>1o4h_A mol:protein length:108  PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVK
HYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSK
>1o4h_A mol:protein length:108  PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVK
HYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSK