>1x4b_A mol:protein length:116  Heterogeneous nuclear ribonucleoproteins A2/B1
GSSGSSGMEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVV
MRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGSGPSSG