>1kzk_B mol:protein length:99  Protease
PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQY
DQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>1kzk_B mol:protein length:99  Protease
PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQY
DQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
>1kzk_A mol:protein length:99  Protease
PQITLWKRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQY
DQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF