>1qi9_A mol:protein length:556  PROTEIN (VANADIUM BROMOPEROXIDASE)
QTCSTSDDADDPTPPNERDDEAFASRVAAAKRELEGTGTVCQINNGETDLAAKFHKSLP
HDDLGQVDADAFAALEDCILNGDLSICEDVPVGNSEGDPVGRLVNPTAAFAIDISGPAF
SATTIPPVPTLPSPELAAQLAEVYWMALARDVPFMQYGTDDITVTAAANLAGMEGFPNL
DAVSIGSDGTVDPLSQLFRATFVGVETGPFISQLLVNSFTIDSITVEPKQETFAPDVNY
MVDFDEWLNIQNGGPPAGPELLDDELRFVRNARDLARVTFTDNINTEAYRGALILLGLD
AFNRAGVNGPFIDIDRQAGFVNFGISHYFRLIGAAELAQRSSWYQKWQVHRFARPEALG
GTLHLTIKGELNADFDLSLLENAELLKRVAAINAAQNPNNEVTYLLPQAIQEGSPTHPS
YPSGHATQNGAFATVLKALIGLDRGGDCYPDPVYPDDDGLKLIDFRGSCLTFEGEINKL
AVNVAFGRQMLGIHYRFDGIQGLLLGETITVRTLHQELMTFAEESTFEFRLFTGEVIKL
FQDGTFTIDGFKCPGLVYTGVENCV