>1pih_A mol:protein length:73  HIGH POTENTIAL IRON SULFUR PROTEIN
ASEPRAEDGHAHDYVNEAADASGHPRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVL
VKAEGWCSVYAPAS