>2a72_B mol:protein length:146  Regulator of G-protein signalling 7
SMKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIKE
VPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTHNVKEPGRYTFEDAQEHIYKLMKSDSY
PRFIRSSAYQELLQAKKKSGNSMDRRTS