>1irs_A mol:protein length:112  IRS-1
MGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRC
GHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILEAMRAMSDEFRPR
>1irs_B mol:protein length:11  IL-4 RECEPTOR PHOSPHOPEPTIDE
LVIAGNPAYRS
>1irs_B mol:protein length:11  IL-4 RECEPTOR PHOSPHOPEPTIDE
LVIAGNPAYRS