>1bt6_A mol:protein length:96  S100A10
PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK