 CG ARG B 142 8211 10246 13313 90 -1026 -632 C ATOM 4698 CD ARG B 142 92.648 11.910 7.900 1.00 88.90 C ANISOU 4698 CD ARG B 142 8992 10808 13976 105 -822 -483 C ATOM 4699 NE ARG B 142 92.477 10.456 7.923 1.00 96.14 N ANISOU 4699 NE ARG B 142 10026 11778 14723 225 -792 -373 N ATOM 4700 CZ ARG B 142 92.111 9.727 6.871 1.00106.81 C ANISOU 4700 CZ ARG B 142 11492 13053 16040 260 -637 -256 C ATOM 4701 NH1 ARG B 142 91.862 10.308 5.703 1.00 87.55 N ANISOU 4701 NH1 ARG B 142 9068 10498 13697 196 -498 -224 N ATOM 4702 NH2 ARG B 142 91.984 8.411 6.981 1.00 95.05 N ANISOU 4702 NH2 ARG B 142 10103 11597 14415 364 -620 -171 N ATOM 4703 N TYR B 143 94.195 16.990 9.948 1.00 89.81 N ANISOU 4703 N TYR B 143 8562 10820 14740 -309 -1247 -1117 N ATOM 4704 CA TYR B 143 94.866 18.262 9.656 1.00 92.09 C ANISOU 4704 CA TYR B 143 8673 10980 15336 -448 -1244 -1209 C ATOM 4705 C TYR B 143 95.807 18.640 10.800 1.00100.48 C ANISOU 4705 C TYR B 143 9543 12139 16495 -482 -1480 -1398 C ATOM 4706 O TYR B 143 96.961 18.975 10.542 1.00101.96 O ANISOU 4706 O TYR B 143 9502 12291 16949 -550 -1493 -1409 O ATOM 4707 CB TYR B 143 93.850 19.395 9.397 1.00 93.06 C ANISOU 4707 CB TYR B 143 8914 10952 15495 -534 -1173 -1272 C ATOM 4708 CG TYR B 143 94.480 20.770 9.323 1.00 97.46 C ANISOU 4708 CG TYR B 143 9297 11362 16372 -680 -1191 -1393 C ATOM 4709 CD1 TYR B 143 95.209 21.165 8.205 1.00 99.92 C ANISOU 4709 CD1 TYR B 143 9478 11530 16957 -754 -1023 -1276 C ATOM 4710 CD2 TYR B 143 94.304 21.696 10.347 1.00100.04 C ANISOU 4710 CD2 TYR B 143 9598 11681 16730 -742 -1363 -1624 C ATOM 4711 CE1 TYR B 143 95.814 22.419 8.144 1.00102.79 C ANISOU 4711 CE1 TYR B 143 9670 11740 17644 -896 -1028 -1376 C ATOM 4712 CE2 TYR B 143 94.892 22.959 10.291 1.00103.14 C ANISOU 4712 CE2 TYR B 143 9830 11916 17444 -887 -1382 -1748 C ATOM 4713 CZ TYR B 143 95.646 23.317 9.185 1.00111.56 C ANISOU 4713 CZ TYR B 143 10752 12830 18803 -969 -1210 -1616 C ATOM 4714 OH TYR B 143 96.227 24.561 9.120 1.00115.09 O ANISOU 4714 OH TYR B 143 11032 13102 19594 -1119 -1214 -1724 O ATOM 4715 N GLN B 144 95.326 18.541 12.056 1.00 98.50 N ANISOU 4715 N GLN B 144 9382 12020 16022 -426 -1664 -1540 N ATOM 4716 CA GLN B 144 96.082 18.864 13.267 1.00101.15 C ANISOU 4716 CA GLN B 144 9570 12477 16385 -438 -1920 -1744 C ATOM 4717 C GLN B 144 97.276 17.880 13.434 1.00108.38 C ANISOU 4717 C GLN B 144 10315 13547 17319 -355 -2008 -1669 C ATOM 4718 O GLN B 144 98.270 18.236 14.065 1.00110.21 O ANISOU 4718 O GLN B 144 10342 13854 17678 -392 -2201 -1812 O ATOM 4719 CB GLN B 144 95.136 18.819 14.482 1.00102.08 C ANISOU 4719 CB GLN B 144 9872 12716 16197 -361 -2060 -1877 C ATOM 4720 CG GLN B 144 95.695 19.418 15.769 1.00119.66 C ANISOU 4720 CG GLN B 144 11986 15052 18428 -383 -2331 -2136 C ATOM 4721 CD GLN B 144 94.679 19.498 16.891 1.00134.95 C ANISOU 4721 CD GLN B 144 14123 17093 20058 -303 -2436 -2268 C ATOM 4722 OE1 GLN B 144 94.904 20.170 17.903 1.00135.07 O ANISOU 4722 OE1 GLN B 144 14096 17158 20066 -333 -2632 -2511 O ATOM 4723 NE2 GLN B 144 93.524 18.862 16.730 1.00117.33 N ANISOU 4723 NE2 GLN B 144 12114 14887 17577 -204 -2302 -2121 N ATOM 4724 N SER B 145 97.186 16.673 12.827 1.00105.17 N ANISOU 4724 N SER B 145 9983 13177 16800 -246 -1866 -1449 N ATOM 4725 CA SER B 145 98.246 15.658 12.840 1.00106.86 C ANISOU 4725 CA SER B 145 10050 13516 17036 -149 -1909 -1345 C ATOM 4726 C SER B 145 99.324 15.964 11.799 1.00114.96 C ANISOU 4726 C SER B 145 10846 14430 18405 -234 -1791 -1269 C ATOM 4727 O SER B 145 100.480 15.584 11.984 1.00116.50 O ANISOU 4727 O SER B 145 10822 14717 18724 -203 -1882 -1258 O ATOM 4728 CB SER B 145 97.665 14.273 12.581 1.00107.94 C ANISOU 4728 CB SER B 145 10375 13712 16924 3 -1793 -1149 C ATOM 4729 OG SER B 145 96.730 13.910 13.579 1.00115.94 O ANISOU 4729 OG SER B 145 11583 14837 17632 90 -1891 -1195 O ATOM 4730 N VAL B 146 98.941 16.633 10.697 1.00113.17 N ANISOU 4730 N VAL B 146 10664 14007 18326 -333 -1582 -1206 N ATOM 4731 CA VAL B 146 99.850 16.992 9.608 1.00115.15 C ANISOU 4731 CA VAL B 146 10722 14134 18896 -411 -1424 -1109 C ATOM 4732 C VAL B 146 100.619 18.285 9.983 1.00125.26 C ANISOU 4732 C VAL B 146 11756 15348 20490 -572 -1553 -1289 C ATOM 4733 O VAL B 146 101.848 18.252 10.021 1.00126.74 O ANISOU 4733 O VAL B 146 11679 15581 20896 -592 -1617 -1292 O ATOM 4734 CB VAL B 146 99.090 17.146 8.255 1.00116.84 C ANISOU 4734 CB VAL B 146 11101 14176 19118 -437 -1148 -959 C ATOM 4735 CG1 VAL B 146 99.974 17.755 7.178 1.00117.87 C ANISOU 4735 CG1 VAL B 146 11036 14165 19585 -528 -974 -868 C ATOM 4736 CG2 VAL B 146 98.517 15.815 7.785 1.00114.39 C ANISOU 4736 CG2 VAL B 146 10997 13922 18543 -288 -1025 -788 C ATOM 4737 N ILE B 147 99.899 19.405 10.257 1.00125.10 N ANISOU 4737 N ILE B 147 11816 15214 20504 -683 -1588 -1440 N ATOM 4738 CA ILE B 147 100.490 20.714 10.573 1.00129.21 C ANISOU 4738 CA ILE B 147 12130 15628 21335 -851 -1697 -1627 C ATOM 4739 C ILE B 147 101.304 20.613 11.917 1.00139.73 C ANISOU 4739 C ILE B 147 13287 17145 22658 -839 -2016 -1828 C ATOM 4740 O ILE B 147 102.401 21.177 11.984 1.00142.40 O ANISOU 4740 O ILE B 147 13342 17451 23311 -945 -2102 -1909 O ATOM 4741 CB ILE B 147 99.408 21.857 10.619 1.00131.99 C ANISOU 4741 CB ILE B 147 12650 15817 21685 -946 -1663 -1747 C ATOM 4742 CG1 ILE B 147 100.024 23.271 10.815 1.00135.55 C ANISOU 4742 CG1 ILE B 147 12891 16107 22506 -1133 -1742 -1933 C ATOM 4743 CG2 ILE B 147 98.289 21.611 11.624 1.00131.75 C ANISOU 4743 CG2 ILE B 147 12863 15905 21292 -857 -1800 -1866 C ATOM 4744 CD1 ILE B 147 100.900 23.808 9.648 1.00146.48 C ANISOU 4744 CD1 ILE B 147 14067 17302 24287 -1247 -1529 -1786 C ATOM 4745 N TYR B 148 100.810 19.862 12.932 1.00138.40 N ATOM 4746 CA TYR B 148 101.538 19.665 14.198 1.00141.87 C ATOM 4747 C TYR B 148 101.838 18.158 14.389 1.00146.83 C ATOM 4748 O TYR B 148 100.979 17.423 14.886 1.00144.90 O ATOM 4749 CB TYR B 148 100.765 20.238 15.412 1.00144.04 C ATOM 4750 CG TYR B 148 100.416 21.705 15.290 1.00147.24 C ATOM 4751 CD1 TYR B 148 101.346 22.692 15.600 1.00152.44 C ATOM 4752 CD2 TYR B 148 99.130 22.107 14.943 1.00146.14 C ATOM 4753 CE1 TYR B 148 101.027 24.045 15.494 1.00154.62 C ATOM 4754 CE2 TYR B 148 98.799 23.455 14.828 1.00148.01 C ATOM 4755 CZ TYR B 148 99.750 24.423 15.109 1.00159.47 C ATOM 4756 OH TYR B 148 99.421 25.754 15.017 1.00162.10 O