>1sae_D mol:protein length:42  TUMOR SUPPRESSOR P53
KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG