>1h9d_D mol:protein length:134  CORE-BINDING FACTOR CBF-BETA
PRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRL
DGMGCLEFDEERAQQE