>1hdl_A mol:protein length:55  SERINE PROTEINASE INHIBITOR LEKTI
KNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFINKCATCKMILEKEAKSQ
>1hdl_A mol:protein length:55  SERINE PROTEINASE INHIBITOR LEKTI
KNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFINKCATCKMILEKEAKSQ