>1osl_D mol:na length:18  5'-D(*CP*GP*AP*TP*AP*AP*GP*AP*TP*AP*TP*CP*TP*TP*AP*TP*CP*G)-3'
CGATAAGATATCTTATCG
>1osl_B mol:protein length:62  Lactose operon repressor
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGK
QSL
>1osl_D mol:na length:18  5'-D(*CP*GP*AP*TP*AP*AP*GP*AP*TP*AP*TP*CP*TP*TP*AP*TP*CP*G)-3'
CGATAAGATATCTTATCG
>1osl_C mol:na length:18  5'-D(*CP*GP*AP*TP*AP*AP*GP*AP*TP*AP*TP*CP*TP*TP*AP*TP*CP*G)-3'
CGATAAGATATCTTATCG
>1osl_A mol:protein length:62  Lactose operon repressor
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRCAQQLAGK
QSL