>1sae_A mol:protein length:42  TUMOR SUPPRESSOR P53
KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG