>1nh1_A mol:protein length:330  Avirulence B protein
MGCVSSKSTTVLSPQTSFNEASRTSFRALPGPSQRQLEVYDQCLIGAARWPDDSSKSNT
PENRAYCQSMYNSIRSAGDEISRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERT
SDTDAVTPLVKPYKSVLARVVDHEDAHDEIMQDNLFGDLNVKVYRQTAYLHGNVIPLNT
FRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPIIKDHLNDLYRQ
AISSDLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAARAIASAHGIELPPFRNGNV
SDIEAMLSGEEEFVEKYRSLLDSDCFGTGHHHHHH