>1saf_D mol:protein length:42  TUMOR SUPPRESSOR P53
KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
>1saf_C mol:protein length:42  TUMOR SUPPRESSOR P53
KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
>1saf_D mol:protein length:42  TUMOR SUPPRESSOR P53
KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
>1saf_A mol:protein length:42  TUMOR SUPPRESSOR P53
KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG
>1saf_B mol:protein length:42  TUMOR SUPPRESSOR P53
KKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPG