>1h9d_H mol:na length:10  DNA (5'-(*CP*AP*AP*CP*CP*GP*CP*AP*AP*C)-3')
CAACCGCAAC
>1h9d_A mol:protein length:134  CORE-BINDING FACTOR ALPHA SUBUNIT1
SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAG
NDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIK
ITVDGPREPRRHRQKL
>1h9d_F mol:na length:10  DNA (5'-(*CP*AP*AP*CP*CP*GP*CP*AP*AP*C)-3')
CAACCGCAAC
>1h9d_D mol:protein length:134  CORE-BINDING FACTOR CBF-BETA
PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRL
DGMGCLEFDEERAQQE
>1h9d_H mol:na length:10  DNA (5'-(*CP*AP*AP*CP*CP*GP*CP*AP*AP*C)-3')
CAACCGCAAC
>1h9d_B mol:protein length:134  CORE-BINDING FACTOR CBF-BETA
PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRL
DGMGCLEFDEERAQQE
>1h9d_E mol:na length:10  DNA (5'-(*GP*TP*TP*GP*CP*GP*GP*TP*TP*G)-3')
GTTGCGGTTG
>1h9d_G mol:na length:10  DNA (5'-(*GP*TP*TP*GP*CP*GP*GP*TP*TP*G)-3')
GTTGCGGTTG
>1h9d_C mol:protein length:134  CORE-BINDING FACTOR ALPHA SUBUNIT1
SMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAG
NDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIK
ITVDGPREPRRHRQKL