>>6JOD:HELIX    5 AA5 GLY A  113  TYR A  148  1                                  36    
GPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIY
Search OCA for entries with sequence similar to this one (with E=10)

HELIX 5 AA5 GLY A 113 TYR A 148 1 36 ATOM 639 N GLY A 113 6.327 46.968 -2.125 1.00151.64 N ANISOU 639 N GLY A 113 15044 15026 27547 1582 -1493 225 N ATOM 640 CA GLY A 113 5.233 47.377 -1.275 1.00164.35 C ANISOU 640 CA GLY A 113 16172 16294 29982 1744 -1133 -112 C ATOM 641 C GLY A 113 5.250 46.732 0.095 1.00168.71 C ANISOU 641 C GLY A 113 16755 16891 30456 1466 -410 -570 C ATOM 642 O GLY A 113 6.046 45.831 0.378 1.00169.37 O ANISOU 642 O GLY A 113 17208 17271 29873 1163 -239 -604 O ATOM 643 N PRO A 114 4.360 47.190 0.980 1.00174.22 N ANISOU 643 N PRO A 114 17056 17291 31847 1560 30 -934 N ATOM 644 CA PRO A 114 4.335 46.623 2.337 1.00173.20 C ANISOU 644 CA PRO A 114 16975 17225 31610 1227 749 -1373 C ATOM 645 C PRO A 114 3.772 45.216 2.382 1.00172.65 C ANISOU 645 C PRO A 114 16667 17492 31440 999 774 -1546 C ATOM 646 O PRO A 114 4.289 44.368 3.123 1.00172.06 O ANISOU 646 O PRO A 114 16913 17611 30851 630 1131 -1679 O ATOM 647 CB PRO A 114 3.458 47.616 3.108 1.00179.08 C ANISOU 647 CB PRO A 114 17310 17554 33178 1418 1185 -1732 C ATOM 648 CG PRO A 114 2.540 48.171 2.070 1.00185.37 C ANISOU 648 CG PRO A 114 17575 18166 34690 1881 619 -1537 C ATOM 649 CD PRO A 114 3.341 48.237 0.795 1.00179.97 C ANISOU 649 CD PRO A 114 17269 17617 33495 1968 -97 -968 C ATOM 650 N VAL A 115 2.721 44.944 1.606 1.00166.99 N ANISOU 650 N VAL A 115 15402 16843 31205 1190 377 -1527 N ATOM 651 CA VAL A 115 2.147 43.603 1.576 1.00155.18 C ANISOU 651 CA VAL A 115 13683 15654 29624 935 370 -1692 C ATOM 652 C VAL A 115 3.177 42.590 1.086 1.00146.99 C ANISOU 652 C VAL A 115 13201 14913 27737 705 118 -1458 C ATOM 653 O VAL A 115 3.278 41.478 1.619 1.00151.08 O ANISOU 653 O VAL A 115 13875 15595 27931 367 382 -1627 O ATOM 654 CB VAL A 115 0.869 43.592 0.716 1.00148.22 C ANISOU 654 CB VAL A 115 12095 14817 29407 1179 -92 -1678 C ATOM 655 CG1 VAL A 115 -0.297 44.145 1.509 1.00148.52 C ANISOU 655 CG1 VAL A 115 11477 14639 30314 1305 345 -2075 C ATOM 656 CG2 VAL A 115 1.073 44.411 -0.549 1.00151.95 C ANISOU 656 CG2 VAL A 115 12587 15210 29939 1549 -802 -1223 C ATOM 657 N MET A 116 3.972 42.961 0.079 1.00136.99 N ANISOU 657 N MET A 116 12247 13702 26100 875 -379 -1072 N ATOM 658 CA MET A 116 4.998 42.049 -0.415 1.00127.50 C ANISOU 658 CA MET A 116 11542 12785 24116 691 -582 -896 C ATOM 659 C MET A 116 6.091 41.834 0.622 1.00126.07 C ANISOU 659 C MET A 116 11875 12608 23419 453 -92 -962 C ATOM 660 O MET A 116 6.637 40.730 0.738 1.00132.79 O ANISOU 660 O MET A 116 13015 13649 23788 233 -39 -985 O ATOM 661 CB MET A 116 5.590 42.578 -1.718 1.00129.08 C ANISOU 661 CB MET A 116 11935 13083 24026 890 -1180 -493 C ATOM 662 CG MET A 116 4.625 42.546 -2.889 1.00133.83 C ANISOU 662 CG MET A 116 12101 13780 24967 1051 -1780 -363 C ATOM 663 SD MET A 116 3.912 40.913 -3.172 1.00127.72 S ANISOU 663 SD MET A 116 11105 13299 24125 789 -1885 -613 S ATOM 664 CE MET A 116 3.005 41.207 -4.686 1.00133.61 C ANISOU 664 CE MET A 116 11409 14195 25163 975 -2697 -356 C ATOM 665 N CYS A 117 6.434 42.879 1.376 1.00126.89 N ANISOU 665 N CYS A 117 12103 12488 23621 491 246 -987 N ATOM 666 CA CYS A 117 7.420 42.733 2.442 1.00127.75 C ANISOU 666 CA CYS A 117 12668 12627 23245 221 704 -1050 C ATOM 667 C CYS A 117 6.922 41.764 3.513 1.00116.96 C ANISOU 667 C CYS A 117 11225 11301 21915 -100 1162 -1366 C ATOM 668 O CYS A 117 7.661 40.871 3.954 1.00 98.52 O ANISOU 668 O CYS A 117 9256 9124 19053 -353 1286 -1331 O ATOM 669 CB CYS A 117 7.744 44.112 3.027 1.00136.10 C ANISOU 669 CB CYS A 117 13844 13419 24448 285 979 -1061 C ATOM 670 SG CYS A 117 8.756 44.153 4.527 1.00139.00 S ANISOU 670 SG CYS A 117 14698 13812 24305 -106 1593 -1195 S ATOM 671 N LYS A 118 5.663 41.920 3.934 1.00117.98 N ANISOU 671 N LYS A 118 10862 11289 22676 -101 1409 -1667 N ATOM 672 CA LYS A 118 5.038 40.958 4.837 1.00121.11 C ANISOU 672 CA LYS A 118 11136 11754 23126 -457 1820 -1966 C ATOM 673 C LYS A 118 5.149 39.542 4.289 1.00124.53 C ANISOU 673 C LYS A 118 11698 12398 23219 -601 1514 -1857 C ATOM 674 O LYS A 118 5.728 38.648 4.922 1.00135.29 O ANISOU 674 O LYS A 118 13444 13840 24118 -908 1711 -1846 O ATOM 675 CB LYS A 118 3.563 41.315 5.049 1.00126.42 C ANISOU 675 CB LYS A 118 11135 12305 24594 -385 2029 -2300 C ATOM 676 CG LYS A 118 3.293 42.352 6.115 1.00133.36 C ANISOU 676 CG LYS A 118 11892 12962 25818 -414 2615 -2604 C ATOM 677 CD LYS A 118 3.230 41.729 7.491 1.00136.03 C ANISOU 677 CD LYS A 118 12391 13390 25903 -934 3265 -2902 C ATOM 678 CE LYS A 118 3.133 42.810 8.545 1.00148.99 C ANISOU 678 CE LYS A 118 14007 14833 27770 -1005 3874 -3228 C ATOM 679 NZ LYS A 118 3.441 42.285 9.891 1.00154.22 N ANISOU 679 NZ LYS A 118 15025 15629 27942 -1581 4462 -3422 N ATOM 680 N VAL A 119 4.599 39.335 3.090 1.00118.68 N ANISOU 680 N VAL A 119 10653 11729 22709 -383 1006 -1769 N ATOM 681 CA VAL A 119 4.426 37.991 2.549 1.00108.05 C ANISOU 681 CA VAL A 119 9344 10545 21165 -545 745 -1765 C ATOM 682 C VAL A 119 5.769 37.300 2.366 1.00101.84 C ANISOU 682 C VAL A 119 9168 9858 19668 -607 611 -1548 C ATOM 683 O VAL A 119 5.942 36.136 2.740 1.00112.55 O ANISOU 683 O VAL A 119 10762 11238 20764 -872 725 -1605 O ATOM 684 CB VAL A 119 3.641 38.048 1.227 1.00108.29 C ANISOU 684 CB VAL A 119 8946 10666 21532 -314 183 -1700 C ATOM 685 CG1 VAL A 119 3.731 36.714 0.504 1.00111.03 C ANISOU 685 CG1 VAL A 119 9462 11182 21543 -480 -138 -1680 C ATOM 686 CG2 VAL A 119 2.194 38.433 1.487 1.00102.55 C ANISOU 686 CG2 VAL A 119 7527 9872 21567 -288 323 -1955 C ATOM 687 N PHE A 120 6.737 37.999 1.784 1.00 98.39 N ANISOU 687 N PHE A 120 8981 9472 18930 -364 367 -1293 N ATOM 688 CA PHE A 120 8.006 37.356 1.472 1.00112.93 C ANISOU 688 CA PHE A 120 11314 11454 20142 -376 214 -1109 C ATOM 689 C PHE A 120 8.927 37.259 2.682 1.00129.46 C ANISOU 689 C PHE A 120 13800 13512 21876 -570 625 -1079 C ATOM 690 O PHE A 120 9.768 36.356 2.737 1.00133.01 O ANISOU 690 O PHE A 120 14597 14040 21899 -646 583 -991 O ATOM 691 CB PHE A 120 8.691 38.096 0.329 1.00123.03 C ANISOU 691 CB PHE A 120 12686 12863 21196 -98 -203 -854 C ATOM 692 CG PHE A 120 7.956 37.987 -0.973 1.00133.59 C ANISOU 692 CG PHE A 120 13730 14301 22726 39 -696 -827 C ATOM 693 CD1 PHE A 120 7.492 36.761 -1.415 1.00134.12 C ANISOU 693 CD1 PHE A 120 13738 14452 22770 -93 -858 -974 C ATOM 694 CD2 PHE A 120 7.701 39.113 -1.740 1.00140.46 C ANISOU 694 CD2 PHE A 120 14398 15168 23805 268 -1016 -644 C ATOM 695 CE1 PHE A 120 6.805 36.652 -2.609 1.00139.89 C ANISOU 695 CE1 PHE A 120 14203 15314 23635 -25 -1330 -958 C ATOM 696 CE2 PHE A 120 7.014 39.011 -2.934 1.00144.72 C ANISOU 696 CE2 PHE A 120 14669 15832 24486 356 -1520 -580 C ATOM 697 CZ PHE A 120 6.565 37.778 -3.369 1.00145.36 C ANISOU 697 CZ PHE A 120 14681 16049 24500 197 -1675 -748 C ATOM 698 N GLY A 121 8.801 38.166 3.651 1.00147.19 N ANISOU 698 N GLY A 121 15999 15641 24288 -654 1010 -1155 N ATOM 699 CA GLY A 121 9.549 37.997 4.889 1.00147.59 C ANISOU 699 CA GLY A 121 16409 15691 23977 -927 1401 -1142 C ATOM 700 C GLY A 121 9.057 36.807 5.691 1.00149.34 C ANISOU 700 C GLY A 121 16675 15870 24196 -1272 1649 -1288 C ATOM 701 O GLY A 121 9.841 35.937 6.091 1.00152.46 O ANISOU 701 O GLY A 121 17444 16311 24172 -1428 1656 -1153 O ATOM 702 N SER A 122 7.743 36.745 5.924 1.00152.80 N ANISOU 702 N SER A 122 16718 16217 25121 -1401 1842 -1553 N ATOM 703 CA SER A 122 7.182 35.612 6.650 1.00147.53 C ANISOU 703 CA SER A 122 16085 15514 24457 -1793 2083 -1692 C ATOM 704 C SER A 122 7.346 34.315 5.870 1.00141.85 C ANISOU 704 C SER A 122 15520 14804 23571 -1769 1700 -1586 C ATOM 705 O SER A 122 7.503 33.246 6.467 1.00145.30 O ANISOU 705 O SER A 122 16246 15177 23785 -2070 1812 -1553 O ATOM 706 CB SER A 122 5.708 35.874 6.961 1.00140.15 C ANISOU 706 CB SER A 122 14615 14526 24109 -1935 2372 -2028 C ATOM 707 OG SER A 122 4.995 36.200 5.783 1.00147.21 O ANISOU 707 OG SER A 122 15055 15435 25445 -1600 1994 -2071 O ATOM 708 N PHE A 123 7.303 34.390 4.540 1.00129.85 N ANISOU 708 N PHE A 123 13835 13350 22152 -1438 1244 -1535 N ATOM 709 CA PHE A 123 7.537 33.218 3.704 1.00117.25 C ANISOU 709 CA PHE A 123 12414 11764 20370 -1402 887 -1483 C ATOM 710 C PHE A 123 8.974 32.738 3.835 1.00102.64 C ANISOU 710 C PHE A 123 11082 9926 17989 -1332 818 -1258 C ATOM 711 O PHE A 123 9.230 31.534 3.968 1.00107.71 O ANISOU 711 O PHE A 123 12002 10458 18465 -1468 778 -1239 O ATOM 712 CB PHE A 123 7.210 33.567 2.253 1.00120.72 C ANISOU 712 CB PHE A 123 12568 12325 20974 -1097 425 -1484 C ATOM 713 CG PHE A 123 7.140 32.386 1.333 1.00121.52 C ANISOU 713 CG PHE A 123 12764 12443 20964 -1122 88 -1539 C ATOM 714 CD1 PHE A 123 5.970 31.654 1.216 1.00121.93 C ANISOU 714 CD1 PHE A 123 12548 12439 21339 -1365 61 -1753 C ATOM 715 CD2 PHE A 123 8.230 32.030 0.558 1.00120.26 C ANISOU 715 CD2 PHE A 123 12942 12368 20382 -919 -186 -1413 C ATOM 716 CE1 PHE A 123 5.896 30.577 0.360 1.00123.88 C ANISOU 716 CE1 PHE A 123 12913 12681 21477 -1426 -243 -1840 C ATOM 717 CE2 PHE A 123 8.161 30.951 -0.303 1.00120.38 C ANISOU 717 CE2 PHE A 123 13060 12377 20300 -950 -460 -1527 C ATOM 718 CZ PHE A 123 6.993 30.224 -0.401 1.00123.71 C ANISOU 718 CZ PHE A 123 13262 12710 21034 -1211 -496 -1741 C ATOM 719 N LEU A 124 9.921 33.672 3.801 1.00102.08 N ANISOU 719 N LEU A 124 11134 9976 17676 -1120 797 -1085 N ATOM 720 CA LEU A 124 11.321 33.333 4.004 1.00110.73 C ANISOU 720 CA LEU A 124 12645 11135 18292 -1050 751 -869 C ATOM 721 C LEU A 124 11.524 32.642 5.343 1.00114.29 C ANISOU 721 C LEU A 124 13378 11458 18590 -1382 1052 -812 C ATOM 722 O LEU A 124 12.116 31.559 5.413 1.00116.38 O ANISOU 722 O LEU A 124 13935 11640 18643 -1396 939 -705 O ATOM 723 CB LEU A 124 12.170 34.597 3.929 1.00118.59 C ANISOU 723 CB LEU A 124 13676 12300 19083 -867 747 -711 C ATOM 724 CG LEU A 124 13.661 34.355 3.783 1.00117.09 C ANISOU 724 CG LEU A 124 13804 12270 18415 -722 607 -495 C ATOM 725 CD1 LEU A 124 13.903 33.836 2.394 1.00126.36 C ANISOU 725 CD1 LEU A 124 14952 13548 19512 -456 232 -519 C ATOM 726 CD2 LEU A 124 14.417 35.638 4.023 1.00104.56 C ANISOU 726 CD2 LEU A 124 12262 10841 16625 -679 695 -349 C ATOM 727 N THR A 125 11.034 33.258 6.421 1.00118.86 N ANISOU 727 N THR A 125 13882 12007 19272 -1663 1437 -883 N ATOM 728 CA THR A 125 11.222 32.678 7.748 1.00119.66 C ANISOU 728 CA THR A 125 14280 12030 19154 -2057 1728 -802 C ATOM 729 C THR A 125 10.540 31.319 7.856 1.00115.64 C ANISOU 729 C THR A 125 13842 11322 18775 -2300 1711 -868 C ATOM 730 O THR A 125 11.103 30.372 8.422 1.00117.26 O ANISOU 730 O THR A 125 14422 11412 18718 -2467 1684 -674 O ATOM 731 CB THR A 125 10.698 33.645 8.809 1.00126.28 C ANISOU 731 CB THR A 125 14998 12901 20081 -2356 2189 -946 C ATOM 732 OG1 THR A 125 11.560 34.790 8.874 1.00133.48 O ANISOU 732 OG1 THR A 125 15980 13955 20782 -2195 2208 -841 O ATOM 733 CG2 THR A 125 10.642 32.984 10.171 1.00120.82 C ANISOU 733 CG2 THR A 125 14594 12156 19157 -2871 2511 -896 C ATOM 734 N LEU A 126 9.339 31.201 7.290 1.00111.67 N ANISOU 734 N LEU A 126 12980 10766 18686 -2327 1694 -1121 N ATOM 735 CA LEU A 126 8.615 29.935 7.307 1.00111.00 C ANISOU 735 CA LEU A 126 12942 10492 18743 -2603 1671 -1212 C ATOM 736 C LEU A 126 9.400 28.831 6.609 1.00116.79 C ANISOU 736 C LEU A 126 14009 11084 19282 -2396 1292 -1066 C ATOM 737 O LEU A 126 9.439 27.694 7.090 1.00126.81 O ANISOU 737 O LEU A 126 15595 12118 20469 -2651 1305 -982 O ATOM 738 CB LEU A 126 7.245 30.118 6.658 1.00110.29 C ANISOU 738 CB LEU A 126 12333 10435 19138 -2626 1656 -1514 C ATOM 739 CG LEU A 126 6.501 28.860 6.212 1.00113.11 C ANISOU 739 CG LEU A 126 12674 10634 19669 -2837 1502 -1642 C ATOM 740 CD1 LEU A 126 6.157 27.979 7.398 1.00115.90 C ANISOU 740 CD1 LEU A 126 13283 10810 19944 -3391 1825 -1622 C ATOM 741 CD2 LEU A 126 5.250 29.249 5.450 1.00114.63 C ANISOU 741 CD2 LEU A 126 12274 10947 20331 -2800 1415 -1914 C ATOM 742 N ASN A 127 10.036 29.139 5.478 1.00116.93 N ANISOU 742 N ASN A 127 13974 11224 19229 -1948 964 -1042 N ATOM 743 CA ASN A 127 10.802 28.102 4.794 1.00118.79 C ANISOU 743 CA ASN A 127 14503 11333 19300 -1732 655 -973 C ATOM 744 C ASN A 127 12.134 27.819 5.471 1.00126.86 C ANISOU 744 C ASN A 127 15921 12311 19967 -1643 658 -680 C ATOM 745 O ASN A 127 12.645 26.699 5.366 1.00134.26 O ANISOU 745 O ASN A 127 17156 13019 20837 -1571 495 -606 O ATOM 746 CB ASN A 127 11.029 28.476 3.336 1.00121.50 C ANISOU 746 CB ASN A 127 14659 11866 19639 -1337 330 -1077 C ATOM 747 CG ASN A 127 9.893 28.036 2.452 1.00126.99 C ANISOU 747 CG ASN A 127 15106 12516 20630 -1427 163 -1342 C ATOM 748 OD1 ASN A 127 10.052 27.898 1.241 1.00134.16 O ANISOU 748 OD1 ASN A 127 15968 13524 21482 -1199 -138 -1445 O ATOM 749 ND2 ASN A 127 8.737 27.795 3.055 1.00123.21 N ANISOU 749 ND2 ASN A 127 14458 11915 20440 -1804 364 -1467 N ATOM 750 N MET A 128 12.727 28.809 6.140 1.00131.27 N ANISOU 750 N MET A 128 16482 13078 20317 -1636 818 -514 N ATOM 751 CA MET A 128 13.892 28.521 6.969 1.00135.66 C ANISOU 751 CA MET A 128 17385 13622 20538 -1643 821 -208 C ATOM 752 C MET A 128 13.534 27.516 8.051 1.00131.43 C ANISOU 752 C MET A 128 17142 12795 19999 -2064 956 -87 C ATOM 753 O MET A 128 14.210 26.493 8.222 1.00134.53 O ANISOU 753 O MET A 128 17857 12969 20289 -1996 773 117 O ATOM 754 CB MET A 128 14.430 29.806 7.597 1.00150.98 C ANISOU 754 CB MET A 128 19272 15849 22246 -1682 1003 -83 C ATOM 755 CG MET A 128 14.918 30.840 6.603 1.00160.37 C ANISOU 755 CG MET A 128 20236 17308 23387 -1310 859 -134 C ATOM 756 SD MET A 128 16.244 30.213 5.556 1.00166.08 S ANISOU 756 SD MET A 128 21072 18126 23903 -836 482 -27 S ATOM 757 CE MET A 128 17.557 31.370 5.929 1.00166.82 C ANISOU 757 CE MET A 128 21185 18590 23609 -749 518 211 C ATOM 758 N PHE A 129 12.449 27.784 8.779 1.00120.15 N ANISOU 758 N PHE A 129 15601 11351 18701 -2508 1280 -214 N ATOM 759 CA PHE A 129 12.044 26.895 9.860 1.00118.47 C ANISOU 759 CA PHE A 129 15680 10901 18433 -3009 1447 -91 C ATOM 760 C PHE A 129 11.611 25.535 9.330 1.00122.29 C ANISOU 760 C PHE A 129 16309 11020 19136 -3035 1244 -152 C ATOM 761 O PHE A 129 11.855 24.509 9.974 1.00123.48 O ANISOU 761 O PHE A 129 16860 10876 19179 -3263 1186 87 O ATOM 762 CB PHE A 129 10.927 27.546 10.672 1.00124.91 C ANISOU 762 CB PHE A 129 16279 11835 19346 -3495 1896 -290 C ATOM 763 CG PHE A 129 11.397 28.669 11.551 1.00127.19 C ANISOU 763 CG PHE A 129 16580 12393 19352 -3622 2160 -209 C ATOM 764 CD1 PHE A 129 12.693 28.689 12.043 1.00117.74 C ANISOU 764 CD1 PHE A 129 15715 11278 17744 -3543 2014 141 C ATOM 765 CD2 PHE A 129 10.547 29.710 11.882 1.00127.48 C ANISOU 765 CD2 PHE A 129 16282 12600 19555 -3819 2551 -502 C ATOM 766 CE1 PHE A 129 13.126 29.722 12.855 1.00107.30 C ANISOU 766 CE1 PHE A 129 14423 10218 16129 -3719 2252 197 C ATOM 767 CE2 PHE A 129 10.974 30.740 12.698 1.00119.57 C ANISOU 767 CE2 PHE A 129 15329 11811 18293 -3966 2821 -477 C ATOM 768 CZ PHE A 129 12.265 30.747 13.181 1.00109.81 C ANISOU 768 CZ PHE A 129 14457 10670 16595 -3942 2669 -127 C ATOM 769 N ALA A 130 10.972 25.500 8.158 1.00117.57 N ANISOU 769 N ALA A 130 15414 10419 18838 -2828 1112 -457 N ATOM 770 CA ALA A 130 10.597 24.218 7.570 1.00111.22 C ANISOU 770 CA ALA A 130 14766 9265 18227 -2864 910 -560 C ATOM 771 C ALA A 130 11.828 23.413 7.172 1.00108.04 C ANISOU 771 C ALA A 130 14719 8638 17692 -2465 590 -374 C ATOM 772 O ALA A 130 11.895 22.206 7.426 1.00115.28 O ANISOU 772 O ALA A 130 16005 9138 18660 -2602 489 -264 O ATOM 773 CB ALA A 130 9.680 24.437 6.366 1.00 98.87 C ANISOU 773 CB ALA A 130 12786 7814 16965 -2751 810 -932 C ATOM 774 N SER A 131 12.818 24.066 6.562 1.00107.31 N ANISOU 774 N SER A 131 14519 8805 17448 -1975 436 -338 N ATOM 775 CA SER A 131 14.045 23.367 6.199 1.00111.51 C ANISOU 775 CA SER A 131 15313 9176 17879 -1558 170 -196 C ATOM 776 C SER A 131 14.756 22.827 7.436 1.00113.75 C ANISOU 776 C SER A 131 15981 9246 17994 -1701 168 220 C ATOM 777 O SER A 131 15.119 21.646 7.489 1.00117.61 O ANISOU 777 O SER A 131 16801 9309 18578 -1619 -15 340 O ATOM 778 CB SER A 131 14.963 24.297 5.402 1.00116.64 C ANISOU 778 CB SER A 131 15727 10233 18358 -1081 60 -233 C ATOM 779 OG SER A 131 16.161 23.639 5.018 1.00123.34 O ANISOU 779 OG SER A 131 16755 10973 19134 -659 -161 -145 O ATOM 780 N ILE A 132 14.948 23.672 8.453 1.00109.40 N ANISOU 780 N ILE A 132 15408 8966 17193 -1933 356 449 N ATOM 781 CA ILE A 132 15.709 23.249 9.627 1.00114.52 C ANISOU 781 CA ILE A 132 16416 9490 17608 -2088 303 891 C ATOM 782 C ILE A 132 14.961 22.159 10.387 1.00125.10 C ANISOU 782 C ILE A 132 18109 10381 19043 -2587 355 1020 C ATOM 783 O ILE A 132 15.540 21.133 10.776 1.00126.92 O ANISOU 783 O ILE A 132 18721 10232 19271 -2546 125 1335 O ATOM 784 CB ILE A 132 16.021 24.460 10.523 1.00104.89 C ANISOU 784 CB ILE A 132 15100 8703 16050 -2304 514 1058 C ATOM 785 CG1 ILE A 132 16.919 25.444 9.770 1.00104.24 C ANISOU 785 CG1 ILE A 132 14731 9019 15856 -1819 418 987 C ATOM 786 CG2 ILE A 132 16.671 24.009 11.824 1.00104.02 C ANISOU 786 CG2 ILE A 132 15377 8500 15647 -2587 447 1536 C ATOM 787 CD1 ILE A 132 17.246 26.694 10.547 1.00111.63 C ANISOU 787 CD1 ILE A 132 15580 10362 16474 -2028 622 1105 C ATOM 788 N PHE A 133 13.660 22.366 10.603 1.00138.56 N ANISOU 788 N PHE A 133 19680 12115 20852 -3070 652 787 N ATOM 789 CA PHE A 133 12.836 21.360 11.263 1.00151.62 C ANISOU 789 CA PHE A 133 21642 13378 22587 -3625 741 869 C ATOM 790 C PHE A 133 12.803 20.051 10.482 1.00153.02 C ANISOU 790 C PHE A 133 22046 13030 23063 -3424 457 795 C ATOM 791 O PHE A 133 12.669 18.977 11.080 1.00160.27 O ANISOU 791 O PHE A 133 23396 13491 24009 -3751 383 1036 O ATOM 792 CB PHE A 133 11.414 21.890 11.453 1.00155.56 C ANISOU 792 CB PHE A 133 21831 14076 23199 -4130 1134 540 C ATOM 793 CG PHE A 133 11.304 23.001 12.457 1.00151.80 C ANISOU 793 CG PHE A 133 21222 14009 22446 -4463 1492 590 C ATOM 794 CD1 PHE A 133 12.327 23.255 13.356 1.00151.43 C ANISOU 794 CD1 PHE A 133 21450 14085 22001 -4497 1450 981 C ATOM 795 CD2 PHE A 133 10.166 23.787 12.506 1.00147.03 C ANISOU 795 CD2 PHE A 133 20203 13667 21995 -4750 1872 224 C ATOM 796 CE1 PHE A 133 12.216 24.275 14.279 1.00148.87 C ANISOU 796 CE1 PHE A 133 21036 14134 21393 -4854 1803 977 C ATOM 797 CE2 PHE A 133 10.048 24.805 13.425 1.00146.33 C ANISOU 797 CE2 PHE A 133 20000 13918 21682 -5053 2246 202 C ATOM 798 CZ PHE A 133 11.074 25.051 14.314 1.00146.98 C ANISOU 798 CZ PHE A 133 20407 14115 21323 -5128 2224 565 C ATOM 799 N PHE A 134 12.915 20.114 9.154 1.00139.50 N ANISOU 799 N PHE A 134 20082 11359 21562 -2926 299 460 N ATOM 800 CA PHE A 134 12.942 18.887 8.367 1.00135.55 C ANISOU 800 CA PHE A 134 19814 10355 21332 -2726 52 324 C ATOM 801 C PHE A 134 14.294 18.192 8.462 1.00139.52 C ANISOU 801 C PHE A 134 20656 10544 21810 -2269 -247 639 C ATOM 802 O PHE A 134 14.356 16.960 8.437 1.00147.96 O ANISOU 802 O PHE A 134 22111 11022 23087 -2268 -424 711 O ATOM 803 CB PHE A 134 12.586 19.174 6.908 1.00135.26 C ANISOU 803 CB PHE A 134 19411 10505 21479 -2408 -9 -164 C ATOM 804 CG PHE A 134 11.110 19.120 6.626 1.00140.79 C ANISOU 804 CG PHE A 134 19899 11217 22376 -2873 148 -493 C ATOM 805 CD1 PHE A 134 10.311 18.161 7.226 1.00146.23 C ANISOU 805 CD1 PHE A 134 20877 11493 23192 -3432 229 -443 C ATOM 806 CD2 PHE A 134 10.520 20.036 5.770 1.00143.81 C ANISOU 806 CD2 PHE A 134 19782 12035 22824 -2772 195 -827 C ATOM 807 CE1 PHE A 134 8.953 18.111 6.974 1.00147.64 C ANISOU 807 CE1 PHE A 134 20805 11731 23561 -3886 378 -756 C ATOM 808 CE2 PHE A 134 9.162 19.996 5.519 1.00145.67 C ANISOU 808 CE2 PHE A 134 19756 12317 23275 -3184 305 -1114 C ATOM 809 CZ PHE A 134 8.377 19.031 6.121 1.00148.46 C ANISOU 809 CZ PHE A 134 20356 12297 23757 -3745 409 -1097 C ATOM 810 N ILE A 135 15.387 18.953 8.563 1.00135.21 N ANISOU 810 N ILE A 135 19960 10368 21044 -1872 -316 823 N ATOM 811 CA ILE A 135 16.687 18.336 8.823 1.00133.03 C ANISOU 811 CA ILE A 135 19944 9843 20758 -1459 -602 1174 C ATOM 812 C ILE A 135 16.650 17.590 10.151 1.00135.02 C ANISOU 812 C ILE A 135 20668 9699 20937 -1902 -669 1676 C ATOM 813 O ILE A 135 17.074 16.429 10.251 1.00137.04 O ANISOU 813 O ILE A 135 21298 9369 21402 -1741 -932 1891 O ATOM 814 CB ILE A 135 17.804 19.396 8.804 1.00124.79 C ANISOU 814 CB ILE A 135 18604 9361 19450 -1062 -638 1299 C ATOM 815 CG1 ILE A 135 17.883 20.076 7.439 1.00119.53 C ANISOU 815 CG1 ILE A 135 17524 9063 18830 -652 -598 837 C ATOM 816 CG2 ILE A 135 19.144 18.768 9.145 1.00127.21 C ANISOU 816 CG2 ILE A 135 19108 9455 19772 -642 -950 1684 C ATOM 817 CD1 ILE A 135 18.804 21.277 7.428 1.00123.65 C ANISOU 817 CD1 ILE A 135 17739 10184 19059 -393 -578 937 C ATOM 818 N THR A 136 16.123 18.248 11.189 1.00129.88 N ANISOU 818 N THR A 136 20018 9345 19985 -2486 -427 1865 N ATOM 819 CA THR A 136 15.982 17.602 12.491 1.00135.13 C ANISOU 819 CA THR A 136 21151 9702 20490 -3037 -458 2348 C ATOM 820 C THR A 136 15.097 16.362 12.406 1.00132.34 C ANISOU 820 C THR A 136 21153 8703 20427 -3380 -483 2282 C ATOM 821 O THR A 136 15.414 15.317 12.990 1.00128.12 O ANISOU 821 O THR A 136 21111 7621 19947 -3490 -732 2701 O ATOM 822 CB THR A 136 15.409 18.601 13.497 1.00129.80 C ANISOU 822 CB THR A 136 20370 9521 19424 -3668 -97 2418 C ATOM 823 OG1 THR A 136 16.392 19.604 13.786 1.00111.45 O ANISOU 823 OG1 THR A 136 17850 7704 16792 -3414 -130 2588 O ATOM 824 CG2 THR A 136 14.993 17.901 14.785 1.00140.58 C ANISOU 824 CG2 THR A 136 22234 10598 20584 -4398 -58 2844 C ATOM 825 N CYS A 137 13.986 16.458 11.673 1.00135.38 N ANISOU 825 N CYS A 137 21296 9133 21010 -3565 -254 1776 N ATOM 826 CA CYS A 137 13.061 15.337 11.555 1.00144.99 C ANISOU 826 CA CYS A 137 22817 9785 22490 -3969 -251 1663 C ATOM 827 C CYS A 137 13.682 14.163 10.803 1.00157.45 C ANISOU 827 C CYS A 137 24697 10704 24421 -3458 -611 1642 C ATOM 828 O CYS A 137 13.383 13.003 11.112 1.00162.29 O ANISOU 828 O CYS A 137 25796 10661 25208 -3764 -730 1817 O ATOM 829 CB CYS A 137 11.778 15.808 10.869 1.00142.58 C ANISOU 829 CB CYS A 137 22085 9769 22318 -4244 46 1106 C ATOM 830 SG CYS A 137 10.521 14.543 10.647 1.00166.00 S ANISOU 830 SG CYS A 137 25332 12150 25590 -4829 85 889 S ATOM 831 N MET A 138 14.544 14.437 9.821 1.00161.42 N ANISOU 831 N MET A 138 24936 11354 25040 -2704 -767 1414 N ATOM 832 CA MET A 138 15.224 13.359 9.114 1.00168.33 C ANISOU 832 CA MET A 138 26072 11620 26267 -2167 -1066 1339 C ATOM 833 C MET A 138 16.312 12.724 9.964 1.00167.73 C ANISOU 833 C MET A 138 26389 11132 26209 -1931 -1376 1942 C ATOM 834 O MET A 138 16.548 11.517 9.857 1.00176.88 O ANISOU 834 O MET A 138 27965 11533 27707 -1763 -1615 2034 O ATOM 835 CB MET A 138 15.825 13.881 7.813 1.00177.05 C ANISOU 835 CB MET A 138 26747 13077 27447 -1473 -1094 884 C ATOM 836 CG MET A 138 14.806 14.435 6.849 1.00180.11 C ANISOU 836 CG MET A 138 26761 13834 27838 -1654 -878 318 C ATOM 837 SD MET A 138 15.527 14.749 5.237 1.00182.89 S ANISOU 837 SD MET A 138 26754 14472 28264 -904 -961 -202 S ATOM 838 CE MET A 138 16.194 13.123 4.898 1.00195.16 C ANISOU 838 CE MET A 138 28805 15123 30226 -509 -1212 -257 C ATOM 839 N SER A 139 16.992 13.513 10.800 1.00152.89 N ANISOU 839 N SER A 139 24387 9720 23986 -1910 -1401 2358 N ATOM 840 CA SER A 139 17.949 12.919 11.728 1.00151.07 C ANISOU 840 CA SER A 139 24526 9135 23738 -1777 -1743 3009 C ATOM 841 C SER A 139 17.242 12.052 12.759 1.00150.43 C ANISOU 841 C SER A 139 24999 8552 23603 -2491 -1765 3416 C ATOM 842 O SER A 139 17.737 10.976 13.119 1.00153.41 O ANISOU 842 O SER A 139 25691 8470 24128 -2288 -2000 3744 O ATOM 843 CB SER A 139 18.764 14.009 12.421 1.00152.29 C ANISOU 843 CB SER A 139 24412 9982 23468 -1702 -1757 3350 C ATOM 844 OG SER A 139 19.519 14.758 11.487 1.00145.25 O ANISOU 844 OG SER A 139 23016 9569 22606 -1042 -1742 3010 O ATOM 845 N VAL A 140 16.088 12.506 13.252 1.00155.95 N ANISOU 845 N VAL A 140 25656 9581 24018 -3261 -1399 3315 N ATOM 846 CA VAL A 140 15.306 11.691 14.176 1.00161.38 C ANISOU 846 CA VAL A 140 26651 10099 24569 -3904 -1252 3547 C ATOM 847 C VAL A 140 14.826 10.426 13.483 1.00170.23 C ANISOU 847 C VAL A 140 27979 10577 26121 -3814 -1290 3273 C ATOM 848 O VAL A 140 14.821 9.338 14.072 1.00186.89 O ANISOU 848 O VAL A 140 30466 12256 28288 -3967 -1404 3602 O ATOM 849 CB VAL A 140 14.133 12.507 14.749 1.00158.06 C ANISOU 849 CB VAL A 140 26003 10249 23802 -4684 -793 3378 C ATOM 850 CG1 VAL A 140 13.166 11.608 15.492 1.00160.93 C ANISOU 850 CG1 VAL A 140 26595 10442 24107 -5326 -622 3489 C ATOM 851 CG2 VAL A 140 14.655 13.586 15.673 1.00158.74 C ANISOU 851 CG2 VAL A 140 25978 10934 23402 -4847 -730 3705 C ATOM 852 N ASP A 141 14.428 10.545 12.215 1.00165.92 N ANISOU 852 N ASP A 141 27205 9964 25875 -3581 -1205 2664 N ATOM 853 CA ASP A 141 13.973 9.378 11.470 1.00170.68 C ANISOU 853 CA ASP A 141 27995 9992 26862 -3516 -1216 2334 C ATOM 854 C ASP A 141 15.103 8.374 11.275 1.00166.32 C ANISOU 854 C ASP A 141 27746 8843 26607 -2837 -1554 2540 C ATOM 855 O ASP A 141 14.896 7.161 11.403 1.00173.61 O ANISOU 855 O ASP A 141 29021 9199 27743 -2939 -1596 2624 O ATOM 856 CB ASP A 141 13.395 9.815 10.125 1.00168.87 C ANISOU 856 CB ASP A 141 27430 9909 26824 -3398 -1085 1625 C ATOM 857 CG ASP A 141 12.865 8.655 9.316 1.00169.46 C ANISOU 857 CG ASP A 141 27690 9453 27244 -3408 -1065 1228 C ATOM 858 OD1 ASP A 141 11.854 8.054 9.732 1.00170.94 O ANISOU 858 OD1 ASP A 141 28001 9506 27444 -4040 -892 1239 O ATOM 859 OD2 ASP A 141 13.461 8.344 8.265 1.00170.28 O ANISOU 859 OD2 ASP A 141 27794 9303 27602 -2795 -1210 883 O ATOM 860 N ARG A 142 16.309 8.860 10.974 1.00161.81 N ANISOU 860 N ARG A 142 27004 8397 26080 -2129 -1789 2618 N ATOM 861 CA ARG A 142 17.453 7.964 10.846 1.00171.91 C ANISOU 861 CA ARG A 142 28473 9179 27665 -1426 -2095 2816 C ATOM 862 C ARG A 142 17.786 7.296 12.174 1.00186.63 C ANISOU 862 C ARG A 142 30710 10800 29400 -1646 -2288 3546 C ATOM 863 O ARG A 142 18.123 6.107 12.210 1.00190.96 O ANISOU 863 O ARG A 142 31574 10727 30255 -1392 -2452 3695 O ATOM 864 CB ARG A 142 18.664 8.728 10.316 1.00165.47 C ANISOU 864 CB ARG A 142 27287 8678 26908 -651 -2282 2749 C ATOM 865 CG ARG A 142 18.546 9.165 8.873 1.00164.89 C ANISOU 865 CG ARG A 142 26868 8763 27022 -285 -2151 2009 C ATOM 866 CD ARG A 142 19.773 9.955 8.470 1.00172.68 C ANISOU 866 CD ARG A 142 27446 10126 28037 442 -2316 1988 C ATOM 867 NE ARG A 142 19.761 10.306 7.055 1.00172.29 N ANISOU 867 NE ARG A 142 27038 10308 28118 828 -2163 1261 N ATOM 868 CZ ARG A 142 20.760 10.922 6.434 1.00166.05 C ANISOU 868 CZ ARG A 142 25791 10024 27278 1466 -2160 1066 C ATOM 869 NH1 ARG A 142 20.665 11.201 5.143 1.00164.07 N ANISOU 869 NH1 ARG A 142 25233 10065 27042 1717 -1971 398 N ATOM 870 NH2 ARG A 142 21.855 11.257 7.103 1.00163.27 N ANISOU 870 NH2 ARG A 142 25286 9914 26833 1811 -2353 1546 N ATOM 871 N TYR A 143 17.702 8.044 13.277 1.00193.52 N ANISOU 871 N TYR A 143 31557 12163 29809 -2130 -2267 3998 N ATOM 872 CA TYR A 143 17.996 7.468 14.588 1.00203.95 C ANISOU 872 CA TYR A 143 33228 13341 30921 -2406 -2466 4700 C ATOM 873 C TYR A 143 17.001 6.370 14.943 1.00208.76 C ANISOU 873 C TYR A 143 34229 13479 31610 -2985 -2332 4736 C ATOM 874 O TYR A 143 17.388 5.256 15.323 1.00222.42 O ANISOU 874 O TYR A 143 36329 14641 33541 -2838 -2578 5098 O ATOM 875 CB TYR A 143 17.986 8.569 15.646 1.00201.24 C ANISOU 875 CB TYR A 143 32761 13714 29989 -2902 -2395 5068 C ATOM 876 CG TYR A 143 18.183 8.100 17.071 1.00204.50 C ANISOU 876 CG TYR A 143 33522 14116 30062 -3315 -2578 5766 C ATOM 877 CD1 TYR A 143 19.446 7.776 17.547 1.00205.05 C ANISOU 877 CD1 TYR A 143 33691 14059 30159 -2825 -3030 6306 C ATOM 878 CD2 TYR A 143 17.109 8.016 17.951 1.00205.17 C ANISOU 878 CD2 TYR A 143 33792 14378 29784 -4199 -2303 5870 C ATOM 879 CE1 TYR A 143 19.633 7.364 18.852 1.00210.67 C ANISOU 879 CE1 TYR A 143 34724 14792 30530 -3224 -3239 6953 C ATOM 880 CE2 TYR A 143 17.287 7.606 19.257 1.00211.11 C ANISOU 880 CE2 TYR A 143 34873 15164 30176 -4604 -2480 6489 C ATOM 881 CZ TYR A 143 18.552 7.287 19.704 1.00215.34 C ANISOU 881 CZ TYR A 143 35544 15550 30724 -4127 -2964 7041 C ATOM 882 OH TYR A 143 18.736 6.874 21.004 1.00223.86 O ANISOU 882 OH TYR A 143 36959 16676 31423 -4551 -3183 7668 O ATOM 883 N GLN A 144 15.707 6.669 14.818 1.00201.56 N ANISOU 883 N GLN A 144 33213 12804 30566 -3643 -1949 4364 N ATOM 884 CA GLN A 144 14.676 5.699 15.157 1.00203.27 C ANISOU 884 CA GLN A 144 33733 12657 30845 -4257 -1797 4372 C ATOM 885 C GLN A 144 14.575 4.566 14.145 1.00195.52 C ANISOU 885 C GLN A 144 32936 10940 30411 -3918 -1844 4002 C ATOM 886 O GLN A 144 13.938 3.553 14.446 1.00196.66 O ANISOU 886 O GLN A 144 33410 10637 30674 -4335 -1803 4095 O ATOM 887 CB GLN A 144 13.325 6.400 15.299 1.00205.22 C ANISOU 887 CB GLN A 144 33703 13450 30820 -5027 -1366 4045 C ATOM 888 CG GLN A 144 13.265 7.366 16.469 1.00206.71 C ANISOU 888 CG GLN A 144 33768 14337 30436 -5496 -1238 4393 C ATOM 889 CD GLN A 144 11.853 7.810 16.783 1.00210.85 C ANISOU 889 CD GLN A 144 34043 15336 30735 -6284 -794 4099 C ATOM 890 OE1 GLN A 144 10.920 7.526 16.032 1.00212.43 O ANISOU 890 OE1 GLN A 144 34089 15405 31221 -6457 -606 3621 O ATOM 891 NE2 GLN A 144 11.687 8.507 17.902 1.00213.07 N ANISOU 891 NE2 GLN A 144 34253 16202 30502 -6762 -624 4361 N ATOM 892 N SER A 145 15.173 4.707 12.963 1.00193.86 N ANISOU 892 N SER A 145 32527 10610 30519 -3200 -1912 3566 N ATOM 893 CA SER A 145 15.272 3.584 12.039 1.00188.80 C ANISOU 893 CA SER A 145 32093 9260 30380 -2806 -1959 3217 C ATOM 894 C SER A 145 16.512 2.739 12.289 1.00207.50 C ANISOU 894 C SER A 145 34745 11073 33023 -2140 -2312 3634 C ATOM 895 O SER A 145 16.520 1.549 11.953 1.00221.48 O ANISOU 895 O SER A 145 36835 12127 35189 -1977 -2352 3537 O ATOM 896 CB SER A 145 15.278 4.078 10.592 1.00190.29 C ANISOU 896 CB SER A 145 31933 9615 30754 -2376 -1831 2474 C ATOM 897 OG SER A 145 16.450 4.826 10.314 1.00187.49 O ANISOU 897 OG SER A 145 31302 9562 30375 -1655 -2015 2511 O ATOM 898 N VAL A 146 17.560 3.327 12.870 1.00202.62 N ANISOU 898 N VAL A 146 33994 10771 32222 -1754 -2570 4090 N ATOM 899 CA VAL A 146 18.743 2.549 13.223 1.00208.67 C ANISOU 899 CA VAL A 146 34968 11067 33249 -1135 -2940 4548 C ATOM 900 C VAL A 146 18.499 1.740 14.492 1.00215.98 C ANISOU 900 C VAL A 146 36366 11655 34040 -1660 -3101 5225 C ATOM 901 O VAL A 146 18.890 0.570 14.576 1.00218.20 O ANISOU 901 O VAL A 146 36996 11219 34692 -1373 -3300 5443 O ATOM 902 CB VAL A 146 19.971 3.468 13.361 1.00205.94 C ANISOU 902 CB VAL A 146 34247 11234 32766 -536 -3185 4785 C ATOM 903 CG1 VAL A 146 21.123 2.725 14.017 1.00209.86 C ANISOU 903 CG1 VAL A 146 34924 11353 33458 -27 -3603 5392 C ATOM 904 CG2 VAL A 146 20.396 3.994 11.998 1.00205.00 C ANISOU 904 CG2 VAL A 146 33698 11303 32888 128 -3070 4108 C ATOM 905 N ILE A 147 17.843 2.337 15.493 1.00218.31 N ANISOU 905 N ILE A 147 36686 12461 33801 -2443 -3003 5550 N ATOM 906 CA ILE A 147 17.563 1.593 16.720 1.00225.20 C ANISOU 906 CA ILE A 147 38012 13080 34475 -3010 -3144 6177 C ATOM 907 C ILE A 147 16.572 0.466 16.452 1.00221.26 C ANISOU 907 C ILE A 147 37864 11938 34265 -3422 -2963 5952 C ATOM 908 O ILE A 147 16.689 -0.626 17.019 1.00230.93 O ANISOU 908 O ILE A 147 39544 12555 35644 -3505 -3178 6388 O ATOM 909 CB ILE A 147 17.062 2.535 17.831 1.00216.46 C ANISOU 909 CB ILE A 147 36820 12748 32678 -3785 -3016 6491 C ATOM 910 CG1 ILE A 147 18.169 3.496 18.263 1.00206.71 C ANISOU 910 CG1 ILE A 147 35319 12072 31148 -3406 -3265 6830 C ATOM 911 CG2 ILE A 147 16.571 1.737 19.032 1.00219.78 C ANISOU 911 CG2 ILE A 147 37717 12944 32847 -4486 -3099 7041 C ATOM 912 CD1 ILE A 147 17.958 4.069 19.648 1.00206.98 C ANISOU 912 CD1 ILE A 147 35435 12709 30499 -4133 -3259 7328 C ATOM 913 N TYR A 148 15.589 0.704 15.584 1.00173.95 N ATOM 914 CA TYR A 148 14.579 -0.300 15.257 1.00180.11 C ATOM 915 C TYR A 148 14.863 -0.873 13.873 1.00187.58 C ATOM 916 O TYR A 148 14.465 -0.275 12.861 1.00195.29 O ATOM 917 CB TYR A 148 13.169 0.303 15.305 1.00187.45 C ATOM 918 CG TYR A 148 12.668 0.678 16.688 1.00196.92 C ATOM 919 CD1 TYR A 148 13.515 0.675 17.788 1.00198.87 C ATOM 920 CD2 TYR A 148 11.337 1.024 16.892 1.00203.95 C ATOM 921 CE1 TYR A 148 13.059 1.018 19.048 1.00200.33 C ATOM 922 CE2 TYR A 148 10.870 1.366 18.151 1.00205.28 C ATOM 923 CZ TYR A 148 11.735 1.360 19.225 1.00203.69 C ATOM 924 OH TYR A 148 11.275 1.699 20.477 1.00205.81 O