>2cry_A mol:protein length:122  Kin of IRRE-like protein 3
GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGT
SGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSG
PSSG
>2cry_A mol:protein length:122  Kin of IRRE-like protein 3
GSSGSSGTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTPPPDRIAWSWKENVLESGT
SGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMSG
PSSG