>1ixb_B mol:protein length:205  SUPEROXIDE DISMUTASE
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEK
AAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKF
QNRRPDYIKEFWNVVNWDEAAARFAAKK