>2bv1_A mol:protein length:145  REGULATOR OF G-PROTEIN SIGNALLING 1
SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACE
DYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVI
YTLMEKDSYPRFLKSDIYLNLLNDLQA
>2bv1_B mol:protein length:145  REGULATOR OF G-PROTEIN SIGNALLING 1
SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACE
DYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVI
YTLMEKDSYPRFLKSDIYLNLLNDLQA
>2bv1_B mol:protein length:145  REGULATOR OF G-PROTEIN SIGNALLING 1
SMSGMKSSKSKDVLSAAEVMQWSQSLEKLLANQTGQNVFGSFLKSEFSEENIEFWLACE
DYKKTESDLLPCKAEEIYKAFVHSDAAKQINIDFRTRESTAKKIKAPTPTCFDEAQKVI
YTLMEKDSYPRFLKSDIYLNLLNDLQA