>1mun_A mol:protein length:225  ADENINE GLYCOSYLASE
MQASQFSAQVLDWYDKYGRKTLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARF
PTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVG
RSTAGAILSLSLGKHFPILNGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGV
ERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK
>1mun_A mol:protein length:225  ADENINE GLYCOSYLASE
MQASQFSAQVLDWYDKYGRKTLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARF
PTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLHGGKFPETFEEVAALPGVG
RSTAGAILSLSLGKHFPILNGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGV
ERFNQAMMDLGAMICTRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK