>1egi_B mol:protein length:147  MACROPHAGE MANNOSE RECEPTOR
GIPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIW
RLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGD
PTMSWNDINCEHLNNWICQIQKGQTPKPD