>1v6g_A mol:protein length:81  Actin Binding LIM Protein 2
GSSGSSGLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTF
NGKECMCQKCSLPVSVSGPSSG
>1v6g_A mol:protein length:81  Actin Binding LIM Protein 2
GSSGSSGLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTF
NGKECMCQKCSLPVSVSGPSSG