>2bwg_D mol:protein length:367  GMP REDUCTASE I
MHHHHHHSSGVDLGTENLYFQSMPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFT
FRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECL
QNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIM
AGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
HIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDT
AMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRAT
FIRVTQQHNTVFS
>2bwg_A mol:protein length:367  GMP REDUCTASE I
MHHHHHHSSGVDLGTENLYFQSMPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFT
FRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECL
QNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIM
AGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
HIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDT
AMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRAT
FIRVTQQHNTVFS
>2bwg_B mol:protein length:367  GMP REDUCTASE I
MHHHHHHSSGVDLGTENLYFQSMPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFT
FRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECL
QNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIM
AGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
HIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDT
AMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRAT
FIRVTQQHNTVFS
>2bwg_C mol:protein length:367  GMP REDUCTASE I
MHHHHHHSSGVDLGTENLYFQSMPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFT
FRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECL
QNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIM
AGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
HIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDT
AMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRAT
FIRVTQQHNTVFS
>2bwg_D mol:protein length:367  GMP REDUCTASE I
MHHHHHHSSGVDLGTENLYFQSMPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFT
FRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECL
QNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIM
AGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKG
HIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDT
AMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRAT
FIRVTQQHNTVFS