>1gul_G mol:protein length:222  GLUTATHIONE TRANSFERASE A4-4
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVE
IDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQ
KEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSA
FPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP