>1cks_A mol:protein length:79  CYCLIN-DEPENDENT KINASE SUBUNIT, TYPE 2
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMI
HEPEPHILLFRRPLPKDQQK