>1zsv_C mol:protein length:349  NADP-dependent leukotriene B4 12-hydroxydehydrogenase
MHHHHHHSSGVDLGTENLYFQSMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLL
EALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISD
GKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSV
VGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFD
NVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRW
QGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA