>1d7w_B mol:protein length:104  MYELOPEROXIDASE
CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVA
LARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPA