>1cks_C mol:protein length:79  CYCLIN-DEPENDENT KINASE SUBUNIT, TYPE 2
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMI
HEPEPHILLFRRPLPKDQQK
>1cks_C mol:protein length:79  CYCLIN-DEPENDENT KINASE SUBUNIT, TYPE 2
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMI
HEPEPHILLFRRPLPKDQQK
>1cks_A mol:protein length:79  CYCLIN-DEPENDENT KINASE SUBUNIT, TYPE 2
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMI
HEPEPHILLFRRPLPKDQQK
>1cks_B mol:protein length:79  CYCLIN-DEPENDENT KINASE SUBUNIT, TYPE 2
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMI
HEPEPHILLFRRPLPKDQQK