>1ffj_A mol:protein length:60  CYTOTOXIN 2
LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKC
N
>1ffj_A mol:protein length:60  CYTOTOXIN 2
LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKC
N