>2daz_A mol:protein length:124  InaD-like protein
GSSGSSGDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGIN
PEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIRNEDAVNQMA
SGPSSG
>2daz_A mol:protein length:124  InaD-like protein
GSSGSSGDAFTDQKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGIN
PEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIRNEDAVNQMA
SGPSSG