>1ezf_A mol:protein length:340  FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE
MDRNSLSNSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTIS
VEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
RMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSM
GLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNA
LHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLM
MDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN
>1ezf_C mol:protein length:340  FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE
MDRNSLSNSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTIS
VEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
RMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSM
GLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNA
LHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLM
MDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN
>1ezf_C mol:protein length:340  FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE
MDRNSLSNSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTIS
VEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
RMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSM
GLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNA
LHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLM
MDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN
>1ezf_B mol:protein length:340  FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE
MDRNSLSNSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTIS
VEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR
RMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSM
GLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNA
LHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLM
MDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN