>2a1i_A mol:protein length:146  DNA excision repair protein ERCC-1
MGSSHHHHHHSQDPAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALF
LSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILA
WSPEEAGRYLETYKAYEQKPADLLMEKL