>1d7w_A mol:protein length:104  MYELOPEROXIDASE
CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVA
LARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPA