>1qgh_A mol:protein length:156  NON-HEME IRON-CONTAINING FERRITIN
MKTINSVDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQMDE
VAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTLELLRDEYKQGIE
LTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE