>1zv4_X mol:protein length:158  Regulator of G-protein signaling 17
MHHHHHHSSGVDLGTENLYFQSMNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYS
EENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDP
NPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTAGS