>1gul_H mol:protein length:222  GLUTATHIONE TRANSFERASE A4-4
MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVE
IDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQ
KEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSA
FPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP